BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001N01

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP34641.1|  hypothetical protein JCGZ_11985                         139   6e-38   Jatropha curcas
ref|XP_002281099.1|  PREDICTED: protein LOL1                            136   4e-37   Vitis vinifera
emb|CAN76365.1|  hypothetical protein VITISV_014138                     136   6e-37   Vitis vinifera
gb|KHG28475.1|  Protein LOL1 -like protein                              136   8e-37   Gossypium arboreum [tree cotton]
gb|KJB25335.1|  hypothetical protein B456_004G186300                    135   2e-36   Gossypium raimondii
ref|XP_010269986.1|  PREDICTED: protein LSD1                            134   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_006847710.1|  hypothetical protein AMTR_s00149p00075900          134   3e-36   Amborella trichopoda
emb|CBI33909.3|  unnamed protein product                                137   3e-36   Vitis vinifera
ref|XP_010941225.1|  PREDICTED: protein LSD1                            134   4e-36   Elaeis guineensis
ref|XP_010275257.1|  PREDICTED: protein LSD1-like                       132   2e-35   Nelumbo nucifera [Indian lotus]
gb|KJB25334.1|  hypothetical protein B456_004G186300                    132   2e-35   Gossypium raimondii
gb|AFK34347.1|  unknown                                                 131   4e-35   Lotus japonicus
ref|NP_001061042.1|  Os08g0159500                                       132   6e-35   
ref|XP_008799374.1|  PREDICTED: protein LSD1 isoform X2                 130   7e-35   Phoenix dactylifera
ref|XP_004972784.1|  PREDICTED: LOW QUALITY PROTEIN: protein LSD1...    131   8e-35   
gb|ABW70167.1|  LOL1                                                    130   2e-34   Bambusa oldhamii
ref|XP_003608622.1|  Zinc finger protein LSD1                           130   2e-34   Medicago truncatula
emb|CAF05902.1|  zinc finger protein                                    129   2e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AAS13688.1|  zinc finger protein LSD1                                129   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659855.1|  PREDICTED: LOW QUALITY PROTEIN: protein LSD1...    131   3e-34   
ref|XP_002528249.1|  conserved hypothetical protein                     129   4e-34   Ricinus communis
ref|XP_004300252.1|  PREDICTED: protein LOL1                            129   6e-34   Fragaria vesca subsp. vesca
ref|XP_002445097.1|  hypothetical protein SORBIDRAFT_07g004050          128   6e-34   Sorghum bicolor [broomcorn]
ref|XP_007039533.1|  Lsd one like 1 isoform 1                           128   7e-34   Theobroma cacao [chocolate]
ref|XP_006436739.1|  hypothetical protein CICLE_v10032940mg             128   8e-34   
gb|KEH31552.1|  LSD1-type zinc finger protein                           127   8e-34   Medicago truncatula
ref|XP_011028205.1|  PREDICTED: protein LOL1                            128   9e-34   Populus euphratica
ref|XP_006303377.1|  hypothetical protein CARUB_v10010527mg             128   9e-34   
ref|XP_007209744.1|  hypothetical protein PRUPE_ppa013007mg             128   9e-34   Prunus persica
ref|XP_004509019.1|  PREDICTED: protein LOL1-like isoform X1            128   1e-33   Cicer arietinum [garbanzo]
gb|AFK36740.1|  unknown                                                 128   1e-33   Lotus japonicus
gb|KHG28572.1|  Protein LOL1 -like protein                              128   1e-33   Gossypium arboreum [tree cotton]
ref|XP_008238278.1|  PREDICTED: protein LOL1                            128   1e-33   Prunus mume [ume]
ref|XP_011014158.1|  PREDICTED: protein LOL1-like                       128   1e-33   Populus euphratica
ref|XP_011018590.1|  PREDICTED: protein LOL1-like                       128   1e-33   Populus euphratica
ref|XP_006368419.1|  hypothetical protein POPTR_0001s02650g             128   1e-33   Populus trichocarpa [western balsam poplar]
gb|KDO51128.1|  hypothetical protein CISIN_1g032227mg                   127   1e-33   Citrus sinensis [apfelsine]
ref|XP_008373559.1|  PREDICTED: protein LOL1                            127   1e-33   Malus domestica [apple tree]
ref|NP_001151942.1|  LOC100285579                                       127   2e-33   Zea mays [maize]
ref|XP_006436741.1|  hypothetical protein CICLE_v10032940mg             127   2e-33   Citrus clementina [clementine]
gb|ABQ23215.1|  LSD1-type zinc finger protein                           127   2e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006385636.1|  hypothetical protein POPTR_0003s08890g             127   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010053598.1|  PREDICTED: protein LOL1                            127   3e-33   Eucalyptus grandis [rose gum]
ref|XP_010104333.1|  hypothetical protein L484_023284                   126   3e-33   
emb|CDP12998.1|  unnamed protein product                                126   4e-33   Coffea canephora [robusta coffee]
ref|XP_010677260.1|  PREDICTED: protein LOL1                            126   4e-33   Beta vulgaris subsp. vulgaris [field beet]
emb|CCW28769.1|  putative LSD1 zinc finger domain protein               126   4e-33   Arachis duranensis
ref|XP_006368420.1|  hypothetical protein POPTR_0001s02650g             126   5e-33   
gb|ACB37310.1|  LOL1-like protein                                       126   5e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573460.1|  PREDICTED: protein LSD1                            126   5e-33   Brachypodium distachyon [annual false brome]
ref|NP_001288950.1|  protein LOL1                                       126   6e-33   Brassica rapa
ref|XP_009590866.1|  PREDICTED: protein LOL1 isoform X2                 125   6e-33   Nicotiana tomentosiformis
emb|CDY26902.1|  BnaA05g18100D                                          126   6e-33   Brassica napus [oilseed rape]
ref|XP_009590862.1|  PREDICTED: protein LOL1 isoform X1                 125   6e-33   Nicotiana tomentosiformis
ref|XP_007155770.1|  hypothetical protein PHAVU_003G230100g             126   6e-33   Phaseolus vulgaris [French bean]
ref|XP_006352846.1|  PREDICTED: protein LOL1-like isoform X4            125   6e-33   Solanum tuberosum [potatoes]
ref|XP_004245885.1|  PREDICTED: protein LOL1 isoform X2                 125   6e-33   Solanum lycopersicum
ref|NP_001237533.1|  uncharacterized protein LOC100306356               125   8e-33   Glycine max [soybeans]
gb|AFW61163.1|  hypothetical protein ZEAMMB73_950191                    127   9e-33   
ref|XP_009151437.1|  PREDICTED: protein LOL1 isoform X1                 125   1e-32   Brassica rapa
ref|XP_009392782.1|  PREDICTED: protein LSD1-like                       125   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003517373.1|  PREDICTED: protein LOL1-like isoform X1            124   2e-32   Glycine max [soybeans]
ref|XP_010531725.1|  PREDICTED: protein LOL1-like                       124   3e-32   Tarenaya hassleriana [spider flower]
ref|XP_010540778.1|  PREDICTED: protein LOL1-like                       124   3e-32   Tarenaya hassleriana [spider flower]
ref|XP_006352843.1|  PREDICTED: protein LOL1-like isoform X1            124   4e-32   Solanum tuberosum [potatoes]
ref|NP_564405.1|  protein LOL1                                          124   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004245884.1|  PREDICTED: protein LOL1 isoform X1                 124   4e-32   Solanum lycopersicum
ref|XP_008465951.1|  PREDICTED: protein LOL1                            123   5e-32   Cucumis melo [Oriental melon]
ref|XP_002890995.1|  hypothetical protein ARALYDRAFT_473445             124   5e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_006415178.1|  hypothetical protein EUTSA_v10008989mg             124   5e-32   
ref|XP_006415176.1|  hypothetical protein EUTSA_v10008989mg             124   5e-32   Eutrema salsugineum [saltwater cress]
ref|XP_009408105.1|  PREDICTED: protein LSD1 isoform X1                 123   6e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004148489.1|  PREDICTED: protein LOL1-like isoform 1             123   7e-32   
ref|NP_849742.2|  protein LOL1                                          124   8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478675.1|  PREDICTED: protein LOL1                            121   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010499802.1|  PREDICTED: protein LOL1-like                       120   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010461077.1|  PREDICTED: protein LOL1                            120   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010919877.1|  PREDICTED: protein LSD1-like isoform X1            119   4e-30   Elaeis guineensis
ref|XP_002988289.1|  hypothetical protein SELMODRAFT_447251             117   4e-29   Selaginella moellendorffii
ref|XP_007156662.1|  hypothetical protein PHAVU_002G006500g             116   4e-29   Phaseolus vulgaris [French bean]
ref|XP_002963886.1|  hypothetical protein SELMODRAFT_270395             117   4e-29   Selaginella moellendorffii
ref|XP_009408107.1|  PREDICTED: protein LSD1 isoform X2                 114   1e-28   
ref|XP_008799378.1|  PREDICTED: protein LSD1 isoform X3                 111   1e-27   Phoenix dactylifera
ref|XP_010246054.1|  PREDICTED: protein LOL1-like                       111   2e-27   
ref|XP_008799372.1|  PREDICTED: protein LSD1 isoform X1                 112   2e-27   
ref|XP_002968020.1|  hypothetical protein SELMODRAFT_72709              110   4e-27   
ref|XP_009385726.1|  PREDICTED: protein LSD1-like isoform X2            110   5e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO51131.1|  hypothetical protein CISIN_1g032227mg                   108   1e-26   Citrus sinensis [apfelsine]
gb|KDO51130.1|  hypothetical protein CISIN_1g032227mg                   108   1e-26   Citrus sinensis [apfelsine]
gb|AFW61165.1|  hypothetical protein ZEAMMB73_950191                    108   2e-26   
gb|AFW61160.1|  hypothetical protein ZEAMMB73_950191                    107   3e-26   
ref|XP_009590867.1|  PREDICTED: protein LOL1 isoform X3                 105   1e-25   Nicotiana tomentosiformis
ref|XP_001765348.1|  predicted protein                                  107   2e-25   
ref|XP_007155769.1|  hypothetical protein PHAVU_003G230100g             105   3e-25   Phaseolus vulgaris [French bean]
gb|AAG51243.1|AC055769_2  zinc-finger protein, putative; 7043-7771      103   7e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385724.1|  PREDICTED: protein LSD1-like isoform X1            105   8e-25   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY68066.1|  BnaC05g51440D                                          103   1e-24   Brassica napus [oilseed rape]
ref|XP_001753847.1|  predicted protein                                  105   2e-24   
ref|XP_008439499.1|  PREDICTED: protein LSD1                            103   3e-24   Cucumis melo [Oriental melon]
ref|XP_010098492.1|  hypothetical protein L484_025928                   103   5e-24   
gb|ABK24017.1|  unknown                                                 105   6e-24   Picea sitchensis
ref|XP_009362159.1|  PREDICTED: protein LSD1-like isoform X2            102   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_009362158.1|  PREDICTED: protein LSD1-like isoform X1            102   1e-23   
ref|XP_010919878.1|  PREDICTED: protein LSD1-like isoform X2            101   1e-23   Elaeis guineensis
ref|XP_007212162.1|  hypothetical protein PRUPE_ppa012421mg             102   1e-23   Prunus persica
ref|XP_008388274.1|  PREDICTED: protein LSD1-like                       102   2e-23   
ref|XP_008225697.1|  PREDICTED: protein LSD1                            102   2e-23   Prunus mume [ume]
ref|XP_004134888.1|  PREDICTED: vacuolar protein sorting-associat...    105   2e-23   
ref|XP_009353887.1|  PREDICTED: protein LSD1                            101   2e-23   
ref|XP_004158699.1|  PREDICTED: protein LOL3-like                       104   2e-23   
ref|XP_007022938.1|  LSD1 zinc finger family protein isoform 1          101   3e-23   Theobroma cacao [chocolate]
ref|XP_011460430.1|  PREDICTED: protein LSD1                            100   6e-23   Fragaria vesca subsp. vesca
gb|EYU37301.1|  hypothetical protein MIMGU_mgv1a014848mg                100   6e-23   Erythranthe guttata [common monkey flower]
ref|XP_008349140.1|  PREDICTED: protein LSD1-like                       100   6e-23   
ref|XP_008383355.1|  PREDICTED: protein LSD1-like                       100   6e-23   Malus domestica [apple tree]
ref|XP_009785779.1|  PREDICTED: protein LSD1-like                     97.8    9e-23   Nicotiana sylvestris
dbj|BAF93195.1|  putative LSD1 like 1                                 97.8    1e-22   Hordeum vulgare [barley]
ref|XP_008392322.1|  PREDICTED: protein LSD1                            102   1e-22   
ref|XP_008804686.1|  PREDICTED: protein LSD1-like                     99.4    2e-22   Phoenix dactylifera
ref|XP_011069944.1|  PREDICTED: protein LSD1-like                     99.4    2e-22   Sesamum indicum [beniseed]
gb|KDP34884.1|  hypothetical protein JCGZ_09172                       99.0    2e-22   Jatropha curcas
ref|XP_006448805.1|  hypothetical protein CICLE_v10016959mg           98.6    3e-22   
gb|KDO77549.1|  hypothetical protein CISIN_1g026941mg                 99.8    4e-22   Citrus sinensis [apfelsine]
ref|XP_006468386.1|  PREDICTED: protein LSD1-like isoform X1          98.2    5e-22   
ref|XP_008796329.1|  PREDICTED: protein LOL1-like                     97.1    7e-22   Phoenix dactylifera
ref|XP_007159612.1|  hypothetical protein PHAVU_002G252000g           97.1    2e-21   Phaseolus vulgaris [French bean]
ref|XP_006836398.1|  hypothetical protein AMTR_s00092p00140740        97.1    2e-21   Amborella trichopoda
ref|XP_007159613.1|  hypothetical protein PHAVU_002G252000g           97.1    2e-21   Phaseolus vulgaris [French bean]
ref|XP_010904647.1|  PREDICTED: protein LOL3-like isoform X1          96.7    2e-21   Elaeis guineensis
gb|EPS60735.1|  hypothetical protein M569_14067                       95.1    2e-21   Genlisea aurea
ref|XP_008776040.1|  PREDICTED: protein LOL2-like                     96.7    2e-21   Phoenix dactylifera
gb|AFK40862.1|  unknown                                               96.3    3e-21   Medicago truncatula
gb|ACJ86028.1|  unknown                                               96.3    3e-21   Medicago truncatula
gb|AET04490.2|  LSD1-type zinc finger protein                         96.3    3e-21   Medicago truncatula
gb|AFK42285.1|  unknown                                               96.3    3e-21   Medicago truncatula
gb|AET04488.2|  LSD1-type zinc finger protein                         96.3    4e-21   Medicago truncatula
ref|XP_004148756.1|  PREDICTED: protein LSD1-like                     94.7    4e-21   
ref|XP_006363645.1|  PREDICTED: protein LSD1-like isoform X1          95.5    5e-21   Solanum tuberosum [potatoes]
ref|XP_009783613.1|  PREDICTED: protein LOL2-like isoform X1          95.5    5e-21   Nicotiana sylvestris
emb|CDX73255.1|  BnaC05g28510D                                        93.2    6e-21   
gb|ADM52200.1|  zinc finger protein LSD1                              95.5    6e-21   Pisum sativum [garden pea]
ref|XP_003630012.1|  Lsd1-like protein                                95.9    7e-21   
ref|XP_010655864.1|  PREDICTED: protein LSD1                          95.1    8e-21   Vitis vinifera
gb|KJB69103.1|  hypothetical protein B456_011G005300                  94.7    8e-21   Gossypium raimondii
gb|KJB69105.1|  hypothetical protein B456_011G005300                  95.1    8e-21   Gossypium raimondii
ref|XP_003630013.1|  Lsd1-like protein                                95.9    9e-21   
ref|XP_010906718.1|  PREDICTED: protein LSD1-like                     94.7    1e-20   
gb|ACN33908.1|  unknown                                               93.2    2e-20   Zea mays [maize]
emb|CBI39012.3|  unnamed protein product                              95.5    2e-20   Vitis vinifera
gb|AFW61167.1|  hypothetical protein ZEAMMB73_950191                  91.3    2e-20   
gb|EPS73579.1|  hypothetical protein M569_01179                       93.2    3e-20   Genlisea aurea
gb|KHG09798.1|  Protein LSD1 -like protein                            92.8    4e-20   Gossypium arboreum [tree cotton]
ref|XP_009627143.1|  PREDICTED: protein LOL1-like                     91.3    6e-20   Nicotiana tomentosiformis
ref|XP_009408561.1|  PREDICTED: protein LOL3-like isoform X1          92.8    7e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001235545.1|  uncharacterized protein LOC100527656             92.4    7e-20   Glycine max [soybeans]
ref|XP_008448703.1|  PREDICTED: protein LOL1 isoform X2               92.8    7e-20   Cucumis melo [Oriental melon]
ref|NP_001241344.1|  uncharacterized protein LOC100776394             92.4    7e-20   Glycine max [soybeans]
gb|KHN48116.1|  Protein LSD1                                          92.4    7e-20   Glycine soja [wild soybean]
ref|XP_006579392.1|  PREDICTED: uncharacterized protein LOC100776...  92.4    8e-20   Glycine max [soybeans]
ref|XP_006584536.1|  PREDICTED: uncharacterized protein LOC100527...  92.4    9e-20   Glycine max [soybeans]
gb|KJB68462.1|  hypothetical protein B456_010G246900                  92.0    1e-19   Gossypium raimondii
gb|KJB68469.1|  hypothetical protein B456_010G246900                  92.0    1e-19   Gossypium raimondii
gb|ACU16283.1|  unknown                                               92.0    1e-19   Glycine max [soybeans]
ref|XP_004488206.1|  PREDICTED: protein LSD1-like                     91.7    1e-19   Cicer arietinum [garbanzo]
ref|XP_009758570.1|  PREDICTED: protein LSD1-like                     91.3    2e-19   Nicotiana sylvestris
ref|XP_011085606.1|  PREDICTED: vacuolar protein sorting-associat...  94.0    2e-19   
gb|AFK33823.1|  unknown                                               91.3    2e-19   Lotus japonicus
ref|XP_011040571.1|  PREDICTED: protein LSD1-like                     90.9    2e-19   Populus euphratica
ref|XP_006353029.1|  PREDICTED: protein LSD1-like isoform X1          90.9    3e-19   Solanum tuberosum [potatoes]
ref|XP_010316974.1|  PREDICTED: protein LSD1                          90.9    3e-19   Solanum lycopersicum
ref|XP_009408562.1|  PREDICTED: protein LOL3-like isoform X2          90.9    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004504166.1|  PREDICTED: protein LSD1-like isoform X2          90.9    3e-19   
ref|XP_010030655.1|  PREDICTED: protein LSD1                          90.9    3e-19   Eucalyptus grandis [rose gum]
ref|XP_002464188.1|  hypothetical protein SORBIDRAFT_01g013820        90.5    4e-19   Sorghum bicolor [broomcorn]
gb|KHG16142.1|  Protein LOL3                                          90.1    5e-19   Gossypium arboreum [tree cotton]
ref|XP_008680836.1|  PREDICTED: zinc finger protein LSD2 isoform X1   90.9    6e-19   
emb|CDP03017.1|  unnamed protein product                              90.1    6e-19   Coffea canephora [robusta coffee]
ref|XP_002317066.1|  LESION SIMULATING DISEASE family protein         89.4    1e-18   
gb|AFK48804.1|  unknown                                               89.0    1e-18   Lotus japonicus
ref|XP_011096731.1|  PREDICTED: protein LSD1                          89.0    1e-18   Sesamum indicum [beniseed]
ref|NP_001152350.1|  zinc finger protein LSD2 precursor               88.6    2e-18   Zea mays [maize]
ref|XP_010258673.1|  PREDICTED: protein LSD1                          87.8    4e-18   Nelumbo nucifera [Indian lotus]
ref|XP_003533828.1|  PREDICTED: protein LSD1 isoform X1               87.4    5e-18   Glycine max [soybeans]
ref|XP_004982348.1|  PREDICTED: protein LOL3-like                     87.4    6e-18   Setaria italica
gb|ACB37311.1|  LSD1-like protein                                     87.0    7e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002529881.1|  Charged multivesicular body protein 2b-B, pu...  89.7    7e-18   
ref|XP_006597921.1|  PREDICTED: protein LSD1-like isoform X3          86.3    1e-17   Glycine max [soybeans]
ref|XP_006597920.1|  PREDICTED: protein LSD1-like isoform X2          86.3    1e-17   Glycine max [soybeans]
dbj|BAJ85341.1|  predicted protein                                    86.3    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003546559.1|  PREDICTED: protein LSD1-like isoform X1          86.3    2e-17   Glycine max [soybeans]
gb|EYU19079.1|  hypothetical protein MIMGU_mgv1a014809mg              86.3    2e-17   Erythranthe guttata [common monkey flower]
gb|EMS64940.1|  hypothetical protein TRIUR3_03600                     86.3    2e-17   Triticum urartu
ref|XP_006597922.1|  PREDICTED: protein LSD1-like isoform X4          86.3    2e-17   Glycine max [soybeans]
ref|XP_008672226.1|  PREDICTED: uncharacterized protein LOC100194...  86.3    2e-17   Zea mays [maize]
gb|EYU19078.1|  hypothetical protein MIMGU_mgv1a014809mg              85.9    2e-17   Erythranthe guttata [common monkey flower]
gb|ACB37312.1|  LSD1-like protein                                     85.9    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002443528.1|  hypothetical protein SORBIDRAFT_08g021100        85.9    2e-17   Sorghum bicolor [broomcorn]
gb|AFQ31616.1|  LOL2                                                  85.9    2e-17   Triticum aestivum [Canadian hard winter wheat]
gb|ACG28611.1|  18S subunit ribosomal protein                         85.5    3e-17   Zea mays [maize]
gb|ACR35025.1|  unknown                                               85.9    3e-17   Zea mays [maize]
ref|XP_004963153.1|  PREDICTED: protein LOL2-like isoform X3          84.7    5e-17   
gb|AFC88835.1|  putative zinc finger LOL2                             84.7    5e-17   Miscanthus sinensis
ref|XP_004963155.1|  PREDICTED: protein LOL2-like isoform X5          84.7    6e-17   Setaria italica
gb|KJB68464.1|  hypothetical protein B456_010G246900                  84.7    6e-17   Gossypium raimondii
ref|XP_004963151.1|  PREDICTED: protein LOL2-like isoform X1          84.7    6e-17   
ref|XP_004963154.1|  PREDICTED: protein LOL2-like isoform X4          84.3    7e-17   Setaria italica
gb|AFK38381.1|  unknown                                               84.3    7e-17   Lotus japonicus
ref|XP_003577533.1|  PREDICTED: protein LOL2                          84.3    7e-17   Brachypodium distachyon [annual false brome]
ref|NP_001132871.1|  uncharacterized protein LOC100194364             85.5    1e-16   Zea mays [maize]
ref|XP_002300492.1|  LESION SIMULATING DISEASE family protein         84.0    1e-16   
ref|XP_011011056.1|  PREDICTED: protein LSD1-like isoform X3          83.6    1e-16   Populus euphratica
ref|XP_011011057.1|  PREDICTED: protein LSD1-like isoform X4          83.2    2e-16   Populus euphratica
ref|XP_011011055.1|  PREDICTED: protein LOL2-like isoform X2          83.6    2e-16   Populus euphratica
ref|XP_011011054.1|  PREDICTED: protein LOL2-like isoform X1          83.6    2e-16   Populus euphratica
ref|NP_001067250.1|  Os12g0611000                                     83.2    2e-16   
ref|XP_008448702.1|  PREDICTED: protein LOL1 isoform X1               83.2    2e-16   
ref|XP_007022939.1|  LSD1 zinc finger family protein isoform 2        82.0    2e-16   
gb|EEC69660.1|  hypothetical protein OsI_39080                        82.8    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_003562028.1|  PREDICTED: protein LOL3-like                     82.8    3e-16   Brachypodium distachyon [annual false brome]
ref|XP_010538650.1|  PREDICTED: protein LSD1-like isoform X5          81.6    8e-16   Tarenaya hassleriana [spider flower]
ref|XP_010538649.1|  PREDICTED: protein LSD1-like isoform X4          81.6    8e-16   Tarenaya hassleriana [spider flower]
gb|AFK36417.1|  unknown                                               81.3    9e-16   Medicago truncatula
ref|XP_010538646.1|  PREDICTED: protein LSD1-like isoform X1          81.3    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_010538648.1|  PREDICTED: protein LSD1-like isoform X3          81.3    1e-15   Tarenaya hassleriana [spider flower]
gb|KEH37789.1|  LSD1-type zinc finger protein                         80.9    1e-15   Medicago truncatula
ref|XP_010687115.1|  PREDICTED: protein LSD1 isoform X3               80.9    1e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009597146.1|  PREDICTED: protein LOL1-like                     79.7    1e-15   Nicotiana tomentosiformis
ref|XP_010538647.1|  PREDICTED: protein LSD1-like isoform X2          80.9    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_009407702.1|  PREDICTED: protein LOL2-like                     80.9    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010687114.1|  PREDICTED: protein LSD1 isoform X2               81.3    2e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687113.1|  PREDICTED: protein LSD1 isoform X1               81.3    2e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004504165.1|  PREDICTED: protein LSD1-like isoform X1          80.1    2e-15   Cicer arietinum [garbanzo]
ref|XP_010537299.1|  PREDICTED: protein LSD1 isoform X2               80.1    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_009133770.1|  PREDICTED: protein LSD1 isoform X3               80.1    4e-15   Brassica rapa
ref|XP_006398067.1|  hypothetical protein EUTSA_v10001047mg           79.3    4e-15   
ref|XP_010537276.1|  PREDICTED: protein LSD1 isoform X1               79.3    4e-15   Tarenaya hassleriana [spider flower]
gb|ADK63407.1|  zinc finger protein                                   79.3    5e-15   Brassica rapa
ref|XP_009133777.1|  PREDICTED: protein LSD1 isoform X4               79.3    6e-15   Brassica rapa
emb|CDX76459.1|  BnaA08g09410D                                        79.0    7e-15   
gb|KJB56339.1|  hypothetical protein B456_009G1160002                 76.3    8e-15   Gossypium raimondii
gb|KJB56343.1|  hypothetical protein B456_009G1160002                 76.6    8e-15   Gossypium raimondii
ref|XP_010315638.1|  PREDICTED: protein LOL1-like                     76.6    8e-15   
ref|XP_009133755.1|  PREDICTED: protein LSD1 isoform X1               79.0    9e-15   Brassica rapa
gb|KJB68466.1|  hypothetical protein B456_010G246900                  77.4    1e-14   Gossypium raimondii
emb|CDX82760.1|  BnaC01g12100D                                        78.6    1e-14   
ref|NP_001050737.1|  Os03g0639600                                     78.2    1e-14   
ref|XP_010434287.1|  PREDICTED: protein LSD1 isoform X3               78.2    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009133762.1|  PREDICTED: protein LSD1 isoform X2               78.2    2e-14   Brassica rapa
ref|XP_006650331.1|  PREDICTED: protein LOL3-like                     77.8    2e-14   Oryza brachyantha
ref|XP_006587107.1|  PREDICTED: protein LSD1 isoform X2               77.0    2e-14   Glycine max [soybeans]
ref|XP_006284594.1|  hypothetical protein CARUB_v10005824mg           77.8    2e-14   Capsella rubella
gb|AAL50981.1|AF453322_1  zinc finger protein LSD1                    77.8    2e-14   Brassica oleracea
ref|XP_010434286.1|  PREDICTED: protein LSD1 isoform X2               77.8    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010434285.1|  PREDICTED: protein LSD1 isoform X1               77.8    2e-14   Camelina sativa [gold-of-pleasure]
emb|CDX98669.1|  BnaA03g44540D                                        77.0    4e-14   
ref|XP_009783614.1|  PREDICTED: protein LSD1-like isoform X2          75.5    7e-14   Nicotiana sylvestris
ref|XP_010449179.1|  PREDICTED: protein LSD1-like isoform X3          76.3    8e-14   
gb|KGN55776.1|  hypothetical protein Csa_3G011775                     73.6    8e-14   Cucumis sativus [cucumbers]
ref|XP_002869934.1|  hypothetical protein ARALYDRAFT_492829           75.9    9e-14   
ref|XP_006363646.1|  PREDICTED: protein LSD1-like isoform X2          75.1    9e-14   
ref|XP_010449175.1|  PREDICTED: protein LSD1-like isoform X1          75.9    1e-13   Camelina sativa [gold-of-pleasure]
gb|AAL50982.1|AF453323_1  zinc finger protein LSD2                    75.5    1e-13   Brassica oleracea
gb|EMT22195.1|  hypothetical protein F775_09435                       75.5    2e-13   
ref|XP_010449177.1|  PREDICTED: protein LSD1-like isoform X2          74.7    3e-13   Camelina sativa [gold-of-pleasure]
ref|NP_849549.1|  zinc finger protein LSD1                            74.7    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439583.1|  PREDICTED: protein LSD1-like isoform X2          74.7    3e-13   Camelina sativa [gold-of-pleasure]
ref|NP_849548.1|  zinc finger protein LSD1                            74.3    3e-13   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49490.1|  BnaC07g18090D                                        75.1    3e-13   Brassica napus [oilseed rape]
dbj|BAH57095.1|  AT4G20380                                            74.7    3e-13   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA50354.1|  TPA: hypothetical protein ZEAMMB73_703800            72.4    3e-13   
ref|XP_010439582.1|  PREDICTED: protein LSD1-like isoform X1          73.6    7e-13   Camelina sativa [gold-of-pleasure]
gb|EMS52308.1|  hypothetical protein TRIUR3_17786                     72.4    8e-13   Triticum urartu
gb|ACG47919.1|  18S subunit ribosomal protein                         71.6    2e-12   Zea mays [maize]
ref|XP_006286008.1|  hypothetical protein CARUB_v10007536mg           71.2    2e-12   
ref|NP_001154257.1|  zinc finger protein LSD1                         70.9    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413872.1|  hypothetical protein EUTSA_v10026533mg           69.3    9e-12   
ref|XP_006413871.1|  hypothetical protein EUTSA_v10026533mg           68.6    2e-11   
ref|XP_004972942.1|  PREDICTED: protein LOL4-like isoform X3          67.8    4e-11   Setaria italica
ref|XP_010449027.1|  PREDICTED: protein LOL2-like                     67.8    4e-11   Camelina sativa [gold-of-pleasure]
gb|AFK33363.1|  unknown                                               66.2    1e-10   
ref|XP_009338990.1|  PREDICTED: protein LOL2-like isoform X1          66.2    1e-10   
gb|AAP80648.1|AF475127_1  18S subunit ribosomal protein               66.6    1e-10   
ref|XP_007212238.1|  hypothetical protein PRUPE_ppa013416mg           65.9    1e-10   
ref|XP_008225091.1|  PREDICTED: protein LOL2-like                     65.9    2e-10   
ref|XP_010439449.1|  PREDICTED: protein LOL2-like                     65.9    2e-10   
ref|XP_008383900.1|  PREDICTED: protein LOL2-like                     65.9    2e-10   
ref|XP_010434153.1|  PREDICTED: protein LOL2-like                     65.9    2e-10   
ref|XP_007022940.1|  LSD1 zinc finger family protein isoform 3        65.5    2e-10   
ref|XP_009410823.1|  PREDICTED: regulator of G-protein signaling ...  67.4    4e-10   
ref|XP_009352923.1|  PREDICTED: protein LOL2-like isoform X1          64.3    5e-10   
gb|AEB22065.1|  lesion stimulating disease 1 protein                  63.9    5e-10   
ref|XP_002869877.1|  hypothetical protein ARALYDRAFT_492714           63.9    8e-10   
gb|AGN12856.1|  putative lsd one-like protein 2                       63.9    8e-10   
gb|KDP20965.1|  hypothetical protein JCGZ_21436                       64.3    8e-10   
ref|XP_002519059.1|  conserved hypothetical protein                   63.5    1e-09   
ref|XP_004972940.1|  PREDICTED: protein LOL4-like isoform X1          63.5    1e-09   
ref|NP_193892.1|  protein lsd one like 2                              63.5    1e-09   
ref|XP_006449334.1|  hypothetical protein CICLE_v10017149mg           62.4    2e-09   
ref|XP_009108490.1|  PREDICTED: protein LOL2                          62.8    2e-09   
ref|XP_006467804.1|  PREDICTED: protein LOL2-like                     62.4    2e-09   
gb|KFK28743.1|  hypothetical protein AALP_AA7G041300                  62.4    2e-09   
ref|XP_010538452.1|  PREDICTED: protein LOL2                          62.4    2e-09   
ref|XP_007159389.1|  hypothetical protein PHAVU_002G234100g           62.4    3e-09   
ref|XP_003529323.1|  PREDICTED: protein LOL2                          62.0    3e-09   
ref|XP_004505056.1|  PREDICTED: protein LOL2-like                     62.0    3e-09   
ref|XP_004146601.1|  PREDICTED: protein LOL2-like                     62.0    3e-09   
emb|CDX76435.1|  BnaA08g09650D                                        62.4    3e-09   
ref|XP_002444995.1|  hypothetical protein SORBIDRAFT_07g002500        62.4    3e-09   
ref|XP_006644363.1|  PREDICTED: nascent polypeptide-associated co...  65.9    3e-09   
ref|XP_007025633.1|  Lsd one like 2                                   62.0    4e-09   
ref|XP_007159388.1|  hypothetical protein PHAVU_002G234100g           62.0    4e-09   
ref|XP_006347045.1|  PREDICTED: titin-like isoform X2                 64.3    4e-09   
ref|XP_006347044.1|  PREDICTED: titin-like isoform X1                 64.3    4e-09   
ref|XP_006347046.1|  PREDICTED: titin-like isoform X3                 64.3    4e-09   
gb|KDO75957.1|  hypothetical protein CISIN_1g033096mg                 61.2    5e-09   
ref|XP_010108198.1|  hypothetical protein L484_014524                 62.0    6e-09   
ref|XP_002519836.1|  conserved hypothetical protein                   60.5    8e-09   
ref|XP_010316749.1|  PREDICTED: uncharacterized protein LOC101248...  63.2    8e-09   
ref|NP_001060920.1|  Os08g0130100                                     60.8    8e-09   
gb|KDO75958.1|  hypothetical protein CISIN_1g033096mg                 60.5    9e-09   
ref|XP_002273964.1|  PREDICTED: protein LOL2                          60.8    9e-09   
ref|XP_008776177.1|  PREDICTED: protein LOL2                          60.5    1e-08   
ref|XP_006413754.1|  hypothetical protein EUTSA_v10026412mg           60.8    1e-08   
ref|XP_004232872.1|  PREDICTED: uncharacterized protein LOC101248...  63.2    1e-08   
ref|XP_010316748.1|  PREDICTED: uncharacterized protein LOC101248...  63.2    1e-08   
ref|XP_006659091.1|  PREDICTED: protein LOL4-like                     60.5    1e-08   
ref|XP_010912488.1|  PREDICTED: protein LOL2                          60.1    1e-08   
ref|XP_004294024.2|  PREDICTED: protein LOL2                          60.1    1e-08   
ref|XP_008442544.1|  PREDICTED: protein LOL2 isoform X4               59.7    2e-08   
ref|XP_008442535.1|  PREDICTED: protein LOL2 isoform X3               59.7    2e-08   
gb|EAY74943.1|  hypothetical protein OsI_02839                        63.2    2e-08   
gb|EAZ12672.1|  hypothetical protein OsJ_02587                        63.2    2e-08   
gb|KEH31073.1|  LSD1-type zinc finger protein                         58.9    4e-08   
ref|XP_008442526.1|  PREDICTED: protein LOL2 isoform X2               58.9    4e-08   
ref|XP_008442518.1|  PREDICTED: protein LOL2 isoform X1               58.9    4e-08   
ref|XP_009765272.1|  PREDICTED: arf-GAP with SH3 domain, ANK repe...  61.2    6e-08   
ref|XP_009765270.1|  PREDICTED: arf-GAP with SH3 domain, ANK repe...  61.2    6e-08   
ref|XP_009765271.1|  PREDICTED: arf-GAP with SH3 domain, ANK repe...  61.2    6e-08   
ref|XP_009765274.1|  PREDICTED: basic salivary proline-rich prote...  61.2    6e-08   
ref|XP_009765273.1|  PREDICTED: protein piccolo-like isoform X4       61.2    6e-08   
ref|XP_010686668.1|  PREDICTED: protein LOL2                          58.5    6e-08   
ref|NP_001043558.1|  Os01g0612700                                     61.6    7e-08   
ref|XP_009605279.1|  PREDICTED: proline-rich receptor-like protei...  61.2    7e-08   
ref|XP_005843568.1|  hypothetical protein CHLNCDRAFT_13521            58.5    7e-08   
emb|CDY31418.1|  BnaC03g64060D                                        59.7    8e-08   
dbj|BAD61218.1|  zinc finger protein LSD2-like                        61.2    8e-08   
ref|XP_005650162.1|  hypothetical protein COCSUDRAFT_83625            58.2    8e-08   
ref|XP_010232018.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    9e-08   
gb|EMS48498.1|  hypothetical protein TRIUR3_35201                     61.2    1e-07   
gb|KEH31074.1|  LSD1-type zinc finger protein                         57.4    1e-07   
ref|XP_008371365.1|  PREDICTED: protein LOL2-like                     56.6    1e-07   
ref|XP_003630014.1|  Lsd1-like protein                                55.8    4e-07   
ref|XP_001697083.1|  zinc-finger protein Lsd1                         56.2    6e-07   
sp|Q704V3.1|LOL5_ORYSJ  RecName: Full=Protein LOL5; AltName: Full...  55.8    6e-07   
emb|CDO99546.1|  unnamed protein product                              57.0    7e-07   
gb|KJB57559.1|  hypothetical protein B456_009G169900                  55.1    1e-06   
emb|CDY31440.1|  BnaC03g63840D                                        55.1    1e-06   
gb|ACH87172.1|  zinc finger protein LSD2-like protein                 55.8    2e-06   
gb|AFW74466.1|  hypothetical protein ZEAMMB73_692100                  54.3    2e-06   
gb|KHG13259.1|  Protein LOL2 -like protein                            54.3    2e-06   
ref|XP_010242919.1|  PREDICTED: protein LOL2 isoform X1               53.5    2e-06   
ref|XP_009410824.1|  PREDICTED: regulator of G-protein signaling ...  55.8    3e-06   
ref|XP_004969153.1|  PREDICTED: histone-lysine N-methyltransferas...  56.6    3e-06   
ref|XP_010242922.1|  PREDICTED: protein LOL2 isoform X4               53.1    3e-06   
ref|XP_010242921.1|  PREDICTED: protein LOL2 isoform X3               52.8    3e-06   
ref|XP_010242920.1|  PREDICTED: protein LOL2 isoform X2               52.8    3e-06   
ref|XP_003573341.1|  PREDICTED: protein LOL4-like                     53.5    3e-06   
ref|XP_010057425.1|  PREDICTED: actin cytoskeleton-regulatory com...  55.8    3e-06   
ref|XP_002305138.2|  hypothetical protein POPTR_0004s04310g           53.1    5e-06   
ref|NP_001173195.1|  Os02g0807700                                     51.6    5e-06   
ref|XP_011027836.1|  PREDICTED: protein LOL2                          52.8    6e-06   
ref|XP_011086077.1|  PREDICTED: proline-rich receptor-like protei...  54.7    8e-06   
ref|XP_010904648.1|  PREDICTED: protein LSD1-like isoform X2          52.0    1e-05   
gb|EYU43394.1|  hypothetical protein MIMGU_mgv1a009107mg              53.1    3e-05   
dbj|BAJ84901.1|  predicted protein                                    51.2    4e-05   
ref|XP_006468388.1|  PREDICTED: protein LSD1-like isoform X3          50.1    5e-05   
ref|XP_002947922.1|  zinc-finger LSD1 protein                         49.7    1e-04   
gb|EPS65994.1|  hypothetical protein M569_08787                       50.1    2e-04   
ref|XP_008678298.1|  PREDICTED: protein LOL4-like isoform X2          47.8    2e-04   
ref|XP_008678297.1|  PREDICTED: protein LOL4-like isoform X1          47.8    3e-04   
ref|XP_008675492.1|  PREDICTED: flocculation protein FLO11-like i...  50.4    3e-04   
ref|XP_008675491.1|  PREDICTED: flocculation protein FLO11-like i...  50.1    3e-04   
ref|XP_009108471.1|  PREDICTED: protein LSD1-like isoform X2          47.8    3e-04   
ref|XP_009108470.1|  PREDICTED: protein LSD1-like isoform X1          47.8    3e-04   



>gb|KDP34641.1| hypothetical protein JCGZ_11985 [Jatropha curcas]
Length=147

 Score =   139 bits (349),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 98/109 (90%), Positives = 102/109 (94%), Gaps = 1/109 (1%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPT PA +   +PA NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPP
Sbjct  1    MPVPLAPYPTPPAATYTPAPA-NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPP  59

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG
Sbjct  60   PGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  108



>ref|XP_002281099.1| PREDICTED: protein LOL1 [Vitis vinifera]
 ref|XP_010663767.1| PREDICTED: protein LOL1 [Vitis vinifera]
 ref|XP_010663770.1| PREDICTED: protein LOL1 [Vitis vinifera]
 ref|XP_010663773.1| PREDICTED: protein LOL1 [Vitis vinifera]
 ref|XP_010663776.1| PREDICTED: protein LOL1 [Vitis vinifera]
 ref|XP_010663781.1| PREDICTED: protein LOL1 [Vitis vinifera]
Length=145

 Score =   136 bits (343),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 96/109 (88%), Gaps = 3/109 (3%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPT P P    +   NGAQSQLVCS CRNLL+YPVGA SVCCAVC+ VTAVP 
Sbjct  1    MPVPLAPYPTPPVPFTQPA---NGAQSQLVCSGCRNLLLYPVGAKSVCCAVCNVVTAVPL  57

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG
Sbjct  58   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  106



>emb|CAN76365.1| hypothetical protein VITISV_014138 [Vitis vinifera]
Length=146

 Score =   136 bits (342),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 96/109 (88%), Gaps = 3/109 (3%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPT P P    +   NGAQSQLVCS CRNLL+YPVGA SVCCAVC+ VTAVP 
Sbjct  1    MPVPLAPYPTPPVPFTQPA---NGAQSQLVCSGCRNLLLYPVGAKSVCCAVCNVVTAVPL  57

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG
Sbjct  58   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  106



>gb|KHG28475.1| Protein LOL1 -like protein [Gossypium arboreum]
Length=147

 Score =   136 bits (342),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 96/109 (88%), Gaps = 3/109 (3%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPT        +   NGAQSQLVCS CRNLLMYP GATSVCCAVC+A+TAVPP
Sbjct  1    MPVPLAPYPTPSGSYTPPA---NGAQSQLVCSGCRNLLMYPAGATSVCCAVCNAITAVPP  57

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  58   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLALEANQVAHVNCG  106



>gb|KJB25335.1| hypothetical protein B456_004G186300 [Gossypium raimondii]
 gb|KJB25336.1| hypothetical protein B456_004G186300 [Gossypium raimondii]
Length=147

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 96/109 (88%), Gaps = 3/109 (3%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPT P          NGAQSQLVCS CRNLLMYP GATSVCCAVC+A+TAVPP
Sbjct  1    MPVPLAPYPTPPGSYTPPV---NGAQSQLVCSGCRNLLMYPAGATSVCCAVCNAITAVPP  57

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  58   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLALEANQVAHVNCG  106



>ref|XP_010269986.1| PREDICTED: protein LSD1 [Nelumbo nucifera]
 ref|XP_010269987.1| PREDICTED: protein LSD1 [Nelumbo nucifera]
 ref|XP_010269988.1| PREDICTED: protein LSD1 [Nelumbo nucifera]
Length=144

 Score =   134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 97/109 (89%), Gaps = 4/109 (4%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPTAP P        NG QSQLVCS CRNLL+YP+GATSVCCAVC+AVT VPP
Sbjct  1    MPVPLAPYPTAPVPFTPP----NGTQSQLVCSGCRNLLVYPIGATSVCCAVCNAVTVVPP  56

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG
Sbjct  57   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  105



>ref|XP_006847710.1| hypothetical protein AMTR_s00149p00075900 [Amborella trichopoda]
 gb|ERN09291.1| hypothetical protein AMTR_s00149p00075900 [Amborella trichopoda]
Length=143

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 96/109 (88%), Gaps = 4/109 (4%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPT P P        NG Q QLVCS CRNLL+YPVGATSVCCAVC+AVTAVPP
Sbjct  1    MPVPLAPYPTPPVPFTAP----NGTQGQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPP  56

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG
Sbjct  57   PGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  105



>emb|CBI33909.3| unnamed protein product [Vitis vinifera]
Length=230

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 96/109 (88%), Gaps = 3/109 (3%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPT P P    +   NGAQSQLVCS CRNLL+YPVGA SVCCAVC+ VTAVP 
Sbjct  86   MPVPLAPYPTPPVPFTQPA---NGAQSQLVCSGCRNLLLYPVGAKSVCCAVCNVVTAVPL  142

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG
Sbjct  143  PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  191



>ref|XP_010941225.1| PREDICTED: protein LSD1 [Elaeis guineensis]
 ref|XP_010941226.1| PREDICTED: protein LSD1 [Elaeis guineensis]
Length=143

 Score =   134 bits (336),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 98/109 (90%), Gaps = 4/109 (4%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPTAP P        NG QSQLVCS CRNLL+YP+GATSVCCAVC+AVTAVPP
Sbjct  1    MPVPLAPYPTAPVPFTPP----NGGQSQLVCSGCRNLLLYPLGATSVCCAVCNAVTAVPP  56

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG
Sbjct  57   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  105



>ref|XP_010275257.1| PREDICTED: protein LSD1-like [Nelumbo nucifera]
 ref|XP_010275258.1| PREDICTED: protein LSD1-like [Nelumbo nucifera]
 ref|XP_010275259.1| PREDICTED: protein LSD1-like [Nelumbo nucifera]
 ref|XP_010275260.1| PREDICTED: protein LSD1-like [Nelumbo nucifera]
 ref|XP_010275261.1| PREDICTED: protein LSD1-like [Nelumbo nucifera]
Length=146

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 97/109 (89%), Gaps = 2/109 (2%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPTAP      +    GAQSQLVCS CRNLL YPVGATSVCCAVC+AVTAVPP
Sbjct  1    MPVPLAPYPTAPVQFMPANVP--GAQSQLVCSGCRNLLAYPVGATSVCCAVCNAVTAVPP  58

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHTINLA+EANQVAHVNCG
Sbjct  59   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLAMEANQVAHVNCG  107



>gb|KJB25334.1| hypothetical protein B456_004G186300 [Gossypium raimondii]
Length=148

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 96/109 (88%), Gaps = 2/109 (2%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPT P        A  GAQSQLVCS CRNLLMYP GATSVCCAVC+A+TAVPP
Sbjct  1    MPVPLAPYPTPPGSYTPPVNA--GAQSQLVCSGCRNLLMYPAGATSVCCAVCNAITAVPP  58

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  59   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLALEANQVAHVNCG  107



>gb|AFK34347.1| unknown [Lotus japonicus]
Length=146

 Score =   131 bits (330),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 2/109 (2%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPT P      +P  NGAQSQL CS CRNLL+YPVGAT+VCCAVC+AVTAVPP
Sbjct  1    MPVPLAPYPTTPPALYTHAP--NGAQSQLACSGCRNLLLYPVGATTVCCAVCNAVTAVPP  58

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTL+MYIRGATSVQCSCCHT+NLALEANQVAHV CG
Sbjct  59   PGTEMAQLVCGGCHTLIMYIRGATSVQCSCCHTVNLALEANQVAHVYCG  107



>ref|NP_001061042.1| Os08g0159500 [Oryza sativa Japonica Group]
 sp|Q0J7V9.1|LSD1_ORYSJ RecName: Full=Protein LSD1; AltName: Full=Protein LESION SIMULATING 
DISEASE 1; Short=OsLSD1; AltName: Full=Putative zinc 
finger LSD1 [Oryza sativa Japonica Group]
 dbj|BAF22956.1| Os08g0159500 [Oryza sativa Japonica Group]
 dbj|BAG99402.1| unnamed protein product [Oryza sativa Japonica Group]
Length=184

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 93/111 (84%), Gaps = 4/111 (4%)
 Frame = +2

Query  215  TIMPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtav  394
            T MPVPLA         P+    PNGAQSQLVCS CRNLLMYP GATSVCCAVCS VTAV
Sbjct  40   TAMPVPLA----PYPTPPVPFTPPNGAQSQLVCSGCRNLLMYPAGATSVCCAVCSTVTAV  95

Query  395  pppGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            P PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  96   PAPGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  146



>ref|XP_008799374.1| PREDICTED: protein LSD1 isoform X2 [Phoenix dactylifera]
 ref|XP_008799375.1| PREDICTED: protein LSD1 isoform X2 [Phoenix dactylifera]
 ref|XP_008799376.1| PREDICTED: protein LSD1 isoform X2 [Phoenix dactylifera]
Length=143

 Score =   130 bits (328),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 95/109 (87%), Gaps = 4/109 (4%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYP +  P        NG Q+QLVCS CRNLL+YP+GATS+CCA+C+AVTA PP
Sbjct  1    MPVPLAPYPNSSVPFTPP----NGGQNQLVCSGCRNLLLYPLGATSICCAICNAVTAAPP  56

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMA+L+CGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG
Sbjct  57   PGTEMARLVCGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  105



>ref|XP_004972784.1| PREDICTED: LOW QUALITY PROTEIN: protein LSD1-like [Setaria italica]
Length=175

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 93/111 (84%), Gaps = 4/111 (4%)
 Frame = +2

Query  215  TIMPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtav  394
            T MPVPLA         P+    PNGAQSQLVC+ CRNLLMYP GATSVCCAVCS VTAV
Sbjct  31   TAMPVPLA----PYPTPPVPFTPPNGAQSQLVCTGCRNLLMYPAGATSVCCAVCSTVTAV  86

Query  395  pppGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            P PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  87   PAPGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  137



>gb|ABW70167.1| LOL1 [Bambusa oldhamii]
Length=142

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 94/109 (86%), Gaps = 5/109 (5%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAP+PT    +P      NGAQSQL+CS CRNLLMY  GATSVCCAVCS +TAVP 
Sbjct  1    MPVPLAPHPTPVPFTPP-----NGAQSQLICSGCRNLLMYSAGATSVCCAVCSTMTAVPA  55

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  56   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  104



>ref|XP_003608622.1| Zinc finger protein LSD1 [Medicago truncatula]
 gb|ACJ85896.1| unknown [Medicago truncatula]
 gb|ACJ86120.1| unknown [Medicago truncatula]
 gb|AES90819.1| LSD1-type zinc finger protein [Medicago truncatula]
 gb|AFK37952.1| unknown [Medicago truncatula]
 gb|AFK38119.1| unknown [Medicago truncatula]
Length=154

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  28   NGAQSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  87

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  88   ATSVQCSCCHTVNLALEANQVAHVNCG  114



>emb|CAF05902.1| zinc finger protein [Oryza sativa Japonica Group]
 dbj|BAG99403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82933.1| hypothetical protein OsI_27897 [Oryza sativa Indica Group]
 gb|EEE68083.1| hypothetical protein OsJ_26122 [Oryza sativa Japonica Group]
Length=143

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 92/109 (84%), Gaps = 4/109 (4%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLA         P+    PNGAQSQLVCS CRNLLMYP GATSVCCAVCS VTAVP 
Sbjct  1    MPVPLA----PYPTPPVPFTPPNGAQSQLVCSGCRNLLMYPAGATSVCCAVCSTVTAVPA  56

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  57   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  105



>gb|AAS13688.1| zinc finger protein LSD1 [Oryza sativa Japonica Group]
Length=143

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 92/109 (84%), Gaps = 4/109 (4%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLA         P+    PNGAQSQLVCS CRNLLMYP GATSVCCAVCS VTAVP 
Sbjct  1    MPVPLA----PYPTPPVPFTPPNGAQSQLVCSGCRNLLMYPAGATSVCCAVCSTVTAVPA  56

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  57   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  105



>ref|XP_006659855.1| PREDICTED: LOW QUALITY PROTEIN: protein LSD1-like [Oryza brachyantha]
Length=229

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 92/111 (83%), Gaps = 4/111 (4%)
 Frame = +2

Query  215  TIMPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtav  394
            T MPVPLA         P+    PNG QSQLVCS CRNLLMYP GATSVCCAVCS VTAV
Sbjct  85   TAMPVPLA----PYPTPPVPFTPPNGTQSQLVCSGCRNLLMYPAGATSVCCAVCSTVTAV  140

Query  395  pppGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            P PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  141  PAPGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  191



>ref|XP_002528249.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34134.1| conserved hypothetical protein [Ricinus communis]
Length=147

 Score =   129 bits (323),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLA     P        + NGAQSQLVCS CRNLL+YP GATSVCCAVC+AVTAVPP
Sbjct  1    MPVPLA-PYPTPPTPYTQPASANGAQSQLVCSGCRNLLLYPAGATSVCCAVCNAVTAVPP  59

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHTINLA+EANQVAHVNCG
Sbjct  60   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLAMEANQVAHVNCG  108



>ref|XP_004300252.1| PREDICTED: protein LOL1 [Fragaria vesca subsp. vesca]
Length=157

 Score =   129 bits (323),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = +2

Query  218  IMPVPLAPYptapapsplmspap-NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtav  394
            IMPVPLAPYPT PAP    + A  NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAV
Sbjct  8    IMPVPLAPYPTPPAPYTPPAAAAANGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAV  67

Query  395  pppGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PPPGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  68   PPPGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLALEANQVAHVNCG  118



>ref|XP_002445097.1| hypothetical protein SORBIDRAFT_07g004050 [Sorghum bicolor]
 gb|EES14592.1| hypothetical protein SORBIDRAFT_07g004050 [Sorghum bicolor]
Length=143

 Score =   128 bits (322),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 92/109 (84%), Gaps = 4/109 (4%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLA         P+    PNGAQSQLVC+ CRNLLMYP GATSVCCAVCS VTAVP 
Sbjct  1    MPVPLA----PYPTPPVPFTPPNGAQSQLVCTGCRNLLMYPAGATSVCCAVCSTVTAVPA  56

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  57   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  105



>ref|XP_007039533.1| Lsd one like 1 isoform 1 [Theobroma cacao]
 ref|XP_007039534.1| Lsd one like 1 isoform 1 [Theobroma cacao]
 gb|EOY24034.1| Lsd one like 1 isoform 1 [Theobroma cacao]
 gb|EOY24035.1| Lsd one like 1 isoform 1 [Theobroma cacao]
Length=145

 Score =   128 bits (321),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLALEANQVAHVNCG  106



>ref|XP_006436739.1| hypothetical protein CICLE_v10032940mg [Citrus clementina]
 ref|XP_006436740.1| hypothetical protein CICLE_v10032940mg [Citrus clementina]
 ref|XP_006485443.1| PREDICTED: protein LOL1-like isoform X1 [Citrus sinensis]
 ref|XP_006485444.1| PREDICTED: protein LOL1-like isoform X2 [Citrus sinensis]
 gb|ESR49979.1| hypothetical protein CICLE_v10032940mg [Citrus clementina]
 gb|ESR49980.1| hypothetical protein CICLE_v10032940mg [Citrus clementina]
 gb|KDO51126.1| hypothetical protein CISIN_1g032227mg [Citrus sinensis]
 gb|KDO51127.1| hypothetical protein CISIN_1g032227mg [Citrus sinensis]
Length=145

 Score =   128 bits (321),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLALEANQVAHVNCG  106



>gb|KEH31552.1| LSD1-type zinc finger protein [Medicago truncatula]
Length=128

 Score =   127 bits (320),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 82/86 (95%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            GAQSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGA
Sbjct  3    GAQSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGA  62

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  63   TSVQCSCCHTVNLALEANQVAHVNCG  88



>ref|XP_011028205.1| PREDICTED: protein LOL1 [Populus euphratica]
 ref|XP_011028206.1| PREDICTED: protein LOL1 [Populus euphratica]
Length=153

 Score =   128 bits (322),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  28   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  87

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  88   ATSVQCSCCHTVNLALEANQVAHVNCG  114



>ref|XP_006303377.1| hypothetical protein CARUB_v10010527mg [Capsella rubella]
 gb|EOA36275.1| hypothetical protein CARUB_v10010527mg [Capsella rubella]
Length=157

 Score =   128 bits (322),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 96/116 (83%), Gaps = 7/116 (6%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspa-------pNGAQSQLVCSRCRNLLMYPVGatsvccavcs  379
            MPVPLAPYPT PAP      A           QSQLVCS CRNLLMYP GATSVCCAVC+
Sbjct  1    MPVPLAPYPTPPAPVMAPPYAPPPTHGGSTSGQSQLVCSGCRNLLMYPAGATSVCCAVCN  60

Query  380  avtavpppGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            AVTAVPPPGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  61   AVTAVPPPGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLALEANQVAHVNCG  116



>ref|XP_007209744.1| hypothetical protein PRUPE_ppa013007mg [Prunus persica]
 gb|EMJ10943.1| hypothetical protein PRUPE_ppa013007mg [Prunus persica]
Length=145

 Score =   128 bits (321),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLALEANQVAHVNCG  106



>ref|XP_004509019.1| PREDICTED: protein LOL1-like isoform X1 [Cicer arietinum]
 ref|XP_004509020.1| PREDICTED: protein LOL1-like isoform X2 [Cicer arietinum]
 ref|XP_004509021.1| PREDICTED: protein LOL1-like isoform X3 [Cicer arietinum]
 ref|XP_004509022.1| PREDICTED: protein LOL1-like isoform X4 [Cicer arietinum]
 ref|XP_004509023.1| PREDICTED: protein LOL1-like isoform X5 [Cicer arietinum]
Length=147

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  22   NGAQSQLVCSGCRNLLVYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  81

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  82   ATSVQCSCCHTVNLALEANQVAHVNCG  108



>gb|AFK36740.1| unknown [Lotus japonicus]
Length=145

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVT+VPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGAQSQLVCSGCRNLLVYPVGATSVCCAVCNAVTSVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLALEANQVAHVNCG  106



>gb|KHG28572.1| Protein LOL1 -like protein [Gossypium arboreum]
 gb|KJB51339.1| hypothetical protein B456_008G227400 [Gossypium raimondii]
 gb|KJB51340.1| hypothetical protein B456_008G227400 [Gossypium raimondii]
 gb|KJB51341.1| hypothetical protein B456_008G227400 [Gossypium raimondii]
 gb|KJB51342.1| hypothetical protein B456_008G227400 [Gossypium raimondii]
Length=146

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  21   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  80

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  81   ATSVQCSCCHTVNLALEANQVAHVNCG  107



>ref|XP_008238278.1| PREDICTED: protein LOL1 [Prunus mume]
 ref|XP_008238279.1| PREDICTED: protein LOL1 [Prunus mume]
 ref|XP_008238280.1| PREDICTED: protein LOL1 [Prunus mume]
Length=145

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLALEANQVAHVNCG  106



>ref|XP_011014158.1| PREDICTED: protein LOL1-like [Populus euphratica]
 ref|XP_011014159.1| PREDICTED: protein LOL1-like [Populus euphratica]
 ref|XP_011014160.1| PREDICTED: protein LOL1-like [Populus euphratica]
 ref|XP_011014161.1| PREDICTED: protein LOL1-like [Populus euphratica]
Length=161

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  36   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  95

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  96   ATSVQCSCCHTVNLALEANQVAHVNCG  122



>ref|XP_011018590.1| PREDICTED: protein LOL1-like [Populus euphratica]
 ref|XP_011018591.1| PREDICTED: protein LOL1-like [Populus euphratica]
 ref|XP_011018592.1| PREDICTED: protein LOL1-like [Populus euphratica]
 ref|XP_011018593.1| PREDICTED: protein LOL1-like [Populus euphratica]
Length=161

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  36   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  95

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  96   ATSVQCSCCHTVNLALEANQVAHVNCG  122



>ref|XP_006368419.1| hypothetical protein POPTR_0001s02650g [Populus trichocarpa]
 gb|ERP64988.1| hypothetical protein POPTR_0001s02650g [Populus trichocarpa]
Length=156

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  31   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  90

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  91   ATSVQCSCCHTVNLALEANQVAHVNCG  117



>gb|KDO51128.1| hypothetical protein CISIN_1g032227mg [Citrus sinensis]
 gb|KDO51129.1| hypothetical protein CISIN_1g032227mg [Citrus sinensis]
Length=142

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLALEANQVAHVNCG  106



>ref|XP_008373559.1| PREDICTED: protein LOL1 [Malus domestica]
Length=152

 Score =   127 bits (320),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  27   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  86

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  87   ATSVQCSCCHTVNLALEANQVAHVNCG  113



>ref|NP_001151942.1| LOC100285579 [Zea mays]
 ref|XP_008677384.1| PREDICTED: LOC100285579 isoform X1 [Zea mays]
 gb|ACG45100.1| LOL1 [Zea mays]
 gb|AFW61161.1| LOL1 isoform 1 [Zea mays]
 gb|AFW61162.1| LOL1 isoform 2 [Zea mays]
Length=143

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVC+ CRNLLMYP GATSVCCAVCS VTAVP PGTEMAQL+CGGCHTLLMYIRG
Sbjct  19   NGAQSQLVCTGCRNLLMYPAGATSVCCAVCSTVTAVPAPGTEMAQLVCGGCHTLLMYIRG  78

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  79   ATSVQCSCCHTVNLAMEANQVAHVNCG  105



>ref|XP_006436741.1| hypothetical protein CICLE_v10032940mg [Citrus clementina]
 gb|ESR49981.1| hypothetical protein CICLE_v10032940mg [Citrus clementina]
Length=162

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLALEANQVAHVNCG  106



>gb|ABQ23215.1| LSD1-type zinc finger protein [Triticum aestivum]
 gb|EMT24478.1| hypothetical protein F775_26150 [Aegilops tauschii]
Length=146

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYPT P P    +P   GAQSQLVCS CRNLLMYP GATSVCCAVCS VTAVP 
Sbjct  1    MPVPLAPYPTPPVPFTPPAPNA-GAQSQLVCSGCRNLLMYPAGATSVCCAVCSTVTAVPA  59

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  60   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  108



>ref|XP_006385636.1| hypothetical protein POPTR_0003s08890g [Populus trichocarpa]
 gb|ERP63433.1| hypothetical protein POPTR_0003s08890g [Populus trichocarpa]
Length=155

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL++PVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  30   NGAQSQLVCSGCRNLLLFPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  89

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  90   ATSVQCSCCHTVNLALEANQVAHVNCG  116



>ref|XP_010053598.1| PREDICTED: protein LOL1 [Eucalyptus grandis]
 ref|XP_010053599.1| PREDICTED: protein LOL1 [Eucalyptus grandis]
 ref|XP_010053600.1| PREDICTED: protein LOL1 [Eucalyptus grandis]
 ref|XP_010053601.1| PREDICTED: protein LOL1 [Eucalyptus grandis]
 gb|KCW77936.1| hypothetical protein EUGRSUZ_D02186 [Eucalyptus grandis]
Length=147

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLA     P  +P   P  NG QSQLVCS CRNLL+YP GATSVCCAVC+AVTAVPP
Sbjct  1    MPVPLA-PYPTPPTTPYTPPPVNGTQSQLVCSGCRNLLLYPAGATSVCCAVCNAVTAVPP  59

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  60   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLALEANQVAHVNCG  108



>ref|XP_010104333.1| hypothetical protein L484_023284 [Morus notabilis]
 gb|EXB99753.1| hypothetical protein L484_023284 [Morus notabilis]
Length=133

 Score =   126 bits (316),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 85/86 (99%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            GAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGA
Sbjct  9    GAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGA  68

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  69   TSVQCSCCHTVNLALEANQVAHVNCG  94



>emb|CDP12998.1| unnamed protein product [Coffea canephora]
Length=145

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 95/109 (87%), Gaps = 3/109 (3%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLA     P P    +P   GAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPP
Sbjct  1    MPVPLA---PYPTPPVPFTPPATGAQSQLVCSGCRNLLVYPVGATSVCCAVCNAVTAVPP  57

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGCHTLLMYIRGATSVQCSCCHTINLA+EANQVAHVNCG
Sbjct  58   PGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLAMEANQVAHVNCG  106



>ref|XP_010677260.1| PREDICTED: protein LOL1 [Beta vulgaris subsp. vulgaris]
Length=146

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 94/109 (86%), Gaps = 3/109 (3%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLA     P P    +P  NGAQSQLVCS CRNLL+YP GATSVCCAVC+AVTAVPP
Sbjct  1    MPVPLA---PYPTPPVPFTPPANGAQSQLVCSGCRNLLLYPAGATSVCCAVCNAVTAVPP  57

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+C GCHTLLMYIRGATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  58   PGTEMAQLVCAGCHTLLMYIRGATSVQCSCCHTVNLALEANQVAHVNCG  106



>emb|CCW28769.1| putative LSD1 zinc finger domain protein [Arachis duranensis]
Length=146

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NG QSQLVCS CRNLL+YPVGA+SVCCAVC+AVTAVPPPGTEMAQLICGGCHTLLMYIRG
Sbjct  21   NGQQSQLVCSGCRNLLLYPVGASSVCCAVCNAVTAVPPPGTEMAQLICGGCHTLLMYIRG  80

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  81   ATSVQCSCCHTVNLAMEANQVAHVNCG  107



>ref|XP_006368420.1| hypothetical protein POPTR_0001s02650g [Populus trichocarpa]
 gb|ERP64989.1| hypothetical protein POPTR_0001s02650g [Populus trichocarpa]
Length=156

 Score =   126 bits (317),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 86/87 (99%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGT+MAQL+CGGCHTLLMYIRG
Sbjct  31   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTKMAQLVCGGCHTLLMYIRG  90

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  91   ATSVQCSCCHTVNLALEANQVAHVNCG  117



>gb|ACB37310.1| LOL1-like protein [Hordeum vulgare subsp. vulgare]
Length=146

 Score =   126 bits (316),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            GAQSQLVCS CRNLLMYP GATSVCCAVCS VTAVP PGTEMAQL+CGGCHTLLMYIRGA
Sbjct  23   GAQSQLVCSGCRNLLMYPAGATSVCCAVCSTVTAVPAPGTEMAQLVCGGCHTLLMYIRGA  82

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  83   TSVQCSCCHTVNLAMEANQVAHVNCG  108



>ref|XP_003573460.1| PREDICTED: protein LSD1 [Brachypodium distachyon]
 ref|XP_010234376.1| PREDICTED: protein LSD1 [Brachypodium distachyon]
Length=146

 Score =   126 bits (316),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            GAQSQLVCS CRNLLMYP GATSVCCAVCS VTAVP PGTEMAQL+CGGCHTLLMYIRGA
Sbjct  23   GAQSQLVCSGCRNLLMYPAGATSVCCAVCSTVTAVPAPGTEMAQLVCGGCHTLLMYIRGA  82

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  83   TSVQCSCCHTVNLAMEANQVAHVNCG  108



>ref|NP_001288950.1| protein LOL1 [Brassica rapa]
 ref|XP_009151438.1| PREDICTED: protein LOL1 isoform X2 [Brassica rapa]
 dbj|BAD95789.1| LSD-One-Like 1 [Brassica rapa]
Length=155

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
             G QSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  30   TGGQSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  89

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  90   ATSVQCSCCHTVNLALEANQVAHVNCG  116



>ref|XP_009590866.1| PREDICTED: protein LOL1 isoform X2 [Nicotiana tomentosiformis]
Length=143

 Score =   125 bits (315),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NG QSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGTQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLAMEANQVAHVNCG  106



>emb|CDY26902.1| BnaA05g18100D [Brassica napus]
Length=154

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/86 (94%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            G QSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGA
Sbjct  30   GGQSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGA  89

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  90   TSVQCSCCHTVNLALEANQVAHVNCG  115



>ref|XP_009590862.1| PREDICTED: protein LOL1 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009590863.1| PREDICTED: protein LOL1 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009590864.1| PREDICTED: protein LOL1 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009590865.1| PREDICTED: protein LOL1 isoform X1 [Nicotiana tomentosiformis]
Length=145

 Score =   125 bits (315),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NG QSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGTQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLAMEANQVAHVNCG  106



>ref|XP_007155770.1| hypothetical protein PHAVU_003G230100g [Phaseolus vulgaris]
 gb|ESW27764.1| hypothetical protein PHAVU_003G230100g [Phaseolus vulgaris]
Length=149

 Score =   126 bits (316),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLLMYP GATSVCCAVC+AVT VPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGAQSQLVCSGCRNLLMYPAGATSVCCAVCNAVTGVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            AT+VQCSCCHT+NLALEANQVAHVNCG
Sbjct  80   ATNVQCSCCHTVNLALEANQVAHVNCG  106



>ref|XP_006352846.1| PREDICTED: protein LOL1-like isoform X4 [Solanum tuberosum]
Length=145

 Score =   125 bits (315),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NG QSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGTQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLAMEANQVAHVNCG  106



>ref|XP_004245885.1| PREDICTED: protein LOL1 isoform X2 [Solanum lycopersicum]
Length=145

 Score =   125 bits (315),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NG QSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGTQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLAMEANQVAHVNCG  106



>ref|NP_001237533.1| uncharacterized protein LOC100306356 [Glycine max]
 ref|XP_003549982.1| PREDICTED: protein LOL1-like [Glycine max]
 gb|ACU14490.1| unknown [Glycine max]
 gb|KHN01689.1| Protein LOL1 [Glycine soja]
 gb|KHN45970.1| Protein LOL1 [Glycine soja]
Length=145

 Score =   125 bits (314),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NG QSQLVCS CRNLL++PVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGVQSQLVCSGCRNLLVFPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  80   ATSVQCSCCHTVNLALEANQVAHVNCG  106



>gb|AFW61163.1| hypothetical protein ZEAMMB73_950191 [Zea mays]
 gb|AFW61164.1| hypothetical protein ZEAMMB73_950191 [Zea mays]
Length=198

 Score =   127 bits (318),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVC+ CRNLLMYP GATSVCCAVCS VTAVP PGTEMAQL+CGGCHTLLMYIRG
Sbjct  19   NGAQSQLVCTGCRNLLMYPAGATSVCCAVCSTVTAVPAPGTEMAQLVCGGCHTLLMYIRG  78

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  79   ATSVQCSCCHTVNLAMEANQVAHVNCG  105



>ref|XP_009151437.1| PREDICTED: protein LOL1 isoform X1 [Brassica rapa]
Length=157

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
             G QSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  30   TGGQSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  89

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  90   ATSVQCSCCHTVNLALEANQVAHVNCG  116



>ref|XP_009392782.1| PREDICTED: protein LSD1-like [Musa acuminata subsp. malaccensis]
Length=160

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NG QSQLVCS CRNLL+YP+GATSVCCAVCSAVTAVPPPGTEMAQLICGGCHTLLM+IRG
Sbjct  36   NGGQSQLVCSGCRNLLLYPLGATSVCCAVCSAVTAVPPPGTEMAQLICGGCHTLLMFIRG  95

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  96   ATSVQCSCCHTVNLALEANQVAHVNCG  122



>ref|XP_003517373.1| PREDICTED: protein LOL1-like isoform X1 [Glycine max]
 ref|XP_006573689.1| PREDICTED: protein LOL1-like isoform X2 [Glycine max]
 gb|KHN42611.1| Protein LOL1 [Glycine soja]
Length=147

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVT VPPPGTEMAQL+CGGCHT LMYIRG
Sbjct  22   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTTVPPPGTEMAQLVCGGCHTFLMYIRG  81

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEAN VAHVNCG
Sbjct  82   ATSVQCSCCHTVNLALEANLVAHVNCG  108



>ref|XP_010531725.1| PREDICTED: protein LOL1-like [Tarenaya hassleriana]
Length=153

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            G QSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGA
Sbjct  27   GGQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGA  86

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  87   TSVQCSCCHTVNLALEANQVAHVNCG  112



>ref|XP_010540778.1| PREDICTED: protein LOL1-like [Tarenaya hassleriana]
Length=153

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGATS
Sbjct  31   QSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGATS  90

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            VQCSCCHT+NLALEANQVAHVNCG
Sbjct  91   VQCSCCHTVNLALEANQVAHVNCG  114



>ref|XP_006352843.1| PREDICTED: protein LOL1-like isoform X1 [Solanum tuberosum]
 ref|XP_006352844.1| PREDICTED: protein LOL1-like isoform X2 [Solanum tuberosum]
 ref|XP_006352845.1| PREDICTED: protein LOL1-like isoform X3 [Solanum tuberosum]
Length=146

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            G QSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGA
Sbjct  22   GTQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGA  81

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  82   TSVQCSCCHTVNLAMEANQVAHVNCG  107



>ref|NP_564405.1| protein LOL1 [Arabidopsis thaliana]
 ref|NP_001117399.1| protein LOL1 [Arabidopsis thaliana]
 sp|Q93ZB1.1|LOL1_ARATH RecName: Full=Protein LOL1; AltName: Full=Protein LSD ONE LIKE 
1; Short=AtLOL1; AltName: Full=Putative zinc finger LOL1 [Arabidopsis 
thaliana]
 gb|AAL15306.1| At1g32540/T9G5_1 [Arabidopsis thaliana]
 gb|AAM51585.1| At1g32540/T9G5_1 [Arabidopsis thaliana]
 gb|AAQ55219.1| LSD1-like [Arabidopsis thaliana]
 gb|AEE31498.1| lsd one like 1 protein [Arabidopsis thaliana]
 gb|AEE31500.1| lsd one like 1 protein [Arabidopsis thaliana]
Length=154

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGATS
Sbjct  32   QSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGATS  91

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            VQCSCCHT+NLALEANQVAHVNCG
Sbjct  92   VQCSCCHTVNLALEANQVAHVNCG  115



>ref|XP_004245884.1| PREDICTED: protein LOL1 isoform X1 [Solanum lycopersicum]
 ref|XP_010325552.1| PREDICTED: protein LOL1 isoform X1 [Solanum lycopersicum]
Length=146

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/86 (92%), Positives = 84/86 (98%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            G QSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGA
Sbjct  22   GTQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGA  81

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  82   TSVQCSCCHTVNLAMEANQVAHVNCG  107



>ref|XP_008465951.1| PREDICTED: protein LOL1 [Cucumis melo]
 ref|XP_008465952.1| PREDICTED: protein LOL1 [Cucumis melo]
 ref|XP_008465953.1| PREDICTED: protein LOL1 [Cucumis melo]
 ref|XP_008465954.1| PREDICTED: protein LOL1 [Cucumis melo]
Length=144

 Score =   123 bits (309),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            N  QSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVP PGTEMAQL+CGGCHTLLMYIRG
Sbjct  21   NATQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPAPGTEMAQLVCGGCHTLLMYIRG  80

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHV+CG
Sbjct  81   ATSVQCSCCHTVNLALEANQVAHVSCG  107



>ref|XP_002890995.1| hypothetical protein ARALYDRAFT_473445 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67254.1| hypothetical protein ARALYDRAFT_473445 [Arabidopsis lyrata subsp. 
lyrata]
Length=154

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGATS
Sbjct  32   QSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGATS  91

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            VQCSCCHT+NLALEANQVAHVNCG
Sbjct  92   VQCSCCHTVNLALEANQVAHVNCG  115



>ref|XP_006415178.1| hypothetical protein EUTSA_v10008989mg [Eutrema salsugineum]
 gb|ESQ33531.1| hypothetical protein EUTSA_v10008989mg [Eutrema salsugineum]
Length=156

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            G QSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGA
Sbjct  30   GGQSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGA  89

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSVQCSCCHT+NLALEANQVA VNCG
Sbjct  90   TSVQCSCCHTVNLALEANQVAQVNCG  115



>ref|XP_006415176.1| hypothetical protein EUTSA_v10008989mg [Eutrema salsugineum]
 ref|XP_006415177.1| hypothetical protein EUTSA_v10008989mg [Eutrema salsugineum]
 gb|ESQ33529.1| hypothetical protein EUTSA_v10008989mg [Eutrema salsugineum]
 gb|ESQ33530.1| hypothetical protein EUTSA_v10008989mg [Eutrema salsugineum]
Length=154

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/86 (93%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            G QSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGA
Sbjct  30   GGQSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGA  89

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSVQCSCCHT+NLALEANQVA VNCG
Sbjct  90   TSVQCSCCHTVNLALEANQVAQVNCG  115



>ref|XP_009408105.1| PREDICTED: protein LSD1 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009408106.1| PREDICTED: protein LSD1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=141

 Score =   123 bits (308),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NG QSQLVCS CRNLL+YP GA SVCCAVC AVT VPPPGTEMAQLICGGCHTLLMYIRG
Sbjct  19   NGGQSQLVCSGCRNLLLYPQGAKSVCCAVCRAVTTVPPPGTEMAQLICGGCHTLLMYIRG  78

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            A+SVQCSCCHT+NLALEANQVAHVNCG
Sbjct  79   ASSVQCSCCHTVNLALEANQVAHVNCG  105



>ref|XP_004148489.1| PREDICTED: protein LOL1-like isoform 1 [Cucumis sativus]
 ref|XP_004148490.1| PREDICTED: protein LOL1-like isoform 2 [Cucumis sativus]
 ref|XP_004168567.1| PREDICTED: protein LOL1-like isoform 1 [Cucumis sativus]
 ref|XP_004168568.1| PREDICTED: protein LOL1-like isoform 2 [Cucumis sativus]
 gb|KGN60405.1| hypothetical protein Csa_3G902960 [Cucumis sativus]
Length=144

 Score =   123 bits (308),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            N  QSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  21   NATQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  80

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            ATSVQCSCCHT+NLALEANQVAHV+CG
Sbjct  81   ATSVQCSCCHTVNLALEANQVAHVSCG  107



>ref|NP_849742.2| protein LOL1 [Arabidopsis thaliana]
 gb|AEE31499.1| lsd one like 1 protein [Arabidopsis thaliana]
Length=187

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGATS
Sbjct  65   QSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGATS  124

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            VQCSCCHT+NLALEANQVAHVNCG
Sbjct  125  VQCSCCHTVNLALEANQVAHVNCG  148



>ref|XP_010478675.1| PREDICTED: protein LOL1 [Camelina sativa]
 ref|XP_010478676.1| PREDICTED: protein LOL1 [Camelina sativa]
Length=154

 Score =   121 bits (303),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CRNLLMYP GA+SVCCAVC+AVTAVPPPGTEMAQL+C GCHTLLMYIRGATS
Sbjct  32   QSQLVCSGCRNLLMYPAGASSVCCAVCNAVTAVPPPGTEMAQLVCAGCHTLLMYIRGATS  91

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            VQCSCCHT+NLALEANQVAHVNCG
Sbjct  92   VQCSCCHTVNLALEANQVAHVNCG  115



>ref|XP_010499802.1| PREDICTED: protein LOL1-like [Camelina sativa]
 ref|XP_010499803.1| PREDICTED: protein LOL1-like [Camelina sativa]
Length=154

 Score =   120 bits (302),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CRNLLMYP GA+SVCCAVC+AVTAVPPPGTEMAQL+C GCHTLLMYIRGATS
Sbjct  32   QSQLVCSGCRNLLMYPAGASSVCCAVCNAVTAVPPPGTEMAQLVCAGCHTLLMYIRGATS  91

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            VQCSCCHT+NLALEANQVAHVNCG
Sbjct  92   VQCSCCHTVNLALEANQVAHVNCG  115



>ref|XP_010461077.1| PREDICTED: protein LOL1 [Camelina sativa]
 ref|XP_010461078.1| PREDICTED: protein LOL1 [Camelina sativa]
Length=154

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/84 (92%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CRNLLMYP GA+SVCCAVC+AVTAVPPPGTEMAQL+C GCHTLLMYIRGATS
Sbjct  32   QSQLVCSGCRNLLMYPAGASSVCCAVCNAVTAVPPPGTEMAQLVCAGCHTLLMYIRGATS  91

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            VQCSCCHT+NLALEANQVAHVNCG
Sbjct  92   VQCSCCHTVNLALEANQVAHVNCG  115



>ref|XP_010919877.1| PREDICTED: protein LSD1-like isoform X1 [Elaeis guineensis]
Length=143

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 89/109 (82%), Gaps = 4/109 (4%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPL PY   P P        NG+QSQ+VCS CRNLL+YP+GATSVCCAVC+AVT VP 
Sbjct  1    MPVPLIPYAAPPVPFTPP----NGSQSQIVCSGCRNLLLYPLGATSVCCAVCNAVTVVPS  56

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMA+L+CGGCH LLM++ GA SVQCSCCHTINLALEANQVAHVNC 
Sbjct  57   PGTEMARLVCGGCHMLLMHMHGAYSVQCSCCHTINLALEANQVAHVNCA  105



>ref|XP_002988289.1| hypothetical protein SELMODRAFT_447251 [Selaginella moellendorffii]
 gb|EFJ10708.1| hypothetical protein SELMODRAFT_447251 [Selaginella moellendorffii]
Length=196

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 87/109 (80%), Gaps = 5/109 (5%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPL PY   P   P       G+Q QL+C  CR LL+YP GAT+V CA+CS+VT VPP
Sbjct  1    MPVPLVPYAPQPHMPPP-----PGSQGQLICGGCRTLLVYPQGATNVRCALCSSVTPVPP  55

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGC TLLMY+RGATSVQCSCCHTINLA+EANQVAH++CG
Sbjct  56   PGTEMAQLVCGGCRTLLMYVRGATSVQCSCCHTINLAMEANQVAHISCG  104



>ref|XP_007156662.1| hypothetical protein PHAVU_002G006500g [Phaseolus vulgaris]
 gb|ESW28656.1| hypothetical protein PHAVU_002G006500g [Phaseolus vulgaris]
Length=143

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 82/87 (94%), Gaps = 2/87 (2%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQ+VCS CRNLL+YPVGATSVCCAVC+AVT VPP   EMAQL+CGGCHTLLM+IRG
Sbjct  19   NGAQSQVVCSGCRNLLLYPVGATSVCCAVCNAVTTVPP--PEMAQLVCGGCHTLLMFIRG  76

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            AT+VQCSCCHT+NLALEANQVAHVNCG
Sbjct  77   ATNVQCSCCHTVNLALEANQVAHVNCG  103



>ref|XP_002963886.1| hypothetical protein SELMODRAFT_270395 [Selaginella moellendorffii]
 gb|EFJ35757.1| hypothetical protein SELMODRAFT_270395 [Selaginella moellendorffii]
Length=196

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 87/109 (80%), Gaps = 5/109 (5%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPL PY   P   P       G+Q QL+C  CR LL+YP GAT+V CA+CS+VT VPP
Sbjct  1    MPVPLVPYAPQPHMPPP-----PGSQGQLICGGCRTLLVYPQGATNVRCALCSSVTPVPP  55

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            PGTEMAQL+CGGC TLLMY+RGATSVQCSCCHTINLA+EANQVAH++CG
Sbjct  56   PGTEMAQLVCGGCRTLLMYVRGATSVQCSCCHTINLAMEANQVAHISCG  104



>ref|XP_009408107.1| PREDICTED: protein LSD1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=139

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 78/87 (90%), Gaps = 2/87 (2%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NG QSQLVCS CRNLL+YP GA SVCCAVC AVT VPP   EMAQLICGGCHTLLMYIRG
Sbjct  19   NGGQSQLVCSGCRNLLLYPQGAKSVCCAVCRAVTTVPP--PEMAQLICGGCHTLLMYIRG  76

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            A+SVQCSCCHT+NLALEANQVAHVNCG
Sbjct  77   ASSVQCSCCHTVNLALEANQVAHVNCG  103



>ref|XP_008799378.1| PREDICTED: protein LSD1 isoform X3 [Phoenix dactylifera]
Length=134

 Score =   111 bits (278),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 86/101 (85%), Gaps = 4/101 (4%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYP +  P        NG Q+QLVCS CRNLL+YP+GATS+CCA+C+AVTA PP
Sbjct  1    MPVPLAPYPNSSVPFTPP----NGGQNQLVCSGCRNLLLYPLGATSICCAICNAVTAAPP  56

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEAN  523
            PGTEMA+L+CGGCHTLLMYIRGATSVQCSCCHTINLALE +
Sbjct  57   PGTEMARLVCGGCHTLLMYIRGATSVQCSCCHTINLALEGS  97



>ref|XP_010246054.1| PREDICTED: protein LOL1-like, partial [Nelumbo nucifera]
Length=145

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  293  AQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGAT  472
            AQSQLV S CRNLL YPVGAT VCCAVC+AVTAV  PGTEMAQL+CGG HT+LMYIRGAT
Sbjct  22   AQSQLVYSGCRNLLAYPVGATFVCCAVCNAVTAVSSPGTEMAQLVCGGRHTILMYIRGAT  81

Query  473  SVQCSCCHTINLALEANQVAHVNCG  547
            SVQC CCHTINLA+EANQV HVNCG
Sbjct  82   SVQCPCCHTINLAMEANQVVHVNCG  106



>ref|XP_008799372.1| PREDICTED: protein LSD1 isoform X1 [Phoenix dactylifera]
 ref|XP_008799373.1| PREDICTED: protein LSD1 isoform X1 [Phoenix dactylifera]
Length=159

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 86/101 (85%), Gaps = 4/101 (4%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPLAPYP +  P        NG Q+QLVCS CRNLL+YP+GATS+CCA+C+AVTA PP
Sbjct  1    MPVPLAPYPNSSVPFTPP----NGGQNQLVCSGCRNLLLYPLGATSICCAICNAVTAAPP  56

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEAN  523
            PGTEMA+L+CGGCHTLLMYIRGATSVQCSCCHTINLALE +
Sbjct  57   PGTEMARLVCGGCHTLLMYIRGATSVQCSCCHTINLALEGS  97



>ref|XP_002968020.1| hypothetical protein SELMODRAFT_72709, partial [Selaginella moellendorffii]
 ref|XP_002992422.1| hypothetical protein SELMODRAFT_72711, partial [Selaginella moellendorffii]
 gb|EFJ06572.1| hypothetical protein SELMODRAFT_72711, partial [Selaginella moellendorffii]
 gb|EFJ31367.1| hypothetical protein SELMODRAFT_72709, partial [Selaginella moellendorffii]
Length=112

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            GAQSQL+CS CR LL+YP GAT+V CA+CS +T V P G EMAQL+CGGC TLL+YIRGA
Sbjct  1    GAQSQLICSGCRTLLIYPHGATNVRCALCSCITPVSPQGPEMAQLVCGGCRTLLLYIRGA  60

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSVQCSCCHT+N+A++ANQ+AHVNCG
Sbjct  61   TSVQCSCCHTVNVAMDANQIAHVNCG  86



>ref|XP_009385726.1| PREDICTED: protein LSD1-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=143

 Score =   110 bits (275),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            N  QSQ+VC  CRNLL+YP GATSVCCAVCSAVT VPPPGTEMAQLICG CHTLLMY+RG
Sbjct  19   NSGQSQVVCCGCRNLLIYPGGATSVCCAVCSAVTTVPPPGTEMAQLICGSCHTLLMYVRG  78

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            A+ VQCSCCHT+NLA EANQVAHVNCG
Sbjct  79   ASRVQCSCCHTVNLAPEANQVAHVNCG  105



>gb|KDO51131.1| hypothetical protein CISIN_1g032227mg [Citrus sinensis]
Length=98

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALE  517
            ATSVQCSCCHT+NLALE
Sbjct  80   ATSVQCSCCHTVNLALE  96



>gb|KDO51130.1| hypothetical protein CISIN_1g032227mg [Citrus sinensis]
Length=118

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/77 (94%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGAQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALE  517
            ATSVQCSCCHT+NLALE
Sbjct  80   ATSVQCSCCHTVNLALE  96



>gb|AFW61165.1| hypothetical protein ZEAMMB73_950191 [Zea mays]
Length=135

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/86 (81%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVC+ CRNLLMYP GATSVCCAVCS VTAVP PGTEMAQL+CGGCHTLLMYIRG
Sbjct  19   NGAQSQLVCTGCRNLLMYPAGATSVCCAVCSTVTAVPAPGTEMAQLVCGGCHTLLMYIRG  78

Query  467  ATSVQCSCCHTINLALEANQVAHVNC  544
            ATSVQCSCCHT+NLA+E       +C
Sbjct  79   ATSVQCSCCHTVNLAMEGKSCDFDSC  104



>gb|AFW61160.1| hypothetical protein ZEAMMB73_950191 [Zea mays]
Length=105

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVC+ CRNLLMYP GATSVCCAVCS VTAVP PGTEMAQL+CGGCHTLLMYIRG
Sbjct  19   NGAQSQLVCTGCRNLLMYPAGATSVCCAVCSTVTAVPAPGTEMAQLVCGGCHTLLMYIRG  78

Query  467  ATSVQCSCCHTINLALE  517
            ATSVQCSCCHT+NLA+E
Sbjct  79   ATSVQCSCCHTVNLAME  95



>ref|XP_009590867.1| PREDICTED: protein LOL1 isoform X3 [Nicotiana tomentosiformis]
Length=102

 Score =   105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/77 (91%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NG QSQLVCS CRNLL+YPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGTQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALE  517
            ATSVQCSCCHT+NLA+E
Sbjct  80   ATSVQCSCCHTVNLAME  96



>ref|XP_001765348.1| predicted protein [Physcomitrella patens]
 gb|EDQ69811.1| predicted protein, partial [Physcomitrella patens]
Length=170

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  302  QLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATSVQ  481
            QL+CS CR LL+YP GA++V CA+CS+VT VPP GTEMAQL+CGGC TLLMY+RGATSVQ
Sbjct  1    QLICSGCRTLLVYPQGASNVRCALCSSVTQVPPHGTEMAQLVCGGCRTLLMYMRGATSVQ  60

Query  482  CSCCHTINLALEANQVAHVNCG  547
            CSCCHT+NLA+EA QVAH+NCG
Sbjct  61   CSCCHTVNLAMEAPQVAHINCG  82



>ref|XP_007155769.1| hypothetical protein PHAVU_003G230100g [Phaseolus vulgaris]
 gb|ESW27763.1| hypothetical protein PHAVU_003G230100g [Phaseolus vulgaris]
Length=136

 Score =   105 bits (263),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            NGAQSQLVCS CRNLLMYP GATSVCCAVC+AVT VPPPGTEMAQL+CGGCHTLLMYIRG
Sbjct  20   NGAQSQLVCSGCRNLLMYPAGATSVCCAVCNAVTGVPPPGTEMAQLVCGGCHTLLMYIRG  79

Query  467  ATSVQCSCCHTINLALEA  520
            AT+VQCSCCHT+NLALE 
Sbjct  80   ATNVQCSCCHTVNLALEG  97



>gb|AAG51243.1|AC055769_2 zinc-finger protein, putative; 7043-7771 [Arabidopsis thaliana]
Length=110

 Score =   103 bits (258),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 73/74 (99%), Gaps = 0/74 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CRNLLMYPVGATSVCCAVC+AVTAVPPPGTEMAQL+CGGCHTLLMYIRGATS
Sbjct  32   QSQLVCSGCRNLLMYPVGATSVCCAVCNAVTAVPPPGTEMAQLVCGGCHTLLMYIRGATS  91

Query  476  VQCSCCHTINLALE  517
            VQCSCCHT+NLALE
Sbjct  92   VQCSCCHTVNLALE  105



>ref|XP_009385724.1| PREDICTED: protein LSD1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009385725.1| PREDICTED: protein LSD1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=150

 Score =   105 bits (261),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 75/94 (80%), Gaps = 7/94 (7%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtav-------pppGTEMAQLICGGCHT  445
            N  QSQ+VC  CRNLL+YP GATSVCCAVCSAVT V          GTEMAQLICG CHT
Sbjct  19   NSGQSQVVCCGCRNLLIYPGGATSVCCAVCSAVTTVPPPGFLEFSAGTEMAQLICGSCHT  78

Query  446  LLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            LLMY+RGA+ VQCSCCHT+NLA EANQVAHVNCG
Sbjct  79   LLMYVRGASRVQCSCCHTVNLAPEANQVAHVNCG  112



>emb|CDY68066.1| BnaC05g51440D, partial [Brassica napus]
Length=141

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/78 (88%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
             G QSQLVCS CRNLLMYPVGA+SVCCAVC+AVTAVPPPGTEMA+L+CGGCHTLLMYIRG
Sbjct  30   TGGQSQLVCSGCRNLLMYPVGASSVCCAVCNAVTAVPPPGTEMARLVCGGCHTLLMYIRG  89

Query  467  ATSVQCSCCHTINLALEA  520
            ATSVQCSCCHT+NLALE 
Sbjct  90   ATSVQCSCCHTVNLALEG  107



>ref|XP_001753847.1| predicted protein [Physcomitrella patens]
 gb|EDQ81169.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +2

Query  305  LVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATSVQC  484
            L+CS CR LL+YP GA++V CA+CS+VT VP  GTEMAQL+CGGC TLLMY+RGATSVQC
Sbjct  11   LICSGCRTLLVYPQGASNVRCALCSSVTQVPSHGTEMAQLVCGGCRTLLMYMRGATSVQC  70

Query  485  SCCHTINLALEANQVAHVNCG  547
            SCCHT+NLA+EA QVAH+NCG
Sbjct  71   SCCHTVNLAMEAPQVAHINCG  91



>ref|XP_008439499.1| PREDICTED: protein LSD1 [Cucumis melo]
 ref|XP_008439500.1| PREDICTED: protein LSD1 [Cucumis melo]
 gb|KGN49498.1| hypothetical protein Csa_6G526320 [Cucumis sativus]
Length=171

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ VT+VPPPGT+MAQLICGGC TLLMY RGATS
Sbjct  2    QSQLVCSGCRSILLYPGGATNVCCALCNTVTSVPPPGTDMAQLICGGCRTLLMYARGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA   NQVAHVNCG
Sbjct  62   VRCSCCHTVNLAPATNQVAHVNCG  85



>ref|XP_010098492.1| hypothetical protein L484_025928 [Morus notabilis]
 gb|EXB75152.1| hypothetical protein L484_025928 [Morus notabilis]
Length=189

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C++VT+VPPPG EMAQLICGGC TLLMY RGATS
Sbjct  2    QSQLVCSGCRSILLYPRGATNVCCALCNSVTSVPPPGMEMAQLICGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA   NQVAHVNCG
Sbjct  62   VRCSCCHTVNLAPGPNQVAHVNCG  85



>gb|ABK24017.1| unknown [Picea sitchensis]
 gb|ACN41207.1| unknown [Picea sitchensis]
Length=243

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            Q QLVC+ CR LL+YP GA +VCCAVC+AVTAVPPPGTEMAQLICG C TLLMY+RGATS
Sbjct  69   QGQLVCNGCRTLLVYPQGAPNVCCAVCNAVTAVPPPGTEMAQLICGHCRTLLMYVRGATS  128

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            VQCSCC T+NLA+EANQVAHVNCG
Sbjct  129  VQCSCCTTVNLAMEANQVAHVNCG  152



>ref|XP_009362159.1| PREDICTED: protein LSD1-like isoform X2 [Pyrus x bretschneideri]
Length=173

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ +T VP PGTEMAQLICGGC TLLM+ RGATS
Sbjct  2    QSQLVCSGCRSILLYPRGATNVCCALCNTITPVPAPGTEMAQLICGGCRTLLMHTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  ++QVAH+NCG
Sbjct  62   VRCSCCHTVNLAPASSQVAHINCG  85



>ref|XP_009362158.1| PREDICTED: protein LSD1-like isoform X1 [Pyrus x bretschneideri]
Length=180

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ +T VP PGTEMAQLICGGC TLLM+ RGATS
Sbjct  9    QSQLVCSGCRSILLYPRGATNVCCALCNTITPVPAPGTEMAQLICGGCRTLLMHTRGATS  68

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  ++QVAH+NCG
Sbjct  69   VRCSCCHTVNLAPASSQVAHINCG  92



>ref|XP_010919878.1| PREDICTED: protein LSD1-like isoform X2 [Elaeis guineensis]
Length=139

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 82/105 (78%), Gaps = 4/105 (4%)
 Frame = +2

Query  221  MPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpp  400
            MPVPL PY   P P        NG+QSQ+VCS CRNLL+YP+GATSVCCAVC+AVT VP 
Sbjct  1    MPVPLIPYAAPPVPFTPP----NGSQSQIVCSGCRNLLLYPLGATSVCCAVCNAVTVVPS  56

Query  401  pGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAH  535
            PGTEMA+L+CGGCH LLM++ GA SVQCSCCHTINLALE    +H
Sbjct  57   PGTEMARLVCGGCHMLLMHMHGAYSVQCSCCHTINLALEGVMKSH  101



>ref|XP_007212162.1| hypothetical protein PRUPE_ppa012421mg [Prunus persica]
 ref|XP_007212163.1| hypothetical protein PRUPE_ppa012421mg [Prunus persica]
 gb|EMJ13361.1| hypothetical protein PRUPE_ppa012421mg [Prunus persica]
 gb|EMJ13362.1| hypothetical protein PRUPE_ppa012421mg [Prunus persica]
Length=170

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ +T VPPPGTEMAQLICGGC TLLM+ RGATS
Sbjct  2    QSQLVCSGCRSILLYPRGATNVCCALCNIITPVPPPGTEMAQLICGGCRTLLMHTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  ++QVAHVNCG
Sbjct  62   VRCSCCHTVNLAPASSQVAHVNCG  85



>ref|XP_008388274.1| PREDICTED: protein LSD1-like [Malus domestica]
Length=179

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ +T VP PGTEMAQLICGGC TLLM+ RGATS
Sbjct  2    QSQLVCSGCRSVLLYPRGATNVCCALCNTITPVPAPGTEMAQLICGGCRTLLMHTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  ++QVAH+NCG
Sbjct  62   VRCSCCHTVNLAPASSQVAHINCG  85



>ref|XP_008225697.1| PREDICTED: protein LSD1 [Prunus mume]
Length=176

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ +T VPPPGTEMAQLICGGC TLLM+ RGATS
Sbjct  2    QSQLVCSGCRSILLYPRGATNVCCALCNIITPVPPPGTEMAQLICGGCRTLLMHTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  ++QVAHVNCG
Sbjct  62   VRCSCCHTVNLAPASSQVAHVNCG  85



>ref|XP_004134888.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
2-like [Cucumis sativus]
Length=410

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ VT+VPPPGT+MAQLICGGC TLLMY RGATS
Sbjct  237  QSQLVCSGCRSILLYPGGATNVCCALCNTVTSVPPPGTDMAQLICGGCRTLLMYARGATS  296

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA   NQVAHVNCG
Sbjct  297  VRCSCCHTVNLAPATNQVAHVNCG  320



>ref|XP_009353887.1| PREDICTED: protein LSD1 [Pyrus x bretschneideri]
 ref|XP_009353888.1| PREDICTED: protein LSD1 [Pyrus x bretschneideri]
Length=170

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ +T VPPPGTEMAQLICGGC TLLM+ RGATS
Sbjct  2    QSQLVCSGCRSVLLYPRGATNVCCALCNIITPVPPPGTEMAQLICGGCRTLLMHTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  ++QVAH+NCG
Sbjct  62   VRCSCCHTVNLAPASSQVAHINCG  85



>ref|XP_004158699.1| PREDICTED: protein LOL3-like [Cucumis sativus]
Length=343

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ VT+VPPPGT+MAQLICGGC TLLMY RGATS
Sbjct  170  QSQLVCSGCRSILLYPGGATNVCCALCNTVTSVPPPGTDMAQLICGGCRTLLMYARGATS  229

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA   NQVAHVNCG
Sbjct  230  VRCSCCHTVNLAPATNQVAHVNCG  253



>ref|XP_007022938.1| LSD1 zinc finger family protein isoform 1 [Theobroma cacao]
 gb|EOY25560.1| LSD1 zinc finger family protein isoform 1 [Theobroma cacao]
Length=170

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GA +VCCA+C+ VT VPPPG +MAQLICGGC TLLMY RGATS
Sbjct  2    QSQLVCSGCRSILLYPRGAANVCCALCNTVTQVPPPGNDMAQLICGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHTIN A  +NQ+AH+NCG
Sbjct  62   VRCSCCHTINFAQASNQIAHINCG  85



>ref|XP_011460430.1| PREDICTED: protein LSD1 [Fragaria vesca subsp. vesca]
Length=165

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GA++VCCA+C+ +T VPPPGTEMAQLICGGC TLLM+  GATS
Sbjct  2    QSQLVCSGCRSILLYPRGASNVCCALCNIITPVPPPGTEMAQLICGGCRTLLMHTSGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  ANQ AH+NCG
Sbjct  62   VRCSCCHTVNLAPAANQFAHINCG  85



>gb|EYU37301.1| hypothetical protein MIMGU_mgv1a014848mg [Erythranthe guttata]
Length=176

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VCS CR+LLMYP GAT+VCCAVCSAVTA+PPPG EMAQLICGGC TLLMY RGA S
Sbjct  2    QSQVVCSGCRSLLMYPSGATNVCCAVCSAVTAIPPPGMEMAQLICGGCRTLLMYTRGAAS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA   N +AH+NCG
Sbjct  62   VRCSCCHTVNLAPAPNNIAHINCG  85



>ref|XP_008349140.1| PREDICTED: protein LSD1-like [Malus domestica]
Length=177

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ +T VPPPGTEMAQLICGGC TLLM+ RGATS
Sbjct  9    QSQLVCSGCRSILLYPRGATNVCCALCNIITPVPPPGTEMAQLICGGCRTLLMHTRGATS  68

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+C+CCHT+NLA  ++QVAH+NCG
Sbjct  69   VRCACCHTVNLAPASSQVAHINCG  92



>ref|XP_008383355.1| PREDICTED: protein LSD1-like [Malus domestica]
Length=170

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ +T VPPPGTEMAQLICGGC TLLM+ RGATS
Sbjct  2    QSQLVCSGCRSILLYPRGATNVCCALCNIITPVPPPGTEMAQLICGGCRTLLMHTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+C+CCHT+NLA  ++QVAH+NCG
Sbjct  62   VRCACCHTVNLAPASSQVAHINCG  85



>ref|XP_009785779.1| PREDICTED: protein LSD1-like, partial [Nicotiana sylvestris]
Length=87

 Score = 97.8 bits (242),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  404  GTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            GTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  2    GTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  49



>dbj|BAF93195.1| putative LSD1 like 1 [Hordeum vulgare]
Length=103

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +2

Query  404  GTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            GTEMAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  18   GTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  65



>ref|XP_008392322.1| PREDICTED: protein LSD1 [Malus domestica]
Length=306

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ +T VP PGTEMAQLICGGC TLLM+ RGATS
Sbjct  2    QSQLVCSGCRSVLLYPRGATNVCCALCNTITPVPAPGTEMAQLICGGCRTLLMHTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  ++QVAH+NCG
Sbjct  62   VRCSCCHTVNLAPASSQVAHINCG  85



>ref|XP_008804686.1| PREDICTED: protein LSD1-like [Phoenix dactylifera]
 ref|XP_008804687.1| PREDICTED: protein LSD1-like [Phoenix dactylifera]
Length=173

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CRNLL+YP GAT+VCCA+C+ +T+VPPPG EM+QL+CGGC TLLMY RGA  
Sbjct  2    QSQLVCNGCRNLLLYPRGATNVCCAICNTITSVPPPGMEMSQLVCGGCRTLLMYTRGANG  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+C+CC+TINLA  ANQVAHVNCG
Sbjct  62   VRCACCNTINLARSANQVAHVNCG  85



>ref|XP_011069944.1| PREDICTED: protein LSD1-like [Sesamum indicum]
Length=175

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 1/84 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VCS CR+LLMYP GA++VCCA+C+A+T VPPPG EMAQLICGGC TLLMY RGATS
Sbjct  2    QSQIVCSGCRSLLMYPSGASNVCCALCNAITTVPPPGMEMAQLICGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA   N +AHVNCG
Sbjct  62   VRCSCCHTVNLAPAPN-IAHVNCG  84



>gb|KDP34884.1| hypothetical protein JCGZ_09172 [Jatropha curcas]
Length=174

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQL CS CR++L+YP GA +VCCA+C+ VT+VPP G EMAQLICGGC TLLMY RGATS
Sbjct  2    QSQLQCSGCRSILLYPRGAANVCCALCNTVTSVPPIGMEMAQLICGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  + QVAH+NCG
Sbjct  62   VRCSCCHTVNLAPASGQVAHINCG  85



>ref|XP_006448805.1| hypothetical protein CICLE_v10016959mg [Citrus clementina]
 ref|XP_006448806.1| hypothetical protein CICLE_v10016959mg [Citrus clementina]
 gb|ESR62045.1| hypothetical protein CICLE_v10016959mg [Citrus clementina]
 gb|ESR62046.1| hypothetical protein CICLE_v10016959mg [Citrus clementina]
Length=170

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ +T+VP PG EMAQLICGGC TLLMY RGATS
Sbjct  2    QSQLVCSGCRSVLLYPRGATNVCCALCNTITSVPIPGMEMAQLICGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA   NQ AHV CG
Sbjct  62   VRCSCCHTVNLAPAPNQFAHVICG  85



>gb|KDO77549.1| hypothetical protein CISIN_1g026941mg [Citrus sinensis]
Length=230

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            G QSQLVCS CR++L+YP GAT+VCCA+C+ +T+VP PG EMAQLICGGC TLLMY RGA
Sbjct  60   GMQSQLVCSGCRSVLLYPRGATNVCCALCNTITSVPIPGMEMAQLICGGCRTLLMYTRGA  119

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
            TSV+CSCCHT+NLA   NQ AH+ CG
Sbjct  120  TSVRCSCCHTVNLAPAPNQFAHIICG  145



>ref|XP_006468386.1| PREDICTED: protein LSD1-like isoform X1 [Citrus sinensis]
 ref|XP_006468387.1| PREDICTED: protein LSD1-like isoform X2 [Citrus sinensis]
Length=170

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR++L+YP GAT+VCCA+C+ +T+VP PG EMAQLICGGC TLLMY RGATS
Sbjct  2    QSQLVCSGCRSVLLYPRGATNVCCALCNTITSVPIPGMEMAQLICGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA   NQ AH+ CG
Sbjct  62   VRCSCCHTVNLAPAPNQFAHIICG  85



>ref|XP_008796329.1| PREDICTED: protein LOL1-like [Phoenix dactylifera]
Length=145

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            G+ S +VC  C+N+L+ P GATSVCCAVC+AVTAVP PGTEMAQL+CGGC TLLMY+RGA
Sbjct  33   GSHSHIVCLGCQNVLLCPPGATSVCCAVCNAVTAVPLPGTEMAQLVCGGCRTLLMYMRGA  92

Query  470  TSVQCSCCHTINLALEANQVAHVNC  544
            + VQCSCCHTINLALEANQVA VNC
Sbjct  93   SGVQCSCCHTINLALEANQVAQVNC  117



>ref|XP_007159612.1| hypothetical protein PHAVU_002G252000g [Phaseolus vulgaris]
 gb|ESW31606.1| hypothetical protein PHAVU_002G252000g [Phaseolus vulgaris]
Length=174

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CR+LL+YP GAT+VCCA+C+ +T+VPPPG EM+QL CGGC TLLMY RGATS
Sbjct  2    QSQLVCNGCRSLLLYPRGATNVCCALCNTITSVPPPGMEMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NL   +NQVAHV+CG
Sbjct  62   VRCSCCHTVNLVPASNQVAHVHCG  85



>ref|XP_006836398.1| hypothetical protein AMTR_s00092p00140740 [Amborella trichopoda]
 gb|ERM99251.1| hypothetical protein AMTR_s00092p00140740 [Amborella trichopoda]
Length=175

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR+ L+YP GAT+VCCAVC+ +T  PPPG EMAQLICGGC  LLMY RGA+S
Sbjct  2    QSQLVCSGCRSTLLYPRGATNVCCAVCNTITPAPPPGMEMAQLICGGCRKLLMYTRGASS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHTIN+A EA  VAHV+CG
Sbjct  62   VRCSCCHTINIAREAYPVAHVSCG  85



>ref|XP_007159613.1| hypothetical protein PHAVU_002G252000g [Phaseolus vulgaris]
 gb|ESW31607.1| hypothetical protein PHAVU_002G252000g [Phaseolus vulgaris]
Length=176

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CR+LL+YP GAT+VCCA+C+ +T+VPPPG EM+QL CGGC TLLMY RGATS
Sbjct  2    QSQLVCNGCRSLLLYPRGATNVCCALCNTITSVPPPGMEMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NL   +NQVAHV+CG
Sbjct  62   VRCSCCHTVNLVPASNQVAHVHCG  85



>ref|XP_010904647.1| PREDICTED: protein LOL3-like isoform X1 [Elaeis guineensis]
Length=173

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CR++L+YP GAT++CCAVC+ +T+VPPP  EM+QL+CGGC TLLMY RGATS
Sbjct  2    QSQLVCNGCRSVLLYPRGATNICCAVCNTITSVPPPAMEMSQLVCGGCRTLLMYSRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC+TINLA  ANQVAHVNC 
Sbjct  62   VRCSCCNTINLARSANQVAHVNCD  85



>gb|EPS60735.1| hypothetical protein M569_14067, partial [Genlisea aurea]
Length=112

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VCS CR+LLMYP GAT+VCCA+CS+VT VPPPG EMAQLICGGC TLLMY R A S
Sbjct  2    QSQIVCSGCRSLLMYPSGATNVCCALCSSVTTVPPPGMEMAQLICGGCRTLLMYTRAAAS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  AN +AH+NCG
Sbjct  62   VRCSCCHTVNLAPAAN-IAHINCG  84



>ref|XP_008776040.1| PREDICTED: protein LOL2-like [Phoenix dactylifera]
 ref|XP_008776041.1| PREDICTED: protein LOL2-like [Phoenix dactylifera]
Length=173

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC+ CRN+L+YP GAT++CCA+CS VT+VPPPG E++QL+CGGC TLLMY  GAT+
Sbjct  2    QSQVVCNGCRNVLLYPRGATNICCAICSTVTSVPPPGMEISQLVCGGCRTLLMYTHGATN  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC+TINLA  ANQVAHVNCG
Sbjct  62   VRCSCCNTINLARSANQVAHVNCG  85



>gb|AFK40862.1| unknown [Medicago truncatula]
Length=176

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CRN L+YP GAT+VCCA+C+ +TAVPPPG +M+QL CGGC TLLMY RGATS
Sbjct  2    QSQLVCNGCRNTLLYPRGATNVCCALCNTITAVPPPGMDMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  +NQVAHV CG
Sbjct  62   VRCSCCHTVNLAPVSNQVAHVPCG  85



>gb|ACJ86028.1| unknown [Medicago truncatula]
 gb|AFK46290.1| unknown [Medicago truncatula]
Length=176

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CRN L+YP GAT+VCCA+C+ +TAVPPPG +M+QL CGGC TLLMY RGATS
Sbjct  2    QSQLVCNGCRNTLLYPRGATNVCCALCNTITAVPPPGMDMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  +NQVAHV CG
Sbjct  62   VRCSCCHTVNLAPVSNQVAHVPCG  85



>gb|AET04490.2| LSD1-type zinc finger protein [Medicago truncatula]
Length=176

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CRN L+YP GAT+VCCA+C+ +TAVPPPG +M+QL CGGC TLLMY RGATS
Sbjct  2    QSQLVCNGCRNTLLYPRGATNVCCALCNTITAVPPPGMDMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  +NQVAHV CG
Sbjct  62   VRCSCCHTVNLAPVSNQVAHVPCG  85



>gb|AFK42285.1| unknown [Medicago truncatula]
Length=178

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CRN L+YP GAT+VCCA+C+ +TAVPPPG +M+QL CGGC TLLMY RGATS
Sbjct  2    QSQLVCNGCRNTLLYPRGATNVCCALCNTITAVPPPGMDMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  +NQVAHV CG
Sbjct  62   VRCSCCHTVNLAPVSNQVAHVPCG  85



>gb|AET04488.2| LSD1-type zinc finger protein [Medicago truncatula]
Length=189

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CRN L+YP GAT+VCCA+C+ +TAVPPPG +M+QL CGGC TLLMY RGATS
Sbjct  15   QSQLVCNGCRNTLLYPRGATNVCCALCNTITAVPPPGMDMSQLYCGGCRTLLMYTRGATS  74

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  +NQVAHV CG
Sbjct  75   VRCSCCHTVNLAPVSNQVAHVPCG  98



>ref|XP_004148756.1| PREDICTED: protein LSD1-like [Cucumis sativus]
 ref|XP_004164419.1| PREDICTED: protein LSD1-like [Cucumis sativus]
Length=142

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  GAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            G Q+Q++CS C+NLL+YP GATS+CCA+C AVT VP  G  MA+L+C GC+TLLMY RGA
Sbjct  25   GCQNQIMCSGCKNLLIYPAGATSICCALCHAVTPVPTSGLTMARLVCSGCYTLLMYSRGA  84

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
             SVQCSCC TIN A EANQ+AH+NCG
Sbjct  85   KSVQCSCCRTINAASEANQMAHINCG  110



>ref|XP_006363645.1| PREDICTED: protein LSD1-like isoform X1 [Solanum tuberosum]
Length=175

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR +L+YP GAT+VCCAVC+A+T VPPPG EMAQLICGGC TLLM+ RGATS
Sbjct  2    QSQLVCSGCRTILLYPRGATNVCCAVCNALTPVPPPGMEMAQLICGGCRTLLMHPRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+C+CCHT+NL    NQ AHVNCG
Sbjct  62   VRCACCHTVNLVPGPNQFAHVNCG  85



>ref|XP_009783613.1| PREDICTED: protein LOL2-like isoform X1 [Nicotiana sylvestris]
Length=175

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR +L+YP GAT+VCCAVC+A+T VPPPG EMAQLICGGC TLLM+ RGATS
Sbjct  2    QSQLVCSGCRTILLYPRGATNVCCAVCNALTPVPPPGMEMAQLICGGCRTLLMHPRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+C+CCHT+NL    NQ AHVNCG
Sbjct  62   VRCACCHTVNLVPGPNQFAHVNCG  85



>emb|CDX73255.1| BnaC05g28510D [Brassica napus]
Length=92

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +2

Query  413  MAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            MAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLALEANQVAHVNCG
Sbjct  1    MAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLALEANQVAHVNCG  45



>gb|ADM52200.1| zinc finger protein LSD1 [Pisum sativum]
Length=176

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CRN+L+YP GAT+VCCA+C+ ++ VPPPG +M+QL CGGC TLLMY RGATS
Sbjct  2    QSQLVCNGCRNMLLYPRGATNVCCALCNTISPVPPPGMDMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  +NQVAHV C 
Sbjct  62   VRCSCCHTVNLAPVSNQVAHVPCA  85



>ref|XP_003630012.1| Lsd1-like protein [Medicago truncatula]
Length=211

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CRN L+YP GAT+VCCA+C+ +TAVPPPG +M+QL CGGC TLLMY RGATS
Sbjct  37   QSQLVCNGCRNTLLYPRGATNVCCALCNTITAVPPPGMDMSQLYCGGCRTLLMYTRGATS  96

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  +NQVAHV CG
Sbjct  97   VRCSCCHTVNLAPVSNQVAHVPCG  120



>ref|XP_010655864.1| PREDICTED: protein LSD1 [Vitis vinifera]
Length=171

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QS L+C+ CR++L+YP GAT+VCCA+C++VT+VPPPG EMAQLICGGC TLLMY RGATS
Sbjct  2    QSHLMCNGCRSILVYPRGATNVCCALCNSVTSVPPPGLEMAQLICGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLA-LEANQVAHVNCG  547
            V+CSCCHT+NLA   +NQVAHVNCG
Sbjct  62   VRCSCCHTVNLAPAPSNQVAHVNCG  86



>gb|KJB69103.1| hypothetical protein B456_011G005300 [Gossypium raimondii]
 gb|KJB69104.1| hypothetical protein B456_011G005300 [Gossypium raimondii]
Length=170

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VCS CR+ L+YP GAT+VCCA+C+ VT VP PG +M QLICGGC TLLMY RG TS
Sbjct  2    QSQIVCSGCRSNLLYPRGATNVCCALCNTVTQVPLPGMDMGQLICGGCRTLLMYARGGTS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA   NQ+AH+NCG
Sbjct  62   VRCSCCHTLNLAPAPNQIAHINCG  85



>gb|KJB69105.1| hypothetical protein B456_011G005300 [Gossypium raimondii]
Length=174

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VCS CR+ L+YP GAT+VCCA+C+ VT VP PG +M QLICGGC TLLMY RG TS
Sbjct  6    QSQIVCSGCRSNLLYPRGATNVCCALCNTVTQVPLPGMDMGQLICGGCRTLLMYARGGTS  65

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA   NQ+AH+NCG
Sbjct  66   VRCSCCHTLNLAPAPNQIAHINCG  89



>ref|XP_003630013.1| Lsd1-like protein [Medicago truncatula]
 gb|AET04489.1| LSD1-type zinc finger protein [Medicago truncatula]
Length=223

 Score = 95.9 bits (237),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CRN L+YP GAT+VCCA+C+ +TAVPPPG +M+QL CGGC TLLMY RGATS
Sbjct  49   QSQLVCNGCRNTLLYPRGATNVCCALCNTITAVPPPGMDMSQLYCGGCRTLLMYTRGATS  108

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  +NQVAHV CG
Sbjct  109  VRCSCCHTVNLAPVSNQVAHVPCG  132



>ref|XP_010906718.1| PREDICTED: protein LSD1-like [Elaeis guineensis]
Length=173

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CR+LL+YP GAT+V CA+C+ VT+VPPPG EM+QL+CGGC TLLMY RGA  
Sbjct  2    QSQLVCNGCRSLLLYPRGATNVRCAICNTVTSVPPPGMEMSQLVCGGCRTLLMYTRGANG  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+C+CC+TINLA  ANQV+HV+CG
Sbjct  62   VRCACCNTINLAQSANQVSHVSCG  85



>gb|ACN33908.1| unknown [Zea mays]
Length=136

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +2

Query  413  MAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            MAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  1    MAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  45



>emb|CBI39012.3| unnamed protein product [Vitis vinifera]
Length=259

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            +  QS L+C+ CR++L+YP GAT+VCCA+C++VT+VPPPG EMAQLICGGC TLLMY RG
Sbjct  87   SAMQSHLMCNGCRSILVYPRGATNVCCALCNSVTSVPPPGLEMAQLICGGCRTLLMYTRG  146

Query  467  ATSVQCSCCHTINLA-LEANQVAHVNCG  547
            ATSV+CSCCHT+NLA   +NQVAHVNCG
Sbjct  147  ATSVRCSCCHTVNLAPAPSNQVAHVNCG  174



>gb|AFW61167.1| hypothetical protein ZEAMMB73_950191 [Zea mays]
Length=83

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +2

Query  413  MAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            MAQL+CGGCHTLLMYIRGATSVQCSCCHT+NLA+EANQVAHVNCG
Sbjct  1    MAQLVCGGCHTLLMYIRGATSVQCSCCHTVNLAMEANQVAHVNCG  45



>gb|EPS73579.1| hypothetical protein M569_01179, partial [Genlisea aurea]
Length=171

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 69/84 (82%), Gaps = 2/84 (2%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VCS CR+LLMYP GAT+V CA+CS VT  PPPG EMAQLICGGC TLLMY RGA S
Sbjct  2    QSQIVCSGCRSLLMYPSGATNVRCALCSGVTTAPPPGMEMAQLICGGCRTLLMYPRGAAS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NL   +  +AH+NCG
Sbjct  62   VRCSCCHTVNLPPAS--IAHINCG  83



>gb|KHG09798.1| Protein LSD1 -like protein [Gossypium arboreum]
Length=169

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 69/84 (82%), Gaps = 3/84 (4%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQL+CS CR++L+YP GATSVCCA+C+ +T     G EMAQLICGGC TLLMY RGA S
Sbjct  2    QSQLICSGCRSILLYPRGATSVCCALCNTITPP---GMEMAQLICGGCRTLLMYTRGAAS  58

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            ++CSCCHTIN+A  +NQ++H+ CG
Sbjct  59   IRCSCCHTINVAPASNQISHITCG  82



>ref|XP_009627143.1| PREDICTED: protein LOL1-like [Nicotiana tomentosiformis]
 ref|XP_009627144.1| PREDICTED: protein LOL1-like [Nicotiana tomentosiformis]
Length=124

 Score = 91.3 bits (225),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQL+CS CR +L+YP GA++VCCAVC+A+T+VPPPG EMAQLICGGC TLLM+ RGA+S
Sbjct  2    QSQLMCSGCRTILLYPRGASNVCCAVCNALTSVPPPGMEMAQLICGGCRTLLMHPRGASS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NL    NQ AHV+CG
Sbjct  62   VRCSCCHTVNLVPGPNQFAHVHCG  85



>ref|XP_009408561.1| PREDICTED: protein LOL3-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=179

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            +G Q QLVCS CRN+L+YP GA SVCCA+CS +T VPPPG EMAQLICGGC TLLM++ G
Sbjct  4    SGMQGQLVCSGCRNVLLYPRGAASVCCAICSTITTVPPPGMEMAQLICGGCRTLLMHVHG  63

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            AT+V+CSCC+TIN+    NQVA+V CG
Sbjct  64   ATTVRCSCCNTINITRPVNQVANVRCG  90



>ref|NP_001235545.1| uncharacterized protein LOC100527656 [Glycine max]
 gb|ACU16787.1| unknown [Glycine max]
Length=175

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC+ CR+LL+YP GAT+VCCA+C+ +T+V PPG EM+QL CGGC TLLMY RGATS
Sbjct  2    QSQVVCNGCRSLLLYPRGATNVCCALCNTITSVSPPGMEMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEA-NQVAHVNCG  547
            V+CSCCHT+NL   A NQVAHV+CG
Sbjct  62   VRCSCCHTVNLVPPASNQVAHVHCG  86



>ref|XP_008448703.1| PREDICTED: protein LOL1 isoform X2 [Cucumis melo]
Length=182

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 77/115 (67%), Gaps = 16/115 (14%)
 Frame = +2

Query  203  FFRSTIMPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsa  382
            FF  T MP P                +    Q+Q++CS C+N+L+YP GATS+CCA+C A
Sbjct  45   FFNITKMPFP----------------SVTCCQNQIMCSGCKNMLIYPAGATSICCALCHA  88

Query  383  vtavpppGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            VT VP  G  MA+L+C GC+TLLMY RGATSVQCSCC TIN A +ANQ+AH NCG
Sbjct  89   VTPVPTSGLTMARLVCSGCYTLLMYSRGATSVQCSCCRTINAASKANQMAHTNCG  143



>ref|NP_001241344.1| uncharacterized protein LOC100776394 [Glycine max]
 gb|ACU20909.1| unknown [Glycine max]
 gb|KHN06517.1| Protein LSD1 [Glycine soja]
Length=177

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC+ CR+LL+YP GAT+VCCA+C+ +T+VPPPG EM+QL CGGC TLLMY RGATS
Sbjct  2    QSQVVCNGCRSLLLYPRGATNVCCALCNTITSVPPPGMEMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEA-NQVAHVNCG  547
            V+CSCCHT+NL   A NQVAHV+CG
Sbjct  62   VRCSCCHTVNLVPPASNQVAHVHCG  86



>gb|KHN48116.1| Protein LSD1 [Glycine soja]
Length=175

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC+ CR+LL+YP GAT+VCCA+C+ +T+VPPPG EM+QL CGGC TLLMY RGATS
Sbjct  2    QSQVVCNGCRSLLLYPRGATNVCCALCNTITSVPPPGMEMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEA-NQVAHVNCG  547
            V+CSCCHT+NL   A NQVAHV+CG
Sbjct  62   VRCSCCHTVNLVPPASNQVAHVHCG  86



>ref|XP_006579392.1| PREDICTED: uncharacterized protein LOC100776394 isoform X1 [Glycine 
max]
Length=175

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC+ CR+LL+YP GAT+VCCA+C+ +T+VPPPG EM+QL CGGC TLLMY RGATS
Sbjct  2    QSQVVCNGCRSLLLYPRGATNVCCALCNTITSVPPPGMEMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEA-NQVAHVNCG  547
            V+CSCCHT+NL   A NQVAHV+CG
Sbjct  62   VRCSCCHTVNLVPPASNQVAHVHCG  86



>ref|XP_006584536.1| PREDICTED: uncharacterized protein LOC100527656 isoform X1 [Glycine 
max]
Length=177

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC+ CR+LL+YP GAT+VCCA+C+ +T+VPPPG EM+QL CGGC TLLMY RGATS
Sbjct  2    QSQVVCNGCRSLLLYPRGATNVCCALCNTITSVPPPGMEMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEA-NQVAHVNCG  547
            V+CSCCHT+NL   A NQVAHV+CG
Sbjct  62   VRCSCCHTVNLVPPASNQVAHVHCG  86



>gb|KJB68462.1| hypothetical protein B456_010G246900 [Gossypium raimondii]
 gb|KJB68463.1| hypothetical protein B456_010G246900 [Gossypium raimondii]
 gb|KJB68467.1| hypothetical protein B456_010G246900 [Gossypium raimondii]
 gb|KJB68468.1| hypothetical protein B456_010G246900 [Gossypium raimondii]
Length=169

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 3/84 (4%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQL+C+ CR++L+YP GATSVCCA+C+ +T     G EMAQLICGGC TLLMY RGA S
Sbjct  2    QSQLICTGCRSILLYPRGATSVCCALCNTITPP---GMEMAQLICGGCRTLLMYTRGAAS  58

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            ++CSCCHTIN+A  +NQ++H+ CG
Sbjct  59   IRCSCCHTINVAPASNQISHITCG  82



>gb|KJB68469.1| hypothetical protein B456_010G246900 [Gossypium raimondii]
Length=173

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 3/84 (4%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQL+C+ CR++L+YP GATSVCCA+C+ +T     G EMAQLICGGC TLLMY RGA S
Sbjct  6    QSQLICTGCRSILLYPRGATSVCCALCNTITPP---GMEMAQLICGGCRTLLMYTRGAAS  62

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            ++CSCCHTIN+A  +NQ++H+ CG
Sbjct  63   IRCSCCHTINVAPASNQISHITCG  86



>gb|ACU16283.1| unknown [Glycine max]
Length=179

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC+ CR+LL+YP GAT+VCCA+C+ + +VPPPG EM+QL CGGC TLLMY RGATS
Sbjct  2    QSQVVCNGCRSLLLYPRGATNVCCALCNTIASVPPPGMEMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEA-NQVAHVNCG  547
            V+CSCCHT+NL   A NQVAHV+CG
Sbjct  62   VRCSCCHTVNLVPPASNQVAHVHCG  86



>ref|XP_004488206.1| PREDICTED: protein LSD1-like [Cicer arietinum]
Length=171

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            +S ++CS CRN+L+YP GA++VCCA+C+ +T V PPG EM+QL CGGC TLLMY RGATS
Sbjct  2    RSHIMCSGCRNILLYPRGASNVCCALCNTITPVTPPGMEMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC+TINL  E+NQ++H++CG
Sbjct  62   VRCSCCNTINLVPESNQLSHIHCG  85



>ref|XP_009758570.1| PREDICTED: protein LSD1-like [Nicotiana sylvestris]
 ref|XP_009758571.1| PREDICTED: protein LSD1-like [Nicotiana sylvestris]
Length=170

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQL+CS CR +L+YP GA++VCCAVC+A+T VPPPG EMAQLICGGC TLLM+ RGA+S
Sbjct  2    QSQLMCSGCRTILLYPRGASNVCCAVCNALTPVPPPGMEMAQLICGGCRTLLMHPRGASS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NL    NQ AHV CG
Sbjct  62   VRCSCCHTVNLVPGPNQFAHVYCG  85



>ref|XP_011085606.1| PREDICTED: vacuolar protein sorting-associated protein 2 homolog 
2-like [Sesamum indicum]
Length=403

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 3/87 (3%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CR +L+YP GAT+VCCA+C+ VTAVP  G EMAQLICGGC TLLM+ RGATS
Sbjct  229  QSQLVCNGCRTILLYPSGATNVCCAICNTVTAVPQAGMEMAQLICGGCRTLLMHARGATS  288

Query  476  VQCSCCHTINL---ALEANQVAHVNCG  547
            V+CSCCHT+NL   A   N VAHVNCG
Sbjct  289  VRCSCCHTVNLVPAAAPPNNVAHVNCG  315



>gb|AFK33823.1| unknown [Lotus japonicus]
Length=175

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CR++L+YP GAT+VCCA+C+ +TAVPPPG +M+QL CGGC TLLMY RGA S
Sbjct  2    QSQLVCNGCRSILLYPRGATNVCCALCNTITAVPPPGMDMSQLYCGGCRTLLMYTRGAAS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  ANQVAHV CG
Sbjct  62   VRCSCCHTVNLA-PANQVAHVPCG  84



>ref|XP_011040571.1| PREDICTED: protein LSD1-like [Populus euphratica]
 ref|XP_011040572.1| PREDICTED: protein LSD1-like [Populus euphratica]
 ref|XP_011040573.1| PREDICTED: protein LSD1-like [Populus euphratica]
Length=168

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR+LL+YP GAT+VCCA+CS VT++P PG + AQLIC GC TLLM+ RGAT+
Sbjct  2    QSQVVCRGCRSLLLYPSGATNVCCALCSTVTSIPAPGMDFAQLICRGCRTLLMFARGATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCH +N A   NQVAHVNCG
Sbjct  62   VRCSCCHIVNFAPGPNQVAHVNCG  85



>ref|XP_006353029.1| PREDICTED: protein LSD1-like isoform X1 [Solanum tuberosum]
 ref|XP_006353030.1| PREDICTED: protein LSD1-like isoform X2 [Solanum tuberosum]
Length=174

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQL+CS CR +L+YP GA++VCCAVC+A+T VPPPG EMAQLICGGC TLLM+ RGA S
Sbjct  2    QSQLMCSGCRTMLLYPRGASNVCCAVCNALTPVPPPGMEMAQLICGGCRTLLMHPRGANS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NL    NQ AHV CG
Sbjct  62   VRCSCCHTVNLVPGPNQFAHVYCG  85



>ref|XP_010316974.1| PREDICTED: protein LSD1 [Solanum lycopersicum]
 ref|XP_010316975.1| PREDICTED: protein LSD1 [Solanum lycopersicum]
Length=174

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQL+CS CR +L+YP GA++VCCAVC+A+T VPPPG EMAQLICGGC TLLM+ RGA S
Sbjct  2    QSQLMCSGCRTMLLYPRGASNVCCAVCNALTPVPPPGMEMAQLICGGCRTLLMHPRGANS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NL    NQ AHV CG
Sbjct  62   VRCSCCHTVNLVPGPNQFAHVYCG  85



>ref|XP_009408562.1| PREDICTED: protein LOL3-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=174

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            Q QLVCS CRN+L+YP GA SVCCA+CS +T VPPPG EMAQLICGGC TLLM++ GAT+
Sbjct  2    QGQLVCSGCRNVLLYPRGAASVCCAICSTITTVPPPGMEMAQLICGGCRTLLMHVHGATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC+TIN+    NQVA+V CG
Sbjct  62   VRCSCCNTINITRPVNQVANVRCG  85



>ref|XP_004504166.1| PREDICTED: protein LSD1-like isoform X2 [Cicer arietinum]
Length=176

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC+ CR++L+YP G T+VCCA+C+ +T VPPPG +M+QL CGGC TLLMY RGATS
Sbjct  2    QSQIVCNGCRSMLLYPRGPTNVCCALCNTITPVPPPGMDMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NLA  +NQ AHV CG
Sbjct  62   VRCSCCQTLNLAPASNQAAHVPCG  85



>ref|XP_010030655.1| PREDICTED: protein LSD1 [Eucalyptus grandis]
 gb|KCW88115.1| hypothetical protein EUGRSUZ_A00512 [Eucalyptus grandis]
Length=180

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 6/90 (7%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGats---vccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            QSQLVC+ CR++L+YP GAT+     C   ++V +    G +MAQLICGGC TLLMY RG
Sbjct  2    QSQLVCNGCRSILLYPRGATNVCCALCNTITSVPSPAYVGADMAQLICGGCRTLLMYTRG  61

Query  467  ATSVQCSCCHTINLA---LEANQVAHVNCG  547
            ATSV+CSCCHT+NLA     +NQ AHVNCG
Sbjct  62   ATSVRCSCCHTVNLAPVTPASNQYAHVNCG  91



>ref|XP_002464188.1| hypothetical protein SORBIDRAFT_01g013820 [Sorghum bicolor]
 gb|EER91186.1| hypothetical protein SORBIDRAFT_01g013820 [Sorghum bicolor]
Length=175

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR +L+YP GA+SVCCAVC A+T VPPPG EMAQLICGGC TLLMY R A +
Sbjct  2    QSQIVCHACRTVLLYPRGASSVCCAVCQAITTVPPPGLEMAQLICGGCRTLLMYTRSADT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC+T+NL    N +AHVNCG
Sbjct  62   VRCSCCNTVNLVRPVNNIAHVNCG  85



>gb|KHG16142.1| Protein LOL3 [Gossypium arboreum]
Length=167

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QS++VCSRCRN+L+YP GAT+VCCA+C+ +T VPPPG EMAQL+CGGC TLLMY  GATS
Sbjct  2    QSEVVCSRCRNILLYPRGATNVCCALCNTITQVPPPGMEMAQLVCGGCRTLLMYTCGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC+ IN    +N +AH+NCG
Sbjct  62   VRCSCCNIINHVTASNPMAHINCG  85



>ref|XP_008680836.1| PREDICTED: zinc finger protein LSD2 isoform X1 [Zea mays]
Length=219

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  NGAQSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            +G Q+Q++C  CR LL+YP GA+SVCCAVC A+T VPPPG EMAQLICGGC TLLMY R 
Sbjct  43   DGMQNQIMCHACRTLLLYPRGASSVCCAVCQAITTVPPPGLEMAQLICGGCRTLLMYTRS  102

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            A +V+CSCC+T+NL    N +AHVNCG
Sbjct  103  ADTVRCSCCNTVNLVRPVNNIAHVNCG  129



>emb|CDP03017.1| unnamed protein product [Coffea canephora]
Length=180

 Score = 90.1 bits (222),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 66/89 (74%), Gaps = 6/89 (7%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsv-----ccavcsavtavpppGTEMAQLICGGCHTLLMYI  460
            QSQ+VCS CR++L+YP GAT+V               +PPPG +MAQLICGGC TLLMY 
Sbjct  2    QSQIVCSGCRSVLLYPRGATNVCCAFCNALTPVPPPQLPPPGMDMAQLICGGCRTLLMYT  61

Query  461  RGATSVQCSCCHTINLALEANQVAHVNCG  547
            RGATSV+CSCCHT+NLA  +N VAHVNCG
Sbjct  62   RGATSVRCSCCHTVNLAPVSN-VAHVNCG  89



>ref|XP_002317066.1| LESION SIMULATING DISEASE family protein [Populus trichocarpa]
 gb|EEE97678.1| LESION SIMULATING DISEASE family protein [Populus trichocarpa]
Length=179

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR+LL+YP GAT+VCCA+CS VT++P PG ++AQLIC GC TLLMY RGAT+
Sbjct  2    QSQVVCRGCRSLLLYPSGATNVCCALCSTVTSIPAPGMDLAQLICRGCRTLLMYARGATT  61

Query  476  VQCSCCHTINLA-LEANQVAHVNCG  547
            V+CSCCH +N A +  NQVAHVNCG
Sbjct  62   VRCSCCHIVNFAPVGPNQVAHVNCG  86



>gb|AFK48804.1| unknown [Lotus japonicus]
Length=175

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CR++L+YP GAT+VCCA+C+ +TAVPPPG +M+QL CGGC TLLM+ RGA S
Sbjct  2    QSQLVCNGCRSILLYPRGATNVCCALCNTITAVPPPGMDMSQLYCGGCRTLLMHTRGAAS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCHT+NLA  ANQVAHV CG
Sbjct  62   VRCSCCHTVNLA-PANQVAHVPCG  84



>ref|XP_011096731.1| PREDICTED: protein LSD1 [Sesamum indicum]
Length=176

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 70/87 (80%), Gaps = 3/87 (3%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            Q+QLVC  CR +L+YP GA++VCCA+C+ VT VPP G EMAQLICGGC TLLM+ +GATS
Sbjct  2    QNQLVCGGCRTVLLYPRGASNVCCAICNVVTPVPPAGMEMAQLICGGCRTLLMHAQGATS  61

Query  476  VQCSCCHTINL---ALEANQVAHVNCG  547
            V+CSCCHT+NL   A   N VAHVNCG
Sbjct  62   VRCSCCHTVNLVPAAAPPNNVAHVNCG  88



>ref|NP_001152350.1| zinc finger protein LSD2 precursor [Zea mays]
 gb|ACG47167.1| zinc finger protein LSD2 [Zea mays]
 gb|ACG48604.1| zinc finger protein LSD2 [Zea mays]
 gb|ACN36137.1| unknown [Zea mays]
 tpg|DAA50355.1| TPA: Zinc finger protein LSD2 isoform 1 [Zea mays]
 tpg|DAA50356.1| TPA: Zinc finger protein LSD2 isoform 2 [Zea mays]
Length=175

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            Q+Q++C  CR LL+YP GA+SVCCAVC A+T VPPPG EMAQLICGGC TLLMY R A +
Sbjct  2    QNQIMCHACRTLLLYPRGASSVCCAVCQAITTVPPPGLEMAQLICGGCRTLLMYTRSADT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC+T+NL    N +AHVNCG
Sbjct  62   VRCSCCNTVNLVRPVNNIAHVNCG  85



>ref|XP_010258673.1| PREDICTED: protein LSD1 [Nelumbo nucifera]
Length=173

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CR++L+YP GAT+VCCA+CS VT+VPPPG EMAQLICGGC TLLMY RGATS
Sbjct  2    QSQLVCNGCRSVLLYPRGATNVCCAICSTVTSVPPPGMEMAQLICGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEAN-QVAHVNCG  547
            V+CSCC T NL   A+   AHVNCG
Sbjct  62   VRCSCCQTTNLVRAASPPYAHVNCG  86



>ref|XP_003533828.1| PREDICTED: protein LSD1 isoform X1 [Glycine max]
 gb|KHN41462.1| Protein LSD1 [Glycine soja]
Length=174

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            +SQLVC+ CR++L+YP GAT+VCCA+C+ +T+VPPPG +M+QL CGGC TLLMY RGATS
Sbjct  2    RSQLVCNGCRSILVYPRGATNVCCALCNTITSVPPPGMDMSQLYCGGCTTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAH  535
            V+CSCCHTINL  E+NQV H
Sbjct  62   VRCSCCHTINLVPESNQVIH  81



>ref|XP_004982348.1| PREDICTED: protein LOL3-like [Setaria italica]
Length=175

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            Q+Q+VC  CR +L+YP GA SVCCA+C AVT VPPPG +MAQLICGGC TLLMY R A +
Sbjct  2    QNQIVCHACRTVLLYPRGAPSVCCALCQAVTTVPPPGLDMAQLICGGCRTLLMYTRSADT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC+T+NL    N +AHVNCG
Sbjct  62   VRCSCCNTVNLVRPVNNIAHVNCG  85



>gb|ACB37311.1| LSD1-like protein [Hordeum vulgare subsp. vulgare]
 gb|ACB37314.1| LSD1-like protein [Hordeum vulgare subsp. vulgare]
Length=177

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsv--ccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            QSQ+VC RCR +L YP GA SV             P P  EMAQLICGGC TLLMY R A
Sbjct  2    QSQIVCHRCRRVLAYPSGAPSVCCAMCRAITAVPPPAPAVEMAQLICGGCRTLLMYTRNA  61

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
             +V+CSCC T+NL    N +AHVNCG
Sbjct  62   DTVRCSCCSTVNLVRPVNNIAHVNCG  87



>ref|XP_002529881.1| Charged multivesicular body protein 2b-B, putative [Ricinus communis]
 gb|EEF32484.1| Charged multivesicular body protein 2b-B, putative [Ricinus communis]
Length=405

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            Q Q++C+ CR++L+YP GA +VCCA+CS +TA PPPG EMAQLICGGC TLLM+ RGATS
Sbjct  234  QGQIMCNGCRSILLYPRGAPNVCCALCSTITAAPPPGMEMAQLICGGCRTLLMHTRGATS  293

Query  476  VQCSCCHTINLALEANQVAHVNC  544
            V+CSCCHT+NLA  + Q AH+NC
Sbjct  294  VRCSCCHTVNLAPVSGQAAHINC  316



>ref|XP_006597921.1| PREDICTED: protein LSD1-like isoform X3 [Glycine max]
Length=176

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +2

Query  299  SQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATSV  478
            SQLVC+ CRN+L+YP GAT+VCCA+C+ VT+VPPPG +M+QL CGGC TLLMY RGATSV
Sbjct  3    SQLVCNGCRNILVYPRGATNVCCALCNTVTSVPPPGMDMSQLYCGGCTTLLMYTRGATSV  62

Query  479  QCSCCHTINL--ALEANQVAH  535
            +CSCCHTINL   LE+NQV H
Sbjct  63   RCSCCHTINLVPVLESNQVIH  83



>ref|XP_006597920.1| PREDICTED: protein LSD1-like isoform X2 [Glycine max]
Length=178

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +2

Query  299  SQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATSV  478
            SQLVC+ CRN+L+YP GAT+VCCA+C+ VT+VPPPG +M+QL CGGC TLLMY RGATSV
Sbjct  3    SQLVCNGCRNILVYPRGATNVCCALCNTVTSVPPPGMDMSQLYCGGCTTLLMYTRGATSV  62

Query  479  QCSCCHTINL--ALEANQVAH  535
            +CSCCHTINL   LE+NQV H
Sbjct  63   RCSCCHTINLVPVLESNQVIH  83



>dbj|BAJ85341.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=176

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 60/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccav-csavtavpppGTEMAQLICGGCHTLLMYIRGAT  472
            QSQ+VC RCR +L YP GA SVCCA+  +     PP   EMAQLICGGC TLLMY R A 
Sbjct  2    QSQIVCHRCRRVLAYPSGAPSVCCAMCRAITAVPPPAPVEMAQLICGGCRTLLMYTRNAD  61

Query  473  SVQCSCCHTINLALEANQVAHVNCG  547
            +V+CSCC T+NL    N +AHVNCG
Sbjct  62   TVRCSCCSTVNLVRPVNNIAHVNCG  86



>ref|XP_003546559.1| PREDICTED: protein LSD1-like isoform X1 [Glycine max]
 gb|KHN45568.1| Protein LSD1 [Glycine soja]
Length=176

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +2

Query  299  SQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATSV  478
            SQLVC+ CRN+L+YP GAT+VCCA+C+ VT+VPPPG +M+QL CGGC TLLMY RGATSV
Sbjct  3    SQLVCNGCRNILVYPRGATNVCCALCNTVTSVPPPGMDMSQLYCGGCTTLLMYTRGATSV  62

Query  479  QCSCCHTINL--ALEANQVAH  535
            +CSCCHTINL   LE+NQV H
Sbjct  63   RCSCCHTINLVPVLESNQVIH  83



>gb|EYU19079.1| hypothetical protein MIMGU_mgv1a014809mg [Erythranthe guttata]
Length=176

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 10/94 (11%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR +L YP GAT+VCCA+C+ VTAVPP G EMAQLICGGCHTLLM+ RGAT+
Sbjct  2    QSQIVCGGCRTVLSYPRGATNVCCALCNVVTAVPPAGMEMAQLICGGCHTLLMHARGATT  61

Query  476  VQCSCCHTINLALE----------ANQVAHVNCG  547
            V+CSCCHT+N   +           N VAHVNCG
Sbjct  62   VRCSCCHTVNRVPDIRSATPPPPPPNNVAHVNCG  95



>gb|EMS64940.1| hypothetical protein TRIUR3_03600 [Triticum urartu]
Length=179

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR++L+YP GA SVCCAVC AVT+ PPPG EMAQLIC GC TLLMY R AT+
Sbjct  2    QSQIVCHGCRSVLLYPRGAPSVCCAVCHAVTSAPPPGMEMAQLICVGCRTLLMYTRNATT  61

Query  476  VQCSCCHTINLALEA---NQVAHVNCG  547
            V+CSCC T+NLA  A   N +AHVNCG
Sbjct  62   VRCSCCDTVNLARPAPPVNSIAHVNCG  88



>ref|XP_006597922.1| PREDICTED: protein LSD1-like isoform X4 [Glycine max]
Length=174

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 2/81 (2%)
 Frame = +2

Query  299  SQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATSV  478
            SQLVC+ CRN+L+YP GAT+VCCA+C+ VT+VPPPG +M+QL CGGC TLLMY RGATSV
Sbjct  3    SQLVCNGCRNILVYPRGATNVCCALCNTVTSVPPPGMDMSQLYCGGCTTLLMYTRGATSV  62

Query  479  QCSCCHTINL--ALEANQVAH  535
            +CSCCHTINL   LE+NQV H
Sbjct  63   RCSCCHTINLVPVLESNQVIH  83



>ref|XP_008672226.1| PREDICTED: uncharacterized protein LOC100194364 isoform X1 [Zea 
mays]
 gb|ACG25974.1| 18S subunit ribosomal protein [Zea mays]
 gb|ACR37905.1| unknown [Zea mays]
 tpg|DAA55111.1| TPA: 18S subunit ribosomal protein isoform 1 [Zea mays]
 tpg|DAA55112.1| TPA: 18S subunit ribosomal protein isoform 2 [Zea mays]
Length=178

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR LL YP GA SVCCAVC  VT VPPP  EMA+LICGGC TLLMY R AT+
Sbjct  2    QSQIVCHGCRTLLFYPRGAPSVCCAVCHVVTNVPPPAMEMARLICGGCQTLLMYARSATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NL    + +AHVNCG
Sbjct  62   VRCSCCDTVNLVRPVSSIAHVNCG  85



>gb|EYU19078.1| hypothetical protein MIMGU_mgv1a014809mg [Erythranthe guttata]
Length=177

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 70/95 (74%), Gaps = 11/95 (12%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR +L YP GAT+VCCA+C+ VTAVPP G EMAQLICGGCHTLLM+ RGAT+
Sbjct  2    QSQIVCGGCRTVLSYPRGATNVCCALCNVVTAVPPAGMEMAQLICGGCHTLLMHARGATT  61

Query  476  VQCSCCHTINLALE-----------ANQVAHVNCG  547
            V+CSCCHT+N   +            N VAHVNCG
Sbjct  62   VRCSCCHTVNRVPDIRSAATPPPPPPNNVAHVNCG  96



>gb|ACB37312.1| LSD1-like protein [Hordeum vulgare subsp. vulgare]
 gb|ACB37313.1| LSD1-like protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90788.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=179

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR++L+YP GA SVCCAVC AVT+ PPPG EMAQLIC GC TLLMY R AT+
Sbjct  2    QSQIVCHGCRSVLLYPRGAPSVCCAVCHAVTSAPPPGMEMAQLICVGCRTLLMYTRNATT  61

Query  476  VQCSCCHTINLALEA---NQVAHVNCG  547
            V+CSCC T+NLA  A   N +AHVNCG
Sbjct  62   VRCSCCDTVNLARPAPPVNSIAHVNCG  88



>ref|XP_002443528.1| hypothetical protein SORBIDRAFT_08g021100 [Sorghum bicolor]
 gb|EES17366.1| hypothetical protein SORBIDRAFT_08g021100 [Sorghum bicolor]
Length=177

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR +L+YP GA SVCCAVC AVT VPPP  EMA+LICGGC TLLMY R AT+
Sbjct  2    QSQIVCHGCRTVLLYPRGAPSVCCAVCHAVTNVPPPAIEMARLICGGCQTLLMYTRSATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NL    + +AHVNCG
Sbjct  62   VRCSCCDTVNLVRPVSSIAHVNCG  85



>gb|AFQ31616.1| LOL2 [Triticum aestivum]
Length=179

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 68/87 (78%), Gaps = 3/87 (3%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR++L+YP GA SVCCAVC AVT  PPPG EMAQLIC GC TLLMY R AT+
Sbjct  2    QSQIVCHGCRSVLLYPRGAPSVCCAVCHAVTNAPPPGMEMAQLICVGCRTLLMYTRNATT  61

Query  476  VQCSCCHTINLALEA---NQVAHVNCG  547
            V+CSCC T+NLA  A   N +AHVNCG
Sbjct  62   VRCSCCDTVNLARPAPPVNSIAHVNCG  88



>gb|ACG28611.1| 18S subunit ribosomal protein [Zea mays]
 gb|ACG29783.1| 18S subunit ribosomal protein [Zea mays]
 gb|ACG44638.1| 18S subunit ribosomal protein [Zea mays]
Length=178

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR LL YP GA SVCCAVC  VT VPPP  EMA+LICGGC TLLMY R AT+
Sbjct  2    QSQIVCHGCRTLLFYPRGAPSVCCAVCHVVTNVPPPAMEMARLICGGCQTLLMYARSATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NL    + +AHVNCG
Sbjct  62   VRCSCCDTVNLVRPVSSIAHVNCG  85



>gb|ACR35025.1| unknown [Zea mays]
 tpg|DAA55114.1| TPA: 18S subunit ribosomal protein [Zea mays]
Length=201

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR LL YP GA SVCCAVC  VT VPPP  EMA+LICGGC TLLMY R AT+
Sbjct  25   QSQIVCHGCRTLLFYPRGAPSVCCAVCHVVTNVPPPAMEMARLICGGCQTLLMYARSATT  84

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NL    + +AHVNCG
Sbjct  85   VRCSCCDTVNLVRPVSSIAHVNCG  108



>ref|XP_004963153.1| PREDICTED: protein LOL2-like isoform X3 [Setaria italica]
Length=181

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR LL+YP GA SVCCAVC  V+ VPPPG EMA+LICGGC TLLMY   AT+
Sbjct  2    QSQIVCHGCRRLLLYPRGAPSVCCAVCRVVSNVPPPGMEMARLICGGCQTLLMYTCNATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NL    + +AHVNCG
Sbjct  62   VRCSCCDTVNLVRPVSSIAHVNCG  85



>gb|AFC88835.1| putative zinc finger LOL2 [Miscanthus sinensis]
Length=177

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR +L+YP GA SVCCAVC AVT VPPP  EMA+LICGGC TLLMY R AT+
Sbjct  2    QSQIVCHGCRTVLLYPRGAPSVCCAVCHAVTNVPPPAMEMARLICGGCQTLLMYTRSATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NL    + +AHVNCG
Sbjct  62   VRCSCCDTVNLVRPVSGIAHVNCG  85



>ref|XP_004963155.1| PREDICTED: protein LOL2-like isoform X5 [Setaria italica]
 ref|XP_004963156.1| PREDICTED: protein LOL2-like isoform X6 [Setaria italica]
Length=177

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR LL+YP GA SVCCAVC  V+ VPPPG EMA+LICGGC TLLMY   AT+
Sbjct  2    QSQIVCHGCRRLLLYPRGAPSVCCAVCRVVSNVPPPGMEMARLICGGCQTLLMYTCNATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NL    + +AHVNCG
Sbjct  62   VRCSCCDTVNLVRPVSSIAHVNCG  85



>gb|KJB68464.1| hypothetical protein B456_010G246900 [Gossypium raimondii]
Length=180

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 14/95 (15%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQL+C+ CR++L+YP GATSVCCA+C+ +T     G EMAQLICGGC TLLMY RGA S
Sbjct  2    QSQLICTGCRSILLYPRGATSVCCALCNTITPP---GMEMAQLICGGCRTLLMYTRGAAS  58

Query  476  VQCSCCHTINLA-----------LEANQVAHVNCG  547
            ++CSCCHTIN+A           + +NQ++H+ CG
Sbjct  59   IRCSCCHTINVAPACLLSFSEHGVASNQISHITCG  93



>ref|XP_004963151.1| PREDICTED: protein LOL2-like isoform X1 [Setaria italica]
 ref|XP_004963152.1| PREDICTED: protein LOL2-like isoform X2 [Setaria italica]
Length=183

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR LL+YP GA SVCCAVC  V+ VPPPG EMA+LICGGC TLLMY   AT+
Sbjct  2    QSQIVCHGCRRLLLYPRGAPSVCCAVCRVVSNVPPPGMEMARLICGGCQTLLMYTCNATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NL    + +AHVNCG
Sbjct  62   VRCSCCDTVNLVRPVSSIAHVNCG  85



>ref|XP_004963154.1| PREDICTED: protein LOL2-like isoform X4 [Setaria italica]
Length=179

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR LL+YP GA SVCCAVC  V+ VPPPG EMA+LICGGC TLLMY   AT+
Sbjct  2    QSQIVCHGCRRLLLYPRGAPSVCCAVCRVVSNVPPPGMEMARLICGGCQTLLMYTCNATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NL    + +AHVNCG
Sbjct  62   VRCSCCDTVNLVRPVSSIAHVNCG  85



>gb|AFK38381.1| unknown [Lotus japonicus]
Length=183

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  302  QLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATSVQ  481
            QLVC+ CRN+L+YP GA +VCCA C+ +T VPP G EM+QL CGGC TLLMY  GATSV+
Sbjct  4    QLVCNGCRNILVYPRGAGNVCCAWCNVITPVPPAGMEMSQLYCGGCRTLLMYANGATSVR  63

Query  482  CSCCHTINLALEANQVAHVNCG  547
            CSCC+TI    E+NQV+H++CG
Sbjct  64   CSCCNTITRVPESNQVSHIHCG  85



>ref|XP_003577533.1| PREDICTED: protein LOL2 [Brachypodium distachyon]
Length=179

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 68/87 (78%), Gaps = 3/87 (3%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR++L+YP GA SVCCAVC AVT+ PPPG EMAQLICGGC TLLMY R AT+
Sbjct  2    QSQIVCHGCRSVLLYPRGAPSVCCAVCHAVTSAPPPGMEMAQLICGGCRTLLMYTRNATT  61

Query  476  VQCSCCHTINL---ALEANQVAHVNCG  547
            V+CSCC T+NL       + +AHVNCG
Sbjct  62   VRCSCCDTVNLVRAGPPVSSIAHVNCG  88



>ref|NP_001132871.1| uncharacterized protein LOC100194364 [Zea mays]
 gb|ACF81897.1| unknown [Zea mays]
 tpg|DAA55113.1| TPA: 18S subunit ribosomal protein [Zea mays]
Length=309

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  CR LL YP GA SVCCAVC  VT VPPP  EMA+LICGGC TLLMY R AT+
Sbjct  133  QSQIVCHGCRTLLFYPRGAPSVCCAVCHVVTNVPPPAMEMARLICGGCQTLLMYARSATT  192

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NL    + +AHVNCG
Sbjct  193  VRCSCCDTVNLVRPVSSIAHVNCG  216



>ref|XP_002300492.1| LESION SIMULATING DISEASE family protein [Populus trichocarpa]
 gb|EEE85297.1| LESION SIMULATING DISEASE family protein [Populus trichocarpa]
Length=174

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  C ++L+YP GA++VCCA+CS VT++P PG +MAQLIC GC +LLMY  GAT+
Sbjct  2    QSQVVCRGCASVLLYPSGASNVCCALCSTVTSIPSPGMDMAQLICRGCRSLLMYPHGATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCH +N+A   NQ AHVNCG
Sbjct  62   VRCSCCHVVNIAPGYNQAAHVNCG  85



>ref|XP_011011056.1| PREDICTED: protein LSD1-like isoform X3 [Populus euphratica]
Length=174

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  C ++L+YP GA++VCCA+CS VT++P PG +MAQLIC GC +LLMY  GAT+
Sbjct  2    QSQVVCRGCASVLLYPSGASNVCCALCSTVTSIPSPGMDMAQLICRGCRSLLMYPHGATT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCH +N+A   NQ AHVNCG
Sbjct  62   VRCSCCHVVNVAPGYNQAAHVNCG  85



>ref|XP_011011057.1| PREDICTED: protein LSD1-like isoform X4 [Populus euphratica]
Length=167

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  C ++L+YP GA++VCCA+CS VT++P PG +MAQLIC GC +LLMY  GAT+
Sbjct  19   QSQVVCRGCASVLLYPSGASNVCCALCSTVTSIPSPGMDMAQLICRGCRSLLMYPHGATT  78

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCH +N+A   NQ AHVNCG
Sbjct  79   VRCSCCHVVNVAPGYNQAAHVNCG  102



>ref|XP_011011055.1| PREDICTED: protein LOL2-like isoform X2 [Populus euphratica]
Length=185

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  C ++L+YP GA++VCCA+CS VT++P PG +MAQLIC GC +LLMY  GAT+
Sbjct  19   QSQVVCRGCASVLLYPSGASNVCCALCSTVTSIPSPGMDMAQLICRGCRSLLMYPHGATT  78

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCH +N+A   NQ AHVNCG
Sbjct  79   VRCSCCHVVNVAPGYNQAAHVNCG  102



>ref|XP_011011054.1| PREDICTED: protein LOL2-like isoform X1 [Populus euphratica]
Length=191

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC  C ++L+YP GA++VCCA+CS VT++P PG +MAQLIC GC +LLMY  GAT+
Sbjct  19   QSQVVCRGCASVLLYPSGASNVCCALCSTVTSIPSPGMDMAQLICRGCRSLLMYPHGATT  78

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCCH +N+A   NQ AHVNCG
Sbjct  79   VRCSCCHVVNVAPGYNQAAHVNCG  102



>ref|NP_001067250.1| Os12g0611000 [Oryza sativa Japonica Group]
 sp|Q2QMB3.1|LOL2_ORYSJ RecName: Full=Protein LOL2; AltName: Full=Protein LSD ONE LIKE 
2; Short=OsLOL2; AltName: Full=Putative zinc finger LOL2 [Oryza 
sativa Japonica Group]
 gb|ABA99369.1| zinc finger protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30269.1| Os12g0611000 [Oryza sativa Japonica Group]
 dbj|BAG99442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53591.1| hypothetical protein OsJ_36836 [Oryza sativa Japonica Group]
Length=172

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccav-csavtavpppGTEMAQLICGGCHTLLMYIRGAT  472
            QSQ+VC  CRN+L+YP GA SVCCAV  +  +  P PG ++A LICGGC TLLMY R AT
Sbjct  2    QSQIVCHGCRNILLYPRGAPSVCCAVCHAVSSTAPSPGMDIAHLICGGCRTLLMYTRNAT  61

Query  473  SVQCSCCHTINLALEANQVAHVNCG  547
            SV+CSCC T+NL    + +AH+NCG
Sbjct  62   SVRCSCCDTVNLVRPVSSIAHLNCG  86



>ref|XP_008448702.1| PREDICTED: protein LOL1 isoform X1 [Cucumis melo]
Length=195

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 77/128 (60%), Gaps = 29/128 (23%)
 Frame = +2

Query  203  FFRSTIMPVPLAPYptapapsplmspapNGAQSQLVCSRCRNLLMYPVGatsvccavcsa  382
            FF  T MP P                +    Q+Q++CS C+N+L+YP GATS+CCA+C A
Sbjct  45   FFNITKMPFP----------------SVTCCQNQIMCSGCKNMLIYPAGATSICCALCHA  88

Query  383  vtavpppGTEMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALE-------------AN  523
            VT VP  G  MA+L+C GC+TLLMY RGATSVQCSCC TIN A +             AN
Sbjct  89   VTPVPTSGLTMARLVCSGCYTLLMYSRGATSVQCSCCRTINAASKESYQIDFELWLQTAN  148

Query  524  QVAHVNCG  547
            Q+AH NCG
Sbjct  149  QMAHTNCG  156



>ref|XP_007022939.1| LSD1 zinc finger family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY25561.1| LSD1 zinc finger family protein isoform 2, partial [Theobroma 
cacao]
Length=137

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  EMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            +MAQLICGGC TLLMY RGATSV+CSCCHTIN A  +NQ+AH+NCG
Sbjct  38   DMAQLICGGCRTLLMYTRGATSVRCSCCHTINFAQASNQIAHINCG  83



>gb|EEC69660.1| hypothetical protein OsI_39080 [Oryza sativa Indica Group]
Length=172

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccav-csavtavpppGTEMAQLICGGCHTLLMYIRGAT  472
            QSQ+VC  CRN+L+YP GA SVCCAV  +  +  P PG ++A LICGGC TLLMY R AT
Sbjct  2    QSQIVCHGCRNILLYPRGAPSVCCAVCHAVSSTAPSPGMDIAHLICGGCRTLLMYTRNAT  61

Query  473  SVQCSCCHTINLALEANQVAHVNCG  547
            SV+CSCC T+NL    + +AH+NCG
Sbjct  62   SVRCSCCDTVNLVRPVSSIAHLNCG  86



>ref|XP_003562028.1| PREDICTED: protein LOL3-like [Brachypodium distachyon]
Length=175

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
             SQ+VC  CR +L YP GA SVCC  C A+T VPPP  EMAQLICGGC TLLMY R A +
Sbjct  2    HSQIVCHGCRRVLCYPSGAPSVCCGACQAITIVPPPALEMAQLICGGCRTLLMYTRNADT  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NL    N +AHVNCG
Sbjct  62   VRCSCCRTVNLVRSVNNIAHVNCG  85



>ref|XP_010538650.1| PREDICTED: protein LSD1-like isoform X5 [Tarenaya hassleriana]
Length=182

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 60/89 (67%), Gaps = 5/89 (6%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvc----cavcsavtavpppGTEMAQLICGGCHTLLMYIR  463
            Q QLVC  CRN+L+YP G+T+VC      +       PP G +MA +ICGGC T+LMY R
Sbjct  2    QDQLVCHGCRNVLLYPRGSTNVCCALCSTINMVPPPHPPRGMDMAHIICGGCRTMLMYTR  61

Query  464  GATSVQCSCCHTINL-ALEANQVAHVNCG  547
            GA SV+CSCC T+NL     NQVAH+NCG
Sbjct  62   GANSVRCSCCQTLNLVPAHTNQVAHINCG  90



>ref|XP_010538649.1| PREDICTED: protein LSD1-like isoform X4 [Tarenaya hassleriana]
Length=185

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 60/89 (67%), Gaps = 5/89 (6%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGat----svccavcsavtavpppGTEMAQLICGGCHTLLMYIR  463
            Q QLVC  CRN+L+YP G+T    ++C  +       PP G +MA +ICGGC T+LMY R
Sbjct  5    QDQLVCHGCRNVLLYPRGSTNVCCALCSTINMVPPPHPPRGMDMAHIICGGCRTMLMYTR  64

Query  464  GATSVQCSCCHTINL-ALEANQVAHVNCG  547
            GA SV+CSCC T+NL     NQVAH+NCG
Sbjct  65   GANSVRCSCCQTLNLVPAHTNQVAHINCG  93



>gb|AFK36417.1| unknown [Medicago truncatula]
Length=173

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 65/87 (75%), Gaps = 3/87 (3%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGats---vccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            +S ++C+ CRN+L+YP GA++     C+  + V  V PPG EM+QL CGGC TLLM+ RG
Sbjct  2    RSHIMCTGCRNILLYPKGASNVCCAVCSTITPVIPVLPPGMEMSQLYCGGCRTLLMHARG  61

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            AT+V+CSCC+TINL  ++NQ+ H+ CG
Sbjct  62   ATTVRCSCCNTINLVPDSNQMNHIRCG  88



>ref|XP_010538646.1| PREDICTED: protein LSD1-like isoform X1 [Tarenaya hassleriana]
Length=188

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGat-------svccavcsavtavpppGTEMAQLICGGCHTLLM  454
            Q QLVC  CRN+L+YP G+T       S    V          G +MA +ICGGC T+LM
Sbjct  5    QDQLVCHGCRNVLLYPRGSTNVCCALCSTINMVPPPHPPRVRAGMDMAHIICGGCRTMLM  64

Query  455  YIRGATSVQCSCCHTINLA-LEANQVAHVNCG  547
            Y RGA SV+CSCC T+NL     NQVAH+NCG
Sbjct  65   YTRGANSVRCSCCQTLNLVPAHTNQVAHINCG  96



>ref|XP_010538648.1| PREDICTED: protein LSD1-like isoform X3 [Tarenaya hassleriana]
Length=185

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGat-------svccavcsavtavpppGTEMAQLICGGCHTLLM  454
            Q QLVC  CRN+L+YP G+T       S    V          G +MA +ICGGC T+LM
Sbjct  2    QDQLVCHGCRNVLLYPRGSTNVCCALCSTINMVPPPHPPRVRAGMDMAHIICGGCRTMLM  61

Query  455  YIRGATSVQCSCCHTINLA-LEANQVAHVNCG  547
            Y RGA SV+CSCC T+NL     NQVAH+NCG
Sbjct  62   YTRGANSVRCSCCQTLNLVPAHTNQVAHINCG  93



>gb|KEH37789.1| LSD1-type zinc finger protein [Medicago truncatula]
Length=173

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 65/87 (75%), Gaps = 3/87 (3%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGats---vccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            +S ++C+ CRN+L+YP GA++     C+  + V  V PPG EM+QL CGGC TLLM+ RG
Sbjct  2    RSHIMCTGCRNILLYPRGASNVCCAVCSTITPVIPVLPPGMEMSQLYCGGCRTLLMHARG  61

Query  467  ATSVQCSCCHTINLALEANQVAHVNCG  547
            AT+V+CSCC+TINL  ++NQ+ H+ CG
Sbjct  62   ATTVRCSCCNTINLVPDSNQMNHIRCG  88



>ref|XP_010687115.1| PREDICTED: protein LSD1 isoform X3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010687116.1| PREDICTED: protein LSD1 isoform X3 [Beta vulgaris subsp. vulgaris]
Length=178

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 64/89 (72%), Gaps = 5/89 (6%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CR +L+YP GA +V CAVC+ VT V  PG EM Q+ICG CHTLLMY RGA S
Sbjct  2    QSQLVCNGCRTILLYPRGAPNVRCAVCNTVTPVQSPGLEMDQIICGCCHTLLMYSRGAAS  61

Query  476  VQCSCCHTINLALE-----ANQVAHVNCG  547
            V+C CCHT+NL        +NQVA V CG
Sbjct  62   VRCLCCHTVNLTSSNPPPVSNQVATVRCG  90



>ref|XP_009597146.1| PREDICTED: protein LOL1-like [Nicotiana tomentosiformis]
Length=128

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVCS CR +L+YP GAT+VCCAVC+A+T VPPPG EMAQLICGGC TLLM+ RGATS
Sbjct  2    QSQLVCSGCRTILLYPRGATNVCCAVCNALTPVPPPGMEMAQLICGGCRTLLMHPRGATS  61

Query  476  VQCSCCHTINL  508
            V+C+CCHT+NL
Sbjct  62   VRCACCHTVNL  72



>ref|XP_010538647.1| PREDICTED: protein LSD1-like isoform X2 [Tarenaya hassleriana]
Length=187

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGat-------svccavcsavtavpppGTEMAQLICGGCHTLLM  454
            Q QLVC  CRN+L+YP G+T       S    V          G +MA +ICGGC T+LM
Sbjct  5    QDQLVCHGCRNVLLYPRGSTNVCCALCSTINMVPPPHPPRVRAGMDMAHIICGGCRTMLM  64

Query  455  YIRGATSVQCSCCHTINLA-LEANQVAHVNCG  547
            Y RGA SV+CSCC T+NL     NQVAH+NCG
Sbjct  65   YTRGANSVRCSCCQTLNLVPAHTNQVAHINCG  96



>ref|XP_009407702.1| PREDICTED: protein LOL2-like [Musa acuminata subsp. malaccensis]
Length=179

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 66/90 (73%), Gaps = 6/90 (7%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGT------EMAQLICGGCHTLLMY  457
            QSQLVC+ CR +L+YP GAT+V CA+C+ +T   P G       EMAQ+IC GC TLLMY
Sbjct  2    QSQLVCNGCRTILLYPRGATNVRCAICNTMTPTLPAGIDMAQQMEMAQIICYGCRTLLMY  61

Query  458  IRGATSVQCSCCHTINLALEANQVAHVNCG  547
              GAT+V+CSCC TIN+A  ANQ A++NCG
Sbjct  62   TSGATNVRCSCCGTINMARPANQNAYLNCG  91



>ref|XP_010687114.1| PREDICTED: protein LSD1 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=203

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 64/89 (72%), Gaps = 5/89 (6%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CR +L+YP GA +V CAVC+ VT V  PG EM Q+ICG CHTLLMY RGA S
Sbjct  27   QSQLVCNGCRTILLYPRGAPNVRCAVCNTVTPVQSPGLEMDQIICGCCHTLLMYSRGAAS  86

Query  476  VQCSCCHTINLALE-----ANQVAHVNCG  547
            V+C CCHT+NL        +NQVA V CG
Sbjct  87   VRCLCCHTVNLTSSNPPPVSNQVATVRCG  115



>ref|XP_010687113.1| PREDICTED: protein LSD1 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=204

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 64/89 (72%), Gaps = 5/89 (6%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQLVC+ CR +L+YP GA +V CAVC+ VT V  PG EM Q+ICG CHTLLMY RGA S
Sbjct  28   QSQLVCNGCRTILLYPRGAPNVRCAVCNTVTPVQSPGLEMDQIICGCCHTLLMYSRGAAS  87

Query  476  VQCSCCHTINLALE-----ANQVAHVNCG  547
            V+C CCHT+NL        +NQVA V CG
Sbjct  88   VRCLCCHTVNLTSSNPPPVSNQVATVRCG  116



>ref|XP_004504165.1| PREDICTED: protein LSD1-like isoform X1 [Cicer arietinum]
Length=171

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 5/84 (6%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QSQ+VC+ CR++L+YP G T+VCCA+C+ +T VPPPG +M+QL CGGC TLLMY RGATS
Sbjct  2    QSQIVCNGCRSMLLYPRGPTNVCCALCNTITPVPPPGMDMSQLYCGGCRTLLMYTRGATS  61

Query  476  VQCSCCHTINLALEANQVAHVNCG  547
            V+CSCC T+NLA      AHV CG
Sbjct  62   VRCSCCQTLNLA-----PAHVPCG  80



>ref|XP_010537299.1| PREDICTED: protein LSD1 isoform X2 [Tarenaya hassleriana]
Length=176

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsv--ccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            Q QLVC  CR++L+YP GAT+V         +   PPPG +MA +ICGGC T+LMY RGA
Sbjct  5    QDQLVCHGCRSILLYPRGATNVCCALCSMINIVPPPPPGVDMAHIICGGCRTMLMYSRGA  64

Query  470  TSVQCSCCHTINL-ALEANQVAHVNCG  547
             SV+CSCC T+NL     NQVAH+NCG
Sbjct  65   NSVRCSCCQTLNLVPAHTNQVAHINCG  91



>ref|XP_009133770.1| PREDICTED: protein LSD1 isoform X3 [Brassica rapa]
Length=190

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 58/97 (60%), Gaps = 13/97 (13%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsv----------ccavcsavtavpppGTEMAQLICGGCHT  445
            Q QLVC  CRN LMYP GAT+V                     P  G +MA ++CGGC T
Sbjct  2    QDQLVCHGCRNTLMYPRGATNVRCALCHIVNMVPLHPHPHPPPPHHGMDMAHIVCGGCRT  61

Query  446  LLMYIRGATSVQCSCCHTINL---ALEANQVAHVNCG  547
            +LMY RGA+SV+CSCC T+NL      +NQVAH+NCG
Sbjct  62   MLMYTRGASSVRCSCCQTVNLVPGPPPSNQVAHINCG  98



>ref|XP_006398067.1| hypothetical protein EUTSA_v10001047mg [Eutrema salsugineum]
 ref|XP_006398068.1| hypothetical protein EUTSA_v10001047mg [Eutrema salsugineum]
 gb|ESQ39520.1| hypothetical protein EUTSA_v10001047mg [Eutrema salsugineum]
 gb|ESQ39521.1| hypothetical protein EUTSA_v10001047mg [Eutrema salsugineum]
Length=177

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 59/88 (67%), Gaps = 4/88 (5%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGats---vccavcsavtavpppGTEMAQLICGGCHTLLMYIRG  466
            Q QLVC  CRN+LMYP GA++     C+  S V    P G +MA +ICGGC  +LMY RG
Sbjct  2    QDQLVCHGCRNVLMYPRGASNVRCALCSTISLVPHSSPQGMDMAHIICGGCGIMLMYTRG  61

Query  467  ATSVQCSCCHTINL-ALEANQVAHVNCG  547
            A+SV+CSCC T+NL     NQ AH+NCG
Sbjct  62   ASSVRCSCCQTLNLVPAPPNQTAHINCG  89



>ref|XP_010537276.1| PREDICTED: protein LSD1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537282.1| PREDICTED: protein LSD1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537289.1| PREDICTED: protein LSD1 isoform X1 [Tarenaya hassleriana]
Length=176

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsv-----ccavcsavtavpppGTEMAQLICGGCHTLLMYI  460
            Q QLVC  CR++L+YP GAT+V                   G +MA +ICGGC T+LMY 
Sbjct  2    QDQLVCHGCRSILLYPRGATNVCCALCSMINIVPPPPPVRAGVDMAHIICGGCRTMLMYS  61

Query  461  RGATSVQCSCCHTINLA-LEANQVAHVNCG  547
            RGA SV+CSCC T+NL     NQVAH+NCG
Sbjct  62   RGANSVRCSCCQTLNLVPAHTNQVAHINCG  91



>gb|ADK63407.1| zinc finger protein [Brassica rapa]
 emb|CDX78991.1| BnaA01g10580D [Brassica napus]
Length=191

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 56/98 (57%), Gaps = 14/98 (14%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGat-----------svccavcsavtavpppGTEMAQLICGGCH  442
            Q QLVC  CRN LMYP GAT            V              G +MA ++CGGC 
Sbjct  2    QDQLVCHGCRNTLMYPRGATNVRCALCHIVNMVPLHPHPPPPHHAHAGMDMAHIVCGGCR  61

Query  443  TLLMYIRGATSVQCSCCHTINL---ALEANQVAHVNCG  547
            T+LMY RGA+SV+CSCC T+NL      +NQVAH+NCG
Sbjct  62   TMLMYTRGASSVRCSCCQTVNLVPGPPPSNQVAHINCG  99



>ref|XP_009133777.1| PREDICTED: protein LSD1 isoform X4 [Brassica rapa]
Length=189

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 58/97 (60%), Gaps = 13/97 (13%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGats----------vccavcsavtavpppGTEMAQLICGGCHT  445
            Q QLVC  CRN LMYP GAT+          +           P  G +MA ++CGGC T
Sbjct  2    QDQLVCHGCRNTLMYPRGATNVRCALCHIVNMVPLHPHPHPPPPHHGMDMAHIVCGGCRT  61

Query  446  LLMYIRGATSVQCSCCHTINLA---LEANQVAHVNCG  547
            +LMY RGA+SV+CSCC T+NL      +NQVAH+NCG
Sbjct  62   MLMYTRGASSVRCSCCQTVNLVPGPPPSNQVAHINCG  98



>emb|CDX76459.1| BnaA08g09410D [Brassica napus]
Length=180

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 57/91 (63%), Gaps = 7/91 (8%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvc----cavcsavtavpppGTEMAQLICGGCHTLLMYIR  463
            Q QLVC  CRN L+YP GAT+V       V        P G +MA ++CGGC T+LMY R
Sbjct  2    QDQLVCHGCRNTLLYPRGATNVRCALCNTVNMIPHHPSPHGMDMAHIVCGGCRTMLMYTR  61

Query  464  GATSVQCSCCHTINL---ALEANQVAHVNCG  547
            G TSV+CSCC T+NL      +NQ AH+NCG
Sbjct  62   GGTSVRCSCCQTLNLVPAPTPSNQFAHINCG  92



>gb|KJB56339.1| hypothetical protein B456_009G1160002, partial [Gossypium raimondii]
 gb|KJB56340.1| hypothetical protein B456_009G1160002, partial [Gossypium raimondii]
 gb|KJB56341.1| hypothetical protein B456_009G1160002, partial [Gossypium raimondii]
 gb|KJB56342.1| hypothetical protein B456_009G1160002, partial [Gossypium raimondii]
Length=74

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QS++VCSRCRN+L+YP GAT+VCCA+C+ +T VPPPG EMAQL+CGGC TLLMY  GATS
Sbjct  2    QSEVVCSRCRNILLYPRGATNVCCALCNTITQVPPPGMEMAQLVCGGCRTLLMYTCGATS  61

Query  476  VQCSCCHTIN  505
            V+CSCC+ IN
Sbjct  62   VRCSCCNIIN  71



>gb|KJB56343.1| hypothetical protein B456_009G1160002, partial [Gossypium raimondii]
Length=91

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QS++VCSRCRN+L+YP GAT+VCCA+C+ +T VPPPG EMAQL+CGGC TLLMY  GATS
Sbjct  19   QSEVVCSRCRNILLYPRGATNVCCALCNTITQVPPPGMEMAQLVCGGCRTLLMYTCGATS  78

Query  476  VQCSCCHTIN  505
            V+CSCC+ IN
Sbjct  79   VRCSCCNIIN  88



>ref|XP_010315638.1| PREDICTED: protein LOL1-like [Solanum lycopersicum]
Length=87

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            QS LVCS CR +L+YP GAT+VCCAVC+ +T VPPPGTEMAQLICG C TLLM+ RGATS
Sbjct  2    QSPLVCSGCRTILLYPRGATNVCCAVCNNLTPVPPPGTEMAQLICGCCRTLLMHPRGATS  61

Query  476  VQCSCCHTINL  508
            V+C+CCHT+NL
Sbjct  62   VRCACCHTVNL  72



>ref|XP_009133755.1| PREDICTED: protein LSD1 isoform X1 [Brassica rapa]
Length=193

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 57/100 (57%), Gaps = 16/100 (16%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvc-------------cavcsavtavpppGTEMAQLICGG  436
            Q QLVC  CRN LMYP GAT+V                           G +MA ++CGG
Sbjct  2    QDQLVCHGCRNTLMYPRGATNVRCALCHIVNMVPLHPHPHPPPPHHAHAGMDMAHIVCGG  61

Query  437  CHTLLMYIRGATSVQCSCCHTINL---ALEANQVAHVNCG  547
            C T+LMY RGA+SV+CSCC T+NL      +NQVAH+NCG
Sbjct  62   CRTMLMYTRGASSVRCSCCQTVNLVPGPPPSNQVAHINCG  101



>gb|KJB68466.1| hypothetical protein B456_010G246900 [Gossypium raimondii]
Length=134

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  410  EMAQLICGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCG  547
            EMAQLICGGC TLLMY RGA S++CSCCHTIN+A  +NQ++H+ CG
Sbjct  2    EMAQLICGGCRTLLMYTRGAASIRCSCCHTINVAPASNQISHITCG  47



>emb|CDX82760.1| BnaC01g12100D [Brassica napus]
Length=194

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 57/101 (56%), Gaps = 17/101 (17%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvc--------------cavcsavtavpppGTEMAQLICG  433
            Q QLVC  CRN LMYP GAT+V                            G +MA ++CG
Sbjct  2    QDQLVCHGCRNTLMYPRGATNVRCALCHIVNMVPLHPHPPPPPPPHHAHAGMDMAHIVCG  61

Query  434  GCHTLLMYIRGATSVQCSCCHTINL---ALEANQVAHVNCG  547
            GC T+LMY RGA+SV+CSCC T+NL      +NQVAH+NCG
Sbjct  62   GCRTMLMYTRGASSVRCSCCQTVNLVPGPPPSNQVAHINCG  102



>ref|NP_001050737.1| Os03g0639600 [Oryza sativa Japonica Group]
 sp|Q6ASS2.1|LOL3_ORYSJ RecName: Full=Protein LOL3; AltName: Full=Protein LSD ONE LIKE 
3; Short=OsLOL3; AltName: Full=Putative zinc finger LOL3 [Oryza 
sativa Japonica Group]
 gb|AAT77863.1| putative zinc finger protein [Oryza sativa Japonica Group]
 gb|AAT85277.1| zinc finger protein, putative [Oryza sativa Japonica Group]
 gb|ABF97818.1| zinc finger protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12651.1| Os03g0639600 [Oryza sativa Japonica Group]
 dbj|BAG99311.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75810.1| hypothetical protein OsI_12759 [Oryza sativa Indica Group]
 gb|EEE59562.1| hypothetical protein OsJ_11851 [Oryza sativa Japonica Group]
Length=186

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsv--ccavcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            QSQ+VC  CR++L YP GA SV             P P  EMA LICGGC TLLMY R A
Sbjct  2    QSQIVCHGCRSVLRYPSGAPSVCCALCQAITTVPPPAPVMEMAHLICGGCRTLLMYTRNA  61

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
             +V+CSCC T+NL    N +AHV+CG
Sbjct  62   DTVRCSCCSTVNLVRPVNNIAHVSCG  87



>ref|XP_010434287.1| PREDICTED: protein LSD1 isoform X3 [Camelina sativa]
Length=187

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 11/95 (12%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvcca--vcsavtavpppGTEMAQLICGGCHTLLMYIRGA  469
            Q QLVC  CRNLLMYP GA++V CA      +   PP G +MA ++CGGC T+LMY RGA
Sbjct  2    QDQLVCHGCRNLLMYPRGASNVRCALCNTINMVPPPPHGMDMAHIVCGGCRTMLMYTRGA  61

Query  470  TSVQCSCCHTINLA---------LEANQVAHVNCG  547
            +SV+CSCC T NL            +NQVA +NCG
Sbjct  62   SSVRCSCCQTTNLVPGLSNQVAHAPSNQVAQINCG  96



>ref|XP_009133762.1| PREDICTED: protein LSD1 isoform X2 [Brassica rapa]
Length=192

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 57/100 (57%), Gaps = 16/100 (16%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvc-------------cavcsavtavpppGTEMAQLICGG  436
            Q QLVC  CRN LMYP GAT+V                           G +MA ++CGG
Sbjct  2    QDQLVCHGCRNTLMYPRGATNVRCALCHIVNMVPLHPHPHPPPPHHAHAGMDMAHIVCGG  61

Query  437  CHTLLMYIRGATSVQCSCCHTINLA---LEANQVAHVNCG  547
            C T+LMY RGA+SV+CSCC T+NL      +NQVAH+NCG
Sbjct  62   CRTMLMYTRGASSVRCSCCQTVNLVPGPPPSNQVAHINCG  101



>ref|XP_006650331.1| PREDICTED: protein LOL3-like [Oryza brachyantha]
Length=176

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 64/86 (74%), Gaps = 2/86 (2%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGT--EMAQLICGGCHTLLMYIRGA  469
            QSQ+VC  CR++L YP GA SVCCA+C A+T VPPP    EMA LICGGC TLLMY R A
Sbjct  2    QSQIVCHGCRSVLRYPSGAPSVCCALCQAITTVPPPAPVLEMAHLICGGCRTLLMYTRNA  61

Query  470  TSVQCSCCHTINLALEANQVAHVNCG  547
             +V+CSCC T+NL    N +AHV+CG
Sbjct  62   DTVRCSCCSTVNLVRPVNNIAHVSCG  87



>ref|XP_006587107.1| PREDICTED: protein LSD1 isoform X2 [Glycine max]
Length=151

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +2

Query  296  QSQLVCSRCRNLLMYPVGatsvccavcsavtavpppGTEMAQLICGGCHTLLMYIRGATS  475
            +SQLVC+ CR++L+YP GAT+VCCA+C+ +T+VPPPG +M+QL CGGC TLLMY RGATS
Sbjct  2    RSQLVCNGCRSILVYPRGATNVCCALCNTITSVPPPGMDMSQLYCGGCTTLLMYTRGATS  61

Query  476  VQCSCCHTINLA  511
            V+CSCCHTINL 
Sbjct  62   VRCSCCHTINLV  73



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335