BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M23

Length=575
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009764594.1|  PREDICTED: histone-lysine N-methyltransferas...    280   3e-89   Nicotiana sylvestris
ref|XP_004242023.1|  PREDICTED: histone-lysine N-methyltransferas...    280   8e-89   Solanum lycopersicum
ref|XP_009618110.1|  PREDICTED: histone-lysine N-methyltransferas...    278   1e-88   Nicotiana tomentosiformis
ref|XP_009764587.1|  PREDICTED: histone-lysine N-methyltransferas...    280   2e-88   Nicotiana sylvestris
ref|XP_009764580.1|  PREDICTED: histone-lysine N-methyltransferas...    279   3e-88   Nicotiana sylvestris
ref|XP_009618109.1|  PREDICTED: histone-lysine N-methyltransferas...    278   6e-88   Nicotiana tomentosiformis
ref|XP_010322913.1|  PREDICTED: histone-lysine N-methyltransferas...    275   2e-87   
ref|XP_010322911.1|  PREDICTED: histone-lysine N-methyltransferas...    275   6e-87   
ref|XP_006363899.1|  PREDICTED: histone-lysine N-methyltransferas...    275   1e-86   Solanum tuberosum [potatoes]
ref|XP_006363898.1|  PREDICTED: histone-lysine N-methyltransferas...    269   2e-84   Solanum tuberosum [potatoes]
ref|XP_011097714.1|  PREDICTED: histone-lysine N-methyltransferas...    263   4e-82   Sesamum indicum [beniseed]
ref|XP_010272881.1|  PREDICTED: histone-lysine N-methyltransferas...    261   2e-81   Nelumbo nucifera [Indian lotus]
ref|XP_010664254.1|  PREDICTED: histone-lysine N-methyltransferas...    259   5e-81   Vitis vinifera
ref|XP_010664253.1|  PREDICTED: histone-lysine N-methyltransferas...    259   6e-81   
ref|XP_010664252.1|  PREDICTED: histone-lysine N-methyltransferas...    259   2e-80   Vitis vinifera
ref|XP_006472718.1|  PREDICTED: histone-lysine N-methyltransferas...    254   1e-78   Citrus sinensis [apfelsine]
gb|EYU22920.1|  hypothetical protein MIMGU_mgv1a005471mg                253   2e-78   Erythranthe guttata [common monkey flower]
gb|KJB29251.1|  hypothetical protein B456_005G091200                    251   5e-78   Gossypium raimondii
ref|XP_007222803.1|  hypothetical protein PRUPE_ppa005026mg             251   1e-77   Prunus persica
gb|KDO80748.1|  hypothetical protein CISIN_1g011626mg                   251   3e-77   Citrus sinensis [apfelsine]
gb|KJB29249.1|  hypothetical protein B456_005G091200                    250   4e-77   Gossypium raimondii
gb|KDP32756.1|  hypothetical protein JCGZ_12048                         250   5e-77   Jatropha curcas
ref|XP_008233908.1|  PREDICTED: histone-lysine N-methyltransferas...    248   4e-76   Prunus mume [ume]
ref|XP_007018969.1|  SET domain protein isoform 2                       244   5e-75   
ref|XP_007018968.1|  SET domain protein isoform 1                       244   6e-75   
ref|XP_007018970.1|  SET domain protein isoform 3                       244   6e-75   
gb|KJB29253.1|  hypothetical protein B456_005G091200                    241   2e-73   Gossypium raimondii
ref|XP_008338790.1|  PREDICTED: histone-lysine N-methyltransferas...    240   2e-73   
ref|XP_010538974.1|  PREDICTED: histone-lysine N-methyltransferas...    239   7e-73   Tarenaya hassleriana [spider flower]
ref|XP_009366986.1|  PREDICTED: histone-lysine N-methyltransferas...    239   9e-73   Pyrus x bretschneideri [bai li]
ref|XP_009366987.1|  PREDICTED: histone-lysine N-methyltransferas...    239   9e-73   Pyrus x bretschneideri [bai li]
gb|KEH34848.1|  histone-lysine N-methyltransferase                      236   1e-72   Medicago truncatula
gb|KJB29252.1|  hypothetical protein B456_005G091200                    239   1e-72   Gossypium raimondii
ref|XP_004290832.1|  PREDICTED: histone-lysine N-methyltransferas...    238   2e-72   Fragaria vesca subsp. vesca
gb|KEH34847.1|  histone-lysine N-methyltransferase                      236   4e-72   Medicago truncatula
ref|XP_010666643.1|  PREDICTED: histone-lysine N-methyltransferas...    235   5e-72   
gb|AES71348.2|  histone-lysine N-methyltransferase                      236   9e-72   Medicago truncatula
ref|XP_010694872.1|  PREDICTED: histone-lysine N-methyltransferas...    236   2e-71   
ref|XP_010091345.1|  Histone-lysine N-methyltransferase                 234   5e-71   
ref|XP_010926452.1|  PREDICTED: histone-lysine N-methyltransferas...    233   1e-70   
ref|XP_002513816.1|  protein with unknown function                      233   1e-70   Ricinus communis
gb|KHG02872.1|  Histone-lysine N-methyltransferase ASHR1 -like pr...    233   2e-70   Gossypium arboreum [tree cotton]
ref|XP_010926450.1|  PREDICTED: histone-lysine N-methyltransferas...    233   2e-70   Elaeis guineensis
ref|XP_011012503.1|  PREDICTED: histone-lysine N-methyltransferas...    230   4e-70   Populus euphratica
ref|XP_004500595.1|  PREDICTED: histone-lysine N-methyltransferas...    232   4e-70   Cicer arietinum [garbanzo]
emb|CDP12439.1|  unnamed protein product                                221   8e-70   Coffea canephora [robusta coffee]
gb|KGN50970.1|  hypothetical protein Csa_5G376270                       231   1e-69   Cucumis sativus [cucumbers]
ref|XP_011012500.1|  PREDICTED: histone-lysine N-methyltransferas...    230   2e-69   Populus euphratica
ref|XP_011012501.1|  PREDICTED: histone-lysine N-methyltransferas...    230   2e-69   Populus euphratica
ref|XP_011012502.1|  PREDICTED: histone-lysine N-methyltransferas...    230   2e-69   Populus euphratica
ref|XP_004140329.1|  PREDICTED: histone-lysine N-methyltransferas...    230   3e-69   
ref|NP_849969.1|  SET domain group protein 37                           229   6e-69   
ref|XP_011001420.1|  PREDICTED: histone-lysine N-methyltransferas...    229   6e-69   Populus euphratica
ref|XP_011001421.1|  PREDICTED: histone-lysine N-methyltransferas...    229   6e-69   Populus euphratica
ref|XP_011001419.1|  PREDICTED: histone-lysine N-methyltransferas...    229   8e-69   Populus euphratica
ref|XP_011001418.1|  PREDICTED: histone-lysine N-methyltransferas...    229   8e-69   Populus euphratica
ref|XP_008782265.1|  PREDICTED: histone-lysine N-methyltransferas...    228   9e-69   
ref|XP_008782264.1|  PREDICTED: histone-lysine N-methyltransferas...    228   2e-68   Phoenix dactylifera
ref|XP_002886136.1|  hypothetical protein ARALYDRAFT_319740             226   8e-68   
ref|XP_008465815.1|  PREDICTED: histone-lysine N-methyltransferas...    225   2e-67   Cucumis melo [Oriental melon]
ref|XP_008465809.1|  PREDICTED: histone-lysine N-methyltransferas...    225   3e-67   Cucumis melo [Oriental melon]
gb|EPS73138.1|  hypothetical protein M569_01616                         223   8e-67   Genlisea aurea
ref|XP_007137368.1|  hypothetical protein PHAVU_009G121500g             222   3e-66   Phaseolus vulgaris [French bean]
gb|AGZ15368.1|  histone-lysine N-methyltransferase ASHR1-like pro...    222   4e-66   Phaseolus vulgaris [French bean]
ref|XP_006297545.1|  hypothetical protein CARUB_v10013566mg             221   5e-66   Capsella rubella
ref|XP_009390922.1|  PREDICTED: histone-lysine N-methyltransferas...    221   9e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009121063.1|  PREDICTED: histone-lysine N-methyltransferas...    219   3e-65   
ref|XP_009121061.1|  PREDICTED: histone-lysine N-methyltransferas...    219   4e-65   Brassica rapa
ref|XP_010467589.1|  PREDICTED: histone-lysine N-methyltransferas...    218   9e-65   Camelina sativa [gold-of-pleasure]
emb|CDY38142.1|  BnaA07g02410D                                          218   1e-64   Brassica napus [oilseed rape]
ref|XP_010065502.1|  PREDICTED: histone-lysine N-methyltransferas...    217   2e-64   Eucalyptus grandis [rose gum]
ref|XP_006409221.1|  hypothetical protein EUTSA_v10022664mg             217   3e-64   Eutrema salsugineum [saltwater cress]
emb|CDY63757.1|  BnaCnng42550D                                          215   1e-63   Brassica napus [oilseed rape]
gb|AFK47176.1|  unknown                                                 214   3e-63   Medicago truncatula
ref|XP_003601097.1|  Histone-lysine N-methyltransferase ASHR1           214   3e-63   
gb|AFW67883.1|  hypothetical protein ZEAMMB73_219813                    203   2e-62   
ref|XP_010489431.1|  PREDICTED: histone-lysine N-methyltransferas...    209   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010666085.1|  PREDICTED: histone-lysine N-methyltransferas...    208   4e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010926451.1|  PREDICTED: histone-lysine N-methyltransferas...    208   5e-61   
gb|ABF98447.1|  MYND finger family protein, expressed                   202   8e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003560708.1|  PREDICTED: histone-lysine N-methyltransferas...    207   1e-60   Brachypodium distachyon [annual false brome]
gb|ABF98446.1|  MYND finger family protein, expressed                   202   6e-60   Oryza sativa Japonica Group [Japonica rice]
gb|KDO80754.1|  hypothetical protein CISIN_1g011626mg                   202   8e-60   Citrus sinensis [apfelsine]
gb|KDO80749.1|  hypothetical protein CISIN_1g011626mg                   202   2e-59   Citrus sinensis [apfelsine]
ref|XP_006434126.1|  hypothetical protein CICLE_v10001105mg             202   5e-59   
gb|KDO80750.1|  hypothetical protein CISIN_1g011626mg                   202   5e-59   Citrus sinensis [apfelsine]
gb|AAM97151.1|  unknown protein,3'-partial                              201   7e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982043.1|  PREDICTED: histone-lysine N-methyltransferas...    202   7e-59   Setaria italica
gb|EEC76031.1|  hypothetical protein OsI_13199                          202   1e-58   Oryza sativa Indica Group [Indian rice]
gb|AAS07242.1|  putative MYND finger protein                            202   1e-58   Oryza sativa Japonica Group [Japonica rice]
gb|AFW67882.1|  hypothetical protein ZEAMMB73_219813                    201   1e-58   
gb|ABF98444.1|  MYND finger family protein, expressed                   202   1e-58   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001131420.1|  histone-lysine N-methyltransferase ASHR1           202   1e-58   Zea mays [maize]
ref|XP_002464022.1|  hypothetical protein SORBIDRAFT_01g010740          201   2e-58   Sorghum bicolor [broomcorn]
gb|ACG37550.1|  histone-lysine N-methyltransferase ASHR1                201   3e-58   Zea mays [maize]
ref|XP_009121064.1|  PREDICTED: histone-lysine N-methyltransferas...    199   1e-57   
ref|XP_006578981.1|  PREDICTED: histone-lysine N-methyltransferas...    198   5e-57   Glycine max [soybeans]
ref|XP_002306611.1|  zinc finger family protein                         196   1e-56   
ref|XP_006650467.1|  PREDICTED: histone-lysine N-methyltransferas...    196   2e-56   Oryza brachyantha
gb|KDO80751.1|  hypothetical protein CISIN_1g011626mg                   181   8e-51   Citrus sinensis [apfelsine]
ref|NP_001173603.1|  Os03g0704200                                       169   2e-49   
ref|XP_006827905.1|  hypothetical protein AMTR_s00008p00145610          174   1e-47   
ref|XP_010926453.1|  PREDICTED: histone-lysine N-methyltransferas...    169   9e-47   Elaeis guineensis
ref|XP_007018972.1|  Histone-lysine N-methyltransferase ASHR1           166   7e-46   
ref|XP_008782266.1|  PREDICTED: histone-lysine N-methyltransferas...    166   1e-45   
gb|EYU22919.1|  hypothetical protein MIMGU_mgv1a006005mg                167   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_007018977.1|  Histone-lysine N-methyltransferase ASHR1 iso...    161   3e-43   
gb|EMT19769.1|  Histone-lysine N-methyltransferase ASHR1                153   2e-40   
ref|XP_007018976.1|  Histone-lysine N-methyltransferase ASHR1           153   3e-40   
gb|ADP02224.1|  zf-MYND domain-containing protein                       152   1e-39   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010230948.1|  PREDICTED: histone-lysine N-methyltransferas...    148   1e-38   
ref|XP_001778213.1|  predicted protein                                  149   1e-38   
gb|AAL75997.1|AF466646_5  putative SET-domain transcriptional reg...    146   3e-38   Zea mays [maize]
ref|XP_002969663.1|  hypothetical protein SELMODRAFT_231366             136   3e-34   Selaginella moellendorffii
ref|XP_011457851.1|  PREDICTED: histone-lysine N-methyltransferas...    128   2e-33   Fragaria vesca subsp. vesca
ref|XP_004500596.1|  PREDICTED: histone-lysine N-methyltransferas...    134   2e-33   
ref|XP_008465812.1|  PREDICTED: histone-lysine N-methyltransferas...    131   1e-32   Cucumis melo [Oriental melon]
ref|XP_010926454.1|  PREDICTED: histone-lysine N-methyltransferas...    126   9e-31   Elaeis guineensis
gb|ABR16570.1|  unknown                                                 122   2e-29   Picea sitchensis
ref|XP_002981276.1|  hypothetical protein SELMODRAFT_114558             116   4e-27   
gb|AFK36247.1|  unknown                                                 109   7e-27   Lotus japonicus
gb|EYU22918.1|  hypothetical protein MIMGU_mgv1a007180mg                113   3e-26   Erythranthe guttata [common monkey flower]
gb|EEE59772.1|  hypothetical protein OsJ_12271                          113   3e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KHN09175.1|  Histone-lysine N-methyltransferase ASHR1-like pro...    103   7e-23   Glycine soja [wild soybean]
gb|KDP32757.1|  hypothetical protein JCGZ_12049                       99.8    2e-21   Jatropha curcas
gb|KDO80752.1|  hypothetical protein CISIN_1g011626mg                 95.1    6e-20   Citrus sinensis [apfelsine]
ref|XP_007018971.1|  Uncharacterized protein TCM_035037               89.7    2e-19   
gb|EMS57953.1|  Histone-lysine N-methyltransferase ASHR1              87.4    4e-17   Triticum urartu
emb|CDQ84991.1|  unnamed protein product                              83.6    3e-16   Oncorhynchus mykiss
ref|NP_001085986.1|  N-lysine methyltransferase SMYD2-B               83.6    2e-15   Xenopus laevis [clawed frog]
ref|XP_008396038.1|  PREDICTED: N-lysine methyltransferase SMYD2      82.4    4e-15   Poecilia reticulata
ref|XP_002934751.2|  PREDICTED: N-lysine methyltransferase SMYD2-...  82.4    4e-15   Xenopus tropicalis [western clawed frog]
ref|XP_007552914.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  82.4    4e-15   Poecilia formosa
ref|XP_005800256.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  82.4    4e-15   Xiphophorus maculatus
ref|NP_001080251.1|  N-lysine methyltransferase SMYD2-A               80.9    2e-14   Xenopus laevis [clawed frog]
gb|EMT62266.1|  Histone-lysine N-methyltransferase ASHR1              79.7    6e-14   Fusarium oxysporum f. sp. cubense race 4
gb|EXM10732.1|  SET and MYND protein                                  79.7    7e-14   Fusarium oxysporum f. sp. cubense tropical race 4 54006
ref|XP_007244713.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  79.0    7e-14   
gb|KDQ60288.1|  hypothetical protein JAAARDRAFT_191683                79.3    8e-14   Jaapia argillacea MUCL 33604
ref|XP_003971775.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  78.6    1e-13   Takifugu rubripes [tiger puffer]
ref|XP_008308104.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  77.8    2e-13   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004083558.2|  PREDICTED: N-lysine methyltransferase SMYD2      77.8    2e-13   Oryzias latipes [Japanese rice fish]
ref|XP_007903218.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  77.4    2e-13   Callorhinchus milii [Australian ghost shark]
ref|XP_007903217.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  77.8    2e-13   Callorhinchus milii [Australian ghost shark]
ref|XP_005734469.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  77.4    2e-13   Pundamilia nyererei
emb|CCT62122.1|  uncharacterized protein FFUJ_01357                   77.8    3e-13   Fusarium fujikuroi IMI 58289
gb|EXK47541.1|  SET and MYND protein                                  77.8    3e-13   Fusarium oxysporum f. sp. melonis 26406
gb|EWY94394.1|  SET and MYND protein                                  77.8    3e-13   Fusarium oxysporum FOSC 3-a
gb|EXM28398.1|  SET and MYND protein                                  77.8    3e-13   Fusarium oxysporum f. sp. vasinfectum 25433
gb|EXA53483.1|  SET and MYND protein                                  77.4    3e-13   Fusarium oxysporum f. sp. pisi HDV247
gb|EWZ50299.1|  SET and MYND protein                                  77.4    3e-13   Fusarium oxysporum Fo47
gb|EKD03370.1|  hypothetical protein A1Q2_02350                       77.4    3e-13   Trichosporon asahii var. asahii CBS 8904
ref|XP_006797154.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  77.0    3e-13   Neolamprologus brichardi [lyretail cichlid]
ref|XP_010780557.1|  PREDICTED: N-lysine methyltransferase SMYD2      77.0    4e-13   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005164480.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  77.0    4e-13   Danio rerio [leopard danio]
ref|XP_005914557.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  76.3    4e-13   Haplochromis burtoni
ref|NP_001025394.1|  N-lysine methyltransferase SMYD2-B isoform 1     76.6    4e-13   Danio rerio [leopard danio]
ref|XP_001838336.2|  hypothetical protein CC1G_04780                  77.4    4e-13   Coprinopsis cinerea okayama7#130
ref|XP_002594889.1|  hypothetical protein BRAFLDRAFT_124463           76.6    5e-13   Branchiostoma floridae
ref|XP_005914556.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  76.3    6e-13   Haplochromis burtoni
ref|XP_004541863.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  76.3    6e-13   
gb|KIJ28651.1|  hypothetical protein M422DRAFT_189461                 75.1    7e-13   Sphaerobolus stellatus SS14
gb|EWG37838.1|  SET and MYND protein                                  76.6    7e-13   Fusarium verticillioides 7600
ref|XP_005288778.1|  PREDICTED: N-lysine methyltransferase SMYD2      75.9    8e-13   Chrysemys picta bellii
ref|XP_004067302.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  75.9    9e-13   Oryzias latipes [Japanese rice fish]
ref|XP_008404070.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  75.9    9e-13   Poecilia reticulata
gb|ABI34494.1|  SET and MYND domain containing 2a                     72.8    1e-12   Danio rerio [leopard danio]
ref|XP_003449905.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  75.5    1e-12   Oreochromis niloticus
ref|XP_008285163.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  75.1    2e-12   Stegastes partitus
ref|XP_010894609.1|  PREDICTED: N-lysine methyltransferase SMYD2      75.1    2e-12   
gb|KIJ27280.1|  hypothetical protein M422DRAFT_191221                 75.1    2e-12   Sphaerobolus stellatus SS14
gb|EXK90053.1|  SET and MYND protein                                  75.1    2e-12   Fusarium oxysporum f. sp. raphani 54005
ref|XP_003053442.1|  hypothetical protein NECHADRAFT_74600            75.1    2e-12   [Nectria] haematococca mpVI 77-13-4
ref|XP_008284973.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  74.3    3e-12   Stegastes partitus
ref|XP_010732983.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  73.9    3e-12   
gb|EJT50303.1|  hypothetical protein A1Q1_00408                       74.7    3e-12   Trichosporon asahii var. asahii CBS 2479
ref|XP_010866973.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  71.2    4e-12   
ref|XP_010732982.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  73.9    4e-12   
gb|EYB33851.1|  hypothetical protein FG05_01168                       74.3    4e-12   Fusarium graminearum
ref|XP_010730623.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  73.9    4e-12   Larimichthys crocea [croceine croaker]
ref|XP_005998637.1|  PREDICTED: N-lysine methyltransferase SMYD2      73.6    5e-12   
ref|XP_003284216.1|  hypothetical protein DICPUDRAFT_147973           73.6    6e-12   Dictyostelium purpureum
dbj|GAM19369.1|  hypothetical protein SAMD00019534_025440             73.6    7e-12   Acytostelium subglobosum LB1
ref|NP_001266980.1|  SET and MYND domain containing 2                 73.2    8e-12   Takifugu rubripes [tiger puffer]
gb|KDB13595.1|  MYND finger family protein                            73.2    9e-12   Ustilaginoidea virens
ref|XP_003454536.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  72.8    1e-11   Oreochromis niloticus
ref|XP_002956692.1|  SET and zf-MYND domain-containing protein        70.9    1e-11   Volvox carteri f. nagariensis
gb|EHJ65468.1|  hypothetical protein KGM_05644                        72.0    1e-11   
ref|XP_007549817.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  72.8    1e-11   Poecilia formosa
ref|NP_001013568.1|  N-lysine methyltransferase SMYD2-A               72.8    1e-11   Danio rerio [leopard danio]
ref|XP_004471639.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  72.4    1e-11   
ref|XP_011163275.1|  PREDICTED: histone-lysine N-methyltransferas...  72.4    1e-11   
ref|XP_006626142.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  72.4    1e-11   Lepisosteus oculatus
ref|XP_008423053.1|  PREDICTED: histone-lysine N-methyltransferas...  72.4    1e-11   Poecilia reticulata
gb|KIM40724.1|  hypothetical protein M413DRAFT_446114                 72.8    1e-11   Hebeloma cylindrosporum h7
ref|XP_006966367.1|  predicted protein                                72.8    1e-11   Trichoderma reesei QM6a
ref|XP_005915134.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  72.4    1e-11   Haplochromis burtoni
ref|XP_011313226.1|  PREDICTED: histone-lysine N-methyltransferas...  72.4    1e-11   Fopius arisanus
gb|KIL94623.1|  hypothetical protein FAVG1_01554                      73.2    1e-11   Fusarium avenaceum
ref|XP_005733342.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  72.0    1e-11   Pundamilia nyererei
ref|XP_004539544.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  72.0    2e-11   Maylandia zebra
ref|XP_004471638.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  72.0    2e-11   Dasypus novemcinctus
ref|XP_011138935.1|  PREDICTED: SET and MYND domain-containing pr...  72.8    2e-11   Harpegnathos saltator
ref|XP_011313227.1|  PREDICTED: histone-lysine N-methyltransferas...  72.0    2e-11   Fopius arisanus
ref|XP_006681928.1|  hypothetical protein BATDEDRAFT_27650            72.0    2e-11   Batrachochytrium dendrobatidis JAM81
ref|XP_011313228.1|  PREDICTED: histone-lysine N-methyltransferas...  71.6    2e-11   Fopius arisanus
gb|AAH98305.1|  SMYD2 protein                                         70.1    2e-11   Homo sapiens [man]
gb|AIC62215.1|  SMYD2                                                 70.1    2e-11   synthetic construct
ref|XP_004485227.1|  PREDICTED: LOW QUALITY PROTEIN: SET and MYND...  72.0    2e-11   Dasypus novemcinctus
ref|XP_006890631.1|  PREDICTED: N-lysine methyltransferase SMYD2      72.0    2e-11   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KJB29250.1|  hypothetical protein B456_005G091200                  70.9    2e-11   Gossypium raimondii
ref|XP_002191464.1|  PREDICTED: N-lysine methyltransferase SMYD2      71.6    3e-11   Taeniopygia guttata
ref|XP_007950799.1|  PREDICTED: N-lysine methyltransferase SMYD2      71.2    3e-11   Orycteropus afer afer
ref|XP_011504410.1|  PREDICTED: SET and MYND domain-containing pr...  72.0    3e-11   Ceratosolen solmsi marchali
ref|XP_008311167.1|  PREDICTED: N-lysine methyltransferase SMYD2      71.2    3e-11   Cynoglossus semilaevis [half-smooth tongue sole]
sp|E1C5V0.1|SMYD2_CHICK  RecName: Full=N-lysine methyltransferase...  71.2    3e-11   Gallus gallus [bantam]
ref|NP_001264500.1|  N-lysine methyltransferase SMYD2                 71.2    3e-11   Gallus gallus [bantam]
ref|XP_009253991.1|  hypothetical protein FPSE_02597                  71.6    3e-11   Fusarium pseudograminearum CS3096
ref|XP_003708212.1|  PREDICTED: SET and MYND domain-containing pr...  71.2    3e-11   
ref|XP_005082950.1|  PREDICTED: N-lysine methyltransferase SMYD2      70.9    3e-11   
ref|XP_008212820.1|  PREDICTED: histone-lysine N-methyltransferas...  70.5    4e-11   Nasonia vitripennis
ref|XP_003394366.1|  PREDICTED: SET and MYND domain-containing pr...  70.9    4e-11   Bombus terrestris [large earth bumblebee]
ref|XP_004415860.1|  PREDICTED: N-lysine methyltransferase SMYD2      70.9    5e-11   Odobenus rosmarus divergens
ref|XP_005523395.1|  PREDICTED: N-lysine methyltransferase SMYD2      70.9    5e-11   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_008559896.1|  PREDICTED: histone-lysine N-methyltransferas...  70.9    5e-11   Microplitis demolitor
ref|XP_006497210.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  68.6    5e-11   Mus musculus [mouse]
gb|AAH49367.2|  SMYD2 protein                                         70.1    6e-11   Homo sapiens [man]
gb|KIH89592.1|  set and mynd domain protein                           70.9    6e-11   Sporothrix brasiliensis 5110
ref|XP_004928798.1|  PREDICTED: SET and MYND domain-containing pr...  70.5    7e-11   
ref|NP_064582.2|  N-lysine methyltransferase SMYD2                    70.1    7e-11   Homo sapiens [man]
pdb|3S7B|A  Chain A, Structural Basis Of Substrate Methylation An...  70.1    7e-11   Homo sapiens [man]
pdb|3RIB|A  Chain A, Human Lysine Methyltransferase Smyd2 In Comp...  70.1    8e-11   Homo sapiens [man]
ref|XP_001275309.1|  SET and MYND domain protein, putative            70.5    8e-11   Aspergillus clavatus NRRL 1
ref|XP_011163278.1|  PREDICTED: histone-lysine N-methyltransferas...  70.1    8e-11   Solenopsis invicta [imported red fire ant]
ref|XP_011263849.1|  PREDICTED: SET and MYND domain-containing pr...  70.5    9e-11   
ref|XP_011263848.1|  PREDICTED: SET and MYND domain-containing pr...  70.5    9e-11   
gb|KJA20540.1|  hypothetical protein HYPSUDRAFT_142116                70.1    1e-10   Hypholoma sublateritium FD-334 SS-4
ref|XP_005483074.1|  PREDICTED: N-lysine methyltransferase SMYD2      69.3    1e-10   Zonotrichia albicollis
ref|XP_006834071.1|  PREDICTED: N-lysine methyltransferase SMYD2      69.3    1e-10   Chrysochloris asiatica
ref|XP_008823080.1|  PREDICTED: N-lysine methyltransferase SMYD2      68.9    2e-10   Nannospalax galili
ref|NP_001153563.1|  N-lysine methyltransferase SMYD2                 68.9    2e-10   Sus scrofa [pigs]
ref|XP_007451352.1|  PREDICTED: N-lysine methyltransferase SMYD2      68.9    2e-10   Lipotes vexillifer [baiji]
ref|XP_005335035.1|  PREDICTED: N-lysine methyltransferase SMYD2      69.3    2e-10   
ref|XP_005348920.1|  PREDICTED: N-lysine methyltransferase SMYD2      68.9    2e-10   Microtus ochrogaster [prairie voles]
ref|XP_004275293.1|  PREDICTED: N-lysine methyltransferase SMYD2      68.9    2e-10   Orcinus orca [Orca]
ref|XP_007394738.1|  hypothetical protein PHACADRAFT_208075           69.3    2e-10   Phanerochaete carnosa HHB-10118-sp
ref|XP_002403605.1|  SET and MYND domain-containing protein (SMYD...  69.3    2e-10   Ixodes scapularis [blacklegged tick]
ref|XP_006074330.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  68.6    2e-10   
ref|XP_004626925.1|  PREDICTED: N-lysine methyltransferase SMYD2      68.6    2e-10   Octodon degus
ref|XP_009185764.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  68.6    2e-10   Papio anubis [baboon]
ref|XP_011056401.1|  PREDICTED: histone-lysine N-methyltransferas...  68.6    2e-10   Acromyrmex echinatior
ref|XP_006112751.1|  PREDICTED: N-lysine methyltransferase SMYD2      69.3    2e-10   
ref|NP_001069832.1|  N-lysine methyltransferase SMYD2                 68.6    2e-10   Bos taurus [bovine]
gb|ESA08452.1|  hypothetical protein GLOINDRAFT_210128                68.9    2e-10   
emb|CBY24692.1|  unnamed protein product                              68.6    2e-10   Oikopleura dioica
ref|XP_011165478.1|  PREDICTED: histone-lysine N-methyltransferas...  68.6    3e-10   
ref|XP_009185774.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  68.6    3e-10   Papio anubis [baboon]
ref|XP_011165481.1|  PREDICTED: histone-lysine N-methyltransferas...  68.6    3e-10   Solenopsis invicta [imported red fire ant]
ref|XP_010339249.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  68.2    3e-10   Saimiri boliviensis boliviensis
ref|XP_002163555.2|  PREDICTED: uncharacterized protein LOC100200645  69.3    3e-10   
ref|XP_002809506.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  68.6    3e-10   
ref|XP_001106482.2|  PREDICTED: SET and MYND domain-containing pr...  68.6    3e-10   Macaca mulatta [rhesus macaque]
gb|EDL94969.1|  SET and MYND domain containing 2, isoform CRA_b       67.8    3e-10   Rattus norvegicus [brown rat]
ref|XP_005005655.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  68.2    3e-10   Cavia porcellus [guinea pig]
dbj|BAE29912.1|  unnamed protein product                              68.2    3e-10   Mus musculus [mouse]
ref|XP_003490836.1|  PREDICTED: SET and MYND domain-containing pr...  68.2    3e-10   Bombus impatiens
ref|XP_002760570.1|  PREDICTED: N-lysine methyltransferase SMYD2      68.2    3e-10   Callithrix jacchus [common marmoset]
ref|XP_003930406.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  68.2    3e-10   Saimiri boliviensis boliviensis
ref|XP_011168402.1|  PREDICTED: SET and MYND domain-containing pr...  68.6    4e-10   
ref|XP_003474289.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  68.2    4e-10   Cavia porcellus [guinea pig]
ref|NP_081072.1|  N-lysine methyltransferase SMYD2                    68.2    4e-10   Mus musculus [mouse]
ref|XP_011168403.1|  PREDICTED: SET and MYND domain-containing pr...  68.6    4e-10   
gb|EDL13024.1|  SET and MYND domain containing 2                      68.2    4e-10   Mus musculus [mouse]
gb|ERS95993.1|  hypothetical protein HMPREF1624_07528                 68.6    4e-10   Sporothrix schenckii ATCC 58251
ref|XP_004699947.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  67.8    5e-10   Echinops telfairi [lesser hedgehog tenrec]
ref|NP_996733.1|  N-lysine methyltransferase SMYD2                    67.8    5e-10   Rattus norvegicus [brown rat]
ref|XP_004853621.1|  PREDICTED: N-lysine methyltransferase SMYD2      67.8    5e-10   Heterocephalus glaber [naked mole rat]
gb|EPZ35095.1|  Zinc finger, MYND-type domain-containing protein      67.8    5e-10   Rozella allomycis CSF55
ref|XP_003802095.1|  PREDICTED: N-lysine methyltransferase SMYD2      67.4    6e-10   Otolemur garnettii
ref|XP_004539545.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  67.4    6e-10   
ref|XP_008465808.1|  PREDICTED: histone-lysine N-methyltransferas...  67.8    6e-10   
ref|XP_642738.1|  SET domain-containing protein                       67.8    6e-10   
ref|XP_008465807.1|  PREDICTED: histone-lysine N-methyltransferas...  67.4    6e-10   
ref|XP_002717452.2|  PREDICTED: N-lysine methyltransferase SMYD2      67.4    7e-10   
ref|XP_010765705.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  67.4    7e-10   
ref|XP_005813869.1|  PREDICTED: histone-lysine N-methyltransferas...  67.4    7e-10   
ref|XP_008465811.1|  PREDICTED: histone-lysine N-methyltransferas...  67.4    7e-10   
ref|XP_011345714.1|  PREDICTED: histone-lysine N-methyltransferas...  67.4    7e-10   
ref|XP_011163574.1|  PREDICTED: histone-lysine N-methyltransferas...  67.0    7e-10   
ref|XP_007230035.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  66.6    8e-10   
ref|XP_003487084.1|  PREDICTED: SET and MYND domain-containing pr...  67.4    8e-10   
gb|KIM28713.1|  hypothetical protein M408DRAFT_329176                 67.4    9e-10   
gb|KHN94462.1|  MYND finger family protein                            67.0    9e-10   
ref|XP_003396714.1|  PREDICTED: SET and MYND domain-containing pr...  67.4    1e-09   
ref|XP_005980337.1|  PREDICTED: N-lysine methyltransferase SMYD2-...  66.6    1e-09   
ref|XP_007575118.1|  PREDICTED: histone-lysine N-methyltransferas...  66.6    1e-09   
ref|XP_011506257.1|  PREDICTED: histone-lysine N-methyltransferas...  66.2    1e-09   
ref|XP_005143930.1|  PREDICTED: N-lysine methyltransferase SMYD2      66.2    1e-09   
ref|XP_009834460.1|  hypothetical protein H257_09796                  66.2    1e-09   
ref|NP_001038756.1|  N-lysine methyltransferase SMYD2-B isoform 2     66.2    1e-09   
gb|ELU10312.1|  hypothetical protein CAPTEDRAFT_158133                66.2    1e-09   
ref|XP_008606890.1|  hypothetical protein SDRG_03050                  66.2    1e-09   
ref|XP_011163277.1|  PREDICTED: histone-lysine N-methyltransferas...  66.2    1e-09   
emb|CCA73046.1|  hypothetical protein PIIN_07001                      66.6    1e-09   
ref|XP_008606891.1|  hypothetical protein, variant                    66.2    2e-09   
gb|EPX71081.1|  histone lysine methyltransferase Set6                 66.2    2e-09   
ref|XP_010990408.1|  PREDICTED: N-lysine methyltransferase SMYD2      65.9    2e-09   
ref|XP_009840545.1|  hypothetical protein H257_14434                  65.9    2e-09   
ref|XP_011056400.1|  PREDICTED: histone-lysine N-methyltransferas...  65.9    2e-09   
ref|XP_007772394.1|  SET domain-containing protein                    66.2    2e-09   
ref|XP_005526931.1|  PREDICTED: histone-lysine N-methyltransferas...  65.9    2e-09   
ref|XP_009301969.1|  PREDICTED: SET and MYND domain-containing pr...  65.9    2e-09   
ref|XP_003698898.1|  PREDICTED: LOW QUALITY PROTEIN: SET and MYND...  65.5    2e-09   
ref|NP_001135157.1|  SET and MYND domain-containing protein 1         64.7    2e-09   
ref|XP_006621991.1|  PREDICTED: histone-lysine N-methyltransferas...  65.5    2e-09   
ref|NP_001034725.1|  SET and MYND domain-containing protein 1         65.9    2e-09   
ref|XP_625013.1|  PREDICTED: histone-lysine N-methyltransferase S...  65.5    3e-09   
ref|XP_004578973.1|  PREDICTED: LOW QUALITY PROTEIN: N-lysine met...  65.5    3e-09   
ref|XP_011254247.1|  PREDICTED: histone-lysine N-methyltransferas...  65.5    3e-09   
gb|KIP05657.1|  hypothetical protein PHLGIDRAFT_73889                 65.5    3e-09   
ref|XP_011053843.1|  PREDICTED: SET and MYND domain-containing pr...  65.9    3e-09   
gb|ABI34493.1|  SET and MYND domain containing 2b                     62.0    3e-09   
ref|XP_008184392.1|  PREDICTED: histone-lysine N-methyltransferas...  65.5    3e-09   
ref|XP_011053841.1|  PREDICTED: SET and MYND domain-containing pr...  65.5    3e-09   
ref|XP_011053844.1|  PREDICTED: SET and MYND domain-containing pr...  65.5    3e-09   
ref|XP_009533210.1|  hypothetical protein PHYSODRAFT_518318           65.1    3e-09   
gb|EFZ09632.1|  hypothetical protein SINV_01274                       65.1    4e-09   
ref|XP_011172843.1|  PREDICTED: histone-lysine N-methyltransferas...  65.1    4e-09   
ref|XP_011165477.1|  PREDICTED: histone-lysine N-methyltransferas...  65.1    4e-09   
ref|XP_011165480.1|  PREDICTED: histone-lysine N-methyltransferas...  64.7    4e-09   
ref|XP_005489779.1|  PREDICTED: histone-lysine N-methyltransferas...  64.7    5e-09   
gb|KFM79258.1|  SET and MYND domain-containing protein 3              64.7    5e-09   
gb|KIL66415.1|  hypothetical protein M378DRAFT_75156                  65.1    5e-09   
ref|XP_010157192.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    6e-09   
gb|KDR23505.1|  SET and MYND domain-containing protein 3              64.3    6e-09   
emb|CDQ89914.1|  unnamed protein product                              64.3    6e-09   
ref|XP_005489778.1|  PREDICTED: histone-lysine N-methyltransferas...  64.3    7e-09   
ref|XP_002173858.1|  histone lysine methyltransferase Set6            64.3    7e-09   
ref|XP_005043339.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    7e-09   
ref|XP_011345713.1|  PREDICTED: histone-lysine N-methyltransferas...  64.3    7e-09   
ref|XP_419536.1|  PREDICTED: histone-lysine N-methyltransferase S...  63.9    8e-09   
gb|EFN77865.1|  SET and MYND domain-containing protein 3              63.5    8e-09   
ref|XP_009482012.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    8e-09   
gb|KII84634.1|  hypothetical protein PLICRDRAFT_117564                64.3    9e-09   
ref|XP_006626128.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    9e-09   
ref|XP_010903059.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    1e-08   
ref|XP_005110937.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    1e-08   
emb|CDP24236.1|  Putative protein of unknown function                 63.9    1e-08   
ref|XP_007263614.1|  SET domain-containing protein                    63.9    1e-08   
ref|XP_008144195.1|  PREDICTED: N-lysine methyltransferase SMYD2      63.5    1e-08   
ref|XP_004935489.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    1e-08   
emb|CDQ69013.1|  unnamed protein product                              64.3    1e-08   
ref|XP_007768768.1|  SET domain-containing protein                    63.5    1e-08   
ref|XP_007827043.1|  hypothetical protein PFICI_00271                 63.9    1e-08   
ref|XP_011149470.1|  PREDICTED: histone-lysine N-methyltransferas...  63.5    1e-08   
ref|XP_010903057.1|  PREDICTED: histone-lysine N-methyltransferas...  63.9    1e-08   
ref|XP_003974920.1|  PREDICTED: SET and MYND domain-containing pr...  63.5    1e-08   
ref|XP_002140515.1|  SET domain-containing protein                    63.9    1e-08   
ref|XP_003265162.2|  PREDICTED: N-lysine methyltransferase SMYD2      63.5    1e-08   
ref|NP_596514.1|  histone lysine methyltransferase Set6 (predicted)   63.5    1e-08   
ref|XP_004935491.1|  PREDICTED: histone-lysine N-methyltransferas...  63.2    2e-08   
ref|XP_007828563.1|  hypothetical protein PFICI_01791                 63.2    2e-08   
ref|XP_008284851.1|  PREDICTED: histone-lysine N-methyltransferas...  63.2    2e-08   
ref|XP_009951888.1|  PREDICTED: histone-lysine N-methyltransferas...  63.2    2e-08   
ref|XP_009876803.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    2e-08   
ref|XP_009951889.1|  PREDICTED: histone-lysine N-methyltransferas...  63.2    2e-08   
ref|XP_006817727.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    2e-08   
ref|XP_008284850.1|  PREDICTED: histone-lysine N-methyltransferas...  63.2    2e-08   
ref|NP_991103.1|  histone-lysine N-methyltransferase SMYD1            63.2    2e-08   
ref|XP_007275593.1|  mynd finger family protein                       63.2    2e-08   
ref|XP_010283714.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    2e-08   
ref|XP_001627600.1|  predicted protein                                62.4    2e-08   
ref|XP_009554283.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    2e-08   
ref|XP_005146080.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    2e-08   
gb|EPE08888.1|  mynd finger domain-containing protein                 62.8    2e-08   
ref|XP_009554284.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    2e-08   
ref|XP_009554281.1|  PREDICTED: histone-lysine N-methyltransferas...  62.8    2e-08   
ref|XP_010305783.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    3e-08   
ref|XP_009914605.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    3e-08   
ref|XP_003035264.1|  hypothetical protein SCHCODRAFT_14438            62.8    3e-08   
ref|XP_007896235.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    3e-08   
ref|XP_009498559.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    3e-08   
ref|XP_007896234.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    3e-08   
ref|XP_009229016.1|  hypothetical protein GGTG_12851                  62.4    3e-08   
ref|XP_009498560.1|  PREDICTED: histone-lysine N-methyltransferas...  62.4    3e-08   
ref|XP_002900537.1|  conserved hypothetical protein                   62.0    3e-08   
ref|XP_008077209.1|  SET                                              62.4    3e-08   
ref|XP_003206069.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    3e-08   
ref|XP_011342210.1|  PREDICTED: SET and MYND domain-containing pr...  62.4    4e-08   
ref|XP_008308614.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    4e-08   
ref|XP_003206068.2|  PREDICTED: histone-lysine N-methyltransferas...  62.0    4e-08   
gb|KIK64626.1|  hypothetical protein GYMLUDRAFT_160635                62.4    4e-08   
gb|KIY68820.1|  SET domain-containing protein                         62.4    4e-08   
ref|XP_011342209.1|  PREDICTED: SET and MYND domain-containing pr...  62.4    4e-08   
ref|XP_008308613.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    4e-08   
gb|EPY53727.1|  histone lysine methyltransferase Set6                 62.0    4e-08   
gb|ESA03480.1|  hypothetical protein GLOINDRAFT_5517                  62.0    4e-08   
ref|XP_009469960.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    4e-08   
ref|XP_009574420.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    4e-08   
ref|XP_009574419.1|  PREDICTED: histone-lysine N-methyltransferas...  62.0    4e-08   
ref|XP_009469961.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    5e-08   
ref|XP_009287673.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    5e-08   
ref|XP_009964392.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    5e-08   
ref|XP_009964393.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    5e-08   
gb|KID87988.1|  MYND finger family protein                            61.6    5e-08   
ref|XP_009287674.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    5e-08   
ref|XP_009044509.1|  hypothetical protein LOTGIDRAFT_177746           61.2    5e-08   
ref|XP_001907306.1|  hypothetical protein                             62.0    5e-08   
ref|XP_009880812.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    5e-08   
gb|KFM01757.1|  Histone-lysine N-methyltransferase SMYD1              61.6    5e-08   
dbj|GAM19370.1|  hypothetical protein SAMD00019534_025450             61.6    5e-08   
ref|XP_009094704.1|  PREDICTED: N-lysine methyltransferase SMYD2      61.6    6e-08   
ref|XP_009880813.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    6e-08   
ref|XP_008500086.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    6e-08   
ref|XP_003058665.1|  predicted protein                                61.6    6e-08   
ref|XP_009647183.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    6e-08   
ref|XP_010198038.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    6e-08   
ref|XP_008500085.1|  PREDICTED: histone-lysine N-methyltransferas...  61.6    6e-08   
ref|XP_010597727.1|  PREDICTED: N-lysine methyltransferase SMYD2      61.2    6e-08   
ref|XP_010198039.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    6e-08   
ref|XP_009330146.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    6e-08   
ref|XP_005703642.1|  SET and MYND domain-containing protein           61.2    6e-08   
ref|XP_009330147.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    7e-08   
ref|XP_010579040.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    7e-08   
ref|XP_007867840.1|  SET domain-containing protein                    61.2    7e-08   
ref|XP_010077594.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    7e-08   
ref|XP_010579041.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    7e-08   
gb|EHK45302.1|  hypothetical protein TRIATDRAFT_79702                 61.2    7e-08   
ref|XP_010077593.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    7e-08   
gb|AHG32675.1|  SET and MYND domain containing protein 1b             61.2    7e-08   
ref|XP_008308612.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    8e-08   
ref|XP_005023347.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    8e-08   
gb|EZA52150.1|  SET and MYND domain-containing protein                61.2    8e-08   
gb|AAL31881.1|AF410782_1  cardiac and skeletal muscle-specific BOP2   61.2    8e-08   
gb|EQB50906.1|  MYND finger                                           61.2    8e-08   
ref|NP_989486.1|  SET and MYND domain-containing protein 1            61.2    8e-08   
ref|XP_005023348.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    8e-08   
ref|XP_003713421.1|  hypothetical protein MGG_15522                   61.2    8e-08   
ref|XP_011163274.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    8e-08   
ref|XP_010166821.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    8e-08   
gb|ERL87192.1|  hypothetical protein D910_04592                       60.8    8e-08   
ref|XP_005023349.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    8e-08   
ref|XP_010166820.1|  PREDICTED: histone-lysine N-methyltransferas...  61.2    8e-08   
ref|XP_003965137.1|  PREDICTED: SET and MYND domain-containing pr...  60.8    8e-08   
gb|EPS28826.1|  hypothetical protein PDE_03772                        60.8    9e-08   
ref|XP_009236077.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  60.8    9e-08   
ref|XP_008211403.1|  PREDICTED: SET and MYND domain-containing pr...  61.2    9e-08   
gb|KIO04970.1|  hypothetical protein M404DRAFT_142041                 61.2    9e-08   
ref|XP_005510012.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    9e-08   
ref|XP_001604392.1|  PREDICTED: SET and MYND domain-containing pr...  61.2    9e-08   
ref|XP_005510013.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    9e-08   
emb|CBY22704.1|  unnamed protein product                              60.8    1e-07   
ref|XP_005796279.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    1e-07   
ref|XP_004914683.1|  PREDICTED: histone-lysine N-methyltransferas...  60.8    1e-07   
ref|XP_006619879.1|  PREDICTED: SET and MYND domain-containing pr...  60.8    1e-07   
ref|XP_002931556.2|  PREDICTED: histone-lysine N-methyltransferas...  60.8    1e-07   
ref|XP_006619877.1|  PREDICTED: SET and MYND domain-containing pr...  60.8    1e-07   
ref|XP_007418284.1|  hypothetical protein MELLADRAFT_69335            60.1    1e-07   
ref|XP_004914684.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    1e-07   
ref|XP_006559035.1|  PREDICTED: SET and MYND domain-containing pr...  60.8    1e-07   
emb|CEJ90658.1|  hypothetical protein VHEMI06425                      60.5    1e-07   
ref|XP_005045639.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    1e-07   
ref|XP_002128556.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    1e-07   
ref|XP_005045638.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    1e-07   
ref|XP_007851872.1|  zinc finger mynd domain-containing protein 17    60.5    1e-07   
ref|XP_010128266.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    1e-07   
emb|CDM27714.1|  SET domain                                           60.5    1e-07   
ref|XP_010142903.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    1e-07   
ref|XP_005229908.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    1e-07   
ref|XP_010022395.1|  PREDICTED: histone-lysine N-methyltransferas...  58.2    1e-07   
ref|XP_010128265.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    1e-07   
ref|XP_005229909.1|  PREDICTED: histone-lysine N-methyltransferas...  60.5    1e-07   
gb|ENN71728.1|  hypothetical protein YQE_11650                        60.1    2e-07   
ref|XP_010142904.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    2e-07   
ref|XP_007254104.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    2e-07   
ref|XP_009439749.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  59.7    2e-07   
ref|XP_009551850.1|  hypothetical protein HETIRDRAFT_53624            60.1    2e-07   
ref|XP_319707.4|  AGAP008954-PA                                       60.1    2e-07   
ref|XP_009684379.1|  PREDICTED: histone-lysine N-methyltransferas...  60.1    2e-07   
gb|KFV86972.1|  Histone-lysine N-methyltransferase SMYD1              60.1    2e-07   
gb|KIM76188.1|  hypothetical protein PILCRDRAFT_78079                 60.1    2e-07   
gb|EMF16097.1|  SET domain-containing protein                         60.1    2e-07   
ref|XP_006789911.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    2e-07   
ref|XP_004547202.1|  PREDICTED: SET and MYND domain-containing pr...  59.7    2e-07   
ref|XP_001842435.1|  conserved hypothetical protein                   60.1    2e-07   
ref|XP_008293366.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    2e-07   
ref|XP_003308794.1|  PREDICTED: N-lysine methyltransferase SMYD2 ...  59.7    2e-07   
ref|XP_006559033.1|  PREDICTED: SET and MYND domain-containing pr...  60.1    2e-07   
gb|KFV96215.1|  Histone-lysine N-methyltransferase Smyd1              56.2    2e-07   
ref|XP_006789910.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    2e-07   
ref|XP_004547200.1|  PREDICTED: SET and MYND domain-containing pr...  59.7    2e-07   
ref|XP_009993915.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    2e-07   
ref|XP_004547201.1|  PREDICTED: SET and MYND domain-containing pr...  59.7    2e-07   
gb|EPS94133.1|  hypothetical protein FOMPIDRAFT_1153487               59.7    2e-07   
ref|XP_006559034.1|  PREDICTED: SET and MYND domain-containing pr...  59.7    2e-07   
ref|XP_006009898.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    2e-07   
ref|XP_005827049.1|  hypothetical protein GUITHDRAFT_164767           59.7    2e-07   
gb|KEZ43143.1|  hypothetical protein SAPIO_CDS5036                    59.7    2e-07   
emb|CDI54469.1|  set domain-containing protein                        60.1    2e-07   
ref|XP_009993914.1|  PREDICTED: histone-lysine N-methyltransferas...  59.7    2e-07   



>ref|XP_009764594.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Nicotiana sylvestris]
Length=427

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+ALS+KG+TVS  P+KGRC+FTTRDFSPGEVII +EPYVSVP K+    SAKCEW
Sbjct  12   MEELQKALSDKGLTVSPVPEKGRCLFTTRDFSPGEVIIWEEPYVSVPNKS----SAKCEW  67

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CFTSTN+K+CSAC VVYYCG TCQKSDWKLHR EC++L KV+++RIKSL P++RLMVKLY
Sbjct  68   CFTSTNLKRCSACHVVYYCGNTCQKSDWKLHRVECKALSKVDKERIKSLTPSVRLMVKLY  127

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ E  IP T +DN+ LVE LVSH++DIDEKQLVLYAQMANLVNLILQ
Sbjct  128  LRRKLQDEKVIPATVLDNFNLVESLVSHIADIDEKQLVLYAQMANLVNLILQ  179



>ref|XP_004242023.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Solanum lycopersicum]
Length=478

 Score =   280 bits (717),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 151/172 (88%), Gaps = 5/172 (3%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEEL+EALS+KG+TVS+ P+KGRC+FTTRDFSPGEVIIS+EPYVSVP K     SAKCEW
Sbjct  1    MEELEEALSDKGLTVSSVPEKGRCLFTTRDFSPGEVIISEEPYVSVPNK-----SAKCEW  55

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CFTS+N+K+CSACQVV YCG TCQKSDWKLHR ECQ L KV+++R+KS+ P+IRLMVKLY
Sbjct  56   CFTSSNLKRCSACQVVNYCGNTCQKSDWKLHRVECQVLSKVDKERVKSITPSIRLMVKLY  115

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ E  IP T MDNY LVE LVSHM+ IDEKQLVLYAQMANLVNLILQ
Sbjct  116  LRRKLQDEKVIPITVMDNYNLVESLVSHMTGIDEKQLVLYAQMANLVNLILQ  167



>ref|XP_009618110.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Nicotiana tomentosiformis]
Length=416

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 151/172 (88%), Gaps = 4/172 (2%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+ LS+KG+T+S  P+KGRC+FTTRDFSPGEVII +EPYVSVP K+    SAKCEW
Sbjct  1    MEELQKGLSDKGLTLSPVPEKGRCLFTTRDFSPGEVIIWEEPYVSVPNKS----SAKCEW  56

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF STN+KKCSAC VVYYCG TCQKSDWKLH+ ECQ+L KV+++RIKSL PT+RLMVKLY
Sbjct  57   CFVSTNLKKCSACHVVYYCGNTCQKSDWKLHKVECQALSKVDKERIKSLTPTVRLMVKLY  116

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LR+KLQ E  IP T +DN++LVE LVSHM+DIDEKQLVLYAQMANLVNLILQ
Sbjct  117  LRKKLQDEKVIPATVLDNFSLVESLVSHMTDIDEKQLVLYAQMANLVNLILQ  168



>ref|XP_009764587.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Nicotiana sylvestris]
Length=492

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+ALS+KG+TVS  P+KGRC+FTTRDFSPGEVII +EPYVSVP K+    SAKCEW
Sbjct  12   MEELQKALSDKGLTVSPVPEKGRCLFTTRDFSPGEVIIWEEPYVSVPNKS----SAKCEW  67

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CFTSTN+K+CSAC VVYYCG TCQKSDWKLHR EC++L KV+++RIKSL P++RLMVKLY
Sbjct  68   CFTSTNLKRCSACHVVYYCGNTCQKSDWKLHRVECKALSKVDKERIKSLTPSVRLMVKLY  127

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ E  IP T +DN+ LVE LVSH++DIDEKQLVLYAQMANLVNLILQ
Sbjct  128  LRRKLQDEKVIPATVLDNFNLVESLVSHIADIDEKQLVLYAQMANLVNLILQ  179



>ref|XP_009764580.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Nicotiana sylvestris]
Length=495

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+ALS+KG+TVS  P+KGRC+FTTRDFSPGEVII +EPYVSVP K+    SAKCEW
Sbjct  12   MEELQKALSDKGLTVSPVPEKGRCLFTTRDFSPGEVIIWEEPYVSVPNKS----SAKCEW  67

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CFTSTN+K+CSAC VVYYCG TCQKSDWKLHR EC++L KV+++RIKSL P++RLMVKLY
Sbjct  68   CFTSTNLKRCSACHVVYYCGNTCQKSDWKLHRVECKALSKVDKERIKSLTPSVRLMVKLY  127

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ E  IP T +DN+ LVE LVSH++DIDEKQLVLYAQMANLVNLILQ
Sbjct  128  LRRKLQDEKVIPATVLDNFNLVESLVSHIADIDEKQLVLYAQMANLVNLILQ  179



>ref|XP_009618109.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Nicotiana tomentosiformis]
Length=482

 Score =   278 bits (711),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 151/172 (88%), Gaps = 4/172 (2%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+ LS+KG+T+S  P+KGRC+FTTRDFSPGEVII +EPYVSVP K+    SAKCEW
Sbjct  1    MEELQKGLSDKGLTLSPVPEKGRCLFTTRDFSPGEVIIWEEPYVSVPNKS----SAKCEW  56

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF STN+KKCSAC VVYYCG TCQKSDWKLH+ ECQ+L KV+++RIKSL PT+RLMVKLY
Sbjct  57   CFVSTNLKKCSACHVVYYCGNTCQKSDWKLHKVECQALSKVDKERIKSLTPTVRLMVKLY  116

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LR+KLQ E  IP T +DN++LVE LVSHM+DIDEKQLVLYAQMANLVNLILQ
Sbjct  117  LRKKLQDEKVIPATVLDNFSLVESLVSHMTDIDEKQLVLYAQMANLVNLILQ  168



>ref|XP_010322913.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Solanum lycopersicum]
Length=426

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 151/174 (87%), Gaps = 7/174 (4%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEEL+EALS+KG+TVS+ P+KGRC+FTTRDFSPGEVIIS+EPYVSVP K     SAKCEW
Sbjct  1    MEELEEALSDKGLTVSSVPEKGRCLFTTRDFSPGEVIISEEPYVSVPNK-----SAKCEW  55

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CFTS+N+K+CSACQVV YCG TCQKSDWKLHR ECQ L KV+++R+KS+ P+IRLMVKLY
Sbjct  56   CFTSSNLKRCSACQVVNYCGNTCQKSDWKLHRVECQVLSKVDKERVKSITPSIRLMVKLY  115

Query  419  LRRKLQSE--NNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ E    IP T MDNY LVE LVSHM+ IDEKQLVLYAQMANLVNLILQ
Sbjct  116  LRRKLQDEKVKVIPITVMDNYNLVESLVSHMTGIDEKQLVLYAQMANLVNLILQ  169



>ref|XP_010322911.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Solanum lycopersicum]
Length=480

 Score =   275 bits (704),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 151/174 (87%), Gaps = 7/174 (4%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEEL+EALS+KG+TVS+ P+KGRC+FTTRDFSPGEVIIS+EPYVSVP K     SAKCEW
Sbjct  1    MEELEEALSDKGLTVSSVPEKGRCLFTTRDFSPGEVIISEEPYVSVPNK-----SAKCEW  55

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CFTS+N+K+CSACQVV YCG TCQKSDWKLHR ECQ L KV+++R+KS+ P+IRLMVKLY
Sbjct  56   CFTSSNLKRCSACQVVNYCGNTCQKSDWKLHRVECQVLSKVDKERVKSITPSIRLMVKLY  115

Query  419  LRRKLQSE--NNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ E    IP T MDNY LVE LVSHM+ IDEKQLVLYAQMANLVNLILQ
Sbjct  116  LRRKLQDEKVKVIPITVMDNYNLVESLVSHMTGIDEKQLVLYAQMANLVNLILQ  169



>ref|XP_006363899.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X2 [Solanum tuberosum]
Length=478

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 150/172 (87%), Gaps = 5/172 (3%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEEL+EALS+KG+TVS+ P+KGRC+FTTRDF PGEVIIS++PYVSVP K     SAKCEW
Sbjct  1    MEELEEALSDKGLTVSSVPEKGRCLFTTRDFFPGEVIISEDPYVSVPNK-----SAKCEW  55

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CFTS N+K+CSACQVV YCG TCQK DWKLHR ECQ+L KV+++R+KS+ P+IRLMVKLY
Sbjct  56   CFTSNNLKRCSACQVVCYCGNTCQKLDWKLHRVECQALSKVDKERVKSITPSIRLMVKLY  115

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ E  IP T MDNY LVE LVSHM+DIDEKQLVLYAQMANLV+LILQ
Sbjct  116  LRRKLQDEKVIPITVMDNYNLVESLVSHMTDIDEKQLVLYAQMANLVSLILQ  167



>ref|XP_006363898.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X1 [Solanum tuberosum]
Length=480

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 150/174 (86%), Gaps = 7/174 (4%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEEL+EALS+KG+TVS+ P+KGRC+FTTRDF PGEVIIS++PYVSVP K     SAKCEW
Sbjct  1    MEELEEALSDKGLTVSSVPEKGRCLFTTRDFFPGEVIISEDPYVSVPNK-----SAKCEW  55

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CFTS N+K+CSACQVV YCG TCQK DWKLHR ECQ+L KV+++R+KS+ P+IRLMVKLY
Sbjct  56   CFTSNNLKRCSACQVVCYCGNTCQKLDWKLHRVECQALSKVDKERVKSITPSIRLMVKLY  115

Query  419  LRRKLQSE--NNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ E    IP T MDNY LVE LVSHM+DIDEKQLVLYAQMANLV+LILQ
Sbjct  116  LRRKLQDEKVKVIPITVMDNYNLVESLVSHMTDIDEKQLVLYAQMANLVSLILQ  169



>ref|XP_011097714.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Sesamum 
indicum]
Length=486

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M+ELQ+AL++K +T+ST P+KGRC+FTTR F PGEVIIS+ PYV VP K K  P +KCEW
Sbjct  1    MDELQKALNDKSLTISTLPEKGRCLFTTRAFFPGEVIISENPYVCVPNKNKESPQSKCEW  60

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+S N+KKCSAC VV+YC + CQKSDWKLH  EC++L K+++DR+KSL P+IRLMV+LY
Sbjct  61   CFSSRNLKKCSACHVVWYCSSKCQKSDWKLHSVECRALSKIDKDRLKSLTPSIRLMVRLY  120

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            +RRKL++E   PTT MDNY  VE LVSHMS++DEKQLVLYAQMANLVNLILQ
Sbjct  121  IRRKLENEKIFPTTVMDNYKHVEPLVSHMSEVDEKQLVLYAQMANLVNLILQ  172



>ref|XP_010272881.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Nelumbo 
nucifera]
 ref|XP_010272882.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Nelumbo 
nucifera]
 ref|XP_010272883.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Nelumbo 
nucifera]
 ref|XP_010272884.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Nelumbo 
nucifera]
Length=483

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 145/172 (84%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+LQ AL+ +G+TVST P+KGRC+ TTRDFS G+VIISQEPY SVP  +    S++C+ 
Sbjct  1    MEDLQSALAARGLTVSTLPEKGRCLVTTRDFSSGDVIISQEPYASVPNNSPV--SSRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+N+KKCSACQVV+YCG+TCQKS+WKLHR ECQ L  ++ D+ KS+ P+IRLMVKLY
Sbjct  59   CFASSNLKKCSACQVVWYCGSTCQKSEWKLHRLECQVLLGLDNDKRKSITPSIRLMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ +  IP TA DNY+LVE LVSHMSDIDEKQLVLYAQMANLVNLILQ
Sbjct  119  LRRKLQGDQAIPATATDNYSLVEALVSHMSDIDEKQLVLYAQMANLVNLILQ  170



>ref|XP_010664254.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Vitis vinifera]
Length=433

 Score =   259 bits (661),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 145/172 (84%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+LQ  LS  G+TVST P+KGRC+ + +DFSPGEVIISQEPYVSVP  +     ++CE 
Sbjct  1    MEDLQADLSANGLTVSTTPEKGRCLLSIKDFSPGEVIISQEPYVSVPNNSAV--HSRCEG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+N+KKCSAC VV+YCG+TCQKSDWKLHR EC +L ++E++R KSL P+IRLMVKLY
Sbjct  59   CFRSSNLKKCSACHVVWYCGSTCQKSDWKLHRLECNALSRLEKERQKSLTPSIRLMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            +RRKLQSE  +PTTA DNY LVE LVSH++DIDEKQLVLYAQMANLVNLILQ
Sbjct  119  MRRKLQSEKIMPTTARDNYNLVEALVSHITDIDEKQLVLYAQMANLVNLILQ  170



>ref|XP_010664253.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Vitis vinifera]
Length=445

 Score =   259 bits (661),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 145/172 (84%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+LQ  LS  G+TVST P+KGRC+ + +DFSPGEVIISQEPYVSVP  +     ++CE 
Sbjct  1    MEDLQADLSANGLTVSTTPEKGRCLLSIKDFSPGEVIISQEPYVSVPNNSAV--HSRCEG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+N+KKCSAC VV+YCG+TCQKSDWKLHR EC +L ++E++R KSL P+IRLMVKLY
Sbjct  59   CFRSSNLKKCSACHVVWYCGSTCQKSDWKLHRLECNALSRLEKERQKSLTPSIRLMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            +RRKLQSE  +PTTA DNY LVE LVSH++DIDEKQLVLYAQMANLVNLILQ
Sbjct  119  MRRKLQSEKIMPTTARDNYNLVEALVSHITDIDEKQLVLYAQMANLVNLILQ  170



>ref|XP_010664252.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Vitis vinifera]
 emb|CBI19071.3| unnamed protein product [Vitis vinifera]
Length=480

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 145/172 (84%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+LQ  LS  G+TVST P+KGRC+ + +DFSPGEVIISQEPYVSVP  +     ++CE 
Sbjct  1    MEDLQADLSANGLTVSTTPEKGRCLLSIKDFSPGEVIISQEPYVSVPNNSAV--HSRCEG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+N+KKCSAC VV+YCG+TCQKSDWKLHR EC +L ++E++R KSL P+IRLMVKLY
Sbjct  59   CFRSSNLKKCSACHVVWYCGSTCQKSDWKLHRLECNALSRLEKERQKSLTPSIRLMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            +RRKLQSE  +PTTA DNY LVE LVSH++DIDEKQLVLYAQMANLVNLILQ
Sbjct  119  MRRKLQSEKIMPTTARDNYNLVEALVSHITDIDEKQLVLYAQMANLVNLILQ  170



>ref|XP_006472718.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Citrus 
sinensis]
Length=481

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+AL ++G+TV+  P+KGRC++TT+DF PGEVIISQEPYV VP  + +   ++C+ 
Sbjct  1    MEELQKALQDRGLTVTGLPEKGRCLYTTKDFYPGEVIISQEPYVCVPNNSSS--ISRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+N+KKCSACQVV+YCG+ CQK DWKLHR ECQ L ++++++ KS+ P+IRLM+KLY
Sbjct  59   CFASSNLKKCSACQVVWYCGSNCQKLDWKLHRLECQVLSRLDKEKRKSVTPSIRLMLKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ++N IP+TA DNY+LVE LV+HMSDIDEKQL+LYAQMANLVNLILQ
Sbjct  119  LRRKLQNDNVIPSTATDNYSLVEALVAHMSDIDEKQLLLYAQMANLVNLILQ  170



>gb|EYU22920.1| hypothetical protein MIMGU_mgv1a005471mg [Erythranthe guttata]
Length=482

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+ L++KG+ VST PQKGRC+FTTRDFSPGEVIISQ PYV+VP K K  P +KCEW
Sbjct  1    MEELQKFLNDKGLAVSTLPQKGRCLFTTRDFSPGEVIISQIPYVAVPNKNKESPESKCEW  60

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+S  +K CSAC+VV+YC + CQKSDWK HR EC++L KV+++R+K L P++RLMVKL 
Sbjct  61   CFSSNTLKACSACRVVWYCSSNCQKSDWKFHRIECRTLSKVDKERVKLLTPSVRLMVKLC  120

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            +RRKL+ E   P T  DNY  V+ LVSHMS+++EKQL+LYAQMANLVNLILQ
Sbjct  121  IRRKLEIEKIFPATVADNYKHVDALVSHMSEVEEKQLILYAQMANLVNLILQ  172



>gb|KJB29251.1| hypothetical protein B456_005G091200 [Gossypium raimondii]
Length=415

 Score =   251 bits (640),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 143/172 (83%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ +L  +G+T+ST P KGR +   RDF PGEVIISQ+PYV VP  + T   ++C+ 
Sbjct  1    MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQDPYVCVPNNSLT--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+ +N+KKCSAC VV+YCG++CQK +WKLHRFECQ L K++++R KS+ PTIR++VKLY
Sbjct  59   CFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRFECQLLAKLDKERRKSVTPTIRMIVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ+EN IP TAMDNY LVE LVSHMSDIDEKQL+LYAQMANLVNLILQ
Sbjct  119  LRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQ  170



>ref|XP_007222803.1| hypothetical protein PRUPE_ppa005026mg [Prunus persica]
 gb|EMJ24002.1| hypothetical protein PRUPE_ppa005026mg [Prunus persica]
Length=480

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ AL ++ +TVS  P+KGRC+FTTRDFSPGEVIISQEPYVSVP  +     ++C+ 
Sbjct  1    MEELQRALEDRSLTVSNVPEKGRCLFTTRDFSPGEVIISQEPYVSVPNNSSA--ESRCDA  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+N+KKCSACQVVYYC  +CQKS+WKLHR EC++L K+ ++R  ++ P+IRLM+KLY
Sbjct  59   CFESSNLKKCSACQVVYYCSNSCQKSEWKLHRLECEALSKLHKERRMAVTPSIRLMIKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LR KLQ+E  IP +AMDNY LVE LV+HMS+IDEKQLVLYAQMANLV+LILQ
Sbjct  119  LRTKLQTERVIPASAMDNYKLVEALVAHMSEIDEKQLVLYAQMANLVSLILQ  170



>gb|KDO80748.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=481

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+AL ++G+TV+  P+KGRC++TT+DF PGEVIISQEPYV VP  + +   ++C+ 
Sbjct  1    MEELQKALQDRGLTVTGLPEKGRCLYTTKDFYPGEVIISQEPYVCVPNNSSS--ISRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+N+KKCSACQVV+YCG+ CQK DWKLHR ECQ L ++++++ KS+ P+IRLM+KLY
Sbjct  59   CFASSNLKKCSACQVVWYCGSNCQKLDWKLHRLECQVLSRLDKEKRKSVTPSIRLMLKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ++N IP+T  DNY+LVE LV+HMSDIDEKQL+LYAQ+ANLVNLILQ
Sbjct  119  LRRKLQNDNVIPSTTTDNYSLVEALVAHMSDIDEKQLLLYAQIANLVNLILQ  170



>gb|KJB29249.1| hypothetical protein B456_005G091200 [Gossypium raimondii]
Length=486

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 143/172 (83%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ +L  +G+T+ST P KGR +   RDF PGEVIISQ+PYV VP  + T   ++C+ 
Sbjct  1    MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQDPYVCVPNNSLT--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+ +N+KKCSAC VV+YCG++CQK +WKLHRFECQ L K++++R KS+ PTIR++VKLY
Sbjct  59   CFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRFECQLLAKLDKERRKSVTPTIRMIVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ+EN IP TAMDNY LVE LVSHMSDIDEKQL+LYAQMANLVNLILQ
Sbjct  119  LRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQ  170



>gb|KDP32756.1| hypothetical protein JCGZ_12048 [Jatropha curcas]
Length=482

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M+ELQEAL + G+TV   P+KGRC+FTT+DF PGEVIISQEPYV VP  + T   ++C+ 
Sbjct  1    MDELQEALQDWGLTVHNLPEKGRCLFTTKDFYPGEVIISQEPYVCVPNNSST--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CFTS N+KKCSACQVV+YCG+ CQK +WKLHR EC+ L K+++DR KS+ P++RLMVKLY
Sbjct  59   CFTSVNLKKCSACQVVWYCGSKCQKLEWKLHRLECEVLSKLDKDRRKSVTPSVRLMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ+   +  TA DNY LVE+LV+HM DIDEKQL+LYAQMANLVNLILQ
Sbjct  119  LRRKLQNNKTLSATATDNYNLVEMLVAHMKDIDEKQLLLYAQMANLVNLILQ  170



>ref|XP_008233908.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Prunus mume]
Length=480

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 143/172 (83%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ AL ++ +TVS  P+KGRC+FT+RDFSPGEVIISQEPYVSVP  +     ++C+ 
Sbjct  1    MEELQRALEDRALTVSNVPEKGRCLFTSRDFSPGEVIISQEPYVSVPNNSSA--ESRCDA  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+N+KKCSACQVVYYC  +CQKS+WKLHR EC++L K+ ++R  ++ P+IRLM+KLY
Sbjct  59   CFESSNLKKCSACQVVYYCSNSCQKSEWKLHRLECEALSKLHKERRMAVTPSIRLMIKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LR KLQ+E   P +AMDNY LVE LV+HMS+IDEKQLVLYAQMANLV+LILQ
Sbjct  119  LRTKLQTEKVSPASAMDNYKLVEALVAHMSEIDEKQLVLYAQMANLVSLILQ  170



>ref|XP_007018969.1| SET domain protein isoform 2 [Theobroma cacao]
 gb|EOY16194.1| SET domain protein isoform 2 [Theobroma cacao]
Length=480

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+LQ +L  +G++VS  P KGR + TT+DF PGEVIISQEPYV VP  + T  S  C+ 
Sbjct  1    MEQLQASLQARGLSVSNLPDKGRSLVTTKDFYPGEVIISQEPYVFVPNNSLTESS--CDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+ +N+KKCSACQVV+YCG+TCQK +WKLHR ECQ+L K++++R KS+ PTIR+MVKLY
Sbjct  59   CFSKSNLKKCSACQVVWYCGSTCQKLEWKLHRLECQALAKLDKERRKSVTPTIRMMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            LRRKLQSE  IP TA+DNY LVE LVSHM DIDEKQLVLYAQMANLVNLIL
Sbjct  119  LRRKLQSERVIPVTAIDNYNLVEQLVSHMLDIDEKQLVLYAQMANLVNLIL  169



>ref|XP_007018968.1| SET domain protein isoform 1 [Theobroma cacao]
 gb|EOY16193.1| SET domain protein isoform 1 [Theobroma cacao]
Length=479

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+LQ +L  +G++VS  P KGR + TT+DF PGEVIISQEPYV VP  + T  S  C+ 
Sbjct  1    MEQLQASLQARGLSVSNLPDKGRSLVTTKDFYPGEVIISQEPYVFVPNNSLTESS--CDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+ +N+KKCSACQVV+YCG+TCQK +WKLHR ECQ+L K++++R KS+ PTIR+MVKLY
Sbjct  59   CFSKSNLKKCSACQVVWYCGSTCQKLEWKLHRLECQALAKLDKERRKSVTPTIRMMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            LRRKLQSE  IP TA+DNY LVE LVSHM DIDEKQLVLYAQMANLVNLIL
Sbjct  119  LRRKLQSERVIPVTAIDNYNLVEQLVSHMLDIDEKQLVLYAQMANLVNLIL  169



>ref|XP_007018970.1| SET domain protein isoform 3 [Theobroma cacao]
 gb|EOY16195.1| SET domain protein isoform 3 [Theobroma cacao]
Length=481

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+LQ +L  +G++VS  P KGR + TT+DF PGEVIISQEPYV VP  + T  S  C+ 
Sbjct  1    MEQLQASLQARGLSVSNLPDKGRSLVTTKDFYPGEVIISQEPYVFVPNNSLTESS--CDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+ +N+KKCSACQVV+YCG+TCQK +WKLHR ECQ+L K++++R KS+ PTIR+MVKLY
Sbjct  59   CFSKSNLKKCSACQVVWYCGSTCQKLEWKLHRLECQALAKLDKERRKSVTPTIRMMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            LRRKLQSE  IP TA+DNY LVE LVSHM DIDEKQLVLYAQMANLVNLIL
Sbjct  119  LRRKLQSERVIPVTAIDNYNLVEQLVSHMLDIDEKQLVLYAQMANLVNLIL  169



>gb|KJB29253.1| hypothetical protein B456_005G091200 [Gossypium raimondii]
Length=484

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 141/172 (82%), Gaps = 4/172 (2%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ +L  +G+T+ST P KGR +   RDF P  VIISQ+PYV VP  + T   ++C+ 
Sbjct  1    MEELQASLQPRGLTLSTFPDKGRSLLAARDFYP--VIISQDPYVCVPNNSLT--ESRCDG  56

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+ +N+KKCSAC VV+YCG++CQK +WKLHRFECQ L K++++R KS+ PTIR++VKLY
Sbjct  57   CFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRFECQLLAKLDKERRKSVTPTIRMIVKLY  116

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ+EN IP TAMDNY LVE LVSHMSDIDEKQL+LYAQMANLVNLILQ
Sbjct  117  LRRKLQNENVIPVTAMDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQ  168



>ref|XP_008338790.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Malus domestica]
Length=480

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ AL  +G+TVS  P KGR +FTTRDFSPGEVII QEPYV VP  +     ++C+ 
Sbjct  1    MEELQRALENRGLTVSNLPDKGRSLFTTRDFSPGEVIILQEPYVCVPNNSPA--ESRCDA  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+N+KKCSACQVVYYC ++CQK +WKLHR EC++L K++++R  ++ P+IRLM+KLY
Sbjct  59   CFQSSNLKKCSACQVVYYCCSSCQKFEWKLHRLECEALSKLQKERRMAVTPSIRLMIKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LR KLQ+E  IP++A+DNY LVE LV+HMS+IDEKQLVLYAQMANLV+LILQ
Sbjct  119  LRTKLQAEKIIPSSAVDNYKLVEALVAHMSEIDEKQLVLYAQMANLVSLILQ  170



>ref|XP_010538974.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Tarenaya 
hassleriana]
Length=484

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M +LQ  L ++G++VS  P KGRC+FT+RDF PGEVI+ QEPYV VP+       ++C+ 
Sbjct  1    MADLQNVLQDRGLSVSNLPDKGRCLFTSRDFRPGEVILRQEPYVFVPSNGSK--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            C T+ N+KKCS CQVV+YCG++CQKS+WKLHR ECQ+L ++++D+ +S+ PTIRLMVKLY
Sbjct  59   CLTTINLKKCSGCQVVWYCGSSCQKSEWKLHRLECQALSRLDKDKRRSVTPTIRLMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            L+RKLQ+E  IP T  DNY LV  LVSHMS+IDEKQ+VLYAQMANLVNLILQ
Sbjct  119  LKRKLQNEQVIPMTITDNYGLVVALVSHMSEIDEKQIVLYAQMANLVNLILQ  170



>ref|XP_009366986.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Pyrus x bretschneideri]
Length=480

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ AL  +G+TVS  P KGR +FTTRDFSPGEVII QEPYV VP  +     ++C+ 
Sbjct  1    MEELQRALENRGLTVSNLPDKGRSLFTTRDFSPGEVIILQEPYVCVPNNSLA--ESRCDA  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+N+KKCSACQVVYYC ++CQKS+WKLH  EC++L K++++R  ++ P+IRLM+KLY
Sbjct  59   CFQSSNLKKCSACQVVYYCCSSCQKSEWKLHHLECEALSKLQKERRMAVTPSIRLMLKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LR KLQ+E  IP+ A+DNY LVE LV+HMS+IDEKQLVLYAQMANLV+LILQ
Sbjct  119  LRTKLQAEKIIPSAAVDNYKLVEALVAHMSEIDEKQLVLYAQMANLVSLILQ  170



>ref|XP_009366987.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Pyrus x bretschneideri]
Length=478

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ AL  +G+TVS  P KGR +FTTRDFSPGEVII QEPYV VP  +     ++C+ 
Sbjct  1    MEELQRALENRGLTVSNLPDKGRSLFTTRDFSPGEVIILQEPYVCVPNNSLA--ESRCDA  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+N+KKCSACQVVYYC ++CQKS+WKLH  EC++L K++++R  ++ P+IRLM+KLY
Sbjct  59   CFQSSNLKKCSACQVVYYCCSSCQKSEWKLHHLECEALSKLQKERRMAVTPSIRLMLKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LR KLQ+E  IP+ A+DNY LVE LV+HMS+IDEKQLVLYAQMANLV+LILQ
Sbjct  119  LRTKLQAEKIIPSAAVDNYKLVEALVAHMSEIDEKQLVLYAQMANLVSLILQ  170



>gb|KEH34848.1| histone-lysine N-methyltransferase [Medicago truncatula]
Length=392

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 6/172 (3%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+AL    +TVST  +KGR +FTTRDF PG+VIISQEPYV VPT+       +C+ 
Sbjct  1    MEELQQALKNCNLTVSTISEKGRSLFTTRDFHPGDVIISQEPYVCVPTQ------KRCDG  54

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF++TN+ KCS CQVV+YCG  CQKS+WKLHR ECQ+L +++ ++ KS+ P+IRLM+KLY
Sbjct  55   CFSTTNLSKCSRCQVVWYCGTPCQKSEWKLHRLECQALSRLDSNKRKSVTPSIRLMLKLY  114

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ +  IP+TAMDNY LVE LV+HMSDI E+QLVLYAQMANLV+LILQ
Sbjct  115  LRRKLQDQKIIPSTAMDNYKLVEALVAHMSDIKEEQLVLYAQMANLVHLILQ  166



>gb|KJB29252.1| hypothetical protein B456_005G091200 [Gossypium raimondii]
Length=496

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 142/182 (78%), Gaps = 12/182 (7%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ +L  +G+T+ST P KGR +   RDF PGEVIISQ+PYV VP  + T   ++C+ 
Sbjct  1    MEELQASLQPRGLTLSTFPDKGRSLLAARDFYPGEVIISQDPYVCVPNNSLT--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+ +N+KKCSAC VV+YCG++CQK +WKLHRFECQ L K++++R KS+ PTIR++VKLY
Sbjct  59   CFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRFECQLLAKLDKERRKSVTPTIRMIVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVS----------HMSDIDEKQLVLYAQMANLVNLI  568
            LRRKLQ+EN IP TAMDNY LVE LVS           MSDIDEKQL+LYAQMANLVNLI
Sbjct  119  LRRKLQNENVIPVTAMDNYNLVEALVSPILFSLKLEKDMSDIDEKQLLLYAQMANLVNLI  178

Query  569  LQ  574
            LQ
Sbjct  179  LQ  180



>ref|XP_004290832.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ +L  +G+TVS  P+KGRC+ TT+DF PG+VIISQEPYV VP  +    ++KC+ 
Sbjct  2    MEELQSSLGNRGLTVSKLPEKGRCLLTTKDFYPGDVIISQEPYVHVPNNS--ADNSKCDA  59

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S+++ KCS CQVVYYC ATCQKS+WKLHR EC++L KV +++ +++ P++RLM++LY
Sbjct  60   CFESSHLMKCSRCQVVYYCSATCQKSEWKLHRLECEALSKVPKEKRRAVTPSLRLMIRLY  119

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
             R KLQS+  IPT+AMDNY LVE LV+HMS++DEKQ+VLYAQMANLVN IL+
Sbjct  120  CRSKLQSQKTIPTSAMDNYGLVEALVAHMSEVDEKQMVLYAQMANLVNFILE  171



>gb|KEH34847.1| histone-lysine N-methyltransferase [Medicago truncatula]
Length=440

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 6/172 (3%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+AL    +TVST  +KGR +FTTRDF PG+VIISQEPYV VPT+       +C+ 
Sbjct  1    MEELQQALKNCNLTVSTISEKGRSLFTTRDFHPGDVIISQEPYVCVPTQ------KRCDG  54

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF++TN+ KCS CQVV+YCG  CQKS+WKLHR ECQ+L +++ ++ KS+ P+IRLM+KLY
Sbjct  55   CFSTTNLSKCSRCQVVWYCGTPCQKSEWKLHRLECQALSRLDSNKRKSVTPSIRLMLKLY  114

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ +  IP+TAMDNY LVE LV+HMSDI E+QLVLYAQMANLV+LILQ
Sbjct  115  LRRKLQDQKIIPSTAMDNYKLVEALVAHMSDIKEEQLVLYAQMANLVHLILQ  166



>ref|XP_010666643.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=427

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEEL+ AL+E  +TVS  P+KGRC+   ++FSPGE+IISQEP +SVP  + +G S +CE 
Sbjct  1    MEELRRALAELSLTVSFLPEKGRCLLAAKNFSPGEIIISQEPCISVPNNS-SGVS-RCEV  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF + NVKKCSAC +V+YCG TCQK+DW LHR ECQ+L K+ ++R K L P+IRLMVKLY
Sbjct  59   CFATANVKKCSACHLVWYCGRTCQKADWTLHRVECQTLSKLGKERQKYLTPSIRLMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ E  IPTT  DNY LVE LVSHM D+DEKQL+LYAQMANLVN+ILQ
Sbjct  119  LRRKLQDEKVIPTTVTDNYNLVEALVSHMPDMDEKQLLLYAQMANLVNVILQ  170



>gb|AES71348.2| histone-lysine N-methyltransferase [Medicago truncatula]
Length=475

 Score =   236 bits (602),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 6/172 (3%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+AL    +TVST  +KGR +FTTRDF PG+VIISQEPYV VPT+       +C+ 
Sbjct  1    MEELQQALKNCNLTVSTISEKGRSLFTTRDFHPGDVIISQEPYVCVPTQ------KRCDG  54

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF++TN+ KCS CQVV+YCG  CQKS+WKLHR ECQ+L +++ ++ KS+ P+IRLM+KLY
Sbjct  55   CFSTTNLSKCSRCQVVWYCGTPCQKSEWKLHRLECQALSRLDSNKRKSVTPSIRLMLKLY  114

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ +  IP+TAMDNY LVE LV+HMSDI E+QLVLYAQMANLV+LILQ
Sbjct  115  LRRKLQDQKIIPSTAMDNYKLVEALVAHMSDIKEEQLVLYAQMANLVHLILQ  166



>ref|XP_010694872.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010695485.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010696053.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010665503.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=482

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEEL+ AL+E  +TVS  P+KGRC+   ++FSPGE+IISQEP +SVP  + +G S +CE 
Sbjct  1    MEELRRALAELSLTVSFLPEKGRCLLAAKNFSPGEIIISQEPCISVPNNS-SGVS-RCEV  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF + NVKKCSAC +V+YCG TCQK+DW LHR ECQ+L K+ ++R K L P+IRLMVKLY
Sbjct  59   CFATANVKKCSACHLVWYCGRTCQKADWTLHRVECQTLSKLGKERQKYLTPSIRLMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ E  IPTT  DNY LVE LVSHM D+DEKQL+LYAQMANLVN+ILQ
Sbjct  119  LRRKLQDEKVIPTTVTDNYNLVEALVSHMPDMDEKQLLLYAQMANLVNVILQ  170



>ref|XP_010091345.1| Histone-lysine N-methyltransferase [Morus notabilis]
 gb|EXB44335.1| Histone-lysine N-methyltransferase [Morus notabilis]
Length=463

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ ALS +G+TVST P+KGRC+FTTRDF PGEVIIS++PYV  P K+  G   +C+ 
Sbjct  1    MEELQRALSSRGLTVSTLPEKGRCLFTTRDFRPGEVIISEKPYVCAPNKSGDGVEWRCDG  60

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF +TN+K+CS CQV +YCG+ CQK +WKLHR EC +L K+++D+ KS+ P+IRLM++LY
Sbjct  61   CFGTTNLKRCSTCQVAWYCGSNCQKEEWKLHRLECDALSKLDKDKRKSVTPSIRLMLRLY  120

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRK ++E  IP TAM+NY LVE LVSHMSDI+EKQLVLYAQMANLVNLILQ
Sbjct  121  LRRKFEAERVIPATAMENYKLVEALVSHMSDIEEKQLVLYAQMANLVNLILQ  172



>ref|XP_010926452.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Elaeis guineensis]
Length=467

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            A+M++LQ ALS  G+TV++ P KGR + TTRDFSPGEVII QEPY S P +  +G S  C
Sbjct  2    AWMDDLQTALSAHGLTVASIPGKGRGLVTTRDFSPGEVIICQEPYASTPKQISSGSS--C  59

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCSAC+V +YCG  CQ+S+WKLH+ ECQ+L  +  +R K L PTIRLMV+
Sbjct  60   DGCFASNNLRKCSACRVAWYCGNACQRSEWKLHQLECQALVALSEERKKKLTPTIRLMVR  119

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LRRKLQSE  IPTTA+DNY+LVE L SH+SD+D++QLVLYAQMANLV L+L
Sbjct  120  LMLRRKLQSEQVIPTTAIDNYSLVEALESHISDVDKEQLVLYAQMANLVKLVL  172



>ref|XP_002513816.1| protein with unknown function [Ricinus communis]
 gb|EEF48399.1| protein with unknown function [Ricinus communis]
Length=482

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ AL   G+ V+   +KGR + TT+DF+PGEVIISQEPYV VP  + T   ++C+ 
Sbjct  1    MEELQAALQNWGLRVANVTEKGRSLVTTKDFNPGEVIISQEPYVCVPNNSAT--ESRCDR  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+S+NVKKCSACQV +YCG++CQK +WKLHR EC++L K+++DR K + P+IRLMV+L 
Sbjct  59   CFSSSNVKKCSACQVAWYCGSSCQKLEWKLHRIECEALSKLDKDRRKYVTPSIRLMVRLL  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            +RRKLQSE  I +TA DNY LVE LV+HM DIDEKQLVLYAQMANLVNLIL+
Sbjct  119  IRRKLQSEKIISSTATDNYDLVEALVAHMKDIDEKQLVLYAQMANLVNLILR  170



>gb|KHG02872.1| Histone-lysine N-methyltransferase ASHR1 -like protein [Gossypium 
arboreum]
Length=478

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 137/172 (80%), Gaps = 3/172 (2%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ +L  +G+T+ST   KGR +   RDF PGEVIISQEPYV VP  + T   ++C+ 
Sbjct  1    MEELQASLQPRGLTLSTFHDKGRSLLAARDFYPGEVIISQEPYVCVPNNSLT--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+ +N+KKCSAC VV+YCG++CQK +WKLHR ECQ L K++++R KS+ PTIR+MVKLY
Sbjct  59   CFSKSNLKKCSACHVVWYCGSSCQKLEWKLHRLECQLLAKLDKERRKSVTPTIRMMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ+ N IP TAMDNY LVE L   MSDIDEKQL+LYAQMANLVNLILQ
Sbjct  119  LRRKLQNGNVIPVTAMDNYNLVEAL-KDMSDIDEKQLLLYAQMANLVNLILQ  169



>ref|XP_010926450.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Elaeis guineensis]
Length=481

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            A+M++LQ ALS  G+TV++ P KGR + TTRDFSPGEVII QEPY S P +  +G S  C
Sbjct  2    AWMDDLQTALSAHGLTVASIPGKGRGLVTTRDFSPGEVIICQEPYASTPKQISSGSS--C  59

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCSAC+V +YCG  CQ+S+WKLH+ ECQ+L  +  +R K L PTIRLMV+
Sbjct  60   DGCFASNNLRKCSACRVAWYCGNACQRSEWKLHQLECQALVALSEERKKKLTPTIRLMVR  119

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LRRKLQSE  IPTTA+DNY+LVE L SH+SD+D++QLVLYAQMANLV L+L
Sbjct  120  LMLRRKLQSEQVIPTTAIDNYSLVEALESHISDVDKEQLVLYAQMANLVKLVL  172



>ref|XP_011012503.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X4 [Populus euphratica]
Length=413

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ  + + G+ VS  P+KGRC+ TT++F PGEVI+ QEPYV VP  + T   ++C+ 
Sbjct  1    MEELQNVVRDGGLAVSNLPEKGRCLLTTKNFHPGEVILRQEPYVCVPNNSST--VSRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S N+KKCSACQVV+YCG+TCQKS+WKLHR EC +L ++E+++ K++ P+IRLMV+LY
Sbjct  59   CFASENLKKCSACQVVWYCGSTCQKSEWKLHRLECGALSRLEKEKRKAVTPSIRLMVRLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ+E  IPT   D+Y  VE LVSH+ ++DEKQLVLYAQMANLV+LILQ
Sbjct  119  LRRKLQNEMFIPTGVTDSYNFVESLVSHLKELDEKQLVLYAQMANLVHLILQ  170



>ref|XP_004500595.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X1 [Cicer arietinum]
Length=482

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 135/172 (78%), Gaps = 1/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+LQ AL ++ +TVS  P KGR +FTTRDF PGEVIIS+E YV VP    +    +C+ 
Sbjct  1    MEDLQRALKDRNLTVSNVPGKGRSLFTTRDFYPGEVIISEEAYVCVPNNNNSS-HKRCDG  59

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CFT+TN+ KCS C VV+YCG  CQKS+WKLHR EC+ L +++ D+ KS+ P+IRLM+KLY
Sbjct  60   CFTTTNLSKCSRCHVVWYCGTACQKSEWKLHRLECEVLSRLDYDKRKSVTPSIRLMLKLY  119

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ E  IP+TA DNY LVE LV+HMSDI E+QLVLYAQMANLV+LILQ
Sbjct  120  LRRKLQDEKIIPSTARDNYKLVEALVAHMSDITEEQLVLYAQMANLVHLILQ  171



>emb|CDP12439.1| unnamed protein product [Coffea canephora]
Length=167

 Score =   221 bits (564),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +2

Query  59   MEELQEALSE-KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCE  235
            MEELQ+AL++ + +TVST P KGRC+FT+R FSPGEVIISQEPYV+VP K     S++CE
Sbjct  1    MEELQKALNDGRSLTVSTLPNKGRCLFTSRHFSPGEVIISQEPYVAVPNKNSNDSSSRCE  60

Query  236  WCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKL  415
            WCF++ N+KKCSACQVV+YCG+TCQK+DWKLHR ECQ L KVE+ RIKSL P+IRLMVKL
Sbjct  61   WCFSTRNLKKCSACQVVWYCGSTCQKTDWKLHRLECQVLSKVEKGRIKSLTPSIRLMVKL  120

Query  416  YLRRKLQSENNIPTTAMDNYALVELLVSHMS  508
            YLRRKLQ E  I  T+ DNY LVE LVS + 
Sbjct  121  YLRRKLQVEQVIAMTSTDNYGLVEALVSPLG  151



>gb|KGN50970.1| hypothetical protein Csa_5G376270 [Cucumis sativus]
Length=496

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 135/173 (78%), Gaps = 2/173 (1%)
 Frame = +2

Query  56   YMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCE  235
            +ME+L  AL+++G+TV+  P+KGR +FTTR+F PGE IISQEPYV VP  +     ++C+
Sbjct  15   FMEDLHSALNDRGLTVTILPEKGRSLFTTRNFRPGEEIISQEPYVCVPNNSPV--ESRCD  72

Query  236  WCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKL  415
             CF S N+KKCSAC+V +YC + CQKS+WKLHR EC +L ++++DR KS+ P+IRLM+KL
Sbjct  73   RCFASINLKKCSACKVAWYCSSVCQKSEWKLHRLECDALARLDKDRHKSVTPSIRLMIKL  132

Query  416  YLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            ++RRKLQSE  IP  A DNY LVE L+ HMS IDEKQLVLYAQM  LVN ILQ
Sbjct  133  FIRRKLQSEKVIPMAATDNYKLVEELIDHMSGIDEKQLVLYAQMGTLVNFILQ  185



>ref|XP_011012500.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X1 [Populus euphratica]
Length=481

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ  + + G+ VS  P+KGRC+ TT++F PGEVI+ QEPYV VP  + T   ++C+ 
Sbjct  1    MEELQNVVRDGGLAVSNLPEKGRCLLTTKNFHPGEVILRQEPYVCVPNNSST--VSRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S N+KKCSACQVV+YCG+TCQKS+WKLHR EC +L ++E+++ K++ P+IRLMV+LY
Sbjct  59   CFASENLKKCSACQVVWYCGSTCQKSEWKLHRLECGALSRLEKEKRKAVTPSIRLMVRLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ+E  IPT   D+Y  VE LVSH+ ++DEKQLVLYAQMANLV+LILQ
Sbjct  119  LRRKLQNEMFIPTGVTDSYNFVESLVSHLKELDEKQLVLYAQMANLVHLILQ  170



>ref|XP_011012501.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X2 [Populus euphratica]
Length=480

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ  + + G+ VS  P+KGRC+ TT++F PGEVI+ QEPYV VP  + T   ++C+ 
Sbjct  1    MEELQNVVRDGGLAVSNLPEKGRCLLTTKNFHPGEVILRQEPYVCVPNNSST--VSRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S N+KKCSACQVV+YCG+TCQKS+WKLHR EC +L ++E+++ K++ P+IRLMV+LY
Sbjct  59   CFASENLKKCSACQVVWYCGSTCQKSEWKLHRLECGALSRLEKEKRKAVTPSIRLMVRLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ+E  IPT   D+Y  VE LVSH+ ++DEKQLVLYAQMANLV+LILQ
Sbjct  119  LRRKLQNEMFIPTGVTDSYNFVESLVSHLKELDEKQLVLYAQMANLVHLILQ  170



>ref|XP_011012502.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X3 [Populus euphratica]
Length=479

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ  + + G+ VS  P+KGRC+ TT++F PGEVI+ QEPYV VP  + T   ++C+ 
Sbjct  1    MEELQNVVRDGGLAVSNLPEKGRCLLTTKNFHPGEVILRQEPYVCVPNNSST--VSRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S N+KKCSACQVV+YCG+TCQKS+WKLHR EC +L ++E+++ K++ P+IRLMV+LY
Sbjct  59   CFASENLKKCSACQVVWYCGSTCQKSEWKLHRLECGALSRLEKEKRKAVTPSIRLMVRLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ+E  IPT   D+Y  VE LVSH+ ++DEKQLVLYAQMANLV+LILQ
Sbjct  119  LRRKLQNEMFIPTGVTDSYNFVESLVSHLKELDEKQLVLYAQMANLVHLILQ  170



>ref|XP_004140329.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Cucumis 
sativus]
 ref|XP_004161650.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Cucumis 
sativus]
Length=482

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 134/172 (78%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+L  AL+++G+TV+  P+KGR +FTTR+F PGE IISQEPYV VP  +     ++C+ 
Sbjct  1    MEDLHSALNDRGLTVTILPEKGRSLFTTRNFRPGEEIISQEPYVCVPNNSPV--ESRCDR  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S N+KKCSAC+V +YC + CQKS+WKLHR EC +L ++++DR KS+ P+IRLM+KL+
Sbjct  59   CFASINLKKCSACKVAWYCSSVCQKSEWKLHRLECDALARLDKDRHKSVTPSIRLMIKLF  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            +RRKLQSE  IP  A DNY LVE L+ HMS IDEKQLVLYAQM  LVN ILQ
Sbjct  119  IRRKLQSEKVIPMAATDNYKLVEELIDHMSGIDEKQLVLYAQMGTLVNFILQ  170



>ref|NP_849969.1| SET domain group protein 37 [Arabidopsis thaliana]
 sp|Q7XJS0.2|ASHR1_ARATH RecName: Full=Histone-lysine N-methyltransferase ASHR1; AltName: 
Full=ASH1-related protein 1; AltName: Full=Protein SET DOMAIN 
GROUP 37 [Arabidopsis thaliana]
 gb|ABP88121.1| At2g17900 [Arabidopsis thaliana]
 gb|AEC06700.1| SET domain group protein 37 [Arabidopsis thaliana]
Length=480

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M +LQ  L ++ + VS  PQKGR +FT RDF PGEVI+SQ+PY+ VP  T +   ++C+ 
Sbjct  1    MADLQRFLQDRCLGVSNLPQKGRSLFTARDFRPGEVILSQKPYICVPNNTSS--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF + N+KKCSACQVV+YCG++CQKS+WKLHR EC++L ++E+++ K + PTIRLMV+LY
Sbjct  59   CFKTNNLKKCSACQVVWYCGSSCQKSEWKLHRDECKALTRLEKEKRKFVTPTIRLMVRLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            ++R LQ+E  +P T  DNY+LVE LVSHMS+IDEKQ++LYAQMANLVNLILQ
Sbjct  119  IKRNLQNEKVLPITTTDNYSLVEALVSHMSEIDEKQMLLYAQMANLVNLILQ  170



>ref|XP_011001420.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X3 [Populus euphratica]
Length=481

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ  + + G+ VS  P+KGRC+ TT++F PGEVI+ QEPYV VP  + T   ++C+ 
Sbjct  1    MEELQNVVRDGGLAVSNLPEKGRCLLTTKNFHPGEVILRQEPYVCVPNNSST--VSRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S N+KKCSACQVV+YCG+TCQKS+WKLHR EC +L ++E+++ K++ P+IRLMV+LY
Sbjct  59   CFASENLKKCSACQVVWYCGSTCQKSEWKLHRLECSALSRLEKEKRKAVTPSIRLMVRLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRR+LQ+E  IPT   D+Y  VE LVSH+ ++DEKQLVLYAQMANLV+LILQ
Sbjct  119  LRRELQNEMFIPTGVTDSYNFVESLVSHLKELDEKQLVLYAQMANLVHLILQ  170



>ref|XP_011001421.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X4 [Populus euphratica]
Length=479

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ  + + G+ VS  P+KGRC+ TT++F PGEVI+ QEPYV VP  + T   ++C+ 
Sbjct  1    MEELQNVVRDGGLAVSNLPEKGRCLLTTKNFHPGEVILRQEPYVCVPNNSST--VSRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S N+KKCSACQVV+YCG+TCQKS+WKLHR EC +L ++E+++ K++ P+IRLMV+LY
Sbjct  59   CFASENLKKCSACQVVWYCGSTCQKSEWKLHRLECSALSRLEKEKRKAVTPSIRLMVRLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRR+LQ+E  IPT   D+Y  VE LVSH+ ++DEKQLVLYAQMANLV+LILQ
Sbjct  119  LRRELQNEMFIPTGVTDSYNFVESLVSHLKELDEKQLVLYAQMANLVHLILQ  170



>ref|XP_011001419.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X2 [Populus euphratica]
Length=490

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ  + + G+ VS  P+KGRC+ TT++F PGEVI+ QEPYV VP  + T   ++C+ 
Sbjct  1    MEELQNVVRDGGLAVSNLPEKGRCLLTTKNFHPGEVILRQEPYVCVPNNSST--VSRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S N+KKCSACQVV+YCG+TCQKS+WKLHR EC +L ++E+++ K++ P+IRLMV+LY
Sbjct  59   CFASENLKKCSACQVVWYCGSTCQKSEWKLHRLECSALSRLEKEKRKAVTPSIRLMVRLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRR+LQ+E  IPT   D+Y  VE LVSH+ ++DEKQLVLYAQMANLV+LILQ
Sbjct  119  LRRELQNEMFIPTGVTDSYNFVESLVSHLKELDEKQLVLYAQMANLVHLILQ  170



>ref|XP_011001418.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X1 [Populus euphratica]
Length=491

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ  + + G+ VS  P+KGRC+ TT++F PGEVI+ QEPYV VP  + T   ++C+ 
Sbjct  1    MEELQNVVRDGGLAVSNLPEKGRCLLTTKNFHPGEVILRQEPYVCVPNNSST--VSRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S N+KKCSACQVV+YCG+TCQKS+WKLHR EC +L ++E+++ K++ P+IRLMV+LY
Sbjct  59   CFASENLKKCSACQVVWYCGSTCQKSEWKLHRLECSALSRLEKEKRKAVTPSIRLMVRLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRR+LQ+E  IPT   D+Y  VE LVSH+ ++DEKQLVLYAQMANLV+LILQ
Sbjct  119  LRRELQNEMFIPTGVTDSYNFVESLVSHLKELDEKQLVLYAQMANLVHLILQ  170



>ref|XP_008782265.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Phoenix dactylifera]
Length=467

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 134/173 (77%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            A+M++LQ ALS +G+TV++ P KGR + T RDFSPGEVII +EPY S P K   G S  C
Sbjct  2    AWMDDLQTALSARGLTVASIPGKGRGLVTARDFSPGEVIICEEPYASTPNKISGGSS--C  59

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCSAC+V +YCG  CQKS+WKLH+ ECQ+L  +  +R K L PTIRLM +
Sbjct  60   DGCFASNNLRKCSACRVAWYCGTACQKSEWKLHQLECQALVALSEERKKKLTPTIRLMGR  119

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LRRKLQ+E  IP TA+DNY+LVE L SH+SD+D++QLVLYAQMANLV L+L
Sbjct  120  LILRRKLQNEQVIPITAIDNYSLVEALESHISDVDKEQLVLYAQMANLVKLVL  172



>ref|XP_008782264.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Phoenix dactylifera]
Length=481

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 134/173 (77%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            A+M++LQ ALS +G+TV++ P KGR + T RDFSPGEVII +EPY S P K   G S  C
Sbjct  2    AWMDDLQTALSARGLTVASIPGKGRGLVTARDFSPGEVIICEEPYASTPNKISGGSS--C  59

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCSAC+V +YCG  CQKS+WKLH+ ECQ+L  +  +R K L PTIRLM +
Sbjct  60   DGCFASNNLRKCSACRVAWYCGTACQKSEWKLHQLECQALVALSEERKKKLTPTIRLMGR  119

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LRRKLQ+E  IP TA+DNY+LVE L SH+SD+D++QLVLYAQMANLV L+L
Sbjct  120  LILRRKLQNEQVIPITAIDNYSLVEALESHISDVDKEQLVLYAQMANLVKLVL  172



>ref|XP_002886136.1| hypothetical protein ARALYDRAFT_319740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62395.1| hypothetical protein ARALYDRAFT_319740 [Arabidopsis lyrata subsp. 
lyrata]
Length=483

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M +LQ  L ++ ++VS  P KGR +FTTRD  PGEVI+SQ+PY+ VP  T     ++C+ 
Sbjct  1    MADLQRFLQDRCLSVSNLPHKGRSLFTTRDIRPGEVILSQKPYICVPNNTSL--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF + N+KKCS CQVV+YCG+ CQKS+WKLHR EC++L ++E+++ K + PTIRLMVKLY
Sbjct  59   CFKTNNLKKCSGCQVVWYCGSFCQKSEWKLHRHECKALTRLEKEKRKFVTPTIRLMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            ++R LQ+E  +P T+ DNY+LVE LVSHMS+IDEKQ++LYAQMANLVNLILQ
Sbjct  119  IKRNLQNEKVLPITSTDNYSLVEALVSHMSEIDEKQMLLYAQMANLVNLILQ  170



>ref|XP_008465815.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X6 
[Cucumis melo]
Length=481

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 132/172 (77%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+L  AL+ +G+TV+  P+KGR +FTTR+F PGE IISQEPYV VP  +      +C+ 
Sbjct  1    MEDLHSALNARGLTVTILPEKGRSLFTTRNFRPGEEIISQEPYVCVPNNSPV--EFRCDR  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S N+KKCSAC+V +YC + CQ+S+WKLHR EC +L ++++ R KS+ P+IRLM+KL+
Sbjct  59   CFASINLKKCSACKVAWYCSSMCQRSEWKLHRLECDALARLDKGRHKSVTPSIRLMIKLF  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            +RRKLQSE  IP  A DNY LVE L+ HMS IDEKQLVLYAQM  LVNLILQ
Sbjct  119  IRRKLQSEKVIPMAATDNYKLVEELIDHMSGIDEKQLVLYAQMGTLVNLILQ  170



>ref|XP_008465809.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Cucumis melo]
Length=496

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 132/172 (77%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+L  AL+ +G+TV+  P+KGR +FTTR+F PGE IISQEPYV VP  +      +C+ 
Sbjct  1    MEDLHSALNARGLTVTILPEKGRSLFTTRNFRPGEEIISQEPYVCVPNNSPV--EFRCDR  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S N+KKCSAC+V +YC + CQ+S+WKLHR EC +L ++++ R KS+ P+IRLM+KL+
Sbjct  59   CFASINLKKCSACKVAWYCSSMCQRSEWKLHRLECDALARLDKGRHKSVTPSIRLMIKLF  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            +RRKLQSE  IP  A DNY LVE L+ HMS IDEKQLVLYAQM  LVNLILQ
Sbjct  119  IRRKLQSEKVIPMAATDNYKLVEELIDHMSGIDEKQLVLYAQMGTLVNLILQ  170



>gb|EPS73138.1| hypothetical protein M569_01616, partial [Genlisea aurea]
Length=475

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME LQ+ LS+  + +S  P+KGRC+FTTRDFSPGEVIIS+ PY+SV +KTK  P +KCEW
Sbjct  1    MENLQKHLSDSSLRISKLPEKGRCLFTTRDFSPGEVIISENPYISVSSKTKESPKSKCEW  60

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF+S +VKKCS C+ V YCG++CQK DW+LH  ECQ L ++  DR+KSL  ++RLM++L 
Sbjct  61   CFSSVSVKKCSGCKFVCYCGSSCQKLDWRLHSVECQKLSELSLDRLKSLTSSLRLMLRLC  120

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLI  568
            +RRKL+ E   PTTA +NY  VE LVSH S  DEK++VLYAQMA+LV++I
Sbjct  121  IRRKLEIEEVYPTTASENYKNVEALVSHFSKFDEKRMVLYAQMADLVHII  170



>ref|XP_007137368.1| hypothetical protein PHAVU_009G121500g [Phaseolus vulgaris]
 gb|ESW09362.1| hypothetical protein PHAVU_009G121500g [Phaseolus vulgaris]
Length=485

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 133/173 (77%), Gaps = 1/173 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+LQ AL + G++VST P+KGR +F TRDF PG+VII QEPYV VP  +      +C+ 
Sbjct  1    MEDLQSALKDCGLSVSTVPEKGRSLFATRDFYPGDVIIGQEPYVCVPNNSPLSTPKRCDG  60

Query  239  CFTSTNV-KKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKL  415
            C T++NV ++CS C V YYC   CQ+S+WKLHR EC+ L ++++D+ KS+ P+IRLMV+L
Sbjct  61   CLTTSNVLRRCSRCHVAYYCRTACQRSEWKLHRLECEVLSRLDKDKRKSVTPSIRLMVRL  120

Query  416  YLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            YLRRKLQ +  I +TAMDNY LVE LV+HMSDI E+QLVLYAQMANLV  ILQ
Sbjct  121  YLRRKLQDDKVISSTAMDNYNLVEALVAHMSDITEEQLVLYAQMANLVYYILQ  173



>gb|AGZ15368.1| histone-lysine N-methyltransferase ASHR1-like protein [Phaseolus 
vulgaris]
Length=488

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 133/173 (77%), Gaps = 1/173 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+LQ AL + G++VST P+KGR +F TRDF PG+VII QEPYV VP  +      +C+ 
Sbjct  1    MEDLQSALKDCGLSVSTVPEKGRSLFATRDFYPGDVIIGQEPYVCVPNNSSLSTPKRCDG  60

Query  239  CFTSTNV-KKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKL  415
            C T++NV ++CS C V YYC   CQ+S+WKLHR EC+ L ++++D+ KS+ P+IRLMV+L
Sbjct  61   CLTTSNVLRRCSRCHVAYYCRTACQRSEWKLHRLECEVLSRLDKDKRKSVTPSIRLMVRL  120

Query  416  YLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            YLRRKLQ +  I +TAMDNY LVE LV+HMSDI E+QLVLYAQMANLV  ILQ
Sbjct  121  YLRRKLQDDKVISSTAMDNYNLVEALVAHMSDITEEQLVLYAQMANLVYYILQ  173



>ref|XP_006297545.1| hypothetical protein CARUB_v10013566mg [Capsella rubella]
 gb|EOA30443.1| hypothetical protein CARUB_v10013566mg [Capsella rubella]
Length=484

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M +L+  L ++ ++V   P+KGR +FTTRDF PGEVI+SQ+PY+ VP  T +   ++C+ 
Sbjct  6    MADLEMFLQDRCLSVLNLPEKGRSLFTTRDFRPGEVILSQKPYICVPNNTSS--ESRCDG  63

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF + N+K+CS CQVV+YCG++CQKS+WKLHR EC++L ++++++ K + PTIRLMVKLY
Sbjct  64   CFKTNNLKRCSGCQVVWYCGSSCQKSEWKLHRDECKALSRLDKEKRKFVTPTIRLMVKLY  123

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            ++R LQ+E  +P T  DNY+LV+ LVSHMS+IDEKQ++LYAQMANLVNLILQ
Sbjct  124  IKRNLQNEKVLPITTTDNYSLVDALVSHMSEIDEKQMLLYAQMANLVNLILQ  175



>ref|XP_009390922.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
             +MEELQ AL+ +G+ V++ P KGR + TT DF+PG+VII QEPY S P KT +G S  C
Sbjct  2    GWMEELQSALAARGLAVASIPGKGRGLITTCDFAPGDVIIFQEPYASTPNKTSSGSS--C  59

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + C  S + +KCSACQV +YCG  CQKS+WK+H+ EC++L  +  DR K L  TIRLMV+
Sbjct  60   DSCLASNDSRKCSACQVAWYCGTACQKSEWKIHQSECRALAALNEDRKKMLTSTIRLMVR  119

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LR++LQSE  IPT+AMDNY LV  L SH+S+IDEKQLVLYAQMANLVNL+L
Sbjct  120  LILRKQLQSEQVIPTSAMDNYDLVATLESHISEIDEKQLVLYAQMANLVNLVL  172



>ref|XP_009121063.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Brassica rapa]
Length=483

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M  LQ  L ++ +TV   P KGR +FT+RDF PGEVI+ QEPYVSVP    +   ++C+ 
Sbjct  1    MANLQSFLRDRCLTVLNLPDKGRSLFTSRDFRPGEVILRQEPYVSVPNNNSS--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF +  +KKCS CQVV+YCG++CQKS+WKLHR EC++L ++E+++   + PTIRLMVKL 
Sbjct  59   CFKTDGLKKCSGCQVVWYCGSSCQKSEWKLHRHECKALCRLEKEKRMLVTPTIRLMVKLC  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            L+R LQ+E  IP T  DNY+LVE LVSHMS++DEKQL+LYAQMANLVNLILQ
Sbjct  119  LKRNLQNEKVIPITTTDNYSLVEALVSHMSELDEKQLMLYAQMANLVNLILQ  170



>ref|XP_009121061.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Brassica rapa]
 ref|XP_009121062.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Brassica rapa]
Length=488

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M  LQ  L ++ +TV   P KGR +FT+RDF PGEVI+ QEPYVSVP    +   ++C+ 
Sbjct  1    MANLQSFLRDRCLTVLNLPDKGRSLFTSRDFRPGEVILRQEPYVSVPNNNSS--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF +  +KKCS CQVV+YCG++CQKS+WKLHR EC++L ++E+++   + PTIRLMVKL 
Sbjct  59   CFKTDGLKKCSGCQVVWYCGSSCQKSEWKLHRHECKALCRLEKEKRMLVTPTIRLMVKLC  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            L+R LQ+E  IP T  DNY+LVE LVSHMS++DEKQL+LYAQMANLVNLILQ
Sbjct  119  LKRNLQNEKVIPITTTDNYSLVEALVSHMSELDEKQLMLYAQMANLVNLILQ  170



>ref|XP_010467589.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Camelina 
sativa]
Length=489

 Score =   218 bits (556),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 136/175 (78%), Gaps = 3/175 (2%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M +L+  L ++ ++V   PQKGR +FTTR F PGEVI+SQ+PYV VP    +   ++C+ 
Sbjct  1    MADLERFLEDRCLSVLNLPQKGRSLFTTRYFRPGEVILSQKPYVCVPNNNTSSSESRCDG  60

Query  239  CFTST---NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMV  409
            CF +    N+K+CS CQVV+YCG++CQKS+WKLHR EC++L ++++++ K + PTIRLMV
Sbjct  61   CFKTNDNNNLKRCSGCQVVWYCGSSCQKSEWKLHRHECKALSRLDKEKRKFVTPTIRLMV  120

Query  410  KLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            KLY++R LQ+E  +P T  DNY LVE LVSHMS+IDE+Q++LYAQMANLVNLILQ
Sbjct  121  KLYIKRNLQNEKVLPVTTTDNYTLVEALVSHMSEIDEQQMLLYAQMANLVNLILQ  175



>emb|CDY38142.1| BnaA07g02410D [Brassica napus]
Length=483

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M  LQ  L ++ +TV   P KGR +FT+RDF PGEVI+ QEPYVSVP    +   ++C+ 
Sbjct  1    MANLQSFLRDRCLTVLNLPDKGRSLFTSRDFRPGEVILRQEPYVSVPNNNSS--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF +  +KKCS CQVV+YCG++CQKS+WKLHR EC++L ++E+++   + PTIRLMVKL 
Sbjct  59   CFKTDGLKKCSGCQVVWYCGSSCQKSEWKLHRHECKALCRLEKEKRMLVTPTIRLMVKLC  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            L+R LQ+E  IP T  D+Y+LVE LVSHMS++DEKQL+LYAQMANLVNLILQ
Sbjct  119  LKRNLQNEKVIPITTTDDYSLVEALVSHMSELDEKQLMLYAQMANLVNLILQ  170



>ref|XP_010065502.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Eucalyptus 
grandis]
 gb|KCW63013.1| hypothetical protein EUGRSUZ_G00611 [Eucalyptus grandis]
Length=479

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 137/173 (79%), Gaps = 5/173 (3%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+L+ AL ++ +TV++ P+KGR +    DF  G+VI+SQEPYV  P   +     +C+ 
Sbjct  1    MEDLKAALRDRCLTVASLPEKGRSLLAATDFHQGQVILSQEPYVFAPNAAE----PRCDG  56

Query  239  CF-TSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKL  415
            CF TS  ++KCSACQ V+YCG++CQKS+WK+HR EC +L ++++++ KS+ P+IRLM+KL
Sbjct  57   CFATSARLRKCSACQAVWYCGSSCQKSEWKMHRLECMALARLDKEKRKSVTPSIRLMIKL  116

Query  416  YLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            Y+RRKLQ E  I TTAMDNY+LV+ LVSHMS+IDEKQLVLYAQMANL+N+ILQ
Sbjct  117  YIRRKLQDEKIISTTAMDNYSLVDALVSHMSEIDEKQLVLYAQMANLINIILQ  169



>ref|XP_006409221.1| hypothetical protein EUTSA_v10022664mg [Eutrema salsugineum]
 gb|ESQ50674.1| hypothetical protein EUTSA_v10022664mg [Eutrema salsugineum]
Length=484

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 134/172 (78%), Gaps = 5/172 (3%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M +LQ+ L ++ +TV   P KGR +FT RDF PGEVI+SQEPY+ VP        ++C+ 
Sbjct  1    MADLQKFLGDRCLTVLNIPGKGRSLFTARDFRPGEVILSQEPYICVPNN-----ESRCDG  55

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF + N+KKCS CQVV+YCG++CQKS+WKLHR EC +L ++E+++   + PTIRLM+KLY
Sbjct  56   CFKTNNLKKCSGCQVVWYCGSSCQKSEWKLHRHECIALSRLEKEKRMLVTPTIRLMLKLY  115

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            ++R LQ++  +P T  DNY+LVE +VSHMS++DEKQL+LYAQMANLVNL+LQ
Sbjct  116  IKRNLQNDKVMPITTTDNYSLVEAMVSHMSELDEKQLMLYAQMANLVNLVLQ  167



>emb|CDY63757.1| BnaCnng42550D [Brassica napus]
Length=483

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 132/172 (77%), Gaps = 2/172 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M + Q  L ++ +TV   P+KGR +F +RDF PGEVI+ QEPYVSVP    +   ++C+ 
Sbjct  1    MADTQTFLRDRCLTVLNLPEKGRSLFISRDFRPGEVILRQEPYVSVPNNNSS--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF +  +KKCS CQVV+YCG++CQKS+WKLHR EC++L ++E+++   + PTIRLMVKLY
Sbjct  59   CFKTDGLKKCSGCQVVWYCGSSCQKSEWKLHRHECKALCRLEKEKRMLVTPTIRLMVKLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            L+R  Q+E  IP T  D+Y+LVE LVSHM ++DEKQL+LYAQMANLVNLILQ
Sbjct  119  LKRNFQNEKVIPITTTDDYSLVEALVSHMPELDEKQLMLYAQMANLVNLILQ  170



>gb|AFK47176.1| unknown [Medicago truncatula]
Length=477

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 139/209 (67%), Gaps = 43/209 (21%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+AL    +TVST  +KGR +FTTRDF PG+VIISQEPYV VPT+       +C+ 
Sbjct  1    MEELQQALKNCDLTVSTISEKGRSLFTTRDFHPGDVIISQEPYVCVPTQ------KRCDG  54

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF++TN+ KCS CQVV+YCG  CQKS+WKLHR ECQ+L +++ ++ KS+ P+IRLM+KLY
Sbjct  55   CFSTTNLSKCSRCQVVWYCGTPCQKSEWKLHRLECQALSRLDSNKRKSVTPSIRLMLKLY  114

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSH--------------------------------  502
            LRRKLQ +  IP+TAMDNY LVE LV+                                 
Sbjct  115  LRRKLQDQKIIPSTAMDNYKLVEALVARILFIIVVLSSRAMIVEFSLLTNMSVVIVLFNT  174

Query  503  -----MSDIDEKQLVLYAQMANLVNLILQ  574
                 MSDI E+QLVLYAQMANLV+LILQ
Sbjct  175  YFHEDMSDIKEEQLVLYAQMANLVHLILQ  203



>ref|XP_003601097.1| Histone-lysine N-methyltransferase ASHR1 [Medicago truncatula]
Length=511

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 139/209 (67%), Gaps = 43/209 (21%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ+AL    +TVST  +KGR +FTTRDF PG+VIISQEPYV VPT+       +C+ 
Sbjct  1    MEELQQALKNCNLTVSTISEKGRSLFTTRDFHPGDVIISQEPYVCVPTQ------KRCDG  54

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF++TN+ KCS CQVV+YCG  CQKS+WKLHR ECQ+L +++ ++ KS+ P+IRLM+KLY
Sbjct  55   CFSTTNLSKCSRCQVVWYCGTPCQKSEWKLHRLECQALSRLDSNKRKSVTPSIRLMLKLY  114

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSH--------------------------------  502
            LRRKLQ +  IP+TAMDNY LVE LV+                                 
Sbjct  115  LRRKLQDQKIIPSTAMDNYKLVEALVARILFIIVVLSSRAMIVEFSLLTNMSVVIVLFNT  174

Query  503  -----MSDIDEKQLVLYAQMANLVNLILQ  574
                 MSDI E+QLVLYAQMANLV+LILQ
Sbjct  175  YFHEDMSDIKEEQLVLYAQMANLVHLILQ  203



>gb|AFW67883.1| hypothetical protein ZEAMMB73_219813 [Zea mays]
Length=190

 Score =   203 bits (516),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 130/173 (75%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            +++E+LQ  L+ +G+TV++ P KGR +  T  F PG+VI++QEPY S P K   G S  C
Sbjct  3    SWLEQLQRELAARGLTVASIPGKGRGLIATCTFFPGDVILNQEPYASTPNKILVGSS--C  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CFTS N++KCS C+V +YC + CQK +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  61   DHCFTSGNLRKCSMCRVTWYCSSNCQKEEWKLHQLECRAMAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L L+RKLQ+E  IP++++DNY LV+ L SH+S +DE QLVLYAQMANLV+LIL
Sbjct  121  LALKRKLQNEKVIPSSSIDNYNLVDGLESHISKVDENQLVLYAQMANLVSLIL  173



>ref|XP_010489431.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Camelina 
sativa]
Length=498

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 136/180 (76%), Gaps = 6/180 (3%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSA--  226
            + M +L+  L ++ ++V   PQKGR +F TR F PGEVI+SQ+PY+ VP       S+  
Sbjct  5    SLMADLERFLEDRCLSVLNLPQKGRSLFATRGFRPGEVILSQKPYICVPNNNNNNTSSSS  64

Query  227  --KCEWCFTST--NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPT  394
              +C+ CF +   N+K+CS CQVV+YCG++CQKS+WKLHR EC++L  +++++ K + PT
Sbjct  65   ESRCDGCFKTNDNNLKRCSGCQVVWYCGSSCQKSEWKLHRHECKALSTLDKEKRKFVTPT  124

Query  395  IRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            IRLMVKLY++R LQ+E  +P T  DNY+LVE LVSHMS+IDEKQ++LYAQMANLVNLILQ
Sbjct  125  IRLMVKLYIKRNLQNEKVLPVTTTDNYSLVEALVSHMSEIDEKQMLLYAQMANLVNLILQ  184



>ref|XP_010666085.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=469

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 128/172 (74%), Gaps = 15/172 (9%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEEL+ AL+E  +TVS  P+KGRC+   ++FSPGE+IISQEP +SVP  + +G S +CE 
Sbjct  1    MEELRRALAELSLTVSFLPEKGRCLLAAKNFSPGEIIISQEPCISVPNNS-SGVS-RCEV  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF + NVKKCSAC +V+YCG TCQK+DW LHR ECQ+L K+ ++R K L P+IRLMV   
Sbjct  59   CFATANVKKCSACHLVWYCGRTCQKADWTLHRVECQTLSKLGKERQKYLTPSIRLMV---  115

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
                      IPTT  DNY LVE LVSHM D+DEKQL+LYAQMANLVN+ILQ
Sbjct  116  ----------IPTTVTDNYNLVEALVSHMPDMDEKQLLLYAQMANLVNVILQ  157



>ref|XP_010926451.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Elaeis guineensis]
Length=468

 Score =   208 bits (529),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 127/173 (73%), Gaps = 15/173 (9%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            A+M++LQ ALS  G+TV++ P KGR + TTRDFSPGEVII QEPY S P +  +G S  C
Sbjct  2    AWMDDLQTALSAHGLTVASIPGKGRGLVTTRDFSPGEVIICQEPYASTPKQISSGSS--C  59

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCSAC+V +YCG  CQ+S+WKLH+ ECQ+L  +  +R K L PTIRLMV 
Sbjct  60   DGCFASNNLRKCSACRVAWYCGNACQRSEWKLHQLECQALVALSEERKKKLTPTIRLMV-  118

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
                        IPTTA+DNY+LVE L SH+SD+D++QLVLYAQMANLV L+L
Sbjct  119  ------------IPTTAIDNYSLVEALESHISDVDKEQLVLYAQMANLVKLVL  159



>gb|ABF98447.1| MYND finger family protein, expressed [Oryza sativa Japonica 
Group]
Length=282

 Score =   202 bits (514),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            ++ E+L++ L+ + + V++ P KGR +F  R F PGEV+ISQEPY S P K   G  + C
Sbjct  3    SWEEQLRDELAGRDLAVASVPGKGRGLFAARSFFPGEVVISQEPYASTPNKISVG--SNC  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCS C+V +YCG+ CQ+ +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  61   DNCFASRNLRKCSVCRVAWYCGSACQREEWKLHQLECRAIAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LRRKLQ +  IP++  DNY LV+ L SH+S++D+ QLVLYAQMANLV LIL
Sbjct  121  LVLRRKLQDDKAIPSSGTDNYNLVDALESHISEVDKNQLVLYAQMANLVQLIL  173



>ref|XP_003560708.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X1 
[Brachypodium distachyon]
Length=482

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 127/170 (75%), Gaps = 2/170 (1%)
 Frame = +2

Query  62   EELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWC  241
            E+L+  LS +G+ +++ P KGR + TTR F PGEVI+  EPY S P K   G  + C+ C
Sbjct  6    EQLERELSGRGLAIASIPGKGRGLVTTRRFFPGEVILCGEPYASTPNKILVG--SNCDHC  63

Query  242  FTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYL  421
            FTS+N++KCS C+V +YCG+ CQK +WKLH+ EC+++  +  DR K L PTIRLMV+L L
Sbjct  64   FTSSNLRKCSVCRVAWYCGSVCQKEEWKLHQLECRAISALTDDRKKMLTPTIRLMVRLIL  123

Query  422  RRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            RRKLQ+E  IP+T  DNY LV+ L SH+S++D+KQLVLYAQMANLV LIL
Sbjct  124  RRKLQNEKVIPSTGTDNYGLVDALESHISEVDDKQLVLYAQMANLVQLIL  173



>gb|ABF98446.1| MYND finger family protein, expressed [Oryza sativa Japonica 
Group]
Length=352

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            ++ E+L++ L+ + + V++ P KGR +F  R F PGEV+ISQEPY S P K   G  + C
Sbjct  3    SWEEQLRDELAGRDLAVASVPGKGRGLFAARSFFPGEVVISQEPYASTPNKISVG--SNC  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCS C+V +YCG+ CQ+ +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  61   DNCFASRNLRKCSVCRVAWYCGSACQREEWKLHQLECRAIAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LRRKLQ +  IP++  DNY LV+ L SH+S++D+ QLVLYAQMANLV LIL
Sbjct  121  LVLRRKLQDDKAIPSSGTDNYNLVDALESHISEVDKNQLVLYAQMANLVQLIL  173



>gb|KDO80754.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=390

 Score =   202 bits (515),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = +2

Query  158  GEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRF  337
            GEVIISQEPYV VP  + +   ++C+ CF S+N+KKCSACQVV+YCG+ CQK DWKLHR 
Sbjct  8    GEVIISQEPYVCVPNNSSS--ISRCDGCFASSNLKKCSACQVVWYCGSNCQKLDWKLHRL  65

Query  338  ECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDID  517
            ECQ L ++++++ KS+ P+IRLM+KLYLRRKLQ++N IP+T  DNY+LVE LV+HMSDID
Sbjct  66   ECQVLSRLDKEKRKSVTPSIRLMLKLYLRRKLQNDNVIPSTTTDNYSLVEALVAHMSDID  125

Query  518  EKQLVLYAQMANLVNLILQ  574
            EKQL+LYAQ+ANLVNLILQ
Sbjct  126  EKQLLLYAQIANLVNLILQ  144



>gb|KDO80749.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=420

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = +2

Query  158  GEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRF  337
            GEVIISQEPYV VP  + +   ++C+ CF S+N+KKCSACQVV+YCG+ CQK DWKLHR 
Sbjct  8    GEVIISQEPYVCVPNNSSS--ISRCDGCFASSNLKKCSACQVVWYCGSNCQKLDWKLHRL  65

Query  338  ECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDID  517
            ECQ L ++++++ KS+ P+IRLM+KLYLRRKLQ++N IP+T  DNY+LVE LV+HMSDID
Sbjct  66   ECQVLSRLDKEKRKSVTPSIRLMLKLYLRRKLQNDNVIPSTTTDNYSLVEALVAHMSDID  125

Query  518  EKQLVLYAQMANLVNLILQ  574
            EKQL+LYAQ+ANLVNLILQ
Sbjct  126  EKQLLLYAQIANLVNLILQ  144



>ref|XP_006434126.1| hypothetical protein CICLE_v10001105mg [Citrus clementina]
 gb|ESR47366.1| hypothetical protein CICLE_v10001105mg [Citrus clementina]
Length=455

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = +2

Query  158  GEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRF  337
            GEVIISQEPYV VP  + +   ++C+ CF S+N+KKCSACQVV+YCG+ CQK DWKLHR 
Sbjct  8    GEVIISQEPYVCVPNNSSS--ISRCDGCFASSNLKKCSACQVVWYCGSNCQKLDWKLHRL  65

Query  338  ECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDID  517
            ECQ L ++++++ KS+ P+IRLM+KLYLRRKLQ++N IP+T  DNY+LVE LV+HMSDID
Sbjct  66   ECQVLSRLDKEKRKSVTPSIRLMLKLYLRRKLQNDNVIPSTTTDNYSLVEALVAHMSDID  125

Query  518  EKQLVLYAQMANLVNLILQ  574
            EKQL+LYAQ+ANLVNLILQ
Sbjct  126  EKQLLLYAQIANLVNLILQ  144



>gb|KDO80750.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=455

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 119/139 (86%), Gaps = 2/139 (1%)
 Frame = +2

Query  158  GEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRF  337
            GEVIISQEPYV VP  + +   ++C+ CF S+N+KKCSACQVV+YCG+ CQK DWKLHR 
Sbjct  8    GEVIISQEPYVCVPNNSSS--ISRCDGCFASSNLKKCSACQVVWYCGSNCQKLDWKLHRL  65

Query  338  ECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDID  517
            ECQ L ++++++ KS+ P+IRLM+KLYLRRKLQ++N IP+T  DNY+LVE LV+HMSDID
Sbjct  66   ECQVLSRLDKEKRKSVTPSIRLMLKLYLRRKLQNDNVIPSTTTDNYSLVEALVAHMSDID  125

Query  518  EKQLVLYAQMANLVNLILQ  574
            EKQL+LYAQ+ANLVNLILQ
Sbjct  126  EKQLLLYAQIANLVNLILQ  144



>gb|AAM97151.1| unknown protein,3'-partial [Oryza sativa Japonica Group]
Length=425

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            ++ E+L++ L+ + + V++ P KGR +F  R F PGEV+ISQEPY S P K   G  + C
Sbjct  3    SWEEQLRDELAGRDLAVASVPGKGRGLFAARSFFPGEVVISQEPYASTPNKISVG--SNC  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCS C+V +YCG+ CQ+ +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  61   DNCFASRNLRKCSVCRVAWYCGSACQREEWKLHQLECRAIAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LRRKLQ +  IP++  DNY LV+ L SH+S++D+ QLVLYAQMANLV LIL
Sbjct  121  LVLRRKLQDDKAIPSSGTDNYNLVDALESHISEVDKNQLVLYAQMANLVQLIL  173



>ref|XP_004982043.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Setaria 
italica]
Length=485

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 127/173 (73%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            ++ E+LQ  L+ +G+ V++ P KGR +  +R F PGEVIISQEPY S P K     S  C
Sbjct  3    SWAEQLQRELAGRGLAVASIPGKGRGLVASRTFFPGEVIISQEPYTSTPNKILVRSS--C  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S+N++KCSAC+V +YC + CQK +WKLH+ EC+ +  +  DR K L PTIRLMV+
Sbjct  61   DHCFASSNLRKCSACRVTWYCSSDCQKEEWKLHQLECRVMAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L L+RKLQ+E  IP++ +DNY LVE L SH+S +DE QLVLYAQMANLV+LIL
Sbjct  121  LVLKRKLQNEKAIPSSNIDNYYLVEALESHISKVDENQLVLYAQMANLVSLIL  173



>gb|EEC76031.1| hypothetical protein OsI_13199 [Oryza sativa Indica Group]
Length=481

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            ++ E+L++ L+ + + V++ P KGR +F  R F PGEV+ISQEPY S P K   G  + C
Sbjct  3    SWEEQLRDELAGRDLAVASVPGKGRGLFAARSFFPGEVVISQEPYASTPNKISVG--SNC  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCS C+V +YCG+ CQ+ +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  61   DNCFASRNLRKCSVCRVAWYCGSACQREEWKLHQLECRAIAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LRRKLQ +  IP++  DNY LV+ L SH+S++D+ QLVLYAQMANLV LIL
Sbjct  121  LVLRRKLQDDKAIPSSGTDNYNLVDALESHISEVDKNQLVLYAQMANLVQLIL  173



>gb|AAS07242.1| putative MYND finger protein [Oryza sativa Japonica Group]
 gb|ABF98445.1| MYND finger family protein, expressed [Oryza sativa Japonica 
Group]
Length=480

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            ++ E+L++ L+ + + V++ P KGR +F  R F PGEV+ISQEPY S P K   G  + C
Sbjct  3    SWEEQLRDELAGRDLAVASVPGKGRGLFAARSFFPGEVVISQEPYASTPNKISVG--SNC  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCS C+V +YCG+ CQ+ +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  61   DNCFASRNLRKCSVCRVAWYCGSACQREEWKLHQLECRAIAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LRRKLQ +  IP++  DNY LV+ L SH+S++D+ QLVLYAQMANLV LIL
Sbjct  121  LVLRRKLQDDKAIPSSGTDNYNLVDALESHISEVDKNQLVLYAQMANLVQLIL  173



>gb|AFW67882.1| hypothetical protein ZEAMMB73_219813 [Zea mays]
Length=443

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 130/173 (75%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            +++E+LQ  L+ +G+TV++ P KGR +  T  F PG+VI++QEPY S P K   G S  C
Sbjct  3    SWLEQLQRELAARGLTVASIPGKGRGLIATCTFFPGDVILNQEPYASTPNKILVGSS--C  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CFTS N++KCS C+V +YC + CQK +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  61   DHCFTSGNLRKCSMCRVTWYCSSNCQKEEWKLHQLECRAMAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L L+RKLQ+E  IP++++DNY LV+ L SH+S +DE QLVLYAQMANLV+LIL
Sbjct  121  LALKRKLQNEKVIPSSSIDNYNLVDGLESHISKVDENQLVLYAQMANLVSLIL  173



>gb|ABF98444.1| MYND finger family protein, expressed [Oryza sativa Japonica 
Group]
Length=481

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            ++ E+L++ L+ + + V++ P KGR +F  R F PGEV+ISQEPY S P K   G  + C
Sbjct  3    SWEEQLRDELAGRDLAVASVPGKGRGLFAARSFFPGEVVISQEPYASTPNKISVG--SNC  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCS C+V +YCG+ CQ+ +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  61   DNCFASRNLRKCSVCRVAWYCGSACQREEWKLHQLECRAIAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LRRKLQ +  IP++  DNY LV+ L SH+S++D+ QLVLYAQMANLV LIL
Sbjct  121  LVLRRKLQDDKAIPSSGTDNYNLVDALESHISEVDKNQLVLYAQMANLVQLIL  173



>ref|NP_001131420.1| histone-lysine N-methyltransferase ASHR1 [Zea mays]
 gb|ACF79818.1| unknown [Zea mays]
 gb|AFW67881.1| histone-lysine N-methyltransferase ASHR1 [Zea mays]
Length=482

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 130/173 (75%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            +++E+LQ  L+ +G+TV++ P KGR +  T  F PG+VI++QEPY S P K   G S  C
Sbjct  3    SWLEQLQRELAARGLTVASIPGKGRGLIATCTFFPGDVILNQEPYASTPNKILVGSS--C  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CFTS N++KCS C+V +YC + CQK +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  61   DHCFTSGNLRKCSMCRVTWYCSSNCQKEEWKLHQLECRAMAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L L+RKLQ+E  IP++++DNY LV+ L SH+S +DE QLVLYAQMANLV+LIL
Sbjct  121  LALKRKLQNEKVIPSSSIDNYNLVDGLESHISKVDENQLVLYAQMANLVSLIL  173



>ref|XP_002464022.1| hypothetical protein SORBIDRAFT_01g010740 [Sorghum bicolor]
 gb|EER91020.1| hypothetical protein SORBIDRAFT_01g010740 [Sorghum bicolor]
Length=482

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 127/173 (73%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            +++E+LQ  L+ +G+ V++ P KGR +  TR F PG+VI++QEPY S P K   G S  C
Sbjct  3    SWLEQLQRELAGRGLAVASIPGKGRGLIATRTFFPGDVILNQEPYASTPNKILVGSS--C  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CFTS N++KCS CQV +YC   CQK +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  61   DHCFTSGNLRKCSMCQVTWYCSTNCQKEEWKLHQLECRAMAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L L+RKLQ+E  IP++++DNY LV+ L SH+  +DE  LVLYAQMANLV+LIL
Sbjct  121  LVLKRKLQNEKVIPSSSIDNYNLVDALESHIWKVDENHLVLYAQMANLVSLIL  173



>gb|ACG37550.1| histone-lysine N-methyltransferase ASHR1 [Zea mays]
Length=482

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 130/173 (75%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            +++E+LQ  L+ +G+TV++ P KGR +  T  F PG+VI++QEPY S P K   G S  C
Sbjct  3    SWLEQLQRELAGRGLTVASIPGKGRGLIATFTFFPGDVILNQEPYASTPNKILVGSS--C  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CFTS N++KCS C+V +YC + CQK +WKLH+ EC+++  +  +R K L PTIRLMV+
Sbjct  61   DHCFTSGNLRKCSMCRVTWYCSSNCQKEEWKLHQLECRAMAALTENRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L L+RKLQ+E  IP++++DNY LV+ L SH+S +DE QLVLYAQMANLV+LIL
Sbjct  121  LALKRKLQNEKVIPSSSIDNYNLVDALESHISKVDENQLVLYAQMANLVSLIL  173



>ref|XP_009121064.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X4 
[Brassica rapa]
Length=475

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 124/172 (72%), Gaps = 15/172 (9%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M  LQ  L ++ +TV   P KGR +FT+RDF PGEVI+ QEPYVSVP    +   ++C+ 
Sbjct  1    MANLQSFLRDRCLTVLNLPDKGRSLFTSRDFRPGEVILRQEPYVSVPNNNSS--ESRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF +  +KKCS CQVV+YCG++CQKS+WKLHR EC++L ++E+++   + PTIRLMV   
Sbjct  59   CFKTDGLKKCSGCQVVWYCGSSCQKSEWKLHRHECKALCRLEKEKRMLVTPTIRLMV---  115

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
                      IP T  DNY+LVE LVSHMS++DEKQL+LYAQMANLVNLILQ
Sbjct  116  ----------IPITTTDNYSLVEALVSHMSELDEKQLMLYAQMANLVNLILQ  157



>ref|XP_006578981.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Glycine 
max]
 gb|KHN47053.1| Histone-lysine N-methyltransferase ASHR1 [Glycine soja]
Length=485

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            ME+LQ  L  + +++ST P+KGR +  TRDF PGEVIISQEPYV VP  +   P  +C+ 
Sbjct  1    MEDLQSGLQNRKLSLSTLPEKGRSLLATRDFYPGEVIISQEPYVCVPNNSSVSPQKRCDG  60

Query  239  CFTSTN---VKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMV  409
            CFT+ N   + +CS CQ+ +YCG  CQ+S+WKLHR EC+ L  + + + KSL P+IRLM+
Sbjct  61   CFTTINNNVLSRCSRCQLAFYCGTACQRSEWKLHRLECEVLSSLHKYKRKSLTPSIRLML  120

Query  410  KLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            +LYLRRKLQ++  IP+TAMDNY LVE LV+HMSDI E+QLVLYAQMANLVN IL+
Sbjct  121  RLYLRRKLQNDKIIPSTAMDNYNLVEALVAHMSDITEEQLVLYAQMANLVNSILE  175



>ref|XP_002306611.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE93607.1| zinc finger family protein [Populus trichocarpa]
Length=458

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 125/172 (73%), Gaps = 23/172 (13%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            MEELQ  + + G+ VS  P+KGRC+ TT++F+PGEVI+ QEPYV VP  + T   ++C+ 
Sbjct  1    MEELQNVVRDGGLAVSNLPEKGRCLLTTKNFNPGEVILRQEPYVCVPNNSST--VSRCDG  58

Query  239  CFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            CF S ++KKCSACQVV+YCG+TCQKS+WKLHR EC +L ++E+++ K++ P+IRLMV+LY
Sbjct  59   CFASESLKKCSACQVVWYCGSTCQKSEWKLHRLECNALSRLEKEKRKAVTPSIRLMVRLY  118

Query  419  LRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            LRRKLQ+E                      D+DEKQLVLYAQMANLV+ ILQ
Sbjct  119  LRRKLQNE---------------------MDLDEKQLVLYAQMANLVHFILQ  149



>ref|XP_006650467.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Oryza 
brachyantha]
Length=477

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 126/173 (73%), Gaps = 2/173 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            ++ E+L++ L+ +G+ V++ P KGR +F TR F PGE++I QEPY S P K   G  + C
Sbjct  3    SWEEQLRDELAGRGLAVASVPGKGRGLFATRSFFPGEIVICQEPYASTPNKISVG--SNC  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCS C+V +YCG++CQK +WKLH+ ECQ++  +  DR K L PTIRLMV+
Sbjct  61   DNCFASRNLRKCSVCRVAWYCGSSCQKEEWKLHQLECQAIAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L LR KLQ++  IP++  DN  LV+ L SH+S++D+ QLVLYAQMA LV LI+
Sbjct  121  LVLRTKLQNDKVIPSSGTDNCNLVDALESHISEVDKNQLVLYAQMATLVQLII  173



>gb|KDO80751.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=456

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 118/175 (67%), Gaps = 38/175 (22%)
 Frame = +2

Query  158  GEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRF  337
            GEVIISQEPYV VP  + +   ++C+ CF S+N+KKCSACQVV+YCG+ CQK DWKLHR 
Sbjct  8    GEVIISQEPYVCVPNNSSS--ISRCDGCFASSNLKKCSACQVVWYCGSNCQKLDWKLHRL  65

Query  338  ECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSH-----  502
            ECQ L ++++++ KS+ P+IRLM+KLYLRRKLQ++N IP+T  DNY+LVE LV+      
Sbjct  66   ECQVLSRLDKEKRKSVTPSIRLMLKLYLRRKLQNDNVIPSTTTDNYSLVEALVARILFEL  125

Query  503  -------------------------------MSDIDEKQLVLYAQMANLVNLILQ  574
                                           MSDIDEKQL+LYAQ+ANLVNLILQ
Sbjct  126  IIWFNQFGLVLCFSYNKSLMPAFVNNLFGKDMSDIDEKQLLLYAQIANLVNLILQ  180



>ref|NP_001173603.1| Os03g0704200 [Oryza sativa Japonica Group]
 dbj|BAH92331.1| Os03g0704200 [Oryza sativa Japonica Group]
Length=174

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 105/150 (70%), Gaps = 2/150 (1%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            ++ E+L++ L+ + + V++ P KGR +F  R F PGEV+ISQEPY S P K   G  + C
Sbjct  24   SWEEQLRDELAGRDLAVASVPGKGRGLFAARSFFPGEVVISQEPYASTPNKISVG--SNC  81

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCS C+V +YCG+ CQ+ +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  82   DNCFASRNLRKCSVCRVAWYCGSACQREEWKLHQLECRAIAALTEDRKKMLTPTIRLMVR  141

Query  413  LYLRRKLQSENNIPTTAMDNYALVELLVSH  502
            L LRRKLQ +  IP++  DNY LV+ L SH
Sbjct  142  LVLRRKLQDDKAIPSSGTDNYNLVDALESH  171



>ref|XP_006827905.1| hypothetical protein AMTR_s00008p00145610 [Amborella trichopoda]
 gb|ERM95321.1| hypothetical protein AMTR_s00008p00145610 [Amborella trichopoda]
Length=517

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            M ELQ  L ++G++VS+  +KGRC+F  RDFSPGEVI SQEPY SV  K     S +C+ 
Sbjct  1    MGELQSYLLKQGLSVSSISEKGRCLFVGRDFSPGEVIFSQEPYASVLDKGSL--SNRCDG  58

Query  239  CFTST-NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKL  415
            CFTS  N+K+CS+C++ +YCG  CQ+S+WK H+ EC +L  +  +R   L  +IRLMV+L
Sbjct  59   CFTSGLNLKRCSSCRMTWYCGGACQRSEWKSHQHECLALVNLSEERRNMLTSSIRLMVRL  118

Query  416  YLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
             LRR+LQ++  I +   DNY LV+ LV+HMSDIDEK+LVLYAQMANLV LIL
Sbjct  119  LLRRRLQNDRVISSNVTDNYNLVQELVAHMSDIDEKKLVLYAQMANLVKLIL  170



>ref|XP_010926453.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X4 
[Elaeis guineensis]
Length=423

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            A+M++LQ ALS  G+TV++ P KGR + TTRDFSPGEVII QEPY S P +  +G S  C
Sbjct  2    AWMDDLQTALSAHGLTVASIPGKGRGLVTTRDFSPGEVIICQEPYASTPKQISSGSS--C  59

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCSAC+V +YCG  CQ+S+WKLH+ ECQ+L  +  +R K L PTIRLMV+
Sbjct  60   DGCFASNNLRKCSACRVAWYCGNACQRSEWKLHQLECQALVALSEERKKKLTPTIRLMVR  119

Query  413  LYLRRKLQSE  442
            L LRRKLQSE
Sbjct  120  LMLRRKLQSE  129



>ref|XP_007018972.1| Histone-lysine N-methyltransferase ASHR1 [Theobroma cacao]
 gb|EOY16197.1| Histone-lysine N-methyltransferase ASHR1 [Theobroma cacao]
Length=357

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 116/171 (68%), Gaps = 5/171 (3%)
 Frame = +2

Query  65   ELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCF  244
            ELQ  L  +G+T+ T   K RC+F TRDF PGEVI+ +EPYV +PT +    +  C+ CF
Sbjct  6    ELQRFLEAEGLTIKTILPKRRCLFATRDFIPGEVIMREEPYVCIPTSS----NPLCQQCF  61

Query  245  TSTN-VKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYL  421
             S   + KC++C +V+YCG  CQ+ DWKLH+ EC+++ ++E+   + + P IRL+VKL++
Sbjct  62   KSDGALSKCASCNIVWYCGVECQRLDWKLHKLECRAISRLEKKWQELVTPEIRLLVKLFI  121

Query  422  RRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            RRKLQ +  IPTT +DN+ LVE ++ H   ++ K+LV YA  A +V  +LQ
Sbjct  122  RRKLQRDKVIPTTPIDNFNLVEAMIDHQYKMEMKKLVAYAMKAEIVTRMLQ  172



>ref|XP_008782266.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X3 
[Phoenix dactylifera]
Length=423

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 97/130 (75%), Gaps = 2/130 (2%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            A+M++LQ ALS +G+TV++ P KGR + T RDFSPGEVII +EPY S P K   G S  C
Sbjct  2    AWMDDLQTALSARGLTVASIPGKGRGLVTARDFSPGEVIICEEPYASTPNKISGGSS--C  59

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCSAC+V +YCG  CQKS+WKLH+ ECQ+L  +  +R K L PTIRLM +
Sbjct  60   DGCFASNNLRKCSACRVAWYCGTACQKSEWKLHQLECQALVALSEERKKKLTPTIRLMGR  119

Query  413  LYLRRKLQSE  442
            L LRRKLQ+E
Sbjct  120  LILRRKLQNE  129



>gb|EYU22919.1| hypothetical protein MIMGU_mgv1a006005mg [Erythranthe guttata]
Length=461

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 105/139 (76%), Gaps = 1/139 (1%)
 Frame = +2

Query  158  GEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRF  337
            GEVIISQ PYV+VP K +  P +KCEWCF+S+++K CSAC+ V+YC   CQ+SDW LHR 
Sbjct  12   GEVIISQSPYVAVPIKDEESPESKCEWCFSSSSIKACSACRAVWYCSRECQRSDWMLHRV  71

Query  338  ECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDID  517
            EC++  K+  + +K L P +RL+VKLY+RRKL++E   P TA DNY LVE LVS++S++D
Sbjct  72   ECKA-SKIVTEMMKPLTPVMRLLVKLYIRRKLENEKIFPATATDNYKLVEALVSNISELD  130

Query  518  EKQLVLYAQMANLVNLILQ  574
             + L+L AQMA LV+  LQ
Sbjct  131  VELLLLSAQMAKLVSSALQ  149



>ref|XP_007018977.1| Histone-lysine N-methyltransferase ASHR1 isoform 1 [Theobroma 
cacao]
 gb|EOY16202.1| Histone-lysine N-methyltransferase ASHR1 isoform 1 [Theobroma 
cacao]
Length=489

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 117/176 (66%), Gaps = 7/176 (4%)
 Frame = +2

Query  56   YMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCE  235
            Y  EL   L  +G+ + T   K RC+F TRDF PGEVI+ +EPYV +PT +       C+
Sbjct  5    YYLELLRFLIPEGLNIYTVLPKRRCLFATRDFFPGEVIMREEPYVCIPTSS----DPLCQ  60

Query  236  WCFTSTN-VKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVER--DRIKSLAPTIRLM  406
             CF S + + KC++C + +YCGA CQ+ DWKLH+ EC+++ ++E+    + +  P IRLM
Sbjct  61   RCFKSGDALLKCASCNIAWYCGAECQRLDWKLHKLECRAISRLEKKWQELVTRTPEIRLM  120

Query  407  VKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            VKL++RRKLQ +  IPTT +DN+ LVE ++ H S+++ ++L  Y  MA +VN +LQ
Sbjct  121  VKLFIRRKLQRDKVIPTTPIDNFDLVEAMIDHQSNMESEKLAEYQIMAQIVNHMLQ  176



>gb|EMT19769.1| Histone-lysine N-methyltransferase ASHR1 [Aegilops tauschii]
Length=463

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 91/130 (70%), Gaps = 2/130 (2%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            A+ E+LQ  L+ +G+ V++ P KGR +   R F PGEVII QEPY S P +   G S  C
Sbjct  3    AWAEQLQRELAGRGLAVASVPGKGRGLVAARSFFPGEVIICQEPYASTPNRISVGSS--C  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CF S N++KCS C+V +YCG+ CQK +WKLH+ ECQ++  +  +R K L PTIRLMVK
Sbjct  61   DHCFASGNLRKCSVCRVAWYCGSVCQKEEWKLHQLECQAISALTEERKKMLTPTIRLMVK  120

Query  413  LYLRRKLQSE  442
            L LRRKLQSE
Sbjct  121  LILRRKLQSE  130



>ref|XP_007018976.1| Histone-lysine N-methyltransferase ASHR1 [Theobroma cacao]
 gb|EOY16201.1| Histone-lysine N-methyltransferase ASHR1 [Theobroma cacao]
Length=485

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 117/178 (66%), Gaps = 12/178 (7%)
 Frame = +2

Query  65   ELQEALSEKGVTVST-------HPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPS  223
            ELQ  L  +G+TVS+       + +  RC+F TRDF  GEVI+ +EPYV +PT +     
Sbjct  6    ELQRFLKAEGLTVSSVLPKFDYNGECMRCLFATRDFITGEVIMREEPYVCIPTSS----D  61

Query  224  AKCEWCFTSTN-VKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIR  400
              C+ CF S   + +C++C +V+YCGA CQ+ DWKLH+ EC+++ ++E+   + + P IR
Sbjct  62   PVCQRCFKSDGTLLRCASCNIVWYCGAECQRLDWKLHKVECRAISRLEKKWQELVTPEIR  121

Query  401  LMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            L+VKL++R KLQ +  IPTT +DN+ LVE ++SH SD++ ++LV Y   A +V   LQ
Sbjct  122  LLVKLFIRTKLQRDKVIPTTPIDNFNLVEAMISHQSDMETEKLVEYMTKAQIVKQRLQ  179



>gb|ADP02224.1| zf-MYND domain-containing protein [Triticum aestivum]
Length=520

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 90/129 (70%), Gaps = 2/129 (2%)
 Frame = +2

Query  56   YMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCE  235
            + E+LQ  L+ +G+ V++ P KGR +   R F PGEVII QEPY S P +   G S  C+
Sbjct  4    WAEQLQRELAGRGLAVASVPGKGRGLVAARSFFPGEVIICQEPYASTPNRISVGSS--CD  61

Query  236  WCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKL  415
             CF S N++KCS C+V +YCG+ CQK +WKLH+ ECQ++  +  +R K L PTIRLMVKL
Sbjct  62   HCFASGNLRKCSVCRVAWYCGSVCQKEEWKLHQLECQAISALTEERKKMLTPTIRLMVKL  121

Query  416  YLRRKLQSE  442
             LRRKLQSE
Sbjct  122  ILRRKLQSE  130



>ref|XP_010230948.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X2 
[Brachypodium distachyon]
Length=449

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 92/127 (72%), Gaps = 2/127 (2%)
 Frame = +2

Query  62   EELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWC  241
            E+L+  LS +G+ +++ P KGR + TTR F PGEVI+  EPY S P K   G  + C+ C
Sbjct  6    EQLERELSGRGLAIASIPGKGRGLVTTRRFFPGEVILCGEPYASTPNKILVG--SNCDHC  63

Query  242  FTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYL  421
            FTS+N++KCS C+V +YCG+ CQK +WKLH+ EC+++  +  DR K L PTIRLMV+L L
Sbjct  64   FTSSNLRKCSVCRVAWYCGSVCQKEEWKLHQLECRAISALTDDRKKMLTPTIRLMVRLIL  123

Query  422  RRKLQSE  442
            RRKLQ+E
Sbjct  124  RRKLQNE  130



>ref|XP_001778213.1| predicted protein [Physcomitrella patens]
 gb|EDQ56995.1| predicted protein [Physcomitrella patens]
Length=490

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 115/172 (67%), Gaps = 4/172 (2%)
 Frame = +2

Query  62   EELQEAL-SEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEW  238
            +EL E L +   ++VS  P KGRC+   R F  GEVI+ QEPYV       +  + +C+ 
Sbjct  7    QELAEYLQNSHNLSVSVSPAKGRCLIANRAFHRGEVILQQEPYVC--ALDDSSQALRCDR  64

Query  239  CF-TSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKL  415
            C+  S+N+K+CSAC+ V+YC A CQ+S W LH+FEC  L ++ +++ +S  P++RL+++ 
Sbjct  65   CYRQSSNLKRCSACKTVFYCCANCQRSGWGLHKFECAILVRLLKEKKRSPTPSLRLVMRF  124

Query  416  YLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
             ++R+LQ+E      A+DNY + E+L +HMS+  E +LV+YAQMA++V  ++
Sbjct  125  LIKRRLQAERVQLKAAVDNYDVCEVLPTHMSETSEDRLVMYAQMASIVQQMM  176



>gb|AAL75997.1|AF466646_5 putative SET-domain transcriptional regulator [Zea mays]
 gb|AFW67884.1| putative SET-domain transcriptional regulator [Zea mays]
Length=410

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +2

Query  53   AYMEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKC  232
            +++E+LQ  L+ +G+TV++ P KGR +  T  F PG+VI++QEPY S P K   G S  C
Sbjct  3    SWLEQLQRELAARGLTVASIPGKGRGLIATCTFFPGDVILNQEPYASTPNKILVGSS--C  60

Query  233  EWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVK  412
            + CFTS N++KCS C+V +YC + CQK +WKLH+ EC+++  +  DR K L PTIRLMV+
Sbjct  61   DHCFTSGNLRKCSMCRVTWYCSSNCQKEEWKLHQLECRAMAALTEDRKKMLTPTIRLMVR  120

Query  413  LYLRRKLQSE  442
            L L+RKLQ+E
Sbjct  121  LALKRKLQNE  130



>ref|XP_002969663.1| hypothetical protein SELMODRAFT_231366 [Selaginella moellendorffii]
 gb|EFJ28787.1| hypothetical protein SELMODRAFT_231366 [Selaginella moellendorffii]
Length=484

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 114/176 (65%), Gaps = 9/176 (5%)
 Frame = +2

Query  59   MEE---LQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAK  229
            MEE   L+  L + G+TV    +KGRC+   RDF  G+ ++ Q+PYV+V      G   +
Sbjct  1    MEEDKNLRARLGDDGLTVINAAEKGRCLVADRDFYAGQTVLEQDPYVAVLDGDSRG--NR  58

Query  230  CEWCFT-STNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLM  406
            C+ CF  S  +++CSAC+ V+YC  TCQ+S WK+H+ EC+ L ++  ++ +   PT+ LM
Sbjct  59   CDACFKQSPALRRCSACKFVFYCSPTCQRSQWKIHQEECKVLVRLSTEQKR---PTLLLM  115

Query  407  VKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            ++L ++R+LQ+   +P TA+DNY +V  L +H S+  +++LV+YAQMA L+  IL 
Sbjct  116  LRLLVKRELQATGVLPVTALDNYEIVRALPTHFSETGDERLVMYAQMAVLIKTILN  171



>ref|XP_011457851.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Fragaria 
vesca subsp. vesca]
Length=171

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +2

Query  230  CEWCFT-STNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLM  406
            C+ CF  S N+ KCS C+ VYYC   CQKS+WKLHR EC++L KV  +    + P IRLM
Sbjct  11   CDACFEESGNLNKCSRCKTVYYCSTACQKSEWKLHRLECEALSKVPLEFHHQITPRIRLM  70

Query  407  VKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            ++L  R KLQ EN IPT+AMDN+ LV  LVSHMS ID  +   YA  ANLV+++LQ
Sbjct  71   IRLQCRLKLQYENTIPTSAMDNHNLVNALVSHMSKIDAHRRWHYAMDANLVSMVLQ  126



>ref|XP_004500596.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004500597.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X3 [Cicer arietinum]
Length=438

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +2

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
             SA  V+ +  A   KS+WKLHR EC+ L +++ D+ KS+ P+IRLM+KLYLRRKLQ E 
Sbjct  25   ASAHVVMLFGTAEPHKSEWKLHRLECEVLSRLDYDKRKSVTPSIRLMLKLYLRRKLQDEK  84

Query  446  NIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
             IP+TA DNY LVE LV+HMSDI E+QLVLYAQMANLV+LILQ
Sbjct  85   IIPSTARDNYKLVEALVAHMSDITEEQLVLYAQMANLVHLILQ  127



>ref|XP_008465812.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X5 
[Cucumis melo]
 ref|XP_008465813.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X5 
[Cucumis melo]
 ref|XP_008465814.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X5 
[Cucumis melo]
Length=417

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +2

Query  305  CQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALV  484
            CQ+S+WKLHR EC +L ++++ R KS+ P+IRLM+KL++RRKLQSE  IP  A DNY LV
Sbjct  2    CQRSEWKLHRLECDALARLDKGRHKSVTPSIRLMIKLFIRRKLQSEKVIPMAATDNYKLV  61

Query  485  ELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            E L+ HMS IDEKQLVLYAQM  LVNLILQ
Sbjct  62   EELIDHMSGIDEKQLVLYAQMGTLVNLILQ  91



>ref|XP_010926454.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 isoform X5 
[Elaeis guineensis]
Length=419

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  311  KSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVEL  490
            +S+WKLH+ ECQ+L  +  +R K L PTIRLMV+L LRRKLQSE  IPTTA+DNY+LVE 
Sbjct  24   RSEWKLHQLECQALVALSEERKKKLTPTIRLMVRLMLRRKLQSEQVIPTTAIDNYSLVEA  83

Query  491  LVSHMSDIDEKQLVLYAQMANLVNLIL  571
            L SH+SD+D++QLVLYAQMANLV L+L
Sbjct  84   LESHISDVDKEQLVLYAQMANLVKLVL  110



>gb|ABR16570.1| unknown [Picea sitchensis]
Length=441

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  65   ELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCF  244
            +LQ AL+EKG+ +S  P+KGRC+   R F+ GE+++ Q+PYVSV        + +C+ CF
Sbjct  16   DLQSALAEKGLAISISPEKGRCLIAKRSFTRGEIVLLQDPYVSVLDSASV--NKRCDVCF  73

Query  245  T-STNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYL  421
               TN+K+CS C+  +YCG TCQ++ W+LH+ EC+++  ++ ++ ++  P+++LM++L +
Sbjct  74   RLCTNLKRCSVCKTTWYCGGTCQRNGWRLHQHECKAITSLKEEKQQTPTPSLQLMLRLLI  133

Query  422  RRKLQS  439
            +RKLQ+
Sbjct  134  KRKLQN  139



>ref|XP_002981276.1| hypothetical protein SELMODRAFT_114558, partial [Selaginella 
moellendorffii]
 gb|EFJ17464.1| hypothetical protein SELMODRAFT_114558, partial [Selaginella 
moellendorffii]
Length=453

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 96/142 (68%), Gaps = 6/142 (4%)
 Frame = +2

Query  149  FSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVYYCGATCQKSDWK  325
            F PG+ ++ Q+PYV+V      G   +C+ CF  S  +K+CSAC+ V+YC  TCQ+S WK
Sbjct  1    FYPGQTVLEQDPYVAVLDGDSRG--NRCDACFKQSPALKRCSACKFVFYCSPTCQRSQWK  58

Query  326  LHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHM  505
            +H+ EC+ L ++  ++ +   PT+ LM++L ++R+LQ+   +P TA+DNY +V  L +H 
Sbjct  59   IHQEECKVLVRLSTEQKR---PTLLLMLRLLVKRELQATGVLPVTALDNYEIVRALPTHF  115

Query  506  SDIDEKQLVLYAQMANLVNLIL  571
            S+  +++LV+YAQMA L+  IL
Sbjct  116  SETGDERLVMYAQMAVLIKTIL  137



>gb|AFK36247.1| unknown [Lotus japonicus]
Length=111

 Score =   109 bits (272),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAK-CE  235
            ME+L  AL ++ + VST PQKGR +FTTRDF PGEVI++QEPYVSVP    +  + K C+
Sbjct  1    MEDLHSALEDRSLAVSTVPQKGRSLFTTRDFYPGEVILTQEPYVSVPNNNSSVSAQKRCD  60

Query  236  WCFTSTNVKKCSACQVVYYCGATCQ  310
             CFT+TN+ KCS CQ V+YCG  CQ
Sbjct  61   RCFTTTNLSKCSRCQTVWYCGTACQ  85



>gb|EYU22918.1| hypothetical protein MIMGU_mgv1a007180mg [Erythranthe guttata]
Length=416

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 73/142 (51%), Gaps = 45/142 (32%)
 Frame = +2

Query  149  FSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKL  328
            ++ GEVIISQ P+V+VP   +  P +KCEWCF+S+N+K CSAC  V+YC  TCQ      
Sbjct  7    YTIGEVIISQSPFVAVPNVYEESPESKCEWCFSSSNIKACSACHAVWYCSTTCQ------  60

Query  329  HRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMS  508
                                                   N PTT  DN  LVE L SHMS
Sbjct  61   ---------------------------------------NFPTTDTDNSKLVEALGSHMS  81

Query  509  DIDEKQLVLYAQMANLVNLILQ  574
            D+D+KQLV Y QMA LVN ILQ
Sbjct  82   DVDQKQLVNYTQMAALVNAILQ  103



>gb|EEE59772.1| hypothetical protein OsJ_12271 [Oryza sativa Japonica Group]
Length=384

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +2

Query  299  ATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYA  478
            ++C + +WKLH+ EC+++  +  DR K L PTIRLMV+L LRRKLQ +  IP++  DNY 
Sbjct  95   SSCLREEWKLHQLECRAIAALTEDRKKMLTPTIRLMVRLVLRRKLQDDKAIPSSGTDNYN  154

Query  479  LVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
            LV+ L SH+S++D+ QLVLYAQMANLV LIL
Sbjct  155  LVDALESHISEVDKNQLVLYAQMANLVQLIL  185



>gb|KHN09175.1| Histone-lysine N-methyltransferase ASHR1-like protein, partial 
[Glycine soja]
Length=291

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  308  QKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVE  487
            Q+S+WKLHR ECQ L +++ D+ KSL P+IRLM++L+LRRKLQ++  +P+TAMDNY LVE
Sbjct  1    QRSEWKLHRLECQVLSRLDHDKRKSLTPSIRLMLRLHLRRKLQNDKIVPSTAMDNYNLVE  60

Query  488  LLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
             LV++MSDI E+QLVLYA+MANLVN ILQ
Sbjct  61   ALVAYMSDITEEQLVLYAKMANLVNSILQ  89



>gb|KDP32757.1| hypothetical protein JCGZ_12049 [Jatropha curcas]
Length=332

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 82/142 (58%), Gaps = 20/142 (14%)
 Frame = +2

Query  59   MEELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSA----  226
            MEEL+  L +KG++V+T P KGRC+FTT+DFSPGEVII +EPYV VP  T     A    
Sbjct  1    MEELKGFLEDKGLSVTTDPLKGRCLFTTKDFSPGEVIIPEEPYVCVPKSTFLIQVAIDVS  60

Query  227  --KCEWCFTSTNVKKCSACQVVY-YCGATCQ-------KSDWKLHRFECQSLFKVERDRI  376
                 W F          C V++ +     Q       K  WK+H  EC++L ++++   
Sbjct  61   DQAILWVFGM------PGCLVLWKHLPGVKQGILFIPSKLGWKMHLLECRALSRLDKKWH  114

Query  377  KSLAPTIRLMVKLYLRRKLQSE  442
              + P+IRL+VK++LRR LQ++
Sbjct  115  MFVTPSIRLIVKIFLRRNLQNQ  136



>gb|KDO80752.1| hypothetical protein CISIN_1g011626mg [Citrus sinensis]
Length=368

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +2

Query  404  MVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            M+KLYLRRKLQ++N IP+T  DNY+LVE LV+HMSDIDEKQL+LYAQ+ANLVNLILQ
Sbjct  1    MLKLYLRRKLQNDNVIPSTTTDNYSLVEALVAHMSDIDEKQLLLYAQIANLVNLILQ  57



>ref|XP_007018971.1| Uncharacterized protein TCM_035037 [Theobroma cacao]
 gb|EOY16196.1| Uncharacterized protein TCM_035037 [Theobroma cacao]
Length=114

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 69/120 (58%), Gaps = 12/120 (10%)
 Frame = +2

Query  65   ELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCF  244
            ELQ+    +G++VS    KGR +F  + F PGEVII +EPYV+        P   C+ CF
Sbjct  5    ELQDFPEAEGLSVSYILPKGRGLFAKKAFIPGEVIIREEPYVN----ESASPFPVCKGCF  60

Query  245  TSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLR  424
             S  + KCSACQ V+YCG+ CQ+ DW+LH   C SL     + + S   T R  + L+LR
Sbjct  61   ESQGLSKCSACQFVWYCGSECQRLDWRLH---CISL-----NIVPSQGLTRRGTILLHLR  112



>gb|EMS57953.1| Histone-lysine N-methyltransferase ASHR1 [Triticum urartu]
Length=362

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 57/94 (61%), Gaps = 15/94 (16%)
 Frame = +2

Query  161  EVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFE  340
            EVII QEPY S P +   G S  C+ CF S N++KCS             K +WKLH+ E
Sbjct  25   EVIICQEPYASTPNRISVGSS--CDHCFASGNLRKCS-------------KEEWKLHQLE  69

Query  341  CQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSE  442
            CQ++  +  +R K L PTI LMVKL LRRKLQSE
Sbjct  70   CQAISALTEERKKMLTPTICLMVKLILRRKLQSE  103



>emb|CDQ84991.1| unnamed protein product [Oncorhynchus mykiss]
Length=200

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/158 (30%), Positives = 82/158 (52%), Gaps = 10/158 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKK  265
            +G+     P KGR +  T+ F  GE++ +  PY  V T ++ G  + CE+CFT    + K
Sbjct  6    EGIERFVSPGKGRGLRVTKPFKVGELLFASLPYTYVLTASERG--SNCEFCFTRKEGLAK  63

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+   YC   CQK DW +H+ EC ++     +   S   ++RL+ ++  ++K Q + 
Sbjct  64   CGKCKKALYCNVKCQKGDWAMHKLECGAMIAYGENWCPS--ESVRLVARIIAKQKAQKDR  121

Query  446  NIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
            +     +    L+  L SH+ D+D EK+ +    +A+L
Sbjct  122  STSEKLL----LIGELESHIDDVDIEKREMNEGDIASL  155



>ref|NP_001085986.1| N-lysine methyltransferase SMYD2-B [Xenopus laevis]
 sp|Q6GN68.1|SMY2B_XENLA RecName: Full=N-lysine methyltransferase SMYD2-B; AltName: Full=Histone 
methyltransferase SMYD2-B; AltName: Full=SET and 
MYND domain-containing protein 2B [Xenopus laevis]
 gb|AAH73650.1| MGC82991 protein [Xenopus laevis]
Length=430

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 77/147 (52%), Gaps = 9/147 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKK  265
            +G+     P KGR +  TR F+ GE++ S   Y  V T  + G    C++CFT    + K
Sbjct  5    EGLERFDSPGKGRGLKATRSFALGELLFSCPAYTYVLTDNERG--NHCDFCFTRKEGLSK  62

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC   CQK DW +H+ EC S+    ++   S   T+RL  ++  ++K Q+E 
Sbjct  63   CGKCKQAFYCNVDCQKGDWPMHKLECSSMCSSGQNWCPS--ETVRLTARILAKQKTQTER  120

Query  446  NIPTTAMDNYALVELLVSHMSDIDEKQ  526
                TA + +  V+   SH+S +D ++
Sbjct  121  ----TASERFMSVKEFESHLSKLDNEK  143



>ref|XP_008396038.1| PREDICTED: N-lysine methyltransferase SMYD2 [Poecilia reticulata]
 ref|XP_008396039.1| PREDICTED: N-lysine methyltransferase SMYD2 [Poecilia reticulata]
Length=432

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKK  265
            +G+     P KGR +  T+ F  GE++ S  PY  V +  + G    CE+CFT    + +
Sbjct  6    EGIEKFDSPGKGRGLRVTKAFKVGELLFSSPPYSYVLSVEERGNY--CEFCFTRKEGLAR  63

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC A CQK DW +H+ EC ++     +   S   T RL+ ++  ++K+  E 
Sbjct  64   CGKCKKAFYCNAKCQKGDWAMHKLECSAMNAFGENWCPS--DTTRLVARILAKKKMMKER  121

Query  446  NIPTTAMDNYALVELLVSHMSDIDEKQ  526
             +    +    L+E L SH+ D D ++
Sbjct  122  CVSEKML----LIEELQSHLEDEDNEK  144



>ref|XP_002934751.2| PREDICTED: N-lysine methyltransferase SMYD2-A-like [Xenopus (Silurana) 
tropicalis]
Length=430

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 78/150 (52%), Gaps = 9/150 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKK  265
            +G+     P KGR +  TR F+ GE++ S   Y  V T  + G    CE+CF     + K
Sbjct  5    EGLERFDSPGKGRGLKATRPFALGELLFSCPAYTYVLTVNERG--NHCEFCFARKEGLSK  62

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC   CQK DW +H+ EC ++    ++   S   T+RL  ++  ++K Q+E 
Sbjct  63   CGKCKQAFYCNVDCQKGDWPMHKLECSAMCTYGQNWCPS--ETVRLTARILAKQKTQTER  120

Query  446  NIPTTAMDNYALVELLVSHMSDIDEKQLVL  535
                TA + +  V+   SH+S +D ++L L
Sbjct  121  ----TASERFLSVKDFESHLSKLDNEKLEL  146



>ref|XP_007552914.1| PREDICTED: N-lysine methyltransferase SMYD2-like [Poecilia formosa]
Length=432

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKK  265
            +G+     P KGR +  T+ F  GE++ S  PY  V +  + G    CE+CFT    + +
Sbjct  6    EGIEKFDSPGKGRGLRVTKAFKVGELLFSSPPYSYVLSIEERGNY--CEFCFTRKEGLAR  63

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC A CQK DW +H+ EC ++     +   S   T RL+ ++  ++K+  E 
Sbjct  64   CGKCKKAFYCNAKCQKGDWAMHKLECSAMNAFGENWCPS--DTTRLVARILAKKKMMKER  121

Query  446  NIPTTAMDNYALVELLVSHMSDIDEKQ  526
             +    +    L+E L SH+ D D ++
Sbjct  122  CVSEKML----LIEELQSHLEDEDNEK  144



>ref|XP_005800256.1| PREDICTED: N-lysine methyltransferase SMYD2-like [Xiphophorus 
maculatus]
Length=432

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 9/147 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKK  265
            +G+     P KGR +  T+ F  GE++ S  PY  V +  + G    CE+CFT    + +
Sbjct  6    EGIEKFDSPGKGRGLRVTKAFKVGELLFSSPPYSYVLSVEERG--NYCEFCFTRKEGLAR  63

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC A CQK DW +H+ EC ++     +   S   T RL+ ++  ++K+  E 
Sbjct  64   CGKCKKAFYCNAKCQKGDWAMHKLECSAMNAFGENWCPS--DTTRLVARILAKKKMMKER  121

Query  446  NIPTTAMDNYALVELLVSHMSDIDEKQ  526
             +    +    L+E L SH+ D D ++
Sbjct  122  CVSEKML----LIEELQSHLEDEDNEK  144



>ref|NP_001080251.1| N-lysine methyltransferase SMYD2-A [Xenopus laevis]
 sp|Q7ZXV5.1|SMY2A_XENLA RecName: Full=N-lysine methyltransferase SMYD2-A; AltName: Full=Histone 
methyltransferase SMYD2-A; AltName: Full=SET and 
MYND domain-containing protein 2A [Xenopus laevis]
 gb|AAH44103.1| Smyd2-prov protein [Xenopus laevis]
Length=430

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 83/158 (53%), Gaps = 10/158 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKK  265
            +G+     P KGR +  TR F+ GE++ +   Y  V T T+ G    C++CF     + K
Sbjct  5    EGLERFDSPGKGRGLKATRSFALGELLFTCPAYTYVLTDTERG--NHCDFCFARKEGLSK  62

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC   CQK DW +H+ EC ++    ++   S   T+RL  ++  ++K Q+E 
Sbjct  63   CGKCKQAFYCNVDCQKGDWPMHKLECSAMCSYGQNWCPS--ETVRLTARILAKQKTQTER  120

Query  446  NIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
                T  + +  V+   SH+S +D EK+ ++ + +A L
Sbjct  121  ----TPSETFLSVKEFESHLSKLDNEKKELIESDIAAL  154



>gb|EMT62266.1| Histone-lysine N-methyltransferase ASHR1 [Fusarium oxysporum 
f. sp. cubense race 4]
Length=546

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 72/136 (53%), Gaps = 9/136 (7%)
 Frame = +2

Query  110  HPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVY  289
            H +KGR IF+TR FSPG++I+   P + +P+ + T     C  CF   +V+ CS C  V 
Sbjct  11   HDKKGRGIFSTRAFSPGDIILPFTPTILIPSLSHT--KTICSHCFKPADVRSCSGCHAVS  68

Query  290  YCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS-----ENNI  451
            YC A CQ ++W  +H  EC+ L KV       +   +R +++  ++  + +     E N+
Sbjct  69   YCDAACQSANWTAVHSKECKLLRKVTEQGHPGIPTPVRAVIQALVKPGIGAALENLEGNV  128

Query  452  PT-TAMDNYALVELLV  496
             +    D +A +E++ 
Sbjct  129  ESWRKSDKWADMEMMA  144



>gb|EXM10732.1| SET and MYND protein [Fusarium oxysporum f. sp. cubense tropical 
race 4 54006]
Length=530

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 72/136 (53%), Gaps = 9/136 (7%)
 Frame = +2

Query  110  HPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVY  289
            H +KGR IF+TR FSPG++I+   P + +P+ + T     C  CF   +V+ CS C  V 
Sbjct  11   HDKKGRGIFSTRAFSPGDIILPFTPTILIPSLSHT--KTICSHCFKPADVRSCSGCHAVS  68

Query  290  YCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS-----ENNI  451
            YC A CQ ++W  +H  EC+ L KV       +   +R +++  ++  + +     E N+
Sbjct  69   YCDAACQSANWTAVHSKECKLLRKVTEQGHPGIPTPVRAVIQALVKPGIGAALENLEGNV  128

Query  452  PT-TAMDNYALVELLV  496
             +    D +A +E++ 
Sbjct  129  ESWRKSDKWADMEMMA  144



>ref|XP_007244713.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like [Astyanax 
mexicanus]
Length=433

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 73/139 (53%), Gaps = 9/139 (6%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTN-VKKCSACQVVY  289
            P KGR +  T+ F  G++I +   Y  V + ++ G    C++CFT    + KC  C+  Y
Sbjct  15   PGKGRGVRATKHFRVGDLIFACPAYCCVLSTSERG--NHCDFCFTRREALSKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQK DW +H+ EC S+     +   S   T+RL+ ++ L++K QSE     T  +
Sbjct  73   YCNVECQKGDWPMHKLECSSMCSYGENWCPS--ETVRLVARIILKQKFQSEG----TQSE  126

Query  470  NYALVELLVSHMSDIDEKQ  526
               L++   +H+  +D ++
Sbjct  127  RLLLLKEFEAHLDKVDNEK  145



>gb|KDQ60288.1| hypothetical protein JAAARDRAFT_191683 [Jaapia argillacea MUCL 
33604]
Length=586

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 89/181 (49%), Gaps = 23/181 (13%)
 Frame = +2

Query  95   VTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSV-PTKTKTGPSAKCEWCFTSTNVKKCS  271
            V +   P  GR IF     S G +IIS +P+V+V  TK      + C      T +K+C+
Sbjct  57   VEIRQTPSSGRGIFAKEKISRGSIIISTKPHVNVLSTKLLDAFCSACCAPAPPTGLKRCT  116

Query  272  ACQVVYYCGATCQKSDWKLHRFECQSLFK----VERDRIKSLAPTIRLMVKLYLRRKLQS  439
             C+ ++YC A CQ SDW +H+ EC +L K       + +   +  IR M ++  R+K++ 
Sbjct  117  RCRALWYCNAACQNSDWTMHKHECSALQKWAKSAPNEDVAIPSDAIRAMGRMLTRKKVEG  176

Query  440  ENNI---------------PTTAMDNYA-LVELLVSHMSDIDEKQLVLY--AQMANLVNL  565
             ++I               PT+A +++  L   LV ++      +L  Y  A +A+LV++
Sbjct  177  LDSIWAKEVDGMQSHRSSMPTSAFESHTQLSHFLVKYLGVSSPYELAQYGIAAVADLVDV  236

Query  566  I  568
            I
Sbjct  237  I  237



>ref|XP_003971775.1| PREDICTED: N-lysine methyltransferase SMYD2-B-like [Takifugu 
rubripes]
Length=432

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 79/158 (50%), Gaps = 10/158 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKK  265
            +GV     P KGR +  TR F  GE+++S + Y  V +  + G    CE CFT   ++ +
Sbjct  6    EGVERFDSPGKGRGLRVTRAFQVGELLLSSQAYSYVLSVKERGEH--CESCFTRKKSLAR  63

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC   CQK DW +HR EC ++         S     RL+ ++  ++K+Q + 
Sbjct  64   CGKCKKAFYCDVKCQKGDWAMHRLECSAMNAFGEKWCPS--EITRLVARILTKKKMQKDR  121

Query  446  NIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
                 A +   L+  + SH  D+D E++  + A +A L
Sbjct  122  ----CASEKLLLLGEMQSHTEDMDNERRETMEADVAGL  155



>ref|XP_008308104.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like [Cynoglossus 
semilaevis]
Length=435

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 77/150 (51%), Gaps = 10/150 (7%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVY  289
            P +GR +   R F+ GE++     Y SV T T+ G  A CE CFT   ++ KC  C+  Y
Sbjct  15   PSRGRGLRALRHFAVGELVFVCPAYSSVLTVTERG--AHCEHCFTRKEDLSKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ +++K  +E     T  +
Sbjct  73   YCNVDCQRGDWSMHKLECSAMCASGENWCPS--ETVRLVARMIMKQKTTTER----TPSE  126

Query  470  NYALVELLVSHMSDID-EKQLVLYAQMANL  556
               L+    SH+  +D EK  ++ A +  L
Sbjct  127  RLFLLREFESHLDKLDSEKDEMIQADILAL  156



>ref|XP_004083558.2| PREDICTED: N-lysine methyltransferase SMYD2 [Oryzias latipes]
 ref|XP_011489952.1| PREDICTED: N-lysine methyltransferase SMYD2 [Oryzias latipes]
 ref|XP_011489953.1| PREDICTED: N-lysine methyltransferase SMYD2 [Oryzias latipes]
 ref|XP_011489955.1| PREDICTED: N-lysine methyltransferase SMYD2 [Oryzias latipes]
Length=446

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 76/146 (52%), Gaps = 9/146 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+ + + P+KGR +  +R FS GE++ S   Y SV + T+ G    C+ CF     + +C
Sbjct  21   GLEMFSSPEKGRGLRVSRAFSVGELLFSCPAYSSVLSVTERGSC--CDLCFRRKEGLARC  78

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC  +CQK+DW +HR EC ++     +   S   T RL+ ++  ++K+Q    
Sbjct  79   GKCKKAFYCNTSCQKADWAMHRLECSAMVAFGENWCPS--ETSRLVARILAKKKMQK---  133

Query  449  IPTTAMDNYALVELLVSHMSDIDEKQ  526
                  +   L+  + SH+ D D ++
Sbjct  134  -GRCDSEKILLIGEMQSHLEDEDNEK  158



>ref|XP_007903218.1| PREDICTED: N-lysine methyltransferase SMYD2 isoform X2 [Callorhinchus 
milii]
Length=420

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 70/128 (55%), Gaps = 14/128 (11%)
 Frame = +2

Query  62   EELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWC  241
            EEL+  LSE          KGR +   R+F  G++I +   Y  V T  + G    CE+C
Sbjct  3    EELERFLSEG---------KGRGLRARRNFHVGDLIFTCPAYTHVLTVNERG--NHCEYC  51

Query  242  FT-STNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            F     + KC  C++ +YC  +CQK+DW +H+ EC S+ K  ++   S   T+RL  ++ 
Sbjct  52   FARKEGLAKCGRCKLAFYCNISCQKTDWPMHKLECASMCKFGQNWNPS--ETVRLTARIL  109

Query  419  LRRKLQSE  442
            +++KLQ+E
Sbjct  110  VQQKLQTE  117



>ref|XP_007903217.1| PREDICTED: N-lysine methyltransferase SMYD2 isoform X1 [Callorhinchus 
milii]
Length=429

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 70/128 (55%), Gaps = 14/128 (11%)
 Frame = +2

Query  62   EELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWC  241
            EEL+  LSE          KGR +   R+F  G++I +   Y  V T  + G    CE+C
Sbjct  3    EELERFLSEG---------KGRGLRARRNFHVGDLIFTCPAYTHVLTVNERG--NHCEYC  51

Query  242  FT-STNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLY  418
            F     + KC  C++ +YC  +CQK+DW +H+ EC S+ K  ++   S   T+RL  ++ 
Sbjct  52   FARKEGLAKCGRCKLAFYCNISCQKTDWPMHKLECASMCKFGQNWNPS--ETVRLTARIL  109

Query  419  LRRKLQSE  442
            +++KLQ+E
Sbjct  110  VQQKLQTE  117



>ref|XP_005734469.1| PREDICTED: N-lysine methyltransferase SMYD2-like [Pundamilia 
nyererei]
Length=432

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 10/160 (6%)
 Frame = +2

Query  83   SEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTST-NV  259
            S KG+     P KGR +  TR F  GE++ S   Y  V +  + G    CE+CFT T ++
Sbjct  4    SIKGLERFDSPGKGRGLRVTRPFKVGELLFSCPAYSHVLSVKERG--CYCEFCFTRTQHL  61

Query  260  KKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS  439
             +C  C+  +YC   CQK DW +H+ EC ++     +   S     RL+ ++  ++K+Q 
Sbjct  62   ARCGKCKKAFYCNVKCQKGDWAMHKLECSAMVAFGENWCPS--EISRLVARILAKKKMQK  119

Query  440  ENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
            E  +    +    L+  + SH  D D EK+ +  A +A L
Sbjct  120  ERCVCEKML----LIGEMQSHTEDEDNEKREMTEADIARL  155



>emb|CCT62122.1| uncharacterized protein FFUJ_01357 [Fusarium fujikuroi IMI 58289]
Length=530

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 9/136 (7%)
 Frame = +2

Query  110  HPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVY  289
            H +KGR IF+TR FSPG++I+   P + +P+ +       C  CF   +V+ CS C  V 
Sbjct  11   HDKKGRGIFSTRAFSPGDIILPFTPTILIPSLSHI--KTICSHCFKPADVRSCSGCHAVS  68

Query  290  YCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS-----ENNI  451
            YC A CQ ++W  +H  EC+ L KV       +   +R +++  ++  + +     E N+
Sbjct  69   YCDAACQSANWTAVHSKECKLLRKVTEQGHPGIPTPVRAVIQALVKPGIGAALENLEGNV  128

Query  452  PT-TAMDNYALVELLV  496
             +    D +A +E++ 
Sbjct  129  ESWRKSDKWADMEMMA  144



>gb|EXK47541.1| SET and MYND protein [Fusarium oxysporum f. sp. melonis 26406]
Length=530

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 9/136 (7%)
 Frame = +2

Query  110  HPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVY  289
            H +KGR IF+TR FSPG++I+   P + +P+ +       C  CF   +V+ CS C  V 
Sbjct  11   HDKKGRGIFSTRAFSPGDIILPFTPTILIPSLSHI--KTICSHCFKPADVRSCSGCHAVS  68

Query  290  YCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS-----ENNI  451
            YC A CQ ++W  +H  EC+ L KV       +   +R +++  ++  + +     E N+
Sbjct  69   YCDAACQSANWTAVHSKECKLLRKVTEQGHPGIPTPVRAVIQALVKPGIGAALENLEGNV  128

Query  452  PT-TAMDNYALVELLV  496
             +    D +A +E++ 
Sbjct  129  ESWRKSDKWADMEMMA  144



>gb|EWY94394.1| SET and MYND protein [Fusarium oxysporum FOSC 3-a]
Length=530

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 9/136 (7%)
 Frame = +2

Query  110  HPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVY  289
            H +KGR IF+TR FSPG++I+   P + +P+ +       C  CF   +V+ CS C  V 
Sbjct  11   HDKKGRGIFSTRAFSPGDIILPFTPTILIPSLSHI--KTICSHCFKPADVRSCSGCHAVS  68

Query  290  YCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS-----ENNI  451
            YC A CQ ++W  +H  EC+ L KV       +   +R +++  ++  + +     E N+
Sbjct  69   YCDAACQSANWTAVHSKECKLLRKVTEQGHPGIPTPVRAVIQALVKPGIGAALENLEGNV  128

Query  452  PT-TAMDNYALVELLV  496
             +    D +A +E++ 
Sbjct  129  ESWRKSDKWADMEMMA  144



>gb|EXM28398.1| SET and MYND protein [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=530

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 9/136 (7%)
 Frame = +2

Query  110  HPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVY  289
            H +KGR IF+TR FSPG++I+   P + +P+ +       C  CF   +V+ CS C  V 
Sbjct  11   HDKKGRGIFSTRAFSPGDIILPFTPTILIPSLSHI--KTICSHCFKPADVRSCSGCHAVS  68

Query  290  YCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS-----ENNI  451
            YC A CQ ++W  +H  EC+ L KV       +   +R +++  ++  + +     E N+
Sbjct  69   YCDAACQSANWTAVHSKECKLLRKVTEQGHPGIPTPVRAVIQALVKPGIGAALENLEGNV  128

Query  452  PT-TAMDNYALVELLV  496
             +    D +A +E++ 
Sbjct  129  ESWRKSDKWADMEMMA  144



>gb|EXA53483.1| SET and MYND protein [Fusarium oxysporum f. sp. pisi HDV247]
Length=530

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 9/136 (7%)
 Frame = +2

Query  110  HPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVY  289
            H +KGR IF+TR FSPG++I+   P + +P+ +       C  CF   +V+ CS C  V 
Sbjct  11   HDKKGRGIFSTRAFSPGDIILPFTPTILIPSLSHI--KTICSHCFKPADVRSCSGCHAVS  68

Query  290  YCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS-----ENNI  451
            YC A CQ ++W  +H  EC+ L KV       +   +R +++  ++  + +     E N+
Sbjct  69   YCDAACQSANWTAVHSKECKLLRKVTEQGHPGIPTPVRAVIQALVKPGIGAALENLEGNV  128

Query  452  PT-TAMDNYALVELLV  496
             +    D +A +E++ 
Sbjct  129  ESWRKSDKWADMEMMA  144



>gb|EWZ50299.1| SET and MYND protein [Fusarium oxysporum Fo47]
 gb|EWZ92231.1| SET and MYND protein [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXL49243.1| SET and MYND protein [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=530

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 71/136 (52%), Gaps = 9/136 (7%)
 Frame = +2

Query  110  HPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVY  289
            H +KGR IF+TR FSPG++I+   P + +P+ +       C  CF   +V+ CS C  V 
Sbjct  11   HDKKGRGIFSTRAFSPGDIILPFTPTILIPSLSHI--KTICSHCFKPADVRSCSGCHAVS  68

Query  290  YCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS-----ENNI  451
            YC A CQ ++W  +H  EC+ L KV       +   +R +++  ++  + +     E N+
Sbjct  69   YCDAACQSANWTAVHSKECKLLRKVTEQGHPGIPTPVRAVIQALVKPGIGAALENLEGNV  128

Query  452  PT-TAMDNYALVELLV  496
             +    D +A +E++ 
Sbjct  129  ESWRKSDKWADMEMMA  144



>gb|EKD03370.1| hypothetical protein A1Q2_02350 [Trichosporon asahii var. asahii 
CBS 8904]
Length=573

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 65/124 (52%), Gaps = 19/124 (15%)
 Frame = +2

Query  68   LQEALSEKGVTVSTHPQKGRCIFTTRD------------FSPGEVIISQEPYVSVPTKTK  211
             ++ L+   + V T PQ+GR ++  RD             +PGE ++  +P VSV +K  
Sbjct  50   FRDELAGSPLEVKTSPQRGRGLYAARDIKAGELVWRAPKLTPGETLLKTKPLVSVLSKPN  109

Query  212  T-GPSA------KCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERD  370
               P+A       C  C+     ++CS C+ VYYCGA CQ+ DW  H+ EC++L +V + 
Sbjct  110  LYEPAAGQKMELHCNHCYLLKPAQRCSGCKGVYYCGAACQQDDWPSHKTECKALTRVRQL  169

Query  371  RIKS  382
             ++S
Sbjct  170  WVQS  173



>ref|XP_006797154.1| PREDICTED: N-lysine methyltransferase SMYD2-like [Neolamprologus 
brichardi]
Length=432

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 79/158 (50%), Gaps = 10/158 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTST-NVKK  265
            KG+     P KGR +  TR F  GE++ S   Y  V +  + G    CE+CFT T ++ +
Sbjct  6    KGLERFDSPGKGRGLRVTRPFKVGELLFSCPAYSHVLSVKERG--CYCEFCFTRTQHLAR  63

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC   CQK DW +H+ EC ++     +   S     RL+ ++  ++K+Q E 
Sbjct  64   CGKCKKAFYCNVKCQKGDWAMHKLECSAMVAFGENWCPS--EISRLVARILAKKKMQKER  121

Query  446  NIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
             +     +   L+  + SH  D D EK+ +  A +A L
Sbjct  122  CV----CEKMFLIGEMQSHTEDEDNEKREMTEADIARL  155



>ref|XP_010780557.1| PREDICTED: N-lysine methyltransferase SMYD2 [Notothenia coriiceps]
Length=432

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 78/157 (50%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+     P KGR +  T+ F  GE++ S   +  V +  + G    CE+CFT    + +C
Sbjct  7    GIERFDSPGKGRGLRVTKPFKTGELLFSTPAHSYVLSVKERG--CYCEFCFTRKEGLARC  64

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC A CQK DW +H+ EC +L     +   S     RL+ ++  ++K Q E  
Sbjct  65   GKCKKAFYCNAKCQKGDWAMHKLECSALTAFGENWCPS--EISRLVARILAKKKTQKER-  121

Query  449  IPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
                A +   L+E + SH  D+D EK+ +  + +A L
Sbjct  122  ---CASEKMLLIEEIQSHEEDVDNEKREMNESDIAGL  155



>ref|XP_005164480.1| PREDICTED: N-lysine methyltransferase SMYD2-B isoform X1 [Danio 
rerio]
 sp|Q5RGL7.2|SMY2B_DANRE RecName: Full=N-lysine methyltransferase SMYD2-B; AltName: Full=Histone 
methyltransferase SMYD2-B; AltName: Full=SET and 
MYND domain-containing protein 2B [Danio rerio]
Length=434

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 81/157 (52%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+     P KGR +  +R +  GE++ S   Y  V +  + G    CE CFT    + KC
Sbjct  9    GIEQFASPGKGRGLRVSRAYGVGELLFSCPAYSYVLSVGERG--LICEQCFTRKKGLAKC  66

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC A CQK +W +H+ ECQ++     +   S   T+RL+ ++  R K Q E +
Sbjct  67   GKCKKAFYCNANCQKKNWPMHKLECQAMCAFGENWRPS--ETVRLVARIIARLKAQKERS  124

Query  449  IPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
             P+  +    L+  + +H+ D+D EK+ +  A +A L
Sbjct  125  -PSEIL---LLLGEMEAHLEDMDNEKREMTEAHIAGL  157



>ref|XP_005914557.1| PREDICTED: N-lysine methyltransferase SMYD2-like isoform X2 [Haplochromis 
burtoni]
Length=375

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 79/158 (50%), Gaps = 10/158 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTST-NVKK  265
            KG+     P KGR +  +R F  GE++ S   Y  V +  + G    CE+CFT T ++ +
Sbjct  6    KGLERFDSPGKGRGLRVSRPFKVGELLFSCPAYSHVLSVKERG--CYCEFCFTRTQHLAR  63

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC   CQK DW +H+ EC ++     +   S     RL+ ++  ++K+Q E 
Sbjct  64   CGKCKKAFYCNVKCQKGDWAMHKLECSAMVAFGENWCPS--EISRLVARILAKKKMQKER  121

Query  446  NIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
             +    +    L+  + SH  D D EK+ +  A +A L
Sbjct  122  CVCEKML----LIGEMQSHTEDEDNEKREMTEADIARL  155



>ref|NP_001025394.1| N-lysine methyltransferase SMYD2-B isoform 1 [Danio rerio]
Length=437

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 81/157 (52%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+     P KGR +  +R +  GE++ S   Y  V +  + G    CE CFT    + KC
Sbjct  9    GIEQFASPGKGRGLRVSRAYGVGELLFSCPAYSYVLSVGERG--LICEQCFTRKKGLAKC  66

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC A CQK +W +H+ ECQ++     +   S   T+RL+ ++  R K Q E +
Sbjct  67   GKCKKAFYCNANCQKKNWPMHKLECQAMCAFGENWRPS--ETVRLVARIIARLKAQKERS  124

Query  449  IPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
             P+  +    L+  + +H+ D+D EK+ +  A +A L
Sbjct  125  -PSEIL---LLLGEMEAHLEDMDNEKREMTEAHIAGL  157



>ref|XP_001838336.2| hypothetical protein CC1G_04780 [Coprinopsis cinerea okayama7#130]
 gb|EAU83524.2| hypothetical protein CC1G_04780 [Coprinopsis cinerea okayama7#130]
Length=604

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = +2

Query  101  VSTHPQKGRCIFTTRD-FSPGEVIISQEPYVSVPTKTKTGPSAKCEWCF---TSTNVKKC  268
            +   P+ GR I+TT + F PG V++S +P+++  + ++   S+ C  CF   TS  +K+C
Sbjct  64   IRVEPETGRGIYTTDNGFKPGAVLVSTKPHIATLSTSQL--SSYCSACFGPGTSAPLKRC  121

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSL  352
              C++V YCG+ CQ  DW LH+ EC +L
Sbjct  122  PNCKIVMYCGSACQSRDWSLHKLECSAL  149



>ref|XP_002594889.1| hypothetical protein BRAFLDRAFT_124463 [Branchiostoma floridae]
 gb|EEN50900.1| hypothetical protein BRAFLDRAFT_124463 [Branchiostoma floridae]
Length=463

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 85/161 (53%), Gaps = 17/161 (11%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            GV + +  +KGR +  T+ F PG ++ + +PY  V   ++ G   +C++CF    ++ +C
Sbjct  4    GVEIFSSAEKGRGLCATKVFKPGNLVRAADPYAYVLCNSERG--KRCDFCFARKDDMSRC  61

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPT--IRLMVKLYLRRKLQSE  442
            S C+   YC   CQK+ W  H+ EC+S+       +K   PT  IRL+ ++  + K  S 
Sbjct  62   SGCKFARYCDGKCQKAAWTEHKSECKSI-----KTVKPETPTDSIRLIARIINKTKTDSP  116

Query  443  NNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNL  565
              +P  ++D       L S++ ++ E    ++AQ+A ++ +
Sbjct  117  -GVPGNSIDE------LQSNLREMPENVKEMFAQLAVVLRM  150



>ref|XP_005914556.1| PREDICTED: N-lysine methyltransferase SMYD2-like isoform X1 [Haplochromis 
burtoni]
Length=432

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 79/158 (50%), Gaps = 10/158 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTST-NVKK  265
            KG+     P KGR +  +R F  GE++ S   Y  V +  + G    CE+CFT T ++ +
Sbjct  6    KGLERFDSPGKGRGLRVSRPFKVGELLFSCPAYSHVLSVKERG--CYCEFCFTRTQHLAR  63

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC   CQK DW +H+ EC ++     +   S     RL+ ++  ++K+Q E 
Sbjct  64   CGKCKKAFYCNVKCQKGDWAMHKLECSAMVAFGENWCPS--EISRLVARILAKKKMQKER  121

Query  446  NIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
             +    +    L+  + SH  D D EK+ +  A +A L
Sbjct  122  CVCEKML----LIGEMQSHTEDEDNEKREMTEADIARL  155



>ref|XP_004541863.1| PREDICTED: N-lysine methyltransferase SMYD2-like [Maylandia zebra]
Length=432

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 79/160 (49%), Gaps = 10/160 (6%)
 Frame = +2

Query  83   SEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTST-NV  259
            S KG+     P KGR +  TR F  GE++ S   Y  V +  + G    CE+CFT T ++
Sbjct  4    SIKGLERFDSPGKGRGLRVTRPFKVGELLFSCPAYSHVLSVKERG--CYCEFCFTRTQHL  61

Query  260  KKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS  439
             +C  C+  +YC   CQK DW +H+ EC ++     +   S     RL+ ++  ++K+Q 
Sbjct  62   ARCGKCKKAFYCNVKCQKGDWAMHKLECSAMVAFGENWCPS--EISRLVARILAKKKMQK  119

Query  440  ENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
            E  +    +    L+  + SH  D D EK+ +  A +A  
Sbjct  120  ERCVCEKML----LIGEMQSHTEDEDNEKREMTEADIARF  155



>gb|KIJ28651.1| hypothetical protein M422DRAFT_189461, partial [Sphaerobolus 
stellatus SS14]
Length=325

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/175 (26%), Positives = 88/175 (50%), Gaps = 28/175 (16%)
 Frame = +2

Query  119  KGRCIFTTRDFSPGEVIISQEPYV-SVPTKTKTGPSAKCEWCF----TSTNVKKCSACQV  283
            KGR ++  + F  G V+++Q PY+ S+ T      S+ C +C     + +++K+C+ C+V
Sbjct  49   KGRGVYAKKSFKRGTVLLAQRPYIISISTPNL---SSYCSYCAVPSKSESSLKRCTKCKV  105

Query  284  VYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAP--TIRLMVKLYLRRKLQSEN----  445
            V+YC + CQ +DW +H+ EC ++ +          P   +R + ++   RK+Q E+    
Sbjct  106  VWYCSSVCQNADWPIHKHECPAICRWMASAPDGSPPGEAVRTLGRILWGRKVQGEDSGWW  165

Query  446  -----------NIPTTAMDNYA-LVELLVSHMSDIDEKQLVLYA--QMANLVNLI  568
                       ++P+++ D+Y  L   LV ++      +L  Y      ++V+LI
Sbjct  166  KEILALQSHRGSLPSSSTDSYTQLAHFLVRYLGVTSPIELEPYGLHSAGDIVDLI  220



>gb|EWG37838.1| SET and MYND protein [Fusarium verticillioides 7600]
Length=530

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 57/106 (54%), Gaps = 3/106 (3%)
 Frame = +2

Query  110  HPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVY  289
            H  KGR IF+TR FSPG++I+   P + +P+ +       C  CF   +V+ CS C  V 
Sbjct  11   HDTKGRGIFSTRAFSPGDIILPFTPTILIPSLSHI--KTICSHCFKPADVRSCSGCHAVS  68

Query  290  YCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLR  424
            YC A CQ ++W  +H  EC+ L KV       +   +R +++  ++
Sbjct  69   YCDAACQSANWTAVHSKECKLLRKVTEQGHPGIPTPVRAVIQALVK  114



>ref|XP_005288778.1| PREDICTED: N-lysine methyltransferase SMYD2 [Chrysemys picta 
bellii]
Length=436

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 80/159 (50%), Gaps = 10/159 (6%)
 Frame = +2

Query  86   EKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVK  262
            E+G+   T P KGR +   + F+PGE++ S   Y  V T ++ G    CE CF     + 
Sbjct  9    EEGLERFTSPGKGRGLRARQRFAPGELLFSCPAYTCVLTVSERG--NHCECCFARKEGLS  66

Query  263  KCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSE  442
            KC  C+  +YC   CQK+DW +H+ EC ++    ++   S   T+RL  ++  ++K   E
Sbjct  67   KCGRCKQAFYCNVECQKADWAMHKLECSAMCVFGQNWNPS--ETVRLTARILAKQKTHPE  124

Query  443  NNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
                 T  +    V+   SH+  +D EK+ ++   +A L
Sbjct  125  R----TQSEKLLAVKEFESHLDKLDNEKRELIQNDIAAL  159



>ref|XP_004067302.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like [Oryzias latipes]
Length=435

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 79/150 (53%), Gaps = 10/150 (7%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTS-TNVKKCSACQVVY  289
            P KGR +   RDF+ GE++ +   Y  V T  + G  A CE CFT   ++ KC  C+  Y
Sbjct  15   PDKGRGLRALRDFAVGELVFACPAYSYVLTVNERG--AHCEHCFTRREDLFKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ +++++ +E     T  +
Sbjct  73   YCNVDCQRGDWPMHKLECVAMCTHGENWCPS--ETVRLVSRIIMKQRVTTER----TPSE  126

Query  470  NYALVELLVSHMSDID-EKQLVLYAQMANL  556
               L++   SH+  +D EK  +  A +A L
Sbjct  127  RLLLLKEFESHLDKMDSEKDEMNQADIAAL  156



>ref|XP_008404070.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like [Poecilia 
reticulata]
Length=424

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 80/152 (53%), Gaps = 10/152 (7%)
 Frame = +2

Query  107  THPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTS-TNVKKCSACQV  283
             HP +GR +   R F+ GE++ +   Y  V T  + G  A CE CFT   ++ KC  C+ 
Sbjct  2    VHPDRGRGLRAVRHFAVGELVFACPAYSYVLTVNERG--AHCEHCFTRREDLFKCGKCKQ  59

Query  284  VYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTA  463
             YYC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ +++++ ++     T 
Sbjct  60   AYYCNVDCQRGDWPMHKLECVAMCAYGENWCPS--ETVRLVARIIMKQRVTTDR----TP  113

Query  464  MDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
             +   L++   +H+  +D EK+ +  A +A L
Sbjct  114  SERLLLLKEFEAHLDKMDSEKEELNQADIAAL  145



>gb|ABI34494.1| SET and MYND domain containing 2a [Danio rerio]
Length=156

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 70/139 (50%), Gaps = 9/139 (6%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVY  289
            P KGR +   + F  G+++ +   Y  V T  + G   +CE CFT    + KC  C+  Y
Sbjct  15   PGKGRGLKAIKHFKVGDLVFACPAYAYVLTVNERG--GRCECCFTRKEGLSKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ L++K Q+E     T  +
Sbjct  73   YCNVECQRGDWPMHKLECSAMCAYGENWCPS--ETVRLVARIILKQKHQTER----TPSE  126

Query  470  NYALVELLVSHMSDIDEKQ  526
                +  L +H+  +D ++
Sbjct  127  RVLTLRELEAHLDKLDNEK  145



>ref|XP_003449905.1| PREDICTED: N-lysine methyltransferase SMYD2-like [Oreochromis 
niloticus]
Length=440

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 80/160 (50%), Gaps = 10/160 (6%)
 Frame = +2

Query  83   SEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTST-NV  259
            S +G+     P KGR +  TR F  GE++ S   +  V +  + G    CE+CFT T ++
Sbjct  12   SIEGLERFDSPGKGRGLRVTRPFKVGELLFSCPAFSHVLSVKERG--CYCEFCFTRTQHL  69

Query  260  KKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS  439
             +C  C+  +YC   CQK DW +H+ EC ++     +   S     RL+ ++  ++K+Q 
Sbjct  70   ARCGKCKKAFYCNVKCQKGDWAMHKLECSAMVAFGENWCPS--ELSRLVARILAKKKMQK  127

Query  440  ENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
            E  I    +    L+  + SH  D D EK+ +  A +A L
Sbjct  128  ERCICEKML----LIGEMQSHTEDEDNEKREMTEADIAGL  163



>ref|XP_008285163.1| PREDICTED: N-lysine methyltransferase SMYD2-like [Stegastes partitus]
Length=432

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 77/158 (49%), Gaps = 10/158 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKK  265
            +G+     P KGR +  TR F  GE++ S   Y  V +  + G    CE+CF     + +
Sbjct  6    EGLERFDSPGKGRGLRVTRAFKVGELLFSSPAYCYVLSAKERG--CYCEFCFNRKEGLAR  63

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC A CQK DW +H+ EC ++     +   S     RL+ ++  ++K Q E 
Sbjct  64   CGKCKKAFYCNAKCQKGDWAMHKLECSAMLAFGENWCPS--EMSRLVARILAKKKTQKER  121

Query  446  NIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
             +    +    L+  + SH+ D D E++ +  A +A L
Sbjct  122  CVSEKLL----LIGDVQSHVEDEDNERREMNEADLAGL  155



>ref|XP_010894609.1| PREDICTED: N-lysine methyltransferase SMYD2 [Esox lucius]
Length=447

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKK  265
            +G      P KGR +   + F+ G+++ +   Y  V T  + G  A CE+CFT    + K
Sbjct  20   EGTERFASPGKGRGLRALKHFAVGDLVFACPAYSYVLTANERG--AHCEYCFTRKEGLSK  77

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  YYC   CQK DW +H+ EC ++     +   S   T+RL+ ++ +++K+ +E 
Sbjct  78   CGKCKQAYYCEVDCQKGDWPMHKLECTAMCSYGENWCPS--ETVRLVARILMKQKVTTER  135

Query  446  NIPTTAMDNYALVELLVSHMSDIDEKQ  526
                T  +   L+    +H+  +D ++
Sbjct  136  ----TQSERLLLLSEFEAHLDKLDNEK  158



>gb|KIJ27280.1| hypothetical protein M422DRAFT_191221, partial [Sphaerobolus 
stellatus SS14]
Length=477

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/175 (26%), Positives = 88/175 (50%), Gaps = 28/175 (16%)
 Frame = +2

Query  119  KGRCIFTTRDFSPGEVIISQEPYV-SVPTKTKTGPSAKCEWCF----TSTNVKKCSACQV  283
            KGR ++  + F  G V+++Q PY+ S+ T      S+ C +C     + +++K+C+ C+V
Sbjct  49   KGRGVYAKKSFKRGTVLLAQRPYIISISTPNL---SSYCSYCAVPSKSESSLKRCTKCKV  105

Query  284  VYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAP--TIRLMVKLYLRRKLQSEN----  445
            V+YC + CQ +DW +H+ EC ++ +          P   +R + ++   RK+Q E+    
Sbjct  106  VWYCSSVCQNADWPIHKHECPAICRWMASAPDGSPPGEAVRTLGRILWGRKVQGEDSGWW  165

Query  446  -----------NIPTTAMDNYA-LVELLVSHMSDIDEKQLVLYA--QMANLVNLI  568
                       ++P+++ D+Y  L   LV ++      +L  Y      ++V+LI
Sbjct  166  KEILALQSHRGSLPSSSTDSYTQLAHFLVRYLGVTSPVELEPYGLHSAGDIVDLI  220



>gb|EXK90053.1| SET and MYND protein [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL83700.1| SET and MYND protein [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
Length=530

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 70/136 (51%), Gaps = 9/136 (7%)
 Frame = +2

Query  110  HPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVY  289
            H +KGR IF+TR  SPG++I+   P + +P+ +       C  CF   +V+ CS C  V 
Sbjct  11   HDKKGRGIFSTRALSPGDIILPFTPTILIPSLSHI--KTICSHCFKPADVRSCSGCHAVS  68

Query  290  YCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS-----ENNI  451
            YC A CQ ++W  +H  EC+ L KV       +   +R +++  ++  + +     E N+
Sbjct  69   YCDAACQSANWTAVHSKECKLLRKVTEQGHPGIPTPVRAVIQALVKPGIGAALENLEGNV  128

Query  452  PT-TAMDNYALVELLV  496
             +    D +A +E++ 
Sbjct  129  ESWRKSDKWADMEMMA  144



>ref|XP_003053442.1| hypothetical protein NECHADRAFT_74600 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU47729.1| hypothetical protein NECHADRAFT_74600 [Nectria haematococca mpVI 
77-13-4]
Length=530

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 9/137 (7%)
 Frame = +2

Query  119  KGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCG  298
            KGRC+  +R F+PG+ I++  P + +P+ +    S  C  CF     + CS C  V YC 
Sbjct  14   KGRCLIASRSFTPGDTILTFTPTILIPSLSHA--STVCSHCFKPGEPRSCSRCHAVAYCD  71

Query  299  ATCQKSDWK-LHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSE------NNIPT  457
            A+CQ + WK +H  EC+ L KV       L   +R +V+  ++ ++ +       N++  
Sbjct  72   ASCQSAAWKAIHSKECKVLQKVSAQGRPGLPTPVRAVVQALVKAEVGAALEDLEGNDLSW  131

Query  458  TAMDNYALVELLVSHMS  508
               D +A +E++    S
Sbjct  132  RGSDKWADMEMMAMGAS  148



>ref|XP_008284973.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like [Stegastes 
partitus]
Length=435

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 79/150 (53%), Gaps = 10/150 (7%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVY  289
            P +GR +   R F+ GE++ +   Y  V T  + G  A CE CFT   ++ KC  C+  Y
Sbjct  15   PDRGRGLRALRHFAVGELVFACPAYSYVLTVNERG--AHCEHCFTRKEDLFKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ +++++ +E     T  +
Sbjct  73   YCNVDCQRGDWPMHKLECVAMCAYGENWCPS--ETVRLVARIIMKQRVTTER----TPSE  126

Query  470  NYALVELLVSHMSDID-EKQLVLYAQMANL  556
               L++   SH+  +D EK+ +  A +A L
Sbjct  127  RLLLLKEFESHLDKMDSEKEEMNQADIAAL  156



>ref|XP_010732983.1| PREDICTED: N-lysine methyltransferase SMYD2 isoform X2 [Larimichthys 
crocea]
Length=395

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 78/160 (49%), Gaps = 10/160 (6%)
 Frame = +2

Query  83   SEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNV  259
            S KGV     P KGR +  T+ F  GE++ S   Y  V T  + G    CE CFT    +
Sbjct  4    SIKGVERFDSPGKGRGLRVTKPFKVGELLFSCPAYSYVLTVKERG--CFCECCFTRKEGL  61

Query  260  KKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS  439
             KC  C+  +YC   CQK+DW +H+ EC ++     +   S     RL+ ++  ++K Q 
Sbjct  62   AKCGKCKKAFYCNVKCQKADWAMHKLECSAMTAFGENWCPS--EMSRLVARILAKKKTQK  119

Query  440  ENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
            E  +    +    L+  + SH+ D+D EK+ +    +A L
Sbjct  120  ERCVSEKIL----LIGDVQSHVEDVDNEKREMTEVDVAGL  155



>gb|EJT50303.1| hypothetical protein A1Q1_00408 [Trichosporon asahii var. asahii 
CBS 2479]
Length=582

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 19/124 (15%)
 Frame = +2

Query  68   LQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVI------------ISQEPYVSVPTKTK  211
             ++ L+   + V T PQ+GR ++  RD   GE++            +  +P VSV +K  
Sbjct  50   FRDELAGSPLEVKTSPQRGRGLYAARDIKAGELVWRAPKLTAGETLLKTKPLVSVLSKPN  109

Query  212  T-GPSA------KCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERD  370
               P+A       C  C+     ++CS C+ VYYCGA CQ++DW  H+ EC++L +V + 
Sbjct  110  LYEPAAGQKMELHCNHCYLLKPAQRCSGCKGVYYCGAACQQADWPSHKTECKALTRVRQL  169

Query  371  RIKS  382
             ++S
Sbjct  170  WVQS  173



>ref|XP_010866973.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like, partial [Esox 
lucius]
Length=170

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 66/131 (50%), Gaps = 5/131 (4%)
 Frame = +2

Query  83   SEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNV  259
            S +G+     P KGR +  T+ F  GE++    PY  V T ++ G    CE+CFT    +
Sbjct  4    SFEGIEKFDSPGKGRGLRVTKHFQVGELLFVSLPYAYVLTASERG--CHCEFCFTRKEGL  61

Query  260  KKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS  439
             KC  C+  +YC   CQK DW +H+ EC ++     +   S   T+RL+ ++  ++  + 
Sbjct  62   AKCGKCKKAFYCNVKCQKGDWAMHKLECGAMTAFGENWCPS--DTVRLVSRIIAKQVRED  119

Query  440  ENNIPTTAMDN  472
            +  I    +D+
Sbjct  120  KLTIIALLLDH  130



>ref|XP_010732982.1| PREDICTED: N-lysine methyltransferase SMYD2 isoform X1 [Larimichthys 
crocea]
Length=432

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 78/160 (49%), Gaps = 10/160 (6%)
 Frame = +2

Query  83   SEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNV  259
            S KGV     P KGR +  T+ F  GE++ S   Y  V T  + G    CE CFT    +
Sbjct  4    SIKGVERFDSPGKGRGLRVTKPFKVGELLFSCPAYSYVLTVKERG--CFCECCFTRKEGL  61

Query  260  KKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS  439
             KC  C+  +YC   CQK+DW +H+ EC ++     +   S     RL+ ++  ++K Q 
Sbjct  62   AKCGKCKKAFYCNVKCQKADWAMHKLECSAMTAFGENWCPS--EMSRLVARILAKKKTQK  119

Query  440  ENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
            E  +    +    L+  + SH+ D+D EK+ +    +A L
Sbjct  120  ERCVSEKIL----LIGDVQSHVEDVDNEKREMTEVDVAGL  155



>gb|EYB33851.1| hypothetical protein FG05_01168 [Fusarium graminearum]
 emb|CEF73250.1| unnamed protein product [Fusarium graminearum]
Length=530

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 62/112 (55%), Gaps = 4/112 (4%)
 Frame = +2

Query  101  VSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQ  280
            V +H +KGR IF+T+ F+PG+VI+   P + +P+ +    +  C  CF    V+ CS C 
Sbjct  9    VKSH-RKGRGIFSTKSFAPGDVILPFTPTILIPSLSHI--NTICSHCFKQAEVRACSRCH  65

Query  281  VVYYCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             V YC A CQ ++W  +H  EC+ L KV       L   IR +V+  ++ ++
Sbjct  66   AVSYCDAACQAANWTAVHSKECKVLRKVTEQGRPGLPTPIRAVVQALVKPEI  117



>ref|XP_010730623.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like [Larimichthys 
crocea]
Length=435

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 73/139 (53%), Gaps = 9/139 (6%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTS-TNVKKCSACQVVY  289
            P +GR +   R F+ GE++ +   Y  V T  + G  A CE CFT   ++ KC  C+  Y
Sbjct  15   PDRGRGLRAVRHFAVGELVFACPSYAYVLTVNERG--AHCEHCFTRREDLFKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ L++++ +E     T  +
Sbjct  73   YCNVDCQRGDWPMHKLECVAMCAYGENWCPS--ETVRLVARIILKQRVTTER----TPSE  126

Query  470  NYALVELLVSHMSDIDEKQ  526
               L++   +H+  +D ++
Sbjct  127  RLLLLKEFEAHLDKMDSEK  145



>ref|XP_005998637.1| PREDICTED: N-lysine methyltransferase SMYD2 [Latimeria chalumnae]
Length=424

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 76/157 (48%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+     P KGR +   ++F  G+++ S   Y  V T  + G    CE+CF     + KC
Sbjct  9    GIERFNSPGKGRGLQARKEFEVGDLVFSCPAYTHVLTVNERG--NHCEFCFARKEGLSKC  66

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC   CQ+ DW +H+ EC S+    ++   S   T+RL  ++  ++K   E  
Sbjct  67   GRCKQAFYCNVECQRGDWPMHKLECSSMRTFGQNWNPS--ETVRLTARILAKQKTHPER-  123

Query  449  IPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
               T+ +    V    SH+  +D EK+ ++ + +A L
Sbjct  124  ---TSSEKLLAVSEFESHLDKLDNEKRELIQSDIAGL  157



>ref|XP_003284216.1| hypothetical protein DICPUDRAFT_147973 [Dictyostelium purpureum]
 gb|EGC39312.1| hypothetical protein DICPUDRAFT_147973 [Dictyostelium purpureum]
Length=507

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 83/157 (53%), Gaps = 22/157 (14%)
 Frame = +2

Query  83   SEKGVTV--STHPQKGRCIFTTRDFSPGEVIISQ-EPYV-SVPTKTKTGPSAKCEWCFTS  250
            + KG+ +  S +  K   +F+TR F  GE I+S  EPYV SVP          C++C  +
Sbjct  26   NSKGIELRTSNNSDKDLGVFSTRKFKKGEEILSNIEPYVHSVPQHNIV-----CDYCLKN  80

Query  251  T---------NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAP----  391
                      ++K+C+ C+++YYC   CQK  W +H+ EC+ L    ++ ++   P    
Sbjct  81   KNNENLNTTISLKRCTGCKLIYYCSIDCQKKAWPIHKHECKILLAAAQESLQINKPINTK  140

Query  392  TIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSH  502
            +  ++++++++R L+ +N+        + +++ L++H
Sbjct  141  STVMLLRIFIKRMLEIQNSNHIDKTGQFEIIDYLLNH  177



>dbj|GAM19369.1| hypothetical protein SAMD00019534_025440 [Acytostelium subglobosum 
LB1]
Length=488

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 84/168 (50%), Gaps = 12/168 (7%)
 Frame = +2

Query  95   VTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWC----FTSTNVK  262
            V  S  P+ G   F T+ ++ G+++     + S       G    C++C    +++  + 
Sbjct  33   VAPSPLPEGGVGCFATKSYATGDLLFKANSFASAVDNPLVG--YVCDYCLKYDYSNHKID  90

Query  263  KCSACQVVYYCGATCQKSDWK-LHRFECQSLFKVERDRIKSLAP-TIRLMVKLYLRRKLQ  436
            +C+ C  VYYC   CQ + W+ LH++EC  L+KV +   +   P T  L V+L +R KLQ
Sbjct  91   RCAGCHFVYYCSRQCQIAAWEDLHKYEC-PLYKVFKSTSQEPIPRTASLFVRLLIRTKLQ  149

Query  437  SEN---NIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
             +N       +   +Y + E L+SH++ ++  Q   Y  ++++   IL
Sbjct  150  RDNLCTPESKSIFGSYLIFEQLLSHINKMNGDQRFRYTMLSSITASIL  197



>ref|NP_001266980.1| SET and MYND domain containing 2 [Takifugu rubripes]
 tpg|DAA01312.1| TPA_exp: SET and MYND domain protein 2 [Takifugu rubripes]
Length=433

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 70/134 (52%), Gaps = 9/134 (7%)
 Frame = +2

Query  119  KGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTS-TNVKKCSACQVVYYC  295
            KGR +   R FS GE++ +   Y  V T  + G  A CE CFT   ++ KC  C+  YYC
Sbjct  17   KGRGLRAVRHFSVGELVFACPAYSYVLTVNERG--AYCEQCFTRREDLFKCGKCKQAYYC  74

Query  296  GATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNY  475
               CQ+ DW +H+ EC ++     +   S   T+RL+ ++ L++K+ +E     T  +  
Sbjct  75   NVDCQRGDWSMHKMECLAMCAYGENWCPS--ETVRLVARIILKQKVTTEQ----TPSERL  128

Query  476  ALVELLVSHMSDID  517
             L++   SH+  +D
Sbjct  129  LLLKDFESHLDKMD  142



>gb|KDB13595.1| MYND finger family protein [Ustilaginoidea virens]
Length=545

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 63/117 (54%), Gaps = 5/117 (4%)
 Frame = +2

Query  95   VTVSTHPQKGRCIFTTRDFSPGEVI-ISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCS  271
            V V  HP K R +  TR F PG+VI + Q+P +  PT       + C +C    + + CS
Sbjct  11   VDVRPHPSKRRALHATRPFQPGQVIHVFQQPLILHPTADHL--DSVCTYCLRPGSPRACS  68

Query  272  ACQVVYYCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPT-IRLMVKLYLRRKLQ  436
             C   +YC A CQ++ W  +HR EC++L +    +  +  PT +R++++  L + ++
Sbjct  69   RCHAAFYCNAACQRAGWAAIHRNECKALQRRTGSKTGADLPTPVRILLQALLEQGVE  125



>ref|XP_003454536.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like [Oreochromis 
niloticus]
 ref|XP_006779999.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like isoform X1 
[Neolamprologus brichardi]
 ref|XP_006780000.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like isoform X2 
[Neolamprologus brichardi]
Length=435

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 72/139 (52%), Gaps = 9/139 (6%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTS-TNVKKCSACQVVY  289
            P KGR +   R F+ GE++ +   Y  V T  + G  A CE CFT   ++ KC  C+  Y
Sbjct  15   PDKGRGLRAVRHFAVGELVFACPAYSYVLTVNERG--AHCEHCFTRREDLFKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ ++++  +E     T  +
Sbjct  73   YCNVDCQRGDWPMHKLECVAMCSYGENWCPS--ETVRLVARIIMKQRATTER----TPSE  126

Query  470  NYALVELLVSHMSDIDEKQ  526
               L++   +H+  +D ++
Sbjct  127  RLLLLKEFEAHLDKMDSEK  145



>ref|XP_002956692.1| SET and zf-MYND domain-containing protein [Volvox carteri f. 
nagariensis]
 gb|EFJ42294.1| SET and zf-MYND domain-containing protein [Volvox carteri f. 
nagariensis]
Length=265

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 79/163 (48%), Gaps = 17/163 (10%)
 Frame = +2

Query  68   LQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT  247
              +A   KG  V   P KGR +  TR F+PG V++ Q+PYVSV +  +T     C++CF 
Sbjct  12   FSDAELHKGFAVRLLPGKGRHLVATRWFNPGAVVLQQDPYVSVLSDERT--PGFCDFCFR  69

Query  248  STNVK-KCSACQVVYYCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYL  421
                  +C+  ++  YC    Q+  W   ++ EC++L +    R+    PT+RL  +L  
Sbjct  70   PCERPLRCTRSKLARYCCKEHQRLAWVAGYKMECEALVRCA-PRVPP--PTVRLAARLLW  126

Query  422  RRKLQSENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMA  550
            RR      N           +  L  H  ++D+++  LYAQMA
Sbjct  127  RRARCGGING----------LWRLEHHWDELDDRRKQLYAQMA  159



>gb|EHJ65468.1| hypothetical protein KGM_05644 [Danaus plexippus]
Length=370

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 78/136 (57%), Gaps = 12/136 (9%)
 Frame = +2

Query  158  GEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRF  337
            G++I+S+EP+  V +  + G  ++C++C     V KCS CQ V+YC  +CQK  W+ H++
Sbjct  13   GDLILSEEPFAYVLSSKEKG--SRCDFCLEKGKVLKCSGCQFVHYCNRSCQKDAWEDHKW  70

Query  338  ECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAM---DNYALVELLVSHMS  508
            EC +L ++     K++    RL+ ++  R  LQ  N     A     ++ + + L+SH S
Sbjct  71   ECANLKRIAP---KTIPDAARLLARILNR--LQRGNGGAYKAFYTPTSFRVWKDLMSHYS  125

Query  509  DI--DEKQLVLYAQMA  550
            D+  D+K++  ++ ++
Sbjct  126  DLKSDKKRMDHFSTLS  141



>ref|XP_007549817.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like [Poecilia 
formosa]
Length=435

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 79/150 (53%), Gaps = 10/150 (7%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTS-TNVKKCSACQVVY  289
            P +GR +   R F+ GE++ +   Y  V T  + G  A CE CFT   ++ KC  C+  Y
Sbjct  15   PDRGRGLRAVRHFAVGELVFACPAYSYVLTVNERG--AHCEHCFTRREDLFKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ +++++ ++     T  +
Sbjct  73   YCNVDCQRGDWPMHKLECVAMCAYGENWCPS--ETVRLVARIIMKQRVTTDR----TPSE  126

Query  470  NYALVELLVSHMSDID-EKQLVLYAQMANL  556
               L++   +H+  +D EK+ +  A +A L
Sbjct  127  RLLLLKEFEAHLDKMDSEKEELNQADIAAL  156



>ref|NP_001013568.1| N-lysine methyltransferase SMYD2-A [Danio rerio]
 sp|Q5BJI7.1|SMY2A_DANRE RecName: Full=N-lysine methyltransferase SMYD2-A; AltName: Full=Histone 
methyltransferase SMYD2-A; AltName: Full=SET and 
MYND domain-containing protein 2A [Danio rerio]
 gb|AAH91465.1| SET and MYND domain containing 2a [Danio rerio]
Length=435

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 70/139 (50%), Gaps = 9/139 (6%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVY  289
            P KGR +   + F  G+++ +   Y  V T  + G   +CE CFT    + KC  C+  Y
Sbjct  15   PGKGRGLKAIKHFKVGDLVFACPAYAYVLTVNERG--GRCECCFTRKEGLSKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ L++K Q+E     T  +
Sbjct  73   YCNVECQRGDWPMHKLECSAMCAYGENWCPS--ETVRLVARIILKQKHQTER----TPSE  126

Query  470  NYALVELLVSHMSDIDEKQ  526
                +  L +H+  +D ++
Sbjct  127  RVLTLRELEAHLDKLDNEK  145



>ref|XP_004471639.1| PREDICTED: N-lysine methyltransferase SMYD2-like isoform 2 [Dasypus 
novemcinctus]
Length=396

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 77/162 (48%), Gaps = 10/162 (6%)
 Frame = +2

Query  77   ALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCF-TST  253
            A  + G+     P KGR +   R F  G++++S   Y SV T  + G    CE CF    
Sbjct  3    AEGDGGLERFCSPGKGRGLRALRPFQVGDLLLSCPAYASVLTVNERG--NHCEHCFCRKE  60

Query  254  NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             + KC  C+  +YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+
Sbjct  61   GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKI  118

Query  434  QSENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
              E     T  +    V+   SH+  +D EK+ ++ + +A L
Sbjct  119  HPER----THSEKLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>ref|XP_011163275.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like [Solenopsis 
invicta]
Length=434

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 74/142 (52%), Gaps = 9/142 (6%)
 Frame = +2

Query  158  GEVIISQEPYVSV-PTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHR  334
            G  I++++P+V V  +K +T    +C+ CF S  + KCS C  V+YC   CQK  W +H+
Sbjct  9    GTTILTEKPFVFVLSSKYRT---TRCDNCFKSGKMLKCSGCSYVHYCNRNCQKESWPIHK  65

Query  335  FECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDI  514
             EC  L K+  D     A   R+M ++ ++      + +      NY   E LVSH SDI
Sbjct  66   VECARLKKIPLDLWLDDA---RMMARIIIKLNQGGADEVGYYTEKNYKKFEDLVSHYSDI  122

Query  515  --DEKQLVLYAQMANLVNLILQ  574
              D+K++  + ++  ++  +L 
Sbjct  123  IVDKKRMEHFNKIHKILFQLLD  144



>ref|XP_006626142.1| PREDICTED: N-lysine methyltransferase SMYD2-like [Lepisosteus 
oculatus]
Length=435

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 73/150 (49%), Gaps = 9/150 (6%)
 Frame = +2

Query  89   KGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKK  265
            +G+     P KGR +   + F  G+++ +   Y  V T  + G    CE+CF     + K
Sbjct  8    EGIERFISPGKGRGLRALKQFKVGDLLFTCPAYTYVLTVNERG--NHCEFCFARKEGLSK  65

Query  266  CSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSEN  445
            C  C+  +YC   CQK DW +H+ EC S+     +   S   T+RL  ++  ++K+Q+E 
Sbjct  66   CGKCKQAFYCNVDCQKGDWPMHKLECSSMCTFGENWNPS--ETVRLTARIIAKQKIQTEK  123

Query  446  NIPTTAMDNYALVELLVSHMSDIDEKQLVL  535
                T  +    V+   SH+  +D +++ +
Sbjct  124  ----TTSEKLLSVKEFESHLDKLDNEKMEM  149



>ref|XP_008423053.1| PREDICTED: histone-lysine N-methyltransferase SMYD1 [Poecilia 
reticulata]
Length=473

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 71/141 (50%), Gaps = 17/141 (12%)
 Frame = +2

Query  119  KGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVYYC  295
            KGR +  +R+FS GEV++++  Y +V   +    S  C  CF    N+ +C+ C+  +YC
Sbjct  9    KGRGLRASREFSTGEVLLAEPGYAAVVYSSLA--SQVCHSCFRRQANLHRCAQCRFAHYC  66

Query  296  GATCQKSDWKLHRFECQSLFKVERDRIKSLAPT--IRLMVKLYLRRKLQSENNIPTTAMD  469
              TCQ + W  HR EC ++ K+        AP   +RL  +L  RR     N     A D
Sbjct  67   NRTCQTAGWDDHRQECAAIRKL------GAAPNEDVRLAGRLLWRR-----NRDQGLASD  115

Query  470  NYAL-VELLVSHMSDIDEKQL  529
            +  L V+ L  H+ D+ E QL
Sbjct  116  SQLLAVDQLQDHLRDLPEDQL  136



>gb|KIM40724.1| hypothetical protein M413DRAFT_446114 [Hebeloma cylindrosporum 
h7]
Length=650

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/156 (29%), Positives = 80/156 (51%), Gaps = 11/156 (7%)
 Frame = +2

Query  122  GRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT--STNVKKCSACQVVYYC  295
            GR I+T  +  PGE++ S +P+++  +         C  CF   + ++++C+ C+++YYC
Sbjct  80   GRGIYTKFNRRPGEILFSVKPHIAALSNQHL--EEYCSSCFAPKADSLRRCTGCKLLYYC  137

Query  296  GATCQKSDWKLHRFECQSLFK--VERDRIKSLAP--TIRLMVKLYLRRKLQSENNIPTTA  463
               CQ +DW  HR EC  + K   +R    S  P   IR +V++  R++     ++    
Sbjct  138  DEKCQAADWTFHRHECTGIQKWVAKRPSGSSSFPGDAIRCLVRILWRKQKLGSQSVWARE  197

Query  464  MDNYALVELLVSHMSDIDEKQLVLYAQMAN-LVNLI  568
            +D        +S  S+  E Q  LYAQ+A+ +VN +
Sbjct  198  IDGMQSHRTSLSRDSNTHESQ--LYAQLAHSIVNFL  231



>ref|XP_006966367.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR47743.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETS01314.1| SET domain-containing protein [Trichoderma reesei RUT C-30]
Length=535

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 60/121 (50%), Gaps = 5/121 (4%)
 Frame = +2

Query  83   SEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVK  262
            S   V +  HP KGR +  T+ F PG VI S  P + +PT      ++ C  C      +
Sbjct  3    SSSPVEIRPHPSKGRALHATKSFPPGAVIFSFTPLLLLPTVACL--TSVCSHCLRPGEPR  60

Query  263  KCSACQVVYYCGATCQKSDWK-LHRFECQSLFKVERD--RIKSLAPTIRLMVKLYLRRKL  433
             CS C    YC ATCQ + WK +H  EC++L K  RD  R + L    R +++  L  K+
Sbjct  61   LCSRCHAAAYCDATCQAAAWKAVHSRECKALTKTIRDEERRRMLPTPTRALIQALLWGKI  120

Query  434  Q  436
            +
Sbjct  121  R  121



>ref|XP_005915134.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like [Haplochromis 
burtoni]
Length=435

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 72/139 (52%), Gaps = 9/139 (6%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTS-TNVKKCSACQVVY  289
            P KGR +   R F+ GE++ +   Y  V T  + G  A CE CFT   ++ KC  C+  Y
Sbjct  15   PDKGRGLRALRHFAVGELVFACPAYSYVLTVNERG--AHCEHCFTRREDLFKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ ++++  +E     T  +
Sbjct  73   YCNVDCQRGDWPMHKLECVAMCSYGENWCPS--ETVRLVARIIMKQRATTER----TPSE  126

Query  470  NYALVELLVSHMSDIDEKQ  526
               L++   +H+  +D ++
Sbjct  127  RLLLLKEFEAHLDKMDSEK  145



>ref|XP_011313226.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X1 
[Fopius arisanus]
Length=452

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 64/126 (51%), Gaps = 5/126 (4%)
 Frame = +2

Query  143  RDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDW  322
            ++   G+ I++ EP+  V ++       +C+ CF S+ + +C+ CQ VYYCG  CQ+  W
Sbjct  13   QEIKKGKTILTAEPFAFVLSEQHR--KERCDQCFKSSKISRCAGCQYVYYCGRNCQRKAW  70

Query  323  KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSH  502
             +H+ EC +   ++R   + L    R+M ++ ++                Y + + L+SH
Sbjct  71   AIHKIECPN---IKRIHPRVLPDAARMMARIIIKLSQNGREERGYYTPTKYRVFDDLMSH  127

Query  503  MSDIDE  520
            + DI E
Sbjct  128  VIDIKE  133



>gb|KIL94623.1| hypothetical protein FAVG1_01554 [Fusarium avenaceum]
Length=952

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 59/107 (55%), Gaps = 3/107 (3%)
 Frame = +2

Query  116  QKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYC  295
             KGR +F+T+ F+PG++I+   P + +P+ +    +A C  CF    V+ CS C  V YC
Sbjct  435  HKGRGMFSTKTFAPGDIILPFTPTIIIPSLSHI--NAICSHCFKPAEVRACSRCHAVSYC  492

Query  296  GATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             A CQ ++W  +H  EC+ L KV       L   +R +++  ++ ++
Sbjct  493  DAACQSANWTAVHSKECKVLRKVTEQGRPGLPTPVRAVIQALVKPEI  539



>ref|XP_005733342.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like [Pundamilia 
nyererei]
Length=435

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 72/139 (52%), Gaps = 9/139 (6%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTS-TNVKKCSACQVVY  289
            P KGR +   R F+ GE++ +   Y  V T  + G  A CE CFT   ++ KC  C+  Y
Sbjct  15   PDKGRGLRALRHFAVGELVFACPAYSYVLTVNERG--AHCEHCFTRREDLFKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ ++++  +E     T  +
Sbjct  73   YCNVDCQRGDWPMHKLECVAMCSYGENWCPS--ETVRLVARIIMKQRATTER----TPSE  126

Query  470  NYALVELLVSHMSDIDEKQ  526
               L++   +H+  +D ++
Sbjct  127  RLLLLKEFEAHLDKMDSEK  145



>ref|XP_004539544.1| PREDICTED: N-lysine methyltransferase SMYD2-A-like isoform X1 
[Maylandia zebra]
Length=435

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 72/139 (52%), Gaps = 9/139 (6%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTS-TNVKKCSACQVVY  289
            P KGR +   R F+ GE++ +   Y  V T  + G  A CE CFT   ++ KC  C+  Y
Sbjct  15   PDKGRGLRALRHFAVGELVFACPAYSYVLTVNERG--AHCEHCFTRREDLFKCGKCKQAY  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQ+ DW +H+ EC ++     +   S   T+RL+ ++ ++++  +E     T  +
Sbjct  73   YCNVDCQRGDWPMHKLECVAMCSYGENWCPS--ETVRLVARIIMKQRATTER----TPSE  126

Query  470  NYALVELLVSHMSDIDEKQ  526
               L++   +H+  +D ++
Sbjct  127  RLLLLKEFEAHLDKMDSEK  145



>ref|XP_004471638.1| PREDICTED: N-lysine methyltransferase SMYD2-like isoform 1 [Dasypus 
novemcinctus]
Length=433

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 77/162 (48%), Gaps = 10/162 (6%)
 Frame = +2

Query  77   ALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCF-TST  253
            A  + G+     P KGR +   R F  G++++S   Y SV T  + G    CE CF    
Sbjct  3    AEGDGGLERFCSPGKGRGLRALRPFQVGDLLLSCPAYASVLTVNERG--NHCEHCFCRKE  60

Query  254  NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             + KC  C+  +YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+
Sbjct  61   GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKI  118

Query  434  QSENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
              E     T  +    V+   SH+  +D EK+ ++ + +A L
Sbjct  119  HPER----THSEKLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>ref|XP_011138935.1| PREDICTED: SET and MYND domain-containing protein 4-like [Harpegnathos 
saltator]
 gb|EFN84839.1| SET and MYND domain-containing protein 4 [Harpegnathos saltator]
Length=638

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 10/114 (9%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            GVTVS   + GR    TRDF PG+++  ++PY  V  + +      C +C + S N+  C
Sbjct  245  GVTVSFSKRYGRHYIATRDFKPGDIVSIEDPYAHVIYEERY--YTHCHYCLSRSYNLIPC  302

Query  269  SACQVVYYCGATCQKSDWKL-HRFEC------QSLFKVERDRIKSLAPTIRLMV  409
            S C +  YC   C+K  W++ H  EC       SL  V++D+I+ ++  IRL++
Sbjct  303  SKCPIAQYCSEKCRKLAWEVCHMTECPILKLLTSLLNVDKDKIRMISKIIRLLI  356



>ref|XP_011313227.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X2 
[Fopius arisanus]
Length=450

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 64/126 (51%), Gaps = 5/126 (4%)
 Frame = +2

Query  143  RDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDW  322
            ++   G+ I++ EP+  V ++       +C+ CF S+ + +C+ CQ VYYCG  CQ+  W
Sbjct  13   QEIKKGKTILTAEPFAFVLSEQHR--KERCDQCFKSSKISRCAGCQYVYYCGRNCQRKAW  70

Query  323  KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSH  502
             +H+ EC +   ++R   + L    R+M ++ ++                Y + + L+SH
Sbjct  71   AIHKIECPN---IKRIHPRVLPDAARMMARIIIKLSQNGREERGYYTPTKYRVFDDLMSH  127

Query  503  MSDIDE  520
            + DI E
Sbjct  128  VIDIKE  133



>ref|XP_006681928.1| hypothetical protein BATDEDRAFT_27650 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77329.1| hypothetical protein BATDEDRAFT_27650 [Batrachochytrium dendrobatidis 
JAM81]
Length=445

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 62/104 (60%), Gaps = 8/104 (8%)
 Frame = +2

Query  122  GRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVYYCG  298
            GRC+  T+D   G   + ++PYV+V        +  C  CF  + ++++CS+C+VV YC 
Sbjct  17   GRCMIATKDLRVGLEFMMEKPYVAVVDDASLNQT--CSGCFRLAAHMQQCSSCKVVQYCS  74

Query  299  ATCQKSDWKLHRFECQSLFKVERDRIKSLAPT-IRLMVKLYLRR  427
             TCQ+SDW +H+ EC+  FK  + RI    P+ +RL+ ++  +R
Sbjct  75   QTCQRSDWSIHKPECEG-FKAVQPRI---PPSPVRLLGRMMFKR  114



>ref|XP_011313228.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 isoform X3 
[Fopius arisanus]
Length=378

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 64/126 (51%), Gaps = 5/126 (4%)
 Frame = +2

Query  143  RDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDW  322
            ++   G+ I++ EP+  V ++       +C+ CF S+ + +C+ CQ VYYCG  CQ+  W
Sbjct  13   QEIKKGKTILTAEPFAFVLSEQHR--KERCDQCFKSSKISRCAGCQYVYYCGRNCQRKAW  70

Query  323  KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSH  502
             +H+ EC +   ++R   + L    R+M ++ ++                Y + + L+SH
Sbjct  71   AIHKIECPN---IKRIHPRVLPDAARMMARIIIKLSQNGREERGYYTPTKYRVFDDLMSH  127

Query  503  MSDIDE  520
            + DI E
Sbjct  128  VIDIKE  133



>gb|AAH98305.1| SMYD2 protein [Homo sapiens]
Length=272

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 73/150 (49%), Gaps = 10/150 (7%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVY  289
            P KGR +   + F  G+++ S   Y  V T  + G    CE+CFT    + KC  C+  +
Sbjct  15   PGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEYCFTRKEGLSKCGRCKQAF  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+  E     T  +
Sbjct  73   YCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKIHPER----TPSE  126

Query  470  NYALVELLVSHMSDID-EKQLVLYAQMANL  556
                V+   SH+  +D EK+ ++ + +A L
Sbjct  127  KLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>gb|AIC62215.1| SMYD2, partial [synthetic construct]
Length=272

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 73/150 (49%), Gaps = 10/150 (7%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVY  289
            P KGR +   + F  G+++ S   Y  V T  + G    CE+CFT    + KC  C+  +
Sbjct  15   PGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEYCFTRKEGLSKCGRCKQAF  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+  E     T  +
Sbjct  73   YCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKIHPER----TPSE  126

Query  470  NYALVELLVSHMSDID-EKQLVLYAQMANL  556
                V+   SH+  +D EK+ ++ + +A L
Sbjct  127  KLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>ref|XP_004485227.1| PREDICTED: LOW QUALITY PROTEIN: SET and MYND domain containing 
2 [Dasypus novemcinctus]
Length=433

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 77/162 (48%), Gaps = 10/162 (6%)
 Frame = +2

Query  77   ALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCF-TST  253
            A  + G+     P KGR +   R F  G++++S   Y SV T  + G    CE CF    
Sbjct  3    AEGDGGLERFRSPGKGRGLRALRPFQVGDLLLSCPAYASVLTVHERG--NHCEHCFCRKE  60

Query  254  NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             + KC  C+  +YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+
Sbjct  61   GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKI  118

Query  434  QSENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
              E     T  +    V+   SH+  +D EK+ ++ + +A L
Sbjct  119  HPER----THSEKLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>ref|XP_006890631.1| PREDICTED: N-lysine methyltransferase SMYD2 [Elephantulus edwardii]
Length=531

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/163 (27%), Positives = 77/163 (47%), Gaps = 9/163 (6%)
 Frame = +2

Query  83   SEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNV  259
             + G+     P KGR +   R F  G+++ S   Y  V T  + G    CE+CF+    +
Sbjct  102  GDGGLERFCSPGKGRGLRALRPFHVGDLLFSCPAYAYVLTVNERG--NHCEYCFSRKEGL  159

Query  260  KKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS  439
             KC  C+  +YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+  
Sbjct  160  SKCGRCKQAFYCNVECQKEDWSMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKIHP  217

Query  440  ENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANLVNL  565
                P+  +     V+   SH+  +D EK+ ++ + +A L + 
Sbjct  218  PERTPSEKL---LAVKEFESHLDKLDNEKKDLIQSDIAALRHF  257



>gb|KJB29250.1| hypothetical protein B456_005G091200 [Gossypium raimondii]
Length=353

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  464  MDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLILQ  574
            MDNY LVE LVSHMSDIDEKQL+LYAQMANLVNLILQ
Sbjct  1    MDNYNLVEALVSHMSDIDEKQLLLYAQMANLVNLILQ  37



>ref|XP_002191464.1| PREDICTED: N-lysine methyltransferase SMYD2 [Taeniopygia guttata]
Length=436

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 78/157 (50%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+       KGR +   R F+ GE+++S   YV+V T ++ G  + C+ CF     + KC
Sbjct  11   GLERFASAGKGRGLRARRRFAVGELLLSCPAYVAVLTVSERG--SHCDGCFARKEGLSKC  68

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC   CQK DW +H+ EC S+    ++   S   T+RL  ++  ++K   E  
Sbjct  69   GRCKQAFYCNVECQKEDWPMHKLECASMCTFGQNWHPS--ETVRLTARILAKQKTHPER-  125

Query  449  IPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
               T  +    V+   SH+  +D EK+ ++   +A L
Sbjct  126  ---TQSEKLLAVKEFESHLDKLDNEKRELIQNDIAAL  159



>ref|XP_007950799.1| PREDICTED: N-lysine methyltransferase SMYD2 [Orycteropus afer 
afer]
Length=433

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 77/160 (48%), Gaps = 10/160 (6%)
 Frame = +2

Query  83   SEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNV  259
             + G+     P KGR +   + F  G+++ S   Y  V T  + G    CE+CF     +
Sbjct  5    GDGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEYCFARKEGL  62

Query  260  KKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS  439
             KC  C+  +YC   CQK DW +H+ EC ++     +   S   T+RL  ++  ++K+  
Sbjct  63   SKCGRCKQAFYCNVECQKEDWPMHKLECSAMVVFGENWNPS--ETVRLTARILAKQKIHP  120

Query  440  ENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
            E     T  +    V+   SH+S +D EK+ ++ + +A L
Sbjct  121  ER----TPSEKLLAVKEFESHLSKLDNEKKELIQSDIAAL  156



>ref|XP_011504410.1| PREDICTED: SET and MYND domain-containing protein 4-like [Ceratosolen 
solmsi marchali]
Length=648

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 59/119 (50%), Gaps = 11/119 (9%)
 Frame = +2

Query  77   ALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-ST  253
            ALS KGV ++   + GR +  TR F PG +I+ + P+  +    K      C  C   S 
Sbjct  240  ALS-KGVRIAYSKKYGRHLVATRSFKPGSIILKENPFAYIIYTEKH--YTHCHHCLARSY  296

Query  254  NVKKCSACQVVYYCGATCQKSDWKL-HRFEC------QSLFKVERDRIKSLAPTIRLMV  409
            N+  C  C +  YC   C+ S WK+ HR EC        LF V+ D+I+ L   IRL++
Sbjct  297  NLISCPKCPIAQYCSEICKTSAWKMAHRIECPIHAVMSKLFNVDTDKIRMLTKIIRLLI  355



>ref|XP_008311167.1| PREDICTED: N-lysine methyltransferase SMYD2 [Cynoglossus semilaevis]
Length=432

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 71/149 (48%), Gaps = 9/149 (6%)
 Frame = +2

Query  83   SEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNV  259
            S KG+     P KGR +  T+ F  GE++ S   +  V +  + G    CE+CFT    +
Sbjct  4    SIKGIERFESPGKGRGLRVTKAFKVGELLFSCPAFSHVLSVKERG--YYCEFCFTRKEGL  61

Query  260  KKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQS  439
             KC  C+  +YC   CQK+DW +H+ EC ++         S     RL+ ++  + K Q 
Sbjct  62   AKCGKCKKAFYCNVKCQKADWAMHKLECSAITAFGEKWCPS--EMTRLVARILAKTKSQK  119

Query  440  ENNIPTTAMDNYALVELLVSHMSDIDEKQ  526
            E  +    +    L+  + SH+ D+D + 
Sbjct  120  ERCVSEKIL----LIGEMQSHVEDVDNEN  144



>sp|E1C5V0.1|SMYD2_CHICK RecName: Full=N-lysine methyltransferase SMYD2; AltName: Full=Histone 
methyltransferase SMYD2; AltName: Full=SET and MYND 
domain-containing protein 2 [Gallus gallus]
Length=436

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 78/157 (50%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+     P KGR +   R ++ GE++ S   Y +V T ++ G  + C+ CF     + KC
Sbjct  11   GLERFASPGKGRGLRALRRYAVGELLFSCPAYTAVLTVSERG--SHCDGCFARKEGLSKC  68

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC   CQK DW +H+ EC ++    ++   S   T+RL  ++  ++K+  E  
Sbjct  69   GRCKQAFYCNVECQKEDWPMHKLECAAMCAFGQNWNPS--ETVRLTARILAKQKIHPER-  125

Query  449  IPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
               T  +    V+   SH+  +D EK+ ++   +A L
Sbjct  126  ---TQSEKLLAVKEFESHLDKLDNEKRELIQNDIAAL  159



>ref|NP_001264500.1| N-lysine methyltransferase SMYD2 [Gallus gallus]
Length=436

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 78/157 (50%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+     P KGR +   R ++ GE++ S   Y +V T ++ G  + C+ CF     + KC
Sbjct  11   GLERFASPGKGRGLRALRRYAVGELLFSCPAYTAVLTVSERG--SHCDGCFARKEGLSKC  68

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC   CQK DW +H+ EC ++    ++   S   T+RL  ++  ++K+  E  
Sbjct  69   GRCKQAFYCNVECQKEDWPMHKLECAAMCAFGQNWNPS--ETVRLTARILAKQKIHPER-  125

Query  449  IPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
               T  +    V+   SH+  +D EK+ ++   +A L
Sbjct  126  ---TQSEKLLAVKEFESHLDKLDNEKRELIQNDIAAL  159



>ref|XP_009253991.1| hypothetical protein FPSE_02597 [Fusarium pseudograminearum CS3096]
 gb|EKJ77223.1| hypothetical protein FPSE_02597 [Fusarium pseudograminearum CS3096]
Length=520

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 4/112 (4%)
 Frame = +2

Query  101  VSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQ  280
            V +H  +GR IF+T+ F PG+VI+   P + +P+ +    +  C  CF    V+ CS C 
Sbjct  9    VKSH-HRGRGIFSTKSFVPGDVILPFTPRILIPSLSHI--NNICSHCFKQAEVRACSRCH  65

Query  281  VVYYCGATCQKSDW-KLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             V YC A CQ ++W  +H  EC+ L KV       L   IR +V+  ++ ++
Sbjct  66   AVSYCDAACQAANWTAVHSKECKVLRKVTEQGRPGLPTPIRAVVQALVKPEI  117



>ref|XP_003708212.1| PREDICTED: SET and MYND domain-containing protein 3-like [Megachile 
rotundata]
Length=438

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 73/140 (52%), Gaps = 19/140 (14%)
 Frame = +2

Query  116  QKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYC  295
            +KG  IFT + F+          YV + +K +T    +C++C TS  + +CSACQ VYYC
Sbjct  9    KKGTTIFTAKPFA----------YV-LSSKYRTN---RCDYCLTSGKLFRCSACQYVYYC  54

Query  296  GATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNY  475
              +CQ+  W  H  EC +L +V    +  +A   RLM ++ ++     ++ +       +
Sbjct  55   NRSCQQGSWPTHNTECVNLKRVSPKVVPDMA---RLMARIIIKLSQGGDDEVEYYTKTKF  111

Query  476  ALVELLVSHMSDI--DEKQL  529
               + L+SH SDI  DEK++
Sbjct  112  RRFKDLMSHYSDIKKDEKKM  131



>ref|XP_005082950.1| PREDICTED: N-lysine methyltransferase SMYD2 [Mesocricetus auratus]
Length=401

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 74/148 (50%), Gaps = 10/148 (7%)
 Frame = +2

Query  119  KGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVYYC  295
            KGR +   R F  G+++ S   Y SV T  + G    CE CF     + KC  C+  +YC
Sbjct  17   KGRGLRALRPFHVGDLLFSCPAYASVLTVGERG--HHCECCFARKEGLSKCGRCKQAFYC  74

Query  296  GATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNY  475
             A CQK DW LH+ EC S+  V      + + T+RL  ++  ++K+  E     T  +  
Sbjct  75   DAECQKEDWPLHKLECSSM--VVFGESWNPSETVRLTARVLAKQKIHPER----TPSEKL  128

Query  476  ALVELLVSHMSDID-EKQLVLYAQMANL  556
              V+   SH+  +D EK+ ++ + +A L
Sbjct  129  LAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>ref|XP_008212820.1| PREDICTED: histone-lysine N-methyltransferase SMYD3 [Nasonia 
vitripennis]
Length=384

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 74/142 (52%), Gaps = 9/142 (6%)
 Frame = +2

Query  158  GEVIISQEPYVSV-PTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHR  334
            G+ +IS +P+  V  +K K      C++CF S  + KCS CQ VYYC  +CQK  W +H+
Sbjct  6    GDCLISSKPFAYVLSSKHKDN---HCDYCFKSGKLLKCSGCQYVYYCDRSCQKESWSVHK  62

Query  335  FECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDI  514
             EC +L ++    I   A   RLM ++ ++ +    +     A + Y   + L+SH +DI
Sbjct  63   SECINLKRIAPRTIPDAA---RLMARIIVKLQKGGGDEKDYYAKNAYRKFKDLMSHYTDI  119

Query  515  --DEKQLVLYAQMANLVNLILQ  574
              D K++  +  +  ++   ++
Sbjct  120  KNDPKRIEHFVSLCQVLEDFME  141



>ref|XP_003394366.1| PREDICTED: SET and MYND domain-containing protein 3-like [Bombus 
terrestris]
Length=439

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 76/142 (54%), Gaps = 9/142 (6%)
 Frame = +2

Query  158  GEVIISQEPYVSVP-TKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHR  334
            G  I++ +P+  V  +K K   + +C++CF S  + +CSACQ VYYC  +CQ+  W +H 
Sbjct  11   GTTILTAKPFAYVLCSKYK---NVRCDYCFKSGKLFRCSACQYVYYCNQSCQQMSWPMHS  67

Query  335  FECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSDI  514
             EC  L K     I ++A   RLM ++ ++     +         NY   + L+SH S+I
Sbjct  68   KECARLKKFSPWGISNVA---RLMARIIIKLNQGGDEEKGYYNETNYRKFKDLMSHCSEI  124

Query  515  --DEKQLVLYAQMANLVNLILQ  574
              DEK++  +  + N+++  L+
Sbjct  125  KKDEKKMEHFVCLCNVLHKFLE  146



>ref|XP_004415860.1| PREDICTED: N-lysine methyltransferase SMYD2 [Odobenus rosmarus 
divergens]
Length=433

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 76/162 (47%), Gaps = 10/162 (6%)
 Frame = +2

Query  77   ALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-ST  253
            A  + G+     P KGR +   + F  G+++ S   Y  V T  + G    CE+CF    
Sbjct  3    AAGDGGLERFCSPGKGRGLRALQPFHVGDLLFSCPAYAYVLTVNERG--NHCEYCFARKE  60

Query  254  NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             + KC  C+  +YC   CQK DW +H+ EC  +     +   S   T RL  ++  ++K+
Sbjct  61   GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETARLTARILAKQKM  118

Query  434  QSENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
              E     TA +    V+   SH+  +D EK+ ++ + +A L
Sbjct  119  HPER----TASEKLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>ref|XP_005523395.1| PREDICTED: N-lysine methyltransferase SMYD2 [Pseudopodoces humilis]
Length=436

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 76/157 (48%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+       KGR +   R F+ GE++ S   YV+V T ++ G    C+ CF     + KC
Sbjct  11   GLERFASAGKGRGLRARRRFAVGELLFSCPAYVAVLTVSERG--GHCDGCFARKEGLSKC  68

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC   CQK DW +H+ EC S+    ++   S   T+RL  ++  ++K   E  
Sbjct  69   GRCKQAFYCNVECQKEDWPMHKLECASMCAFGQNWNPS--ETVRLTARILAKQKTHPER-  125

Query  449  IPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
               T  +    V+   SH+  +D EK+ ++   +A L
Sbjct  126  ---TQSERLFAVKEFESHLDKLDNEKRELIQNDIAAL  159



>ref|XP_008559896.1| PREDICTED: histone-lysine N-methyltransferase ASHR1 [Microplitis 
demolitor]
Length=451

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 62/132 (47%), Gaps = 11/132 (8%)
 Frame = +2

Query  137  TTRDFSPGE------VIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCG  298
            T +D  PG+       IIS  P+  +          +C++CF S  + +CS CQ VYYC 
Sbjct  4    TAQDDGPGKFLKKGTTIISATPFAFILGSLHR--KERCDYCFKSGKISRCSGCQYVYYCS  61

Query  299  ATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNYA  478
             TCQK  W +H+ EC ++ +V    +   A   RLM ++ ++     +N         Y 
Sbjct  62   KTCQKRGWSIHKVECPNIKRVHPRIVPDAA---RLMARIIIKLFQMGKNERGYYTATKYR  118

Query  479  LVELLVSHMSDI  514
            +   L++H  DI
Sbjct  119  VFNNLMTHAEDI  130



>ref|XP_006497210.1| PREDICTED: N-lysine methyltransferase SMYD2 isoform X2 [Mus musculus]
Length=239

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 71/148 (48%), Gaps = 10/148 (7%)
 Frame = +2

Query  119  KGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVYYC  295
            KGR +   R F  G+++ S   Y  V T  + G    CE CF     + KC  C+  +YC
Sbjct  17   KGRGLRALRPFHVGDLLFSCPAYACVLTVGERG--HHCECCFARKEGLSKCGRCKQAFYC  74

Query  296  GATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNY  475
               CQK DW LH+ EC S+  +  +   S   T+RL  ++  ++K+  E     T  +  
Sbjct  75   DVECQKEDWPLHKLECSSMVVLGENWNPS--ETVRLTARILAKQKIHPER----TPSEKL  128

Query  476  ALVELLVSHMSDID-EKQLVLYAQMANL  556
              V    SH+  +D EK+ ++ + +A L
Sbjct  129  LAVREFESHLDKLDNEKKDLIQSDIAAL  156



>gb|AAH49367.2| SMYD2 protein [Homo sapiens]
Length=371

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 75/157 (48%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+     P KGR +   + F  G+++ S   Y  V T  + G    CE+CFT    + KC
Sbjct  8    GLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEYCFTRKEGLSKC  65

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+  E  
Sbjct  66   GRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKIHPER-  122

Query  449  IPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
               T  +    V+   SH+  +D EK+ ++ + +A L
Sbjct  123  ---TPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>gb|KIH89592.1| set and mynd domain protein [Sporothrix brasiliensis 5110]
Length=607

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 14/103 (14%)
 Frame = +2

Query  65   ELQEALSEKGVTVSTHPQKGRCIFTTRDFSPGEVI-ISQEPYVSVPTKTKTGPSAK--CE  235
            E++   S  GVT +   ++GR +F TR ++PGE I +  +P + +P+    GP A   C 
Sbjct  9    EIRGDRSPPGVTPA---RRGRGLFATRSYAPGEEIAVFGKPLIVLPS----GPDATKTCN  61

Query  236  WCFTST---NVKKCSACQVVYYCGATCQKSDWK-LHRFECQSL  352
             C  +    ++KKC  CQ V YCG  CQ++ WK  H+FEC+ L
Sbjct  62   NCLDARRAGSIKKCQGCQAVVYCGKECQRAHWKRFHKFECKPL  104



>ref|XP_004928798.1| PREDICTED: SET and MYND domain-containing protein DDB_G0292140-like 
[Bombyx mori]
Length=486

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 55/96 (57%), Gaps = 5/96 (5%)
 Frame = +2

Query  137  TTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKS  316
            TT +  PG++++S++P+  V +  + G   +C+ C     + KCS CQ VYYCG +CQK 
Sbjct  8    TTSEIKPGDLLLSEQPFAYVLSSKEQG--NRCDNCLEKVKLLKCSGCQFVYYCGRSCQKD  65

Query  317  DWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLR  424
             W  H++EC +L +V     K +    R++ K+  R
Sbjct  66   AWGDHKWECPNLKRVAP---KVIPDGARMLAKIINR  98



>ref|NP_064582.2| N-lysine methyltransferase SMYD2 [Homo sapiens]
 sp|Q9NRG4.2|SMYD2_HUMAN RecName: Full=N-lysine methyltransferase SMYD2; AltName: Full=HSKM-B; 
AltName: Full=Histone methyltransferase SMYD2; AltName: 
Full=Lysine N-methyltransferase 3C; AltName: Full=SET and 
MYND domain-containing protein 2 [Homo sapiens]
 pdb|3TG4|A Chain A, Structure Of Smyd2 In Complex With Sam
 pdb|3TG5|A Chain A, Structure Of Smyd2 In Complex With P53 And Sah
 gb|AAH98276.1| SET and MYND domain containing 2 [Homo sapiens]
Length=433

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 73/150 (49%), Gaps = 10/150 (7%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVY  289
            P KGR +   + F  G+++ S   Y  V T  + G    CE+CFT    + KC  C+  +
Sbjct  15   PGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEYCFTRKEGLSKCGRCKQAF  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+  E     T  +
Sbjct  73   YCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKIHPER----TPSE  126

Query  470  NYALVELLVSHMSDID-EKQLVLYAQMANL  556
                V+   SH+  +D EK+ ++ + +A L
Sbjct  127  KLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>pdb|3S7B|A Chain A, Structural Basis Of Substrate Methylation And Inhibition 
Of Smyd2
 pdb|3S7D|A Chain A, Structural Basis Of Substrate Methylation And Inhibition 
Of Smyd2
 pdb|3S7F|A Chain A, Structural Basis Of Substrate Methylation And Inhibition 
Of Smyd2
 pdb|3S7J|A Chain A, Structural Basis Of Substrate Methylation And Inhibition 
Of Smyd2
 pdb|4O6F|A Chain A, Structural Basis Of Estrogen Receptor Alpha Methylation 
Mediated By Histone Methyltransferase Smyd2
 gb|AAF86953.1|AF226053_1 HSKM-B [Homo sapiens]
 gb|AAH98133.1| SET and MYND domain containing 2 [Homo sapiens]
 gb|AAH98335.1| SET and MYND domain containing 2 [Homo sapiens]
 dbj|BAG36596.1| unnamed protein product [Homo sapiens]
 dbj|BAJ21071.1| SET and MYND domain containing 2 [synthetic construct]
Length=433

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 73/150 (49%), Gaps = 10/150 (7%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVY  289
            P KGR +   + F  G+++ S   Y  V T  + G    CE+CFT    + KC  C+  +
Sbjct  15   PGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEYCFTRKEGLSKCGRCKQAF  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+  E     T  +
Sbjct  73   YCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKIHPER----TPSE  126

Query  470  NYALVELLVSHMSDID-EKQLVLYAQMANL  556
                V+   SH+  +D EK+ ++ + +A L
Sbjct  127  KLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>pdb|3RIB|A Chain A, Human Lysine Methyltransferase Smyd2 In Complex With 
Adohcy
 pdb|3RIB|B Chain B, Human Lysine Methyltransferase Smyd2 In Complex With 
Adohcy
Length=441

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 73/150 (49%), Gaps = 10/150 (7%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVY  289
            P KGR +   + F  G+++ S   Y  V T  + G    CE+CFT    + KC  C+  +
Sbjct  15   PGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEYCFTRKEGLSKCGRCKQAF  72

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+  E     T  +
Sbjct  73   YCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKIHPER----TPSE  126

Query  470  NYALVELLVSHMSDID-EKQLVLYAQMANL  556
                V+   SH+  +D EK+ ++ + +A L
Sbjct  127  KLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>ref|XP_001275309.1| SET and MYND domain protein, putative [Aspergillus clavatus NRRL 
1]
 gb|EAW13883.1| SET and MYND domain protein, putative [Aspergillus clavatus NRRL 
1]
Length=555

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 73/149 (49%), Gaps = 20/149 (13%)
 Frame = +2

Query  95   VTVSTHPQKGRCIFTTRDFSPGE-VIISQEPYVSVPTKTKTGPSAKCEWCFTS-------  250
             T    P  G  +F ++D  PGE V++ Q+P+V+V    +    +KC  C  +       
Sbjct  61   ATTGPSPGSGTGLFASKDIQPGETVVLIQKPFVAVLDTAQL--ESKCSGCLGAHANRQEA  118

Query  251  TNVKKCSACQVVYYCGATCQKSDWKL-HRFECQSLFKVERDRIKSLAPTIRLMVKLYLRR  427
              +K C+ C+VV YC  TCQ  DWKL H  EC+ +F+  + R+  L    R ++++ +  
Sbjct  119  VELKACTGCRVVKYCNKTCQAKDWKLFHSLECR-IFQNLKPRV--LPNNARAILRMVM--  173

Query  428  KLQSENNIPTTAMDNYALVELLVSHMSDI  514
             L      P   M+   L + L SHM D+
Sbjct  174  -LSERGRYPAGEME---LFKGLESHMKDV  198



>ref|XP_011163278.1| PREDICTED: histone-lysine N-methyltransferase ASHR1-like isoform 
X2 [Solenopsis invicta]
Length=451

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 9/127 (7%)
 Frame = +2

Query  158  GEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQVVYYCGATCQKSDWKLHRF  337
            G  I++  P+V V        + +C+ CF S  + +CS+CQ VYYC   CQK  W++H+ 
Sbjct  16   GTTILTDRPFVFVLRSAYR--TTRCDNCFKSEKLLRCSSCQYVYYCNRKCQKQSWRIHKL  73

Query  338  ECQSLFKVERDRIKSLAP-TIRLMVKLYLRRKLQSENNIPTTAMDNYALVELLVSHMSD-  511
            EC  L K     +  + P ++RL+ ++ ++ K    N +      NY     L SH SD 
Sbjct  74   ECVCLKKT----LPGMLPDSVRLVTRIIIKLKQGGANEMDYYTKKNYRKFADLSSHYSDM  129

Query  512  -IDEKQL  529
             +D K +
Sbjct  130  KVDAKHM  136



>ref|XP_011263849.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X2 
[Camponotus floridanus]
Length=639

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 62/114 (54%), Gaps = 10/114 (9%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            GVT+S   + GR    TR+F PG++I  ++PY  V  + +      C +C + S N+  C
Sbjct  248  GVTISFSERYGRHYIATREFQPGDIISIEDPYAHVIYEERY--YTHCHYCLSKSYNLIPC  305

Query  269  SACQVVYYCGATCQKSDWKL-HRFEC------QSLFKVERDRIKSLAPTIRLMV  409
            + C +  YC   C+K  W+  H+ EC       +L  V++D+I+ ++  IRL++
Sbjct  306  AKCPIAQYCSEKCRKLGWEACHKTECPILKLLTNLLNVDKDKIRMISKIIRLLI  359



>ref|XP_011263848.1| PREDICTED: SET and MYND domain-containing protein 4 isoform X1 
[Camponotus floridanus]
 gb|EFN63141.1| SET and MYND domain-containing protein 4 [Camponotus floridanus]
Length=641

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 62/114 (54%), Gaps = 10/114 (9%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            GVT+S   + GR    TR+F PG++I  ++PY  V  + +      C +C + S N+  C
Sbjct  248  GVTISFSERYGRHYIATREFQPGDIISIEDPYAHVIYEERY--YTHCHYCLSKSYNLIPC  305

Query  269  SACQVVYYCGATCQKSDWKL-HRFEC------QSLFKVERDRIKSLAPTIRLMV  409
            + C +  YC   C+K  W+  H+ EC       +L  V++D+I+ ++  IRL++
Sbjct  306  AKCPIAQYCSEKCRKLGWEACHKTECPILKLLTNLLNVDKDKIRMISKIIRLLI  359



>gb|KJA20540.1| hypothetical protein HYPSUDRAFT_142116 [Hypholoma sublateritium 
FD-334 SS-4]
Length=647

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 44/164 (27%), Positives = 79/164 (48%), Gaps = 10/164 (6%)
 Frame = +2

Query  101  VSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTNVKKCSACQ  280
            + T   KGR I++     PG+V+ + +P+ +  +  K      C       ++++C+ C+
Sbjct  85   IRTTTDKGRGIYSKYTRRPGDVLFAVKPHAAALSAAKLTDYCSCCTAARQGSLRRCTGCK  144

Query  281  VVYYCGATCQKSDWKLHRFECQSL-------FKVERDRIKSLAPTIRLMVKLYLRRKLQS  439
            VVYYC A+CQ  DW  H+ EC ++        K + D     A  IR + ++  R++   
Sbjct  145  VVYYCDASCQSRDWAFHKLECAAIQRWSGASRKTDVDAPVIPADAIRCLARMVWRKQKLG  204

Query  440  ENNIPTTAMDNYALVELLVSHMSDIDEKQLVLYAQMAN-LVNLI  568
             ++     +D  AL     S   D + +   +YAQ+A+ LVN +
Sbjct  205  VDSTWAKEID--ALESHRTSLSKDPNSQVSQMYAQLAHALVNFL  246



>ref|XP_005483074.1| PREDICTED: N-lysine methyltransferase SMYD2 [Zonotrichia albicollis]
Length=436

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 76/157 (48%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+       KGR +   R F+ GE+++S   Y +V T ++ G  + C+ CF     + KC
Sbjct  11   GLERFASAGKGRGLRARRRFAVGELLLSCPAYAAVLTVSERG--SHCDGCFARKEGLAKC  68

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC   CQK DW +H+ EC S+    ++   S   T+RL  ++  ++K   E  
Sbjct  69   GRCKQAFYCNVECQKEDWPMHKLECASMCTFGQNWQPS--ETVRLTARILAKQKTHPER-  125

Query  449  IPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
               T  +    V    SH+  +D EK+ ++   +A L
Sbjct  126  ---TQSEKLLAVREFESHLDKLDNEKRELIQNDIAAL  159



>ref|XP_006834071.1| PREDICTED: N-lysine methyltransferase SMYD2 [Chrysochloris asiatica]
Length=433

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 76/162 (47%), Gaps = 10/162 (6%)
 Frame = +2

Query  77   ALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFTSTN  256
            A  + G+     P KGR +   + F  G+++ S   Y  V T  + G    CE CF   +
Sbjct  3    ADGDGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEHCFARKD  60

Query  257  -VKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             + KC  C+  +YC   CQK DW +HR EC  +     +   S   T+RL  ++  ++K+
Sbjct  61   GLSKCGRCKQAFYCNVECQKEDWPMHRLECSPMVVFGENWNPS--ETVRLTARILAKQKI  118

Query  434  QSENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
              E     T  +    V+   SH+  +D EK+ ++ + +A L
Sbjct  119  HPER----TPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>ref|XP_008823080.1| PREDICTED: N-lysine methyltransferase SMYD2 [Nannospalax galili]
Length=433

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 72/148 (49%), Gaps = 10/148 (7%)
 Frame = +2

Query  119  KGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVYYC  295
            KGR +   R F  GE++ S   Y  V T  + G    CE CF     + KC  C+  +YC
Sbjct  17   KGRGLRALRPFRVGELLFSCPAYAYVLTVNERG--NHCECCFARKEGLSKCGRCKQAFYC  74

Query  296  GATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNY  475
             A CQK DW +H+ EC  +  +  +   S   T+RL  ++  ++K+  E     T +   
Sbjct  75   DADCQKEDWPMHKLECSPMVVLGENWNPS--ETVRLTARILAKQKIHPERTPSETLL---  129

Query  476  ALVELLVSHMSDID-EKQLVLYAQMANL  556
              V+   SH+  +D EK+ ++ + +A L
Sbjct  130  -AVKEFESHLDKLDNEKKDLIQSDIAAL  156



>ref|NP_001153563.1| N-lysine methyltransferase SMYD2 [Sus scrofa]
 sp|C3RZA1.1|SMYD2_PIG RecName: Full=N-lysine methyltransferase SMYD2; AltName: Full=Histone 
methyltransferase SMYD2; AltName: Full=SET and MYND 
domain-containing protein 2 [Sus scrofa]
 gb|ACH71265.1| SET and MYND domain-containing 2 [Sus scrofa]
Length=433

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 76/162 (47%), Gaps = 10/162 (6%)
 Frame = +2

Query  77   ALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-ST  253
            A  + G+     P KGR +   + F  G+++ S   Y  V T  + G    CE+CF    
Sbjct  3    AEGDGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEFCFARKE  60

Query  254  NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             + KC  C+  +YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+
Sbjct  61   GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKI  118

Query  434  QSENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
              E     T  +    V+   SH+  +D EK+ ++ + +A L
Sbjct  119  HPER----TPSEKLLAVKEFESHLDKLDNEKRDLIQSDIAAL  156



>ref|XP_007451352.1| PREDICTED: N-lysine methyltransferase SMYD2 [Lipotes vexillifer]
Length=433

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 77/162 (48%), Gaps = 10/162 (6%)
 Frame = +2

Query  77   ALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-ST  253
            A  + G+     P KGR +   + F  G+++ S   Y  V T  + G    CE+CF    
Sbjct  3    AEGDGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEFCFARKE  60

Query  254  NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             + KC  C+  +YC   CQ+ DW +H+ EC  +  +  +   S   T+RL  ++  ++K+
Sbjct  61   GLSKCGRCKQAFYCNVECQREDWPMHKLECSPMVVLGENWNPS--ETVRLTARILAKQKI  118

Query  434  QSENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
              E     T  +    V+   SH+  +D EK+ ++ + +A L
Sbjct  119  HPER----TPSEKLLAVKEFESHLDKLDNEKKGLIQSDIAAL  156



>ref|XP_005335035.1| PREDICTED: N-lysine methyltransferase SMYD2 [Ictidomys tridecemlineatus]
Length=572

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/150 (29%), Positives = 73/150 (49%), Gaps = 10/150 (7%)
 Frame = +2

Query  113  PQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVY  289
            P KGR +   + F  G+++ S   Y  V T  + G    CE+CF     + KC  C+  +
Sbjct  154  PGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEYCFARKEGLSKCGRCKQAF  211

Query  290  YCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMD  469
            YC   CQK DW +H+ EC  +     +   S + T+RL  ++  ++K+  E     T  +
Sbjct  212  YCNVECQKEDWPMHKLECSPMVVFGENW--SPSETVRLTARILAKQKIHPER----TPSE  265

Query  470  NYALVELLVSHMSDID-EKQLVLYAQMANL  556
                V+   SH+  +D EK+ ++ + +A L
Sbjct  266  KLLAVKEFESHLDKLDNEKKDLIQSDIAAL  295



>ref|XP_005348920.1| PREDICTED: N-lysine methyltransferase SMYD2 [Microtus ochrogaster]
Length=433

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 73/148 (49%), Gaps = 10/148 (7%)
 Frame = +2

Query  119  KGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKCSACQVVYYC  295
            KGR +   R F  G+++ S   Y  V T  + G    CE CF     + KC  C+  +YC
Sbjct  17   KGRGLRALRPFHVGDLLFSCPAYACVLTVGERG--HHCECCFARKEGLSKCGRCKQAFYC  74

Query  296  GATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENNIPTTAMDNY  475
             A CQK DW LH+ EC S+  V      + + T+RL  ++  ++K+  E     T  +  
Sbjct  75   DAECQKEDWPLHKLECSSM--VVFGESWNPSETVRLTARILAKQKIHPER----TPSEKL  128

Query  476  ALVELLVSHMSDID-EKQLVLYAQMANL  556
              V+   SH+  +D EK+ ++ + +A L
Sbjct  129  LAVKEFESHLDKLDNEKKDLIQSDIAAL  156



>ref|XP_004275293.1| PREDICTED: N-lysine methyltransferase SMYD2 [Orcinus orca]
Length=433

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 77/162 (48%), Gaps = 10/162 (6%)
 Frame = +2

Query  77   ALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-ST  253
            A  + G+     P KGR +   + F  G+++ S   Y  V T  + G    CE+CF    
Sbjct  3    AEGDGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTINERG--NHCEFCFARKE  60

Query  254  NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             + KC  C+  +YC   CQ+ DW +H+ EC  +  +  +   S   T+RL  ++  ++K+
Sbjct  61   GLSKCGRCKQAFYCNVECQREDWPMHKLECSPMVVLGENWNPS--ETVRLTARILAKQKI  118

Query  434  QSENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
              E     T  +    V+   SH+  +D EK+ ++ + +A L
Sbjct  119  HPER----TPSEKLLAVKEFESHLDKLDNEKKGLIQSDIAAL  156



>ref|XP_007394738.1| hypothetical protein PHACADRAFT_208075 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM56908.1| hypothetical protein PHACADRAFT_208075 [Phanerochaete carnosa 
HHB-10118-sp]
Length=606

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +2

Query  119  KGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTG-PSAKCEWCFTSTNVKKCSACQVVYYC  295
            KGR ++  + F+PG +++S  P +SV + ++ G   + C      T +K+C+ C+   YC
Sbjct  84   KGRGLYAKQAFAPGTILLSVRPCISVLSSSQLGFYCSHCAGPAPETGLKRCTGCRTTRYC  143

Query  296  GATCQKSDWKLHRFECQSL  352
             A CQ SDW +H+ ECQ+L
Sbjct  144  NAMCQNSDWAVHKMECQAL  162



>ref|XP_002403605.1| SET and MYND domain-containing protein (SMYD), putative [Ixodes 
scapularis]
 gb|EEC01028.1| SET and MYND domain-containing protein (SMYD), putative [Ixodes 
scapularis]
Length=770

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 72/160 (45%), Gaps = 13/160 (8%)
 Frame = +2

Query  116  QKGRCIFTTRDFSPGEVIISQEPYVSV--PTKTKTGPSAKCEWCFTS-TNVKKCSACQVV  286
            +KGR +   RD  PG+ I  + PY SV  P  TKT     C+ C     N   C+ C  V
Sbjct  252  EKGRFLVANRDLQPGDAIFVERPYASVLLPGHTKT----NCQHCHKRLLNAVPCAQCNQV  307

Query  287  YYCGATCQKSDWK-LHRFECQSLFKVERDRIKSLAPTIRLMVKLY----LRRKLQSENNI  451
             YC   C K  W   HR+EC +L  +    I  LA  + L+  L       R L +E  +
Sbjct  308  RYCSFACAKDSWNSYHRWECGNLNLLYSVGIAHLAVRVLLVTGLSGLADFCRHL-AEGKV  366

Query  452  PTTAMDNYALVELLVSHMSDIDEKQLVLYAQMANLVNLIL  571
                   Y  V  LV+H   +  + L+ Y+  A L++++L
Sbjct  367  DVDKNGGYGSVHELVTHSEKMHVEDLLQYSLTAALLSMLL  406



>ref|XP_006074330.1| PREDICTED: N-lysine methyltransferase SMYD2 isoform X2 [Bubalus 
bubalis]
Length=396

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 77/162 (48%), Gaps = 10/162 (6%)
 Frame = +2

Query  77   ALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-ST  253
            A  + G+     P KGR +   + F  G+++ S   Y  V T ++ G    CE+CF    
Sbjct  3    AEGDGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVSERG--NHCEFCFARKE  60

Query  254  NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             + KC  C+  +YC   CQ+ DW +H+ EC  +     +   S   T+RL  ++  ++K+
Sbjct  61   GLSKCGRCKQAFYCNVECQREDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKI  118

Query  434  QSENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
              E     T  +    V+   SH+  +D EK+ ++ + +A L
Sbjct  119  HPER----TPSEKLLAVKEFESHLDKLDNEKRDLIQSDIAAL  156



>ref|XP_004626925.1| PREDICTED: N-lysine methyltransferase SMYD2 [Octodon degus]
Length=433

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/162 (28%), Positives = 74/162 (46%), Gaps = 10/162 (6%)
 Frame = +2

Query  77   ALSEKGVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-ST  253
            A    G+     P KGR +   + F  GE++ +   Y  V T  + G    CE CF    
Sbjct  3    AEGRGGLERFCSPGKGRGLRALQPFQMGELLFACPAYACVLTVGERG--GHCEHCFARKE  60

Query  254  NVKKCSACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKL  433
             + KC  C+  +YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+
Sbjct  61   GLSKCGRCKQAFYCNVECQKEDWHMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKI  118

Query  434  QSENNIPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
              E     T  +    V+   SH+  +D EK+ ++ + +A L
Sbjct  119  HPER----TPSEKLLAVKEFESHLDKLDNEKKDLIQSDIATL  156



>ref|XP_009185764.1| PREDICTED: N-lysine methyltransferase SMYD2 isoform X1 [Papio 
anubis]
Length=435

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 74/157 (47%), Gaps = 10/157 (6%)
 Frame = +2

Query  92   GVTVSTHPQKGRCIFTTRDFSPGEVIISQEPYVSVPTKTKTGPSAKCEWCFT-STNVKKC  268
            G+     P KGR +   + F  G+++ S   Y  V T  + G    CE+CF     + KC
Sbjct  8    GLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERG--NHCEYCFARKEGLSKC  65

Query  269  SACQVVYYCGATCQKSDWKLHRFECQSLFKVERDRIKSLAPTIRLMVKLYLRRKLQSENN  448
              C+  +YC   CQK DW +H+ EC  +     +   S   T+RL  ++  ++K+  E  
Sbjct  66   GRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPS--ETVRLTARILAKQKIHPER-  122

Query  449  IPTTAMDNYALVELLVSHMSDID-EKQLVLYAQMANL  556
               T  +    V+   SH+  +D EK+ ++ + +A L
Sbjct  123  ---TPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAAL  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750