BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M22

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004511894.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       322   1e-109   Cicer arietinum [garbanzo]
dbj|BAJ53199.1|  JHL03K20.8                                             322   2e-109   Jatropha curcas
ref|XP_007155902.1|  hypothetical protein PHAVU_003G241600g             321   3e-109   Phaseolus vulgaris [French bean]
ref|XP_010093513.1|  SUMO-conjugating enzyme SCE1                       321   4e-109   Morus notabilis
ref|XP_004288010.1|  PREDICTED: SUMO-conjugating enzyme SCE1            320   6e-109   Fragaria vesca subsp. vesca
gb|KJB39148.1|  hypothetical protein B456_007G216300                    320   7e-109   Gossypium raimondii
ref|XP_007156772.1|  hypothetical protein PHAVU_002G016300g             320   7e-109   Phaseolus vulgaris [French bean]
ref|XP_003517314.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    319   1e-108   Glycine max [soybeans]
ref|XP_006590254.1|  PREDICTED: uncharacterized protein LOC100305...    319   2e-108   Glycine max [soybeans]
gb|AFK39856.1|  unknown                                                 319   2e-108   Lotus japonicus
ref|NP_001235590.1|  uncharacterized protein LOC100500268               319   2e-108   Glycine max [soybeans]
emb|CDP02519.1|  unnamed protein product                                319   3e-108   Coffea canephora [robusta coffee]
ref|XP_007047350.1|  Sumo conjugation enzyme 1                          318   4e-108   
ref|NP_001234980.1|  uncharacterized protein LOC100305922               318   7e-108   Glycine max [soybeans]
ref|XP_006425960.1|  hypothetical protein CICLE_v10026671mg             317   1e-107   Citrus clementina [clementine]
emb|CAE45567.1|  SUMO E2 conjugating enzyme SCE1                        317   1e-107   Nicotiana benthamiana
ref|XP_009367435.1|  PREDICTED: SUMO-conjugating enzyme SCE1            317   1e-107   Pyrus x bretschneideri [bai li]
ref|XP_009389843.1|  PREDICTED: SUMO-conjugating enzyme SCE1            317   2e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385926.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       316   2e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783454.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       316   3e-107   Phoenix dactylifera
ref|XP_011097247.1|  PREDICTED: SUMO-conjugating enzyme SCE1            316   3e-107   Sesamum indicum [beniseed]
ref|XP_007206053.1|  hypothetical protein PRUPE_ppa012626mg             316   3e-107   Prunus persica
ref|XP_008338336.1|  PREDICTED: SUMO-conjugating enzyme SCE1            316   4e-107   Malus domestica [apple tree]
ref|XP_008809080.1|  PREDICTED: SUMO-conjugating enzyme SCE1            315   5e-107   Phoenix dactylifera
ref|XP_004151860.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       315   5e-107   Cucumis sativus [cucumbers]
ref|XP_009783412.1|  PREDICTED: SUMO-conjugating enzyme SCE1            315   6e-107   Nicotiana sylvestris
gb|KHG02093.1|  SUMO-conjugating enzyme SCE1 -like protein              315   8e-107   Gossypium arboreum [tree cotton]
ref|XP_004509116.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       314   2e-106   Cicer arietinum [garbanzo]
ref|XP_009615424.1|  PREDICTED: SUMO-conjugating enzyme SCE1            314   2e-106   Nicotiana tomentosiformis
ref|XP_011099107.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       314   2e-106   Sesamum indicum [beniseed]
ref|XP_009781499.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       314   2e-106   Nicotiana sylvestris
emb|CAN61018.1|  hypothetical protein VITISV_001138                     314   2e-106   Vitis vinifera
ref|XP_002468614.1|  hypothetical protein SORBIDRAFT_01g049010          314   2e-106   Sorghum bicolor [broomcorn]
ref|XP_002307279.1|  ubiquitin-conjugating enzyme family protein        313   3e-106   Populus trichocarpa [western balsam poplar]
ref|XP_004234662.1|  PREDICTED: SUMO-conjugating enzyme SCE1 isof...    313   3e-106   Solanum lycopersicum
ref|NP_001274896.1|  SUMO-conjugating enzyme SCE1-like                  313   4e-106   Solanum tuberosum [potatoes]
ref|XP_002283130.1|  PREDICTED: SUMO-conjugating enzyme SCE1            313   4e-106   Vitis vinifera
ref|XP_010934002.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       313   4e-106   Elaeis guineensis
ref|XP_010270683.1|  PREDICTED: SUMO-conjugating enzyme SCE1            313   5e-106   Nelumbo nucifera [Indian lotus]
ref|NP_001048802.1|  Os03g0123100                                       313   5e-106   
ref|XP_003558940.1|  PREDICTED: SUMO-conjugating enzyme SCE1            313   5e-106   Brachypodium distachyon [annual false brome]
ref|XP_010070565.1|  PREDICTED: SUMO-conjugating enzyme SCE1            313   6e-106   Eucalyptus grandis [rose gum]
ref|XP_006649299.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       312   8e-106   Oryza brachyantha
ref|XP_002284949.1|  PREDICTED: SUMO-conjugating enzyme SCE1            312   1e-105   Vitis vinifera
ref|NP_001149113.1|  ubiquitin-conjugating enzyme E2 I                  311   2e-105   
ref|XP_010927156.1|  PREDICTED: SUMO-conjugating enzyme SCE1            311   2e-105   Elaeis guineensis
ref|XP_010263454.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       311   2e-105   Nelumbo nucifera [Indian lotus]
emb|CDP01300.1|  unnamed protein product                                311   3e-105   Coffea canephora [robusta coffee]
ref|XP_004231867.1|  PREDICTED: SUMO-conjugating enzyme SCE1            311   3e-105   
ref|XP_008650364.1|  PREDICTED: SUMO-conjugating enzyme SCE1            311   3e-105   Zea mays [maize]
ref|XP_009390474.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    310   6e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010919083.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       310   6e-105   Elaeis guineensis
ref|XP_009599931.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       310   6e-105   Nicotiana tomentosiformis
ref|XP_009139007.1|  PREDICTED: SUMO-conjugating enzyme SCE1            310   8e-105   Brassica rapa
ref|XP_009606595.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       310   8e-105   Nicotiana tomentosiformis
ref|XP_003611678.1|  SUMO-conjugating enzyme UBC9                       310   1e-104   Medicago truncatula
gb|ACJ83979.1|  unknown                                                 310   1e-104   Medicago truncatula
ref|XP_010548072.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       310   1e-104   Tarenaya hassleriana [spider flower]
gb|ACG45477.1|  ubiquitin-conjugating enzyme E2 I                       309   2e-104   Zea mays [maize]
ref|XP_010524335.1|  PREDICTED: SUMO-conjugating enzyme SCE1            309   2e-104   Tarenaya hassleriana [spider flower]
gb|ADP37981.1|  ubiquitin-protein ligase                                308   3e-104   Brassica napus [oilseed rape]
emb|CDY47661.1|  BnaC04g23980D                                          308   4e-104   Brassica napus [oilseed rape]
gb|ABG79538.1|  putative E2 SUMO conjugating enzyme                     308   4e-104   Triticum turgidum subsp. durum
ref|XP_004983815.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       308   4e-104   Setaria italica
gb|EMS60436.1|  SUMO-conjugating enzyme SCE1                            308   6e-104   Triticum urartu
ref|XP_006855190.1|  hypothetical protein AMTR_s00051p00153990          308   6e-104   Amborella trichopoda
emb|CDY70581.1|  BnaAnng34240D                                          308   7e-104   Brassica napus [oilseed rape]
ref|NP_001065167.1|  Os10g0536000                                       307   9e-104   
ref|XP_009793052.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       307   9e-104   Nicotiana sylvestris
gb|KFK35081.1|  hypothetical protein AALP_AA5G232800                    307   1e-103   Arabis alpina [alpine rockcress]
ref|XP_009104077.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       307   1e-103   Brassica rapa
ref|XP_006402833.1|  hypothetical protein EUTSA_v10006282mg             307   1e-103   Eutrema salsugineum [saltwater cress]
ref|XP_002465018.1|  hypothetical protein SORBIDRAFT_01g030580          306   2e-103   Sorghum bicolor [broomcorn]
gb|AFK40127.1|  unknown                                                 306   2e-103   Lotus japonicus
ref|XP_008657947.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       306   2e-103   Zea mays [maize]
gb|ABK23443.1|  unknown                                                 305   4e-103   Picea sitchensis
ref|XP_008660103.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       305   6e-103   Zea mays [maize]
ref|XP_009116485.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       305   8e-103   Brassica rapa
dbj|BAJ86881.1|  predicted protein                                      305   8e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006291969.1|  hypothetical protein CARUB_v10018157mg             305   9e-103   Capsella rubella
ref|XP_009771488.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       305   1e-102   Nicotiana sylvestris
ref|XP_003574257.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       305   1e-102   Brachypodium distachyon [annual false brome]
ref|XP_008244101.1|  PREDICTED: SUMO-conjugating enzyme SCE1            303   2e-102   
emb|CDX71988.1|  BnaC08g28860D                                          303   3e-102   
gb|EPS61715.1|  ubiquitin carrier protein                               303   4e-102   Genlisea aurea
ref|XP_007223632.1|  hypothetical protein PRUPE_ppa012638mg             303   4e-102   Prunus persica
ref|XP_010504726.1|  PREDICTED: SUMO-conjugating enzyme SCE1            302   7e-102   Camelina sativa [gold-of-pleasure]
ref|XP_009417521.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       301   2e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008220257.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       301   2e-101   Prunus mume [ume]
ref|XP_010516423.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       301   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_006662001.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       301   2e-101   Oryza brachyantha
ref|XP_004291083.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       301   4e-101   Fragaria vesca subsp. vesca
ref|NP_191346.1|  SUMO-conjugating enzyme SCE1                          300   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427677.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       300   4e-101   Camelina sativa [gold-of-pleasure]
ref|XP_006354854.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       300   9e-101   Solanum tuberosum [potatoes]
ref|XP_009620476.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       299   1e-100   Nicotiana tomentosiformis
ref|XP_008378017.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       298   3e-100   
ref|XP_006402394.1|  hypothetical protein EUTSA_v10006281mg             298   6e-100   Eutrema salsugineum [saltwater cress]
ref|XP_001768256.1|  predicted protein                                  297   7e-100   
ref|XP_001776874.1|  predicted protein                                  297   1e-99    
ref|XP_006473285.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    297   1e-99    Citrus sinensis [apfelsine]
ref|XP_010679521.1|  PREDICTED: SUMO-conjugating enzyme SCE1            296   1e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009390473.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    297   2e-99    
ref|XP_011069737.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       296   2e-99    Sesamum indicum [beniseed]
ref|XP_004238134.1|  PREDICTED: SUMO-conjugating enzyme SCE1            296   2e-99    Solanum lycopersicum
ref|XP_010523001.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       296   3e-99    Tarenaya hassleriana [spider flower]
gb|KDO84093.1|  hypothetical protein CISIN_1g031420mg                   295   5e-99    Citrus sinensis [apfelsine]
ref|XP_006434720.1|  hypothetical protein CICLE_v10002741mg             295   9e-99    Citrus clementina [clementine]
ref|XP_008393782.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       294   1e-98    
ref|XP_004252754.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       294   2e-98    Solanum lycopersicum
emb|CDX93982.1|  BnaC04g21410D                                          293   2e-98    
gb|ABK23228.1|  unknown                                                 293   5e-98    Picea sitchensis
ref|XP_009138734.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       292   7e-98    Brassica rapa
ref|XP_006342638.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       291   1e-97    Solanum tuberosum [potatoes]
gb|AEI83503.1|  ubiquitin-conjugating enzyme E2 I                       291   2e-97    Wolffia arrhiza
ref|XP_002980875.1|  SUMO-conjugating enzyme 1a                         291   3e-97    Selaginella moellendorffii
ref|XP_002301168.1|  hypothetical protein POPTR_0002s12510g             290   9e-97    Populus trichocarpa [western balsam poplar]
ref|XP_006374899.1|  hypothetical protein POPTR_0014s02500g             288   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_011017169.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       288   5e-96    Populus euphratica
ref|XP_006374896.1|  hypothetical protein POPTR_0014s02480g             286   2e-95    Populus trichocarpa [western balsam poplar]
ref|XP_011029489.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       286   3e-95    Populus euphratica
ref|XP_002534386.1|  ubiquitin-conjugating enzyme E2 I, putative        286   5e-95    
gb|EYU25458.1|  hypothetical protein MIMGU_mgv11b023148mg               282   7e-94    Erythranthe guttata [common monkey flower]
gb|KCW59391.1|  hypothetical protein EUGRSUZ_H02096                     284   8e-94    Eucalyptus grandis [rose gum]
ref|XP_010317791.1|  PREDICTED: SUMO-conjugating enzyme SCE1 isof...    281   2e-93    Solanum lycopersicum
ref|XP_007017167.1|  Sumo conjugation enzyme 1 isoform 1                281   2e-93    
ref|XP_011029476.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       280   4e-93    Populus euphratica
ref|XP_004156788.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       283   1e-92    
ref|XP_008344316.1|  PREDICTED: SUMO-conjugating enzyme SCE1            278   2e-92    
ref|XP_006291970.1|  hypothetical protein CARUB_v10018157mg             275   6e-91    
ref|XP_010059899.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    274   1e-90    Eucalyptus grandis [rose gum]
gb|KCW66370.1|  hypothetical protein EUGRSUZ_F00190                     275   2e-90    Eucalyptus grandis [rose gum]
ref|XP_008807218.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       268   7e-89    
ref|XP_010059898.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    268   3e-88    Eucalyptus grandis [rose gum]
ref|XP_010318996.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    263   3e-86    
ref|XP_009622849.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       262   5e-86    Nicotiana tomentosiformis
gb|KHG16593.1|  SUMO-conjugating enzyme SCE1 -like protein              262   5e-86    Gossypium arboreum [tree cotton]
gb|EMS55983.1|  SUMO-conjugating enzyme SCE1                            261   5e-86    Triticum urartu
gb|KJB21461.1|  hypothetical protein B456_004G179100                    261   2e-85    Gossypium raimondii
gb|KDO84097.1|  hypothetical protein CISIN_1g031420mg                   260   2e-85    Citrus sinensis [apfelsine]
gb|KHG25846.1|  SUMO-conjugating enzyme SCE1 -like protein              259   1e-84    Gossypium arboreum [tree cotton]
gb|ACA04892.1|  putative ubiquitin-conjugating enzyme E2 I protein      257   3e-84    Picea abies
gb|KJB53560.1|  hypothetical protein B456_009G214500                    258   3e-84    Gossypium raimondii
gb|EYU25459.1|  hypothetical protein MIMGU_mgv1a015370mg                256   1e-83    Erythranthe guttata [common monkey flower]
ref|XP_007017168.1|  Sumo conjugation enzyme 1 isoform 2                256   2e-83    
ref|XP_006344423.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       255   4e-83    Solanum tuberosum [potatoes]
ref|XP_002506123.1|  predicted protein                                  254   8e-83    Micromonas commoda
gb|AAB63513.1|  ubiquitin-conjugating enzyme                            250   1e-81    Prunus armeniaca
ref|XP_002448378.1|  hypothetical protein SORBIDRAFT_06g026280          250   3e-81    Sorghum bicolor [broomcorn]
gb|EWM21470.1|  ubiquitin-conjugating enzyme e2 i                       249   8e-81    Nannochloropsis gaditana
gb|AFK49150.1|  unknown                                                 246   3e-80    Lotus japonicus
ref|XP_010094645.1|  Serine palmitoyltransferase 1                      260   7e-80    
ref|XP_005649108.1|  E2 ubiquitin-conjugating-like enzyme               246   8e-80    Coccomyxa subellipsoidea C-169
gb|ABG66220.1|  Ubiquitin-conjugating enzyme E2 I, putative, expr...    245   8e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010059901.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    245   2e-79    Eucalyptus grandis [rose gum]
ref|XP_008668997.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       244   8e-79    Zea mays [maize]
ref|XP_001694849.1|  E2 ubiquitin-conjugating-like enzyme               243   1e-78    Chlamydomonas reinhardtii
ref|XP_002954400.1|  hypothetical protein VOLCADRAFT_102189             243   1e-78    Volvox carteri f. nagariensis
emb|CAD41164.2|  OSJNBa0064M23.9                                        243   1e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006425959.1|  hypothetical protein CICLE_v10026671mg             241   2e-78    
ref|XP_003056766.1|  predicted protein                                  243   2e-78    Micromonas pusilla CCMP1545
ref|XP_002448376.1|  hypothetical protein SORBIDRAFT_06g026250          243   2e-78    Sorghum bicolor [broomcorn]
ref|XP_004976583.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       242   3e-78    Setaria italica
ref|XP_002448377.1|  hypothetical protein SORBIDRAFT_06g026270          242   5e-78    Sorghum bicolor [broomcorn]
gb|KJB53563.1|  hypothetical protein B456_009G214500                    241   6e-78    Gossypium raimondii
ref|XP_006652687.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       241   6e-78    Oryza brachyantha
gb|KJB53564.1|  hypothetical protein B456_009G214500                    240   2e-77    Gossypium raimondii
ref|XP_006473287.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    239   2e-77    
gb|KDO84096.1|  hypothetical protein CISIN_1g031420mg                   238   9e-77    Citrus sinensis [apfelsine]
ref|XP_004242945.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       238   1e-76    Solanum lycopersicum
ref|XP_010318995.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    238   2e-76    Solanum lycopersicum
ref|XP_006434721.1|  hypothetical protein CICLE_v10002741mg             237   2e-76    
ref|XP_003580378.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    237   3e-76    Brachypodium distachyon [annual false brome]
ref|NP_001159056.1|  ubiquitin-conjugating enzyme E2 I                  237   3e-76    Zea mays [maize]
gb|ACG43810.1|  ubiquitin-conjugating enzyme E2 I                       236   7e-76    Zea mays [maize]
ref|XP_003293385.1|  hypothetical protein DICPUDRAFT_58449              235   2e-75    Dictyostelium purpureum
ref|XP_010059902.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like...    234   6e-75    Eucalyptus grandis [rose gum]
gb|EFA82218.1|  putative E2 enzyme Ubc9                                 233   1e-74    Heterostelium album PN500
ref|XP_011398219.1|  SUMO-conjugating enzyme SCE1                       232   4e-74    Auxenochlorella protothecoides
gb|KDO84100.1|  hypothetical protein CISIN_1g031420mg                   230   4e-74    Citrus sinensis [apfelsine]
ref|XP_006434722.1|  hypothetical protein CICLE_v10002741mg             230   7e-74    
ref|XP_001899558.1|  ube2i2 protein                                     231   1e-73    Brugia malayi [agent of lymphatic filariasis]
ref|XP_004873904.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    232   1e-73    
ref|XP_002288880.1|  ubiquitin conjugating enzyme                       230   2e-73    Thalassiosira pseudonana CCMP1335
gb|KJB70051.1|  hypothetical protein B456_011G056100                    229   3e-73    Gossypium raimondii
ref|XP_007908470.1|  PREDICTED: SUMO-conjugating enzyme UBC9            229   4e-73    Callorhinchus milii [Australian ghost shark]
ref|XP_005448278.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like...    229   4e-73    
ref|XP_009858945.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          229   5e-73    
ref|XP_005851683.1|  hypothetical protein CHLNCDRAFT_59526              229   5e-73    Chlorella variabilis
ref|XP_004976582.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       229   6e-73    
ref|XP_007576679.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    228   9e-73    Poecilia formosa
gb|ACI67992.1|  SUMO-conjugating enzyme UBC9-B                          228   1e-72    Salmo salar
pdb|4L83|A  Chain A, Structure Of A Putative Ubiquitin-conjugatin...    229   1e-72    Brugia malayi [agent of lymphatic filariasis]
ref|NP_001147178.1|  LOC100280784                                       229   1e-72    Zea mays [maize]
ref|XP_010390839.1|  PREDICTED: SUMO-conjugating enzyme UBC9            229   1e-72    
ref|XP_005803294.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       228   1e-72    Xiphophorus maculatus
ref|XP_637050.1|  hypothetical protein DDB_G0287693                     228   2e-72    Dictyostelium discoideum AX4
ref|XP_005697407.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    228   2e-72    
ref|XP_010568841.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    228   2e-72    Haliaeetus leucocephalus
ref|XP_007063734.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    228   2e-72    
gb|EFO23090.2|  SUMO-conjugating enzyme UBC9                            228   2e-72    Loa loa
ref|XP_004562508.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like...    228   2e-72    
ref|XP_006245980.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    228   3e-72    
ref|XP_006123351.1|  PREDICTED: SUMO-conjugating enzyme UBC9            227   3e-72    
dbj|BAD92225.1|  ubiquitin-conjugating enzyme E2I variant               228   3e-72    Homo sapiens [man]
ref|XP_005621791.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B is...    227   3e-72    
ref|XP_011500210.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          227   3e-72    Ceratosolen solmsi marchali
ref|XP_007100183.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    230   3e-72    
ref|XP_006037209.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    227   4e-72    
ref|XP_005866608.1|  PREDICTED: SUMO-conjugating enzyme UBC9            227   4e-72    
ref|XP_005697408.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    227   4e-72    
gb|KFP20677.1|  SUMO-conjugating enzyme UBC9                            227   4e-72    Egretta garzetta
gb|EMC86701.1|  SUMO-conjugating enzyme UBC9                            227   4e-72    
pdb|1KPS|A  Chain A, Structural Basis For E2-Mediated Sumo Conjug...    227   4e-72    Mus musculus [mouse]
ref|XP_010873204.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B-like     226   4e-72    Esox lucius
ref|NP_001187932.1|  sumo-conjugating enzyme ubc9                       226   4e-72    Ictalurus punctatus
ref|XP_010282674.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    227   4e-72    Phaethon lepturus
gb|KFQ56066.1|  SUMO-conjugating enzyme UBC9                            227   4e-72    Nestor notabilis
ref|NP_003336.1|  SUMO-conjugating enzyme UBC9                          226   4e-72    Homo sapiens [man]
ref|NP_571908.1|  SUMO-conjugating enzyme UBC9-B                        226   4e-72    Danio rerio [leopard danio]
gb|AAP36303.1|  Homo sapiens ubiquitin-conjugating enzyme E2I (UB...    226   5e-72    synthetic construct
ref|XP_009665363.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    228   5e-72    Struthio camelus australis
ref|XP_008579450.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    227   5e-72    Galeopterus variegatus [Malayan flying lemur]
ref|NP_571426.1|  SUMO-conjugating enzyme UBC9-A                        226   5e-72    Danio rerio [leopard danio]
gb|KFM12519.1|  SUMO-conjugating enzyme UBC9                            226   5e-72    Aptenodytes forsteri
pdb|1U9A|A  Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9            226   5e-72    Mus musculus [mouse]
ref|XP_006006938.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B-li...    226   6e-72    Latimeria chalumnae
ref|XP_004056983.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    226   6e-72    
gb|KGL86044.1|  SUMO-conjugating enzyme UBC9                            226   6e-72    Charadrius vociferus
pdb|2O25|C  Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Compl...    226   6e-72    Homo sapiens [man]
ref|XP_007100184.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    227   6e-72    
ref|XP_006037208.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    227   6e-72    
pdb|3A4S|A  Chain A, The Crystal Structure Of The Sld2:ubc9 Complex     226   7e-72    Homo sapiens [man]
pdb|2GRN|A  Chain A, Crystal Structure Of Human Rangap1-Ubc9            226   8e-72    Homo sapiens [man]
ref|XP_009665371.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    226   8e-72    Struthio camelus australis
ref|XP_011300412.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          226   8e-72    Fopius arisanus
dbj|GAM24255.1|  hypothetical protein SAMD00019534_074300               226   9e-72    Acytostelium subglobosum LB1
gb|EDL22414.1|  mCG17660, isoform CRA_c                                 226   9e-72    Mus musculus [mouse]
ref|XP_005391641.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    226   9e-72    
ref|NP_001232317.1|  putative ubiquitin-conjugating enzyme E2I cl...    226   9e-72    Taeniopygia guttata
gb|KFO34746.1|  SUMO-conjugating enzyme UBC9                            227   1e-71    Fukomys damarensis [Damara mole rat]
ref|XP_003417832.2|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    227   1e-71    Loxodonta africana [African bush elephant]
gb|ACO07807.1|  SUMO-1-conjugating enzyme UBC9                          226   1e-71    Oncorhynchus mykiss
gb|EHJ63743.1|  ubiquitin-conjugating enzyme E2                         226   1e-71    
emb|CEG64484.1|  Putative SUMO-conjugating enzyme ubc9                  226   1e-71    Rhizopus microsporus
ref|XP_007979401.1|  PREDICTED: SUMO-conjugating enzyme UBC9            227   1e-71    Chlorocebus sabaeus
gb|EJW88467.1|  ubiquitin carrier protein                               226   1e-71    Wuchereria bancrofti [agent of lymphatic filariasis]
gb|AAH51289.3|  Ubiquitin-conjugating enzyme E2I (UBC9 homolog, y...    226   1e-71    Homo sapiens [man]
dbj|BAM19143.1|  lesswright                                             225   2e-71    Papilio polytes
ref|XP_967918.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B             225   2e-71    Tribolium castaneum [rust-red flour beetle]
gb|ACO08933.1|  SUMO-1-conjugating enzyme UBC9                          225   2e-71    Osmerus mordax
dbj|BAF83807.1|  unnamed protein product                                225   2e-71    Homo sapiens [man]
ref|XP_007453652.1|  PREDICTED: SUMO-conjugating enzyme UBC9            226   2e-71    Lipotes vexillifer [baiji]
gb|ACI33971.1|  SUMO-conjugating enzyme UBC9                            226   2e-71    Salmo salar
gb|ACO52076.1|  SUMO-conjugating enzyme UBC9                            225   2e-71    Rana catesbeiana [bullfrog]
gb|ACI68998.1|  SUMO-conjugating enzyme UBC9-B                          225   2e-71    Salmo salar
emb|CDQ58708.1|  unnamed protein product                                226   2e-71    Oncorhynchus mykiss
ref|XP_007863301.1|  ubiquitin-conjugating enzyme9                      225   2e-71    Gloeophyllum trabeum ATCC 11539
ref|XP_006914048.1|  PREDICTED: SUMO-conjugating enzyme UBC9            227   2e-71    
ref|XP_009010112.1|  hypothetical protein HELRODRAFT_71397              225   2e-71    Helobdella robusta
ref|XP_001606115.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B is...    224   2e-71    Nasonia vitripennis
ref|XP_004537820.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like...    224   3e-71    Ceratitis capitata [medfly]
gb|ACI66562.1|  SUMO-conjugating enzyme UBC9-B                          224   3e-71    Salmo salar
ref|XP_005821430.1|  hypothetical protein GUITHDRAFT_155732             224   3e-71    Guillardia theta CCMP2712
ref|NP_001281115.1|  SUMO-conjugating enzyme UBC9-like                  224   4e-71    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005106871.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B-li...    224   4e-71    Aplysia californica
ref|XP_008558444.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          224   4e-71    Microplitis demolitor
ref|XP_006009207.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like...    224   5e-71    Latimeria chalumnae
pdb|2GRR|A  Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127s      224   5e-71    Homo sapiens [man]
ref|XP_002180700.1|  predicted protein                                  224   5e-71    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_008765771.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    226   6e-71    
ref|XP_005181569.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          224   6e-71    Musca domestica
gb|KIM65356.1|  hypothetical protein SCLCIDRAFT_113026                  224   6e-71    Scleroderma citrinum Foug A
pdb|2GRO|A  Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q       224   6e-71    Homo sapiens [man]
ref|XP_008579441.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    225   6e-71    Galeopterus variegatus [Malayan flying lemur]
gb|KDQ60926.1|  hypothetical protein JAAARDRAFT_151815                  224   6e-71    Jaapia argillacea MUCL 33604
ref|XP_011347203.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          224   7e-71    
gb|ELR62878.1|  SUMO-conjugating enzyme UBC9                            224   7e-71    Bos mutus
ref|XP_002426763.1|  SUMO-1-conjugating enzyme UBC9, putative           224   7e-71    Pediculus humanus corporis [human body lice]
ref|XP_001640489.1|  predicted protein                                  224   7e-71    
ref|XP_010901444.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       223   7e-71    
ref|XP_010337297.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    227   7e-71    
ref|XP_005886931.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          224   8e-71    
ref|XP_007322005.1|  ubiquitin-conjugating enzyme, E2                   223   8e-71    
pdb|2GRQ|A  Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127a      223   1e-70    
ref|XP_001356428.1|  GA15704                                            223   1e-70    
ref|XP_007565742.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       223   1e-70    
ref|XP_003964465.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       223   1e-70    
gb|EJK69498.1|  hypothetical protein THAOC_09238                        223   1e-70    
pdb|2GRP|A  Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a       223   1e-70    
pdb|2UYZ|A  Chain A, Non-Covalent Complex Between Ubc9 And Sumo1        223   1e-70    
emb|CDO73559.1|  hypothetical protein BN946_scf185014.g29               223   1e-70    
ref|XP_002414996.1|  ubiquitin protein ligase, putative                 223   1e-70    
ref|XP_004902352.1|  PREDICTED: SUMO-conjugating enzyme UBC9            224   1e-70    
ref|XP_005806114.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       223   2e-70    
ref|XP_011057878.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          223   2e-70    
pdb|3UIO|A  Chain A, Complex Between Human Rangap1-sumo2, Ubc9 An...    223   2e-70    
gb|AFH89682.1|  ubiquitin-conjugating enzyme                            223   2e-70    
ref|XP_007239085.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       223   2e-70    
ref|XP_003961356.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       222   2e-70    
gb|ABP57628.1|  ubiquitin-conjugating enzyme E2I                        222   2e-70    
ref|XP_009040187.1|  hypothetical protein AURANDRAFT_31459              222   2e-70    
ref|XP_007764593.1|  ubiquitin-conjugating enzyme 9                     222   2e-70    
gb|ABR23407.1|  putative ubiquitin-conjugating enzyme                   222   2e-70    
ref|XP_001968181.1|  GG24645                                            222   2e-70    
gb|KFB45737.1|  ubiquitin-conjugating enzyme E2 i                       222   3e-70    
emb|CBQ68965.1|  probable ubiquitin--protein ligase hus5                222   3e-70    
emb|CEI95327.1|  Putative SUMO-conjugating enzyme ubc9                  222   3e-70    
gb|ACJ03792.1|  ubiquitin-conjugating enzyme E2                         222   3e-70    
gb|KFM78957.1|  SUMO-conjugating enzyme UBC9                            222   3e-70    
ref|NP_476978.1|  lesswright, isoform A                                 222   3e-70    
gb|EDL06246.1|  mCG21975                                                222   3e-70    
gb|ELU16619.1|  hypothetical protein CAPTEDRAFT_21101                   222   3e-70    
gb|KIY43502.1|  ubiquitin-conjugating enzyme 9                          222   3e-70    
gb|EYB84189.1|  hypothetical protein Y032_0322g2463                     222   3e-70    
ref|XP_003140978.1|  ube2i2 protein                                     222   3e-70    
gb|AFU93453.1|  ubiquitin-conjugating enzyme E2 c                       222   3e-70    
emb|CDJ95354.1|  Ubiquitin-conjugating enzyme domain containing p...    222   4e-70    
ref|XP_002500401.1|  predicted protein                                  222   4e-70    
gb|EMS25881.1|  ubiquitin-conjugating enzyme E2 I                       221   4e-70    
gb|KFH73829.1|  SUMO-conjugating enzyme ubc9                            221   5e-70    
ref|XP_001988559.1|  GH10511                                            221   5e-70    
ref|XP_309574.1|  AGAP011076-PA                                         221   5e-70    
gb|KHN74897.1|  SUMO-conjugating enzyme UBC9                            222   5e-70    
emb|CAX77005.1|  lesswright                                             221   5e-70    
ref|XP_002502397.1|  predicted protein                                  221   6e-70    
ref|XP_003488254.1|  PREDICTED: hypothetical protein LOC100741621       235   6e-70    
ref|XP_003399340.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       221   6e-70    
ref|XP_003382769.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B          221   7e-70    
sp|Q6Y1Z4.1|UBC9_PAGMA  RecName: Full=SUMO-conjugating enzyme UBC...    221   7e-70    
emb|CEL51642.1|  ubiquitin-conjugating enzyme E2 I                      221   7e-70    
gb|KDQ33413.1|  hypothetical protein PLEOSDRAFT_1087809                 221   8e-70    
gb|KJA27014.1|  hypothetical protein HYPSUDRAFT_83919                   221   8e-70    
ref|XP_007385473.1|  ubiquitin-conjugating enzyme 9                     221   8e-70    
gb|KDR73630.1|  hypothetical protein GALMADRAFT_251388                  221   9e-70    
ref|XP_006457886.1|  ubiquitin-conjugating enzyme9                      221   9e-70    
gb|ACI68647.1|  SUMO-conjugating enzyme UBC9                            221   9e-70    
gb|KIK57631.1|  hypothetical protein GYMLUDRAFT_75247                   221   1e-69    
ref|XP_001654032.1|  AAEL009770-PA                                      221   1e-69    
emb|CAG04374.1|  unnamed protein product                                220   1e-69    
dbj|GAK66535.1|  ubiquitin-conjugating enzyme9                          220   1e-69    
ref|XP_003059128.1|  predicted protein                                  221   1e-69    
gb|KGL82357.1|  SUMO-conjugating enzyme UBC9                            221   2e-69    
ref|XP_006566477.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    220   2e-69    
gb|AEE61507.1|  unknown                                                 220   2e-69    
gb|EPB87546.1|  SUMO-conjugating enzyme ubc9                            220   2e-69    
dbj|GAN08838.1|  SUMO conjugating enzyme Hus5                           220   2e-69    
emb|CCF48644.1|  probable ubiquitin--protein ligase hus5                220   2e-69    
gb|EDL35680.1|  mCG17818                                                220   2e-69    
gb|ACN10367.1|  SUMO-conjugating enzyme UBC9                            220   2e-69    
ref|XP_320422.3|  AGAP012107-PA                                         220   2e-69    
gb|KIY65299.1|  ubiquitin-conjugating enzyme                            220   2e-69    
gb|EUC61687.1|  ubiquitin-conjugating enzyme, E2                        220   2e-69    
gb|EST08788.1|  ubiquitin-protein ligase                                219   2e-69    
gb|EMD38460.1|  ubiquitin-conjugating enzyme9                           219   3e-69    
gb|ERG79270.1|  sumo-conjugating enzyme ubc9                            220   3e-69    
emb|CAX76993.1|  lesswright                                             220   3e-69    
gb|KIO13437.1|  hypothetical protein M404DRAFT_122495                   219   3e-69    
gb|AAW27023.1|  SJCHGC06275 protein                                     219   3e-69    
ref|XP_009045520.1|  hypothetical protein LOTGIDRAFT_110263             219   4e-69    
gb|KIP12260.1|  hypothetical protein PHLGIDRAFT_62130                   219   4e-69    
ref|XP_005643019.1|  ubiquitin-conjugating enzyme                       219   4e-69    
ref|XP_007361367.1|  ubiquitin-conjugating enzyme 9                     219   4e-69    
emb|CCD82677.1|  putative ubiquitin-conjugating enzyme E2 I             219   4e-69    
gb|ACO08653.1|  SUMO-1-conjugating enzyme UBC9                          219   5e-69    
gb|ADW82097.1|  SUMO-conjugating enzyme                                 219   5e-69    
ref|XP_003740914.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like       219   5e-69    
ref|NP_001268336.1|  SUMO-conjugating enzyme UBC9                       219   5e-69    
ref|XP_011006861.1|  PREDICTED: SUMO-conjugating enzyme SCE1 isof...    218   5e-69    
gb|ETS60172.1|  hypothetical protein PaG_05712                          222   6e-69    
ref|XP_011390864.1|  putative E2 SUMO-conjugating protein UBC9          218   7e-69    
gb|KIL00912.1|  hypothetical protein PAXRUDRAFT_128689                  218   7e-69    
emb|CDI55042.1|  probable ubiquitin--protein ligase hus5                218   7e-69    
gb|EYU44426.1|  hypothetical protein MIMGU_mgv1a0153482mg               217   7e-69    
ref|XP_003035299.1|  ubiquitin-conjugating enzyme 9                     218   8e-69    
gb|KIK46365.1|  hypothetical protein CY34DRAFT_800543                   218   9e-69    
ref|XP_006958337.1|  ubiquitin-conjugating enzyme                       218   9e-69    
emb|CCJ28847.1|  unnamed protein product                                218   9e-69    
ref|XP_001833174.2|  ubiquitin-conjugating enzyme9                      218   1e-68    
gb|KIJ69060.1|  hypothetical protein HYDPIDRAFT_105630                  218   1e-68    
dbj|GAC77593.1|  ubiquitin-protein ligase                               222   1e-68    
ref|XP_007874139.1|  hypothetical protein PNEG_02158                    218   1e-68    
gb|EFX81969.1|  hypothetical protein DAPPUDRAFT_230818                  218   1e-68    
ref|XP_003269093.2|  PREDICTED: uncharacterized protein LOC100583288    225   1e-68    
ref|XP_002116889.1|  hypothetical protein TRIADDRAFT_31624              218   1e-68    
gb|KII89155.1|  hypothetical protein PLICRDRAFT_160305                  218   2e-68    
gb|AFV69238.1|  ubiquitin-conjugating enzyme E2 UBC9                    218   2e-68    
gb|KJB39142.1|  hypothetical protein B456_007G216300                    216   2e-68    
emb|CDQ71070.1|  unnamed protein product                                229   2e-68    
gb|EDL22412.1|  mCG17660, isoform CRA_a                                 217   3e-68    
ref|XP_008036607.1|  ubiquitin-conjugating enzyme 9                     217   3e-68    
gb|EMS65589.1|  SUMO-conjugating enzyme SCE1                            218   3e-68    
gb|KDQ11641.1|  hypothetical protein BOTBODRAFT_35092                   217   3e-68    
gb|ENN74895.1|  hypothetical protein YQE_08473                          224   4e-68    
emb|CDI85656.1|  ubiquitin-conjugating enzyme e2, putative              218   4e-68    
gb|ENN74894.1|  hypothetical protein YQE_08473                          222   4e-68    
gb|EPS96806.1|  hypothetical protein FOMPIDRAFT_1025232                 216   5e-68    
emb|CDS11348.1|  Putative SUMO-conjugating enzyme ubc9                  216   5e-68    
emb|CBJ27032.1|  conserved unknown protein                              216   6e-68    
ref|NP_001119692.1|  lesswright                                         216   6e-68    
gb|KIO32572.1|  hypothetical protein M407DRAFT_105533                   216   6e-68    
gb|KIJ10477.1|  hypothetical protein PAXINDRAFT_172107                  216   6e-68    
emb|CBY43552.1|  unnamed protein product                                216   7e-68    
ref|XP_007264073.1|  ubiquitin-conjugating enzyme 9                     216   7e-68    
ref|XP_008694938.1|  PREDICTED: SUMO-conjugating enzyme UBC9            215   9e-68    
gb|KHN88730.1|  SUMO-conjugating enzyme UBC9                            216   9e-68    
ref|XP_003699980.1|  PREDICTED: uncharacterized protein LOC100881261    230   1e-67    
gb|AAC50603.1|  ubiquitin-conjugating enzyme 9 (UBC9)                   215   1e-67    
gb|EPY50814.1|  SUMO conjugating enzyme Hus5                            215   1e-67    
gb|KIM79640.1|  hypothetical protein PILCRDRAFT_823178                  215   2e-67    
ref|XP_007395516.1|  hypothetical protein PHACADRAFT_120280             215   2e-67    
ref|XP_007846103.1|  ubiquitin-conjugating enzyme 9                     215   2e-67    
gb|KIK31127.1|  hypothetical protein PISMIDRAFT_132723                  215   2e-67    
gb|EFN62617.1|  SUMO-conjugating enzyme UBC9                            228   3e-67    
gb|AET50682.1|  hypothetical protein                                    217   3e-67    
ref|XP_955236.1|  ubiquitin-conjugating enzyme (E2)                     214   4e-67    
ref|NP_001040407.1|  ubiquitin-conjugating enzyme E2                    214   4e-67    
gb|ACM50882.1|  E2 ubiquitin conjugating enzyme                         214   5e-67    
dbj|BAH72855.1|  ACYPI000084                                            214   5e-67    
emb|CDJ29851.1|  ubiquitin-conjugating enzyme e2, putative              215   7e-67    
gb|EUB62720.1|  SUMO-conjugating enzyme UBC9                            215   7e-67    
ref|XP_006368023.1|  PREDICTED: SUMO-conjugating enzyme SCE1-like       213   8e-67    
gb|EPX74695.1|  SUMO conjugating enzyme Hus5                            213   9e-67    
ref|XP_793891.1|  PREDICTED: SUMO-conjugating enzyme UBC9-like          213   1e-66    
emb|CDJ00005.1|  ubiquitin conjugating enzyme e2 i                      213   1e-66    
ref|XP_007877095.1|  hypothetical protein PFL1_01402                    213   1e-66    
emb|CDR98059.1|  -UMO-conjugating enzyme UBC9-B                         213   1e-66    
ref|XP_002173301.1|  SUMO conjugating enzyme Hus5                       213   1e-66    
emb|CCA66810.1|  probable ubiquitin--protein ligase hus5                212   2e-66    
ref|XP_007301022.1|  ubiquitin-conjugating enzyme 9                     212   2e-66    
ref|XP_002132550.1|  GA25892                                            212   3e-66    
emb|CDS29546.1|  ubiquitin conjugating enzyme e2 i                      212   3e-66    
ref|XP_001875349.1|  predicted protein                                  212   3e-66    
ref|NP_593204.1|  SUMO conjugating enzyme Hus5                          211   4e-66    
ref|XP_763568.1|  ubiquitin-conjugating enzyme                          211   4e-66    
ref|XP_003243970.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B-like     211   4e-66    
emb|CDR98039.1|  -SUMO-conjugating enzyme UBC9                          211   4e-66    
dbj|GAA99148.1|  hypothetical protein E5Q_05839                         211   5e-66    
gb|KJB39143.1|  hypothetical protein B456_007G216300                    210   5e-66    
gb|EMT31701.1|  Sumo-conjugating enzyme ubc9                            211   5e-66    
ref|XP_009542778.1|  hypothetical protein HETIRDRAFT_414959             211   6e-66    
emb|CDJ63826.1|  ubiquitin-conjugating enzyme e2, putative              213   6e-66    
pdb|4M1N|A  Chain A, Crystal Structure Of Plasmodium Falciparum U...    211   7e-66    
gb|KIM28763.1|  hypothetical protein M408DRAFT_329217                   211   7e-66    
ref|XP_002066723.1|  GK24638                                            211   7e-66    
emb|CDH59002.1|  ubiquitin-conjugating enzyme 9                         211   8e-66    
gb|KIK08740.1|  hypothetical protein K443DRAFT_672259                   211   9e-66    
gb|EGT43408.1|  hypothetical protein CAEBREN_17107                      211   1e-65    
emb|CDI81316.1|  ubiquitin-conjugating enzyme e2, putative              213   1e-65    
pdb|3RCZ|B  Chain B, Rad60 Sld2 Ubc9 Complex                            211   1e-65    
ref|XP_003879879.1|  ubiquitin carrier protein, related                 212   1e-65    
ref|XP_002258423.1|  Ubiquitin-conjugating enzyme                       210   1e-65    
gb|ELW67784.1|  BAI1-associated protein 3                               229   1e-65    
ref|XP_002634156.1|  C. briggsae CBR-UBC-9 protein                      210   1e-65    
emb|CDM27915.1|  SUMO-conjugating enzyme ubc9                           210   1e-65    
ref|XP_004403170.1|  PREDICTED: SUMO-conjugating enzyme UBC9 isof...    209   2e-65    
ref|XP_008887051.1|  ubiquitin-conjugating enzyme subfamily protein     212   2e-65    
ref|XP_001352023.1|  ubiquitin conjugating enzyme, putative             209   2e-65    
pdb|4JUE|A  Chain A, Crystal Structure Of Plasmodium Falciparum U...    209   2e-65    
ref|XP_003108197.1|  CRE-UBC-9 protein                                  210   2e-65    
ref|XP_001419699.1|  predicted protein                                  209   2e-65    
ref|XP_002369648.1|  ubiquitin-conjugating enzyme E2, putative          211   3e-65    
ref|XP_002565702.1|  Pc22g17930                                         209   3e-65    
ref|NP_001023158.1|  Protein UBC-9                                      209   3e-65    
gb|KIM48747.1|  hypothetical protein M413DRAFT_437924                   209   3e-65    
ref|XP_002014591.1|  GL19266                                            209   3e-65    
ref|XP_001732266.1|  hypothetical protein MGL_0041                      209   3e-65    
ref|XP_007337046.1|  ubiquitin-conjugating enzyme9                      209   3e-65    
ref|XP_001614687.1|  ubiquitin conjugating enzyme                       209   4e-65    
ref|XP_001947239.1|  PREDICTED: SUMO-conjugating enzyme UBC9-B-like     209   4e-65    
gb|EFX03658.1|  sumo conjugating enzyme                                 209   4e-65    
ref|XP_004832099.1|  ubiquitin-conjugating enzyme family member p...    209   5e-65    
emb|CDQ73278.1|  unnamed protein product                                209   5e-65    
gb|KEI38888.1|  hypothetical protein L969DRAFT_95055                    208   8e-65    
ref|XP_009691372.1|  ubiquitin carrier protein                          208   8e-65    
gb|KJB39144.1|  hypothetical protein B456_007G216300                    207   9e-65    
ref|XP_004348529.1|  ubiquitinconjugating enzyme, putative              207   1e-64    
ref|XP_572712.1|  ubiquitin-conjugating enzyme e2-18 kda                207   1e-64    
gb|EJY76190.1|  Ubiquitin conjugating enzyme, putative                  207   1e-64    
ref|XP_003195742.1|  ubiquitin-conjugating enzyme                       207   1e-64    
ref|XP_002675420.1|  predicted protein                                  207   1e-64    
ref|XP_007001189.1|  hypothetical protein TREMEDRAFT_58215              207   1e-64    
gb|KIR98527.1|  ubiquitin-conjugating enzyme E2 I                       207   2e-64    
ref|XP_004255836.1|  SUMO-conjugating enzyme UBC9, putative             207   2e-64    
gb|AFR97059.1|  ubiquitin-conjugating enzyme E2 I                       207   2e-64    
gb|ESA11669.1|  hypothetical protein GLOINDRAFT_347677                  207   2e-64    
emb|CDJ48680.1|  ubiquitin-conjugating enzyme e2, putative              209   2e-64    
ref|XP_001609154.1|  ubiquitin conjugating enzyme                       207   3e-64    
ref|XP_007418932.1|  hypothetical protein MELLADRAFT_114055             207   3e-64    
ref|XP_003717980.1|  SUMO-conjugating enzyme ubc9                       207   3e-64    
gb|KGO68463.1|  Ubiquitin-conjugating enzyme, E2                        207   3e-64    
ref|XP_008625160.1|  SUMO-conjugating enzyme UBC9                       207   3e-64    
gb|EJU05640.1|  ubiquitin-conjugating enzyme                            207   3e-64    
ref|XP_001949992.2|  PREDICTED: SUMO-conjugating enzyme UBC9-B-like     206   4e-64    
emb|CDJ60382.1|  ubiquitin-conjugating enzyme e2, putative              209   4e-64    
gb|ESA17705.1|  hypothetical protein GLOINDRAFT_344968                  206   4e-64    
ref|XP_005848868.1|  hypothetical protein CHLNCDRAFT_144242             206   5e-64    
ref|XP_002785759.1|  SUMO-conjugating enzyme ubc9, putative             206   6e-64    
gb|ENH81712.1|  sumo conjugating enzyme                                 206   6e-64    
ref|XP_001214722.1|  ubiquitin-conjugating enzyme E2-18 kDa             206   6e-64    



>ref|XP_004511894.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Cicer arietinum]
Length=159

 Score =   322 bits (826),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/159 (95%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRLAEERK+WRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG YPL
Sbjct  1    MSGIARGRLAEERKSWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYYPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL
Sbjct  61   TMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            DQPNPADPAQTEGYHLFIQD VEYKRRV+QQAKQYPPL+
Sbjct  121  DQPNPADPAQTEGYHLFIQDVVEYKRRVKQQAKQYPPLL  159



>dbj|BAJ53199.1| JHL03K20.8 [Jatropha curcas]
 gb|KDP31974.1| hypothetical protein JCGZ_12435 [Jatropha curcas]
Length=160

 Score =   322 bits (824),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GG+ARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MSGGVARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD  EYK+RVRQQAKQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDGAEYKKRVRQQAKQYPPLV  160



>ref|XP_007155902.1| hypothetical protein PHAVU_003G241600g [Phaseolus vulgaris]
 gb|ESW27896.1| hypothetical protein PHAVU_003G241600g [Phaseolus vulgaris]
Length=160

 Score =   321 bits (823),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERK+WRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MSGGIARGRLTEERKSWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ+FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQSFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYPPL+
Sbjct  121  LDQPNPADPAQTEGYHLFIQDATEYKRRVRQQAKQYPPLL  160



>ref|XP_010093513.1| SUMO-conjugating enzyme SCE1 [Morus notabilis]
 gb|EXB54179.1| SUMO-conjugating enzyme SCE1 [Morus notabilis]
Length=160

 Score =   321 bits (822),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK+WRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKSWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD VEYK+RVR QAKQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDAVEYKKRVRVQAKQYPPLV  160



>ref|XP_004288010.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Fragaria vesca subsp. 
vesca]
Length=160

 Score =   320 bits (821),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK+WRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKSWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPANFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNP+DPAQTEGYHLFIQD+ EYKRRVRQQAKQYPPLV
Sbjct  121  LDQPNPSDPAQTEGYHLFIQDSTEYKRRVRQQAKQYPPLV  160



>gb|KJB39148.1| hypothetical protein B456_007G216300 [Gossypium raimondii]
Length=160

 Score =   320 bits (821),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  121  LDAPNPADPAQTEGYHLFIQDANEYKRRVRQQAKQYPPLV  160



>ref|XP_007156772.1| hypothetical protein PHAVU_002G016300g [Phaseolus vulgaris]
 ref|XP_007156773.1| hypothetical protein PHAVU_002G016300g [Phaseolus vulgaris]
 gb|ESW28766.1| hypothetical protein PHAVU_002G016300g [Phaseolus vulgaris]
 gb|ESW28767.1| hypothetical protein PHAVU_002G016300g [Phaseolus vulgaris]
Length=159

 Score =   320 bits (820),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 150/159 (94%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRLAEERK+WRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +PL
Sbjct  1    MSGIARGRLAEERKSWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGYFPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL
Sbjct  61   TMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            DQPNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  121  DQPNPADPAQTEGYHLFIQDATEYKRRVRQQAKQYPPLV  159



>ref|XP_003517314.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X1 [Glycine 
max]
 ref|XP_006573646.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Glycine 
max]
 gb|KHN36251.1| SUMO-conjugating enzyme SCE1 [Glycine soja]
Length=159

 Score =   319 bits (818),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRLAEERK+WRKNHPHGFVAKPETLPD TVNLMVWHCTIPGKAGTDWEGG +PL
Sbjct  1    MSGIARGRLAEERKSWRKNHPHGFVAKPETLPDATVNLMVWHCTIPGKAGTDWEGGYFPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL
Sbjct  61   TMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            DQPNPADPAQTEGYHLFIQD  EYKRRVRQQ+KQYPPLV
Sbjct  121  DQPNPADPAQTEGYHLFIQDAAEYKRRVRQQSKQYPPLV  159



>ref|XP_006590254.1| PREDICTED: uncharacterized protein LOC100305922 isoform X1 [Glycine 
max]
 ref|XP_006590255.1| PREDICTED: uncharacterized protein LOC100305922 isoform X2 [Glycine 
max]
 gb|KHN42102.1| SUMO-conjugating enzyme SCE1 [Glycine soja]
Length=159

 Score =   319 bits (818),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRLAEERK+WRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +PL
Sbjct  1    MSGIARGRLAEERKSWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGYFPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL
Sbjct  61   TMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            DQPNPADPAQTEGYHLFIQD  EYKRRVRQQ+KQYPPLV
Sbjct  121  DQPNPADPAQTEGYHLFIQDAAEYKRRVRQQSKQYPPLV  159



>gb|AFK39856.1| unknown [Lotus japonicus]
Length=160

 Score =   319 bits (817),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK+WRKNHPHGFVAKPET PDGTVN+MVWHCTIPGK GTDWE G YP
Sbjct  1    MSGGIARGRLAEERKSWRKNHPHGFVAKPETQPDGTVNMMVWHCTIPGKTGTDWENGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDATEYKRRVRQQAKQYPPLV  160



>ref|NP_001235590.1| uncharacterized protein LOC100500268 [Glycine max]
 ref|XP_003524642.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Glycine max]
 gb|ACU15291.1| unknown [Glycine max]
 gb|KHN08823.1| SUMO-conjugating enzyme SCE1 [Glycine soja]
 gb|KHN15642.1| SUMO-conjugating enzyme SCE1 [Glycine soja]
Length=160

 Score =   319 bits (817),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERK+WRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLTEERKSWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYPPL+
Sbjct  121  LDQPNPADPAQTEGYHLFIQDAAEYKRRVRQQAKQYPPLL  160



>emb|CDP02519.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   319 bits (817),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERKAWRKNHPHGFVAKPETLPDG+VNLMVWHCTIPGK GTDWEGG+YP
Sbjct  1    MSGGIARGRLTEERKAWRKNHPHGFVAKPETLPDGSVNLMVWHCTIPGKPGTDWEGGSYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD +EYK+RVRQQAKQYPPL+
Sbjct  121  LDQPNPADPAQTDGYHLFIQDALEYKKRVRQQAKQYPPLI  160



>ref|XP_007047350.1| Sumo conjugation enzyme 1 [Theobroma cacao]
 gb|EOX91507.1| Sumo conjugation enzyme 1 [Theobroma cacao]
Length=160

 Score =   318 bits (815),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/160 (94%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLQDGTVNLMVWHCTIPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  121  LDAPNPADPAQTEGYHLFIQDANEYKRRVRQQAKQYPPLV  160



>ref|NP_001234980.1| uncharacterized protein LOC100305922 [Glycine max]
 gb|ACU13836.1| unknown [Glycine max]
Length=159

 Score =   318 bits (814),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRLAEERK WRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +PL
Sbjct  1    MSGIARGRLAEERKPWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGYFPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL
Sbjct  61   TMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            DQPNPADPAQTEGYHLFIQD  EYKRRVRQQ+KQYPPLV
Sbjct  121  DQPNPADPAQTEGYHLFIQDAAEYKRRVRQQSKQYPPLV  159



>ref|XP_006425960.1| hypothetical protein CICLE_v10026671mg [Citrus clementina]
 ref|XP_006494471.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Citrus sinensis]
 gb|ESR39200.1| hypothetical protein CICLE_v10026671mg [Citrus clementina]
 gb|KDO79110.1| hypothetical protein CISIN_1g031379mg [Citrus sinensis]
Length=160

 Score =   317 bits (812),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK+WRKNHPHGFVAKPETLPDG+VNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKSWRKNHPHGFVAKPETLPDGSVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYP L+
Sbjct  121  LDQPNPADPAQTEGYHLFIQDAAEYKRRVRQQAKQYPALL  160



>emb|CAE45567.1| SUMO E2 conjugating enzyme SCE1 [Nicotiana benthamiana]
Length=160

 Score =   317 bits (812),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DG+VNLMVWHC+IPGKAGTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLSDGSVNLMVWHCSIPGKAGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   VTIHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD +EYK+RVR QAKQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDAIEYKKRVRLQAKQYPPLV  160



>ref|XP_009367435.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Pyrus x bretschneideri]
Length=160

 Score =   317 bits (812),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD  EYK+RVRQQ+KQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDATEYKKRVRQQSKQYPPLV  160



>ref|XP_009389843.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   317 bits (811),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK+WRKNHPHGFVAKPETLPDG+VNLM+WHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKSWRKNHPHGFVAKPETLPDGSVNLMIWHCTIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPAEYKRRVRQQAKQYPPLV  160



>ref|XP_009385926.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Musa acuminata 
subsp. malaccensis]
Length=160

 Score =   316 bits (810),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDG+VNLM WHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGSVNLMTWHCTIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTVHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD VEYKRRVRQQAKQYPPL+
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPVEYKRRVRQQAKQYPPLL  160



>ref|XP_008783454.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Phoenix dactylifera]
Length=160

 Score =   316 bits (810),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWR+NHPHGFVAKPETLPDG+VNLM+WHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRRNHPHGFVAKPETLPDGSVNLMIWHCTIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVRQQAKQYPPL+
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPAEYKRRVRQQAKQYPPLI  160



>ref|XP_011097247.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Sesamum indicum]
Length=160

 Score =   316 bits (810),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 150/160 (94%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPE LPDGTVNLMVW CTIPGKAGTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPEYLPDGTVNLMVWQCTIPGKAGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            L QPNPADPAQTEGYH+FIQD VEY +RVRQQAKQYPPLV
Sbjct  121  LGQPNPADPAQTEGYHMFIQDEVEYGKRVRQQAKQYPPLV  160



>ref|XP_007206053.1| hypothetical protein PRUPE_ppa012626mg [Prunus persica]
 gb|EMJ07252.1| hypothetical protein PRUPE_ppa012626mg [Prunus persica]
Length=160

 Score =   316 bits (809),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DGTVNLMVWHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLSDGTVNLMVWHCTIPGKTGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD  EYK+RVRQQAKQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDATEYKKRVRQQAKQYPPLV  160



>ref|XP_008338336.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Malus domestica]
 ref|XP_009372432.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Pyrus x bretschneideri]
Length=160

 Score =   316 bits (809),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKTGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD  EYK+RVRQQ++QYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDATEYKKRVRQQSRQYPPLV  160



>ref|XP_008809080.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Phoenix dactylifera]
 ref|XP_008809081.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Phoenix dactylifera]
 ref|XP_008809083.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Phoenix dactylifera]
 ref|XP_008809084.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Phoenix dactylifera]
 ref|XP_008809085.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Phoenix dactylifera]
Length=160

 Score =   315 bits (808),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDG+VNLMVWHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGSVNLMVWHCTIPGKLGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  121  LDLPNPADPAQTDGYHLFIQDPAEYKRRVRQQAKQYPPLV  160



>ref|XP_004151860.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Cucumis sativus]
 ref|XP_008462833.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Cucumis melo]
 gb|KGN63318.1| hypothetical protein Csa_2G428410 [Cucumis sativus]
Length=160

 Score =   315 bits (808),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK+WRKNHPHGFVAKPET+PDGTVNLM+WHC IPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKSWRKNHPHGFVAKPETMPDGTVNLMIWHCIIPGKVGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPPKC+FPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLNFSEDYPSKPPKCRFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD VEYK+RVRQQAKQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDAVEYKKRVRQQAKQYPPLV  160



>ref|XP_009783412.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Nicotiana sylvestris]
Length=160

 Score =   315 bits (808),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DG+VNLMVWHC+IPGK GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLSDGSVNLMVWHCSIPGKTGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   VTIHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD +EYK+RVR QAKQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDAIEYKKRVRLQAKQYPPLV  160



>gb|KHG02093.1| SUMO-conjugating enzyme SCE1 -like protein [Gossypium arboreum]
 gb|KJB39147.1| hypothetical protein B456_007G216300 [Gossypium raimondii]
Length=163

 Score =   315 bits (807),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 154/163 (94%), Gaps = 3/163 (2%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPH---GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG  229
            M GGIARGRLAEERKAWRKNHPH   GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHVRGGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG  60

Query  230  NYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGI  409
             +PLT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GI
Sbjct  61   YFPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGI  120

Query  410  QDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QDLLD PNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  121  QDLLDAPNPADPAQTEGYHLFIQDANEYKRRVRQQAKQYPPLV  163



>ref|XP_004509116.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Cicer arietinum]
Length=159

 Score =   314 bits (804),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRL EERK+WRKNHPHGFVAKPETLPDG+VNLM+WHCTIPGK+GTDWEGG +PL
Sbjct  1    MSGIARGRLTEERKSWRKNHPHGFVAKPETLPDGSVNLMIWHCTIPGKSGTDWEGGYFPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL
Sbjct  61   TLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            DQPNPADPAQTEGYHLFIQDT EYKRRVR QAKQYPPL+
Sbjct  121  DQPNPADPAQTEGYHLFIQDTTEYKRRVRLQAKQYPPLL  159



>ref|XP_009615424.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Nicotiana tomentosiformis]
Length=160

 Score =   314 bits (804),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DG+VNLM WHC+IPGK GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLSDGSVNLMAWHCSIPGKTGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   VTIHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD +EYK+RVR QAKQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDAIEYKKRVRLQAKQYPPLV  160



>ref|XP_011099107.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Sesamum indicum]
Length=160

 Score =   314 bits (804),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG YP
Sbjct  1    MSGGIARGRLTEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKPGTDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            L QPN +DPAQTEGYHLFIQD+VEY +RVR QAKQYPPLV
Sbjct  121  LVQPNASDPAQTEGYHLFIQDSVEYNKRVRSQAKQYPPLV  160



>ref|XP_009781499.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana sylvestris]
Length=160

 Score =   314 bits (804),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDG+VNLMVWHCTIPGK GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGSVNLMVWHCTIPGKTGTDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTVHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD +EY++RVR Q+KQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDALEYRKRVRLQSKQYPPLV  160



>emb|CAN61018.1| hypothetical protein VITISV_001138 [Vitis vinifera]
Length=160

 Score =   314 bits (804),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GY LFIQ+  EYKRRVRQQAKQYPPLV
Sbjct  121  LDQPNPADPAQTDGYQLFIQEPAEYKRRVRQQAKQYPPLV  160



>ref|XP_002468614.1| hypothetical protein SORBIDRAFT_01g049010 [Sorghum bicolor]
 ref|XP_004985918.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Setaria italica]
 gb|EER95612.1| hypothetical protein SORBIDRAFT_01g049010 [Sorghum bicolor]
Length=160

 Score =   314 bits (804),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLM+WHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMIWHCTIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVR QAKQYP LV
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPTEYKRRVRLQAKQYPALV  160



>ref|XP_002307279.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 ref|XP_011006860.1| PREDICTED: SUMO-conjugating enzyme SCE1 isoform X1 [Populus euphratica]
 emb|CAD29823.2| putative ubiquitin-conjugating enzyme [Populus x canadensis]
 gb|ABK93309.1| unknown [Populus trichocarpa]
 gb|EEE94275.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
Length=160

 Score =   313 bits (803),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK+WRKNHPHGFVAKPET PDGTVNLMVWHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKSWRKNHPHGFVAKPETQPDGTVNLMVWHCTIPGKLGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLNFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD  EYK+RVRQQAKQYP LV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDAAEYKKRVRQQAKQYPSLV  160



>ref|XP_004234662.1| PREDICTED: SUMO-conjugating enzyme SCE1 isoform X2 [Solanum lycopersicum]
Length=160

 Score =   313 bits (803),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERKAWR+NHPHGFVAKPETLPDG+VNLMVWHC+IPGK GTDWEGG YP
Sbjct  1    MSAGIARGRLAEERKAWRRNHPHGFVAKPETLPDGSVNLMVWHCSIPGKTGTDWEGGCYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   VTIHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD +EYK+RV+ QAKQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDAIEYKKRVKLQAKQYPPLV  160



>ref|NP_001274896.1| SUMO-conjugating enzyme SCE1-like [Solanum tuberosum]
 gb|AFX66975.1| SUMO E2 conjugating enzyme SCE1 [Solanum tuberosum]
Length=160

 Score =   313 bits (802),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERKAWRKNHPHGFVAKPETLPDG+VNLMVWHC+IPGK GTDWEGG YP
Sbjct  1    MSAGIARGRLAEERKAWRKNHPHGFVAKPETLPDGSVNLMVWHCSIPGKTGTDWEGGCYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   VTIHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD +EYK+R + QAKQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDAIEYKKRAKLQAKQYPPLV  160



>ref|XP_002283130.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Vitis vinifera]
 emb|CBI21382.3| unnamed protein product [Vitis vinifera]
Length=162

 Score =   313 bits (802),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRL EERKAWRKNHPHGFVAKPETLPDG VNLMVW CTIPGK GTDWEGG +P
Sbjct  1    MSAGIARGRLMEERKAWRKNHPHGFVAKPETLPDGQVNLMVWQCTIPGKPGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHLFIQDAAEYKRRVRQQAKQYPPLV  160



>ref|XP_010934002.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Elaeis guineensis]
Length=160

 Score =   313 bits (802),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DG+VNLMVW+CTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLADGSVNLMVWNCTIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNP+DPAQT+GYHLFIQD  EY+RRVRQQAKQYPPLV
Sbjct  121  LDQPNPSDPAQTDGYHLFIQDLTEYRRRVRQQAKQYPPLV  160



>ref|XP_010270683.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Nelumbo nucifera]
Length=160

 Score =   313 bits (802),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKPGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +++ FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   ISLQFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQ+  EYKRRVRQQAKQYPPLV
Sbjct  121  LDQPNPADPAQTDGYHLFIQEPAEYKRRVRQQAKQYPPLV  160



>ref|NP_001048802.1| Os03g0123100 [Oryza sativa Japonica Group]
 gb|AAN74837.1| Putative ubiquitin-conjugating enzyme [Oryza sativa Japonica 
Group]
 gb|ABF93717.1| Ubiquitin-conjugating enzyme E2 I, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10716.1| Os03g0123100 [Oryza sativa Japonica Group]
 gb|EAY88329.1| hypothetical protein OsI_09788 [Oryza sativa Indica Group]
 gb|EAZ25409.1| hypothetical protein OsJ_09225 [Oryza sativa Japonica Group]
 dbj|BAG88233.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=160

 Score =   313 bits (802),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DGTVNLM+WHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLADGTVNLMIWHCTIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVR QAKQYPP+V
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPTEYKRRVRLQAKQYPPIV  160



>ref|XP_003558940.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Brachypodium distachyon]
Length=160

 Score =   313 bits (801),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DGTVNLMVWHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLGDGTVNLMVWHCTIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLNFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRR+R QAKQYPPLV
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPTEYKRRIRLQAKQYPPLV  160



>ref|XP_010070565.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Eucalyptus grandis]
Length=159

 Score =   313 bits (801),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRL EERKAWRKNHPHGFVAKPETLPDGTVNLM+WHC IPGKAGTDWEGG YPL
Sbjct  1    MSGIARGRLTEERKAWRKNHPHGFVAKPETLPDGTVNLMIWHCIIPGKAGTDWEGGFYPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL
Sbjct  61   TLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            DQPNPADPAQTEGYHLFIQD  EYK+RVR QAKQYP L+
Sbjct  121  DQPNPADPAQTEGYHLFIQDVTEYKKRVRMQAKQYPSLI  159



>ref|XP_006649299.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Oryza brachyantha]
Length=160

 Score =   312 bits (800),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET+ DGTVNLM+WHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETMADGTVNLMIWHCTIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVR QAKQYPP+V
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPTEYKRRVRLQAKQYPPIV  160



>ref|XP_002284949.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Vitis vinifera]
 emb|CBI19485.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   312 bits (799),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPN ADPAQT+GY LFIQ+  EYKRRVRQQAKQYPPLV
Sbjct  121  LDQPNAADPAQTDGYQLFIQEPAEYKRRVRQQAKQYPPLV  160



>ref|NP_001149113.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 gb|ACG34242.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 gb|AFW89763.1| putative ubiquitin-conjugating enzyme family [Zea mays]
Length=160

 Score =   311 bits (798),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPE+LPDGTVNLM+WHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPESLPDGTVNLMIWHCTIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRV+ QAKQYP LV
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPTEYKRRVKLQAKQYPALV  160



>ref|XP_010927156.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Elaeis guineensis]
Length=160

 Score =   311 bits (798),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/160 (92%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DG+VNLMVWHCTIPGK GTDW+GG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLSDGSVNLMVWHCTIPGKQGTDWDGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPAEYKRRVRQQAKQYPPLV  160



>ref|XP_010263454.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nelumbo nucifera]
Length=160

 Score =   311 bits (797),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDG+VNLMVW+CTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGSVNLMVWNCTIPGKPGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   ITLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GY LFIQ+  EYKRRVRQQAKQYPPLV
Sbjct  121  LDQPNPADPAQTDGYQLFIQEPAEYKRRVRQQAKQYPPLV  160



>emb|CDP01300.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   311 bits (797),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPE+  DG+VNLMVWHCTIPGKAGTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPESGADGSVNLMVWHCTIPGKAGTDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGY +++Q+  EYKRRVRQQAKQYPP+V
Sbjct  121  LDQPNPADPAQTEGYQMYMQEPAEYKRRVRQQAKQYPPIV  160



>ref|XP_004231867.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Solanum lycopersicum]
Length=160

 Score =   311 bits (797),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDG+VNLM+WHCTIPGKA TDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGSVNLMIWHCTIPGKAETDWEGGCYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTIHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYH+FIQD +EY++RVR Q+KQYPPLV
Sbjct  121  LDQPNPADPAQTEGYHMFIQDVLEYRKRVRLQSKQYPPLV  160



>ref|XP_008650364.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Zea mays]
 gb|ACG24785.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 gb|ACG37840.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 tpg|DAA43022.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=160

 Score =   311 bits (796),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPE+LPDGTVNLM+W CTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPESLPDGTVNLMIWQCTIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVR QAKQYP LV
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPTEYKRRVRLQAKQYPALV  160



>ref|XP_009390474.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=160

 Score =   310 bits (795),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DGTVNLM+WHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLADGTVNLMIWHCTIPGKPGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPPKC+FPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLYFSEDYPSKPPKCRFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EY+RRVRQQAKQYP LV
Sbjct  121  LDQPNPADPAQTDGYHLFIQDLEEYRRRVRQQAKQYPALV  160



>ref|XP_010919083.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Elaeis guineensis]
Length=160

 Score =   310 bits (795),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DG+VNLMVW+C IPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLHDGSVNLMVWNCIIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVRQQAKQYPPL+
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPAEYKRRVRQQAKQYPPLI  160



>ref|XP_009599931.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana tomentosiformis]
Length=160

 Score =   310 bits (794),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DG+VNLMVWHCTIPGK GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLTDGSVNLMVWHCTIPGKTGTDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDL
Sbjct  61   LTIHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQTEGYHLFIQD +EY++RVR Q+KQYPP+V
Sbjct  121  LDQPNPADPAQTEGYHLFIQDALEYRKRVRLQSKQYPPIV  160



>ref|XP_009139007.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Brassica rapa]
 emb|CDX88967.1| BnaA04g02190D [Brassica napus]
Length=160

 Score =   310 bits (794),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  121  LDTPNPADPAQTDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>ref|XP_009606595.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana tomentosiformis]
Length=160

 Score =   310 bits (794),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET PDG+VNLMVWHC+IPGK GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETGPDGSVNLMVWHCSIPGKTGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +TMHFSEDYPSKPPKCKFPQ FFHPN+YPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   ITMHFSEDYPSKPPKCKFPQGFFHPNIYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNP DPAQT+GY L++QDT EYKRRVRQQAKQYP L+
Sbjct  121  LDQPNPNDPAQTDGYQLYMQDTAEYKRRVRQQAKQYPALI  160



>ref|XP_003611678.1| SUMO-conjugating enzyme UBC9 [Medicago truncatula]
 gb|AES94636.1| ubiquitin-conjugating enzyme [Medicago truncatula]
 gb|AFK34870.1| unknown [Medicago truncatula]
Length=159

 Score =   310 bits (793),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRLAEERK+WRKNHPHGFVAKPET PDGT+NLM WHC+IPGKAGTDWEGG YPL
Sbjct  1    MSGIARGRLAEERKSWRKNHPHGFVAKPETNPDGTINLMAWHCSIPGKAGTDWEGGYYPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TM FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLL
Sbjct  61   TMVFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            DQPNPADPAQTEGYHLFIQD VEYKRRV+QQAKQYP ++
Sbjct  121  DQPNPADPAQTEGYHLFIQDAVEYKRRVKQQAKQYPSII  159



>gb|ACJ83979.1| unknown [Medicago truncatula]
 gb|AFK49507.1| unknown [Medicago truncatula]
 gb|KEH31466.1| ubiquitin-conjugating enzyme [Medicago truncatula]
Length=159

 Score =   310 bits (793),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRL EERK+WRKNHPHGFVAKPET  DG+VNLM+WHCTIPGKAGTDWEGG +PL
Sbjct  1    MSGIARGRLTEERKSWRKNHPHGFVAKPETAADGSVNLMIWHCTIPGKAGTDWEGGYFPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL
Sbjct  61   TLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            DQPNPADPAQTEGYHLFIQDT EYKRRVR QAKQYP +V
Sbjct  121  DQPNPADPAQTEGYHLFIQDTTEYKRRVRLQAKQYPSIV  159



>ref|XP_010548072.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Tarenaya hassleriana]
Length=160

 Score =   310 bits (793),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERKAWRKNHPHGFVAKPETLPDGT NLMVW C IPGK+GTDWEGG +P
Sbjct  1    MASGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTCNLMVWQCIIPGKSGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            L MHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAI+VKQILVGIQDL
Sbjct  61   LAMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAISVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKR+VRQQAKQYPP+V
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPAEYKRKVRQQAKQYPPIV  160



>gb|ACG45477.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
Length=160

 Score =   309 bits (792),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPE+LPDGTVNLM+W CTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPESLPDGTVNLMIWQCTIPGKQGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNP DPAQT+GYHLFIQD  EYKRRVR QAKQYP LV
Sbjct  121  LDQPNPVDPAQTDGYHLFIQDPTEYKRRVRLQAKQYPALV  160



>ref|XP_010524335.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Tarenaya hassleriana]
Length=160

 Score =   309 bits (791),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERKAWRKNHPHGFVAKPET PDGT NLMVW CTIPGK GTDWEGG +P
Sbjct  1    MASGIARGRLAEERKAWRKNHPHGFVAKPETSPDGTCNLMVWQCTIPGKPGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVRQQAKQYPP++
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPAEYKRRVRQQAKQYPPIL  160



>gb|ADP37981.1| ubiquitin-protein ligase [Brassica napus]
Length=160

 Score =   308 bits (790),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITV+QILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVEQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  121  LDTPNPADPAQTDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>emb|CDY47661.1| BnaC04g23980D [Brassica napus]
Length=160

 Score =   308 bits (789),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLFIQD VEYK+RV+ Q KQYPP+V
Sbjct  121  LDTPNPADPAQTDGYHLFIQDAVEYKKRVKLQYKQYPPIV  160



>gb|ABG79538.1| putative E2 SUMO conjugating enzyme [Triticum turgidum subsp. 
durum]
Length=161

 Score =   308 bits (789),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRLAEERKAWRKNHPHGFVAKPETL DGTVNLMVWHCTIPGK GTDWEGG +PLT
Sbjct  4    GGIARGRLAEERKAWRKNHPHGFVAKPETLGDGTVNLMVWHCTIPGKQGTDWEGGYFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD
Sbjct  64   LHFSEDYPSKPPKCKFPTNFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  123

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNPADPAQT+GYHLFIQD  EYKRRVR QAKQYP LV
Sbjct  124  QPNPADPAQTDGYHLFIQDPAEYKRRVRAQAKQYPALV  161



>ref|XP_004983815.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Setaria italica]
Length=160

 Score =   308 bits (789),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVA+PETL DG+ NLM+W+CTIPGK GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVARPETLADGSANLMIWNCTIPGKQGTDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVR QAKQYP LV
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPAEYKRRVRLQAKQYPALV  160



>gb|EMS60436.1| SUMO-conjugating enzyme SCE1 [Triticum urartu]
Length=161

 Score =   308 bits (788),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRLAEERKAWRKNHPHGFVAKPETL DGTVNLMVWHCTIPGK GTDWEGG +PLT
Sbjct  4    GGIARGRLAEERKAWRKNHPHGFVAKPETLGDGTVNLMVWHCTIPGKQGTDWEGGYFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD
Sbjct  64   LHFSEDYPSKPPKCKFPTNFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  123

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNPADPAQT+GYHLFIQD  EYKRRVR QAKQYP LV
Sbjct  124  QPNPADPAQTDGYHLFIQDPAEYKRRVRVQAKQYPALV  161



>ref|XP_006855190.1| hypothetical protein AMTR_s00051p00153990 [Amborella trichopoda]
 gb|ERN16657.1| hypothetical protein AMTR_s00051p00153990 [Amborella trichopoda]
Length=160

 Score =   308 bits (788),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDG+VNLMVW CTIPGK  TDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGSVNLMVWQCTIPGKQATDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +T+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   ITLHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQ+  EYKRRVRQQAKQYPPL+
Sbjct  121  LDQPNPADPAQTDGYHLFIQEPAEYKRRVRQQAKQYPPLL  160



>emb|CDY70581.1| BnaAnng34240D [Brassica napus]
Length=160

 Score =   308 bits (788),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPETL DG+VNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETLTDGSVNLMVWHCTIPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  121  LDTPNPADPAQTDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>ref|NP_001065167.1| Os10g0536000 [Oryza sativa Japonica Group]
 gb|AAL58113.1|AC092697_1 putative ubiquitin-conjugating enzyme [Oryza sativa Japonica 
Group]
 gb|AAP54809.1| Ubiquitin-conjugating enzyme E2 I, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27081.1| Os10g0536000 [Oryza sativa Japonica Group]
 dbj|BAG97144.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00378.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67364.1| hypothetical protein OsI_34467 [Oryza sativa Indica Group]
 gb|EEE51317.1| hypothetical protein OsJ_32281 [Oryza sativa Japonica Group]
Length=160

 Score =   307 bits (787),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET+ DG+ NLM+WHCTIPGK GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETMADGSANLMIWHCTIPGKQGTDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYH+FIQD  EYKRRVR QAKQYP L+
Sbjct  121  LDQPNPADPAQTDGYHIFIQDKPEYKRRVRVQAKQYPALL  160



>ref|XP_009793052.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana sylvestris]
Length=160

 Score =   307 bits (787),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET PDG+VNLMVWHC+IPGK GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETGPDGSVNLMVWHCSIPGKTGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +TMHFSEDYPSKPPKCKFPQ FFHPN+YPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   ITMHFSEDYPSKPPKCKFPQGFFHPNIYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNP DPAQT+GY L++QDT EYKRRVR QAKQYP L+
Sbjct  121  LDQPNPNDPAQTDGYQLYMQDTAEYKRRVRHQAKQYPALI  160



>gb|KFK35081.1| hypothetical protein AALP_AA5G232800 [Arabis alpina]
Length=160

 Score =   307 bits (786),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  121  LDTPNPADPAQTDGYHLFIQDPVEYKKRVKLQSKQYPPVV  160



>ref|XP_009104077.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Brassica rapa]
 emb|CDX98253.1| BnaC06g16140D [Brassica napus]
 emb|CDX67711.1| BnaA07g17510D [Brassica napus]
Length=160

 Score =   307 bits (786),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGPDGSVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  121  LDTPNPADPAQTDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>ref|XP_006402833.1| hypothetical protein EUTSA_v10006282mg [Eutrema salsugineum]
 gb|ESQ44286.1| hypothetical protein EUTSA_v10006282mg [Eutrema salsugineum]
Length=160

 Score =   307 bits (786),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLFIQD  EYK+RV+ Q+KQYPP+V
Sbjct  121  LDTPNPADPAQTDGYHLFIQDAAEYKKRVKLQSKQYPPIV  160



>ref|XP_002465018.1| hypothetical protein SORBIDRAFT_01g030580 [Sorghum bicolor]
 gb|EER92016.1| hypothetical protein SORBIDRAFT_01g030580 [Sorghum bicolor]
Length=160

 Score =   306 bits (785),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVA+PETL DG+ NLMVW+CTIPGK GTDWE G YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVARPETLADGSANLMVWNCTIPGKQGTDWESGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVR QAKQYP LV
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPAEYKRRVRLQAKQYPALV  160



>gb|AFK40127.1| unknown [Lotus japonicus]
Length=159

 Score =   306 bits (784),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 141/159 (89%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRL EERK+WRKNHPHGFVAKPETL DGT+NLMVWHCTIPGK GTDW+GG +PL
Sbjct  1    MAGIARGRLTEERKSWRKNHPHGFVAKPETLSDGTINLMVWHCTIPGKTGTDWDGGYFPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL
Sbjct  61   TLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            DQPNPADPAQTEGYHLFIQD  EYKRRV+QQ K +PPLV
Sbjct  121  DQPNPADPAQTEGYHLFIQDVAEYKRRVQQQTKLFPPLV  159



>ref|XP_008657947.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Zea mays]
 tpg|DAA46073.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=160

 Score =   306 bits (784),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVA+PETL DG+ NLMVW CTIPGK GTDWE G YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVARPETLADGSANLMVWSCTIPGKQGTDWESGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVR QAKQYP LV
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPTEYKRRVRLQAKQYPALV  160



>gb|ABK23443.1| unknown [Picea sitchensis]
Length=160

 Score =   305 bits (782),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVA+P+T PDG++NLMVW C IPGK+GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVARPDTQPDGSLNLMVWQCIIPGKSGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDL
Sbjct  61   LTINFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNP DPAQT+GYHLFIQD  EYKRRVRQQAKQYPPLV
Sbjct  121  LDQPNPGDPAQTDGYHLFIQDLTEYKRRVRQQAKQYPPLV  160



>ref|XP_008660103.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Zea mays]
 gb|AFW88190.1| putative ubiquitin-conjugating enzyme family isoform 1 [Zea mays]
 gb|AFW88191.1| putative ubiquitin-conjugating enzyme family isoform 2 [Zea mays]
Length=160

 Score =   305 bits (781),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVA+PE+L DG+VNLMVW+CTIPGK GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVARPESLTDGSVNLMVWNCTIPGKHGTDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDS WRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSDWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYHLFIQD  EYKRRVR QAKQYP LV
Sbjct  121  LDQPNPADPAQTDGYHLFIQDPAEYKRRVRLQAKQYPALV  160



>ref|XP_009116485.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Brassica rapa]
Length=160

 Score =   305 bits (780),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET  DG+VNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGTDGSVNLMVWHCTIPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  121  LDTPNPADPAQTDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>dbj|BAJ86881.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   305 bits (780),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRLAEERKAWRKNHPHGFVAKPET+ DG+VNLM+W+CTIPGK GTDWE G YPLT
Sbjct  4    GGIARGRLAEERKAWRKNHPHGFVAKPETMADGSVNLMIWNCTIPGKQGTDWESGYYPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD
Sbjct  64   LHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  123

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNPADPAQT+GYHLFIQD  EY+RR+R QAKQYP LV
Sbjct  124  QPNPADPAQTDGYHLFIQDPAEYRRRIRLQAKQYPALV  161



>ref|XP_006291969.1| hypothetical protein CARUB_v10018157mg [Capsella rubella]
 gb|EOA24867.1| hypothetical protein CARUB_v10018157mg [Capsella rubella]
Length=160

 Score =   305 bits (780),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLF QD VEYK+RV+ Q+KQYPP+V
Sbjct  121  LDTPNPADPAQTDGYHLFCQDPVEYKKRVKLQSKQYPPIV  160



>ref|XP_009771488.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana sylvestris]
Length=160

 Score =   305 bits (780),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET  DG+VNLMVWHC+IPGK  TDWEGG+YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETGADGSVNLMVWHCSIPGKPATDWEGGHYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNP DPAQT+GY L++QDT EYKRRV+QQAKQYP L+
Sbjct  121  LDQPNPNDPAQTDGYQLYMQDTAEYKRRVKQQAKQYPALL  160



>ref|XP_003574257.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Brachypodium distachyon]
Length=161

 Score =   305 bits (780),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRLAEERKAWRKNHPHGFVAKPET+ DG+VNLMVWHCTIPGK GTDWEGG +PLT
Sbjct  4    GGIARGRLAEERKAWRKNHPHGFVAKPETVADGSVNLMVWHCTIPGKQGTDWEGGYFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            + FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD
Sbjct  64   LQFSEDYPSKPPKCKFPQNFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  123

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNPADPAQT+GYHLFIQD  EYK+RVR QAKQYP L+
Sbjct  124  QPNPADPAQTDGYHLFIQDPAEYKKRVRLQAKQYPALI  161



>ref|XP_008244101.1| PREDICTED: SUMO-conjugating enzyme SCE1, partial [Prunus mume]
Length=153

 Score =   303 bits (777),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = +2

Query  80   GRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSE  259
            GRLAEERKAWRKNHPHGFVAKPETL DGTVNLMVWHCTIPGK GTDWEGG +PLT+HFSE
Sbjct  1    GRLAEERKAWRKNHPHGFVAKPETLSDGTVNLMVWHCTIPGKTGTDWEGGFFPLTLHFSE  60

Query  260  DYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPA  439
            DYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPA
Sbjct  61   DYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPA  120

Query  440  DPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            DPAQTEGYHLFIQD  EYK+RVRQQAKQYPPLV
Sbjct  121  DPAQTEGYHLFIQDATEYKKRVRQQAKQYPPLV  153



>emb|CDX71988.1| BnaC08g28860D [Brassica napus]
Length=160

 Score =   303 bits (777),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET  DG+VNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGSDGSVNLMVWHCTIPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAI VKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDSGWRPAIAVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLFIQD VEYK+RV+ Q+KQYPP+V
Sbjct  121  LDTPNPADPAQTDGYHLFIQDAVEYKKRVKLQSKQYPPIV  160



>gb|EPS61715.1| ubiquitin carrier protein [Genlisea aurea]
Length=160

 Score =   303 bits (776),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGI+RGRLAEERKAWRKNHPHGFVAKP+TLPDG++NLMVW C IPGK GTDW+GG +P
Sbjct  1    MSGGISRGRLAEERKAWRKNHPHGFVAKPDTLPDGSLNLMVWQCIIPGKPGTDWDGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNP DPAQTEGYHLFIQD VEYK+RVR QAKQYP +V
Sbjct  121  LDSPNPNDPAQTEGYHLFIQDPVEYKKRVRSQAKQYPSIV  160



>ref|XP_007223632.1| hypothetical protein PRUPE_ppa012638mg [Prunus persica]
 gb|EMJ24831.1| hypothetical protein PRUPE_ppa012638mg [Prunus persica]
Length=160

 Score =   303 bits (776),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET PDG +NLM+W C IPGK+ TDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETGPDGAINLMIWQCIIPGKSSTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GY LFIQ+  EYKRRVRQQAKQYPP++
Sbjct  121  LDQPNPADPAQTDGYQLFIQEPAEYKRRVRQQAKQYPPVL  160



>ref|XP_010504726.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Camelina sativa]
Length=160

 Score =   302 bits (774),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLF QD VEYK+RV+ Q+KQYP +V
Sbjct  121  LDTPNPADPAQTDGYHLFCQDPVEYKKRVKLQSKQYPAIV  160



>ref|XP_009417521.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Musa acuminata 
subsp. malaccensis]
Length=160

 Score =   301 bits (772),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET  DGTVNLMVWHC IPGK GTDWEGG+YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETSADGTVNLMVWHCIIPGKQGTDWEGGHYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKC+FPQ FFHPNVYPSGTVCLSILNEDSGWRPAIT KQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCRFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITAKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD+PNPADPAQ +G+ LFIQD  EY+RRVRQQAKQYP L+
Sbjct  121  LDRPNPADPAQVDGHQLFIQDLSEYRRRVRQQAKQYPALI  160



>ref|XP_008220257.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Prunus mume]
Length=160

 Score =   301 bits (772),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET PDG ++LM+W C IPGK+ TDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETGPDGAIDLMIWQCIIPGKSSTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GY LFIQ+  EYKRRVRQQAKQYPP++
Sbjct  121  LDQPNPADPAQTDGYQLFIQEPAEYKRRVRQQAKQYPPVL  160



>ref|XP_010516423.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Camelina sativa]
Length=160

 Score =   301 bits (772),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRL+EERK+WRKNHPHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLSEERKSWRKNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLF QD VEYK+RV+ Q+KQYP +V
Sbjct  121  LDTPNPADPAQTDGYHLFCQDPVEYKKRVKLQSKQYPAIV  160



>ref|XP_006662001.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Oryza brachyantha]
Length=160

 Score =   301 bits (771),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERKAWRKNHPHGFVAKPET  DG+ NLMVWHC IPGK GTDWEGG YP
Sbjct  1    MSAGIARGRLAEERKAWRKNHPHGFVAKPETTADGSANLMVWHCAIPGKQGTDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDL
Sbjct  61   VTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GYH+FIQD  EYKRRVR QAKQYP L+
Sbjct  121  LDQPNPADPAQTDGYHIFIQDKPEYKRRVRMQAKQYPALL  160



>ref|XP_004291083.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Fragaria vesca 
subsp. vesca]
Length=160

 Score =   301 bits (770),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK+WRKNHPHGFVA+PET PDG+VNLMVW C IPGKA TDWEGGNYP
Sbjct  1    MSGGIARGRLAEERKSWRKNHPHGFVARPETGPDGSVNLMVWQCLIPGKASTDWEGGNYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+ FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTLQFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDKGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPN ADPAQTEGY LFIQ+  EYKRRV+QQAKQYP ++
Sbjct  121  LDQPNAADPAQTEGYQLFIQEPAEYKRRVKQQAKQYPSVI  160



>ref|NP_191346.1| SUMO-conjugating enzyme SCE1 [Arabidopsis thaliana]
 ref|XP_002878176.1| hypothetical protein ARALYDRAFT_486239 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q42551.1|SCE1_ARATH RecName: Full=SUMO-conjugating enzyme SCE1; AltName: Full=Protein 
EMBRYO DEFECTIVE 1637; AltName: Full=Protein hus5 homolog; 
AltName: Full=SUMO-conjugating enzyme 1; Short=AtSCE1 [Arabidopsis 
thaliana]
 gb|AAA86642.1| ubiquitin-conjugating enzyme [Arabidopsis thaliana]
 gb|AAC64116.1| E2 ubiquitin-conjugating-like enzyme [Arabidopsis thaliana]
 emb|CAB67615.1| E2 ubiquitin-conjugating-like enzyme Ahus5 [Arabidopsis thaliana]
 gb|AAK68778.1| E2 ubiquitin-conjugating-like enzyme Ahus5 [Arabidopsis thaliana]
 gb|AAO30040.1| E2 ubiquitin-conjugating-like enzyme Ahus5 [Arabidopsis thaliana]
 gb|EFH54435.1| hypothetical protein ARALYDRAFT_486239 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE79711.1| SUMO-conjugating enzyme SCE1 [Arabidopsis thaliana]
Length=160

 Score =   300 bits (769),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET  DGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGQDGTVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLF QD VEYK+RV+ Q+KQYP LV
Sbjct  121  LDTPNPADPAQTDGYHLFCQDPVEYKKRVKLQSKQYPALV  160



>ref|XP_010427677.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Camelina sativa]
Length=160

 Score =   300 bits (769),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPTGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNPADPAQT+GYHLF QD VEYK+RV+ Q+KQYP +V
Sbjct  121  LDTPNPADPAQTDGYHLFCQDPVEYKKRVKLQSKQYPAIV  160



>ref|XP_006354854.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Solanum tuberosum]
Length=160

 Score =   300 bits (767),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERKAWRKNHPHGFVAKPET PDGTVNLMVW C+IPGK  TDWEGG+YP
Sbjct  1    MSSGIARGRLAEERKAWRKNHPHGFVAKPETGPDGTVNLMVWQCSIPGKPSTDWEGGHYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +TMHFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   ITMHFSEDYPSKPPKCKFPAGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNP DPAQTEGY L++QDT EYK+RV+QQAKQYP L+
Sbjct  121  LDQPNPDDPAQTEGYQLYMQDTDEYKKRVKQQAKQYPALL  160



>ref|XP_009620476.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana tomentosiformis]
Length=160

 Score =   299 bits (766),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET  DG+VNLM+WHC+IPGK  TDWE G+YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETGADGSVNLMIWHCSIPGKPATDWEDGHYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNP DPAQT+GY L++QDT EYKRRV+QQAK YP L+
Sbjct  121  LDQPNPNDPAQTDGYQLYMQDTAEYKRRVKQQAKLYPALL  160



>ref|XP_008378017.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Malus domestica]
Length=160

 Score =   298 bits (764),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET PDG+VNLMVW C IPGK  TDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETAPDGSVNLMVWQCIIPGKPSTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++F+EDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTLNFTEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDKGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            L QPNPADPAQTEGY LFIQ+  EYKRRVRQQAKQYPP++
Sbjct  121  LGQPNPADPAQTEGYQLFIQEPAEYKRRVRQQAKQYPPVI  160



>ref|XP_006402394.1| hypothetical protein EUTSA_v10006281mg [Eutrema salsugineum]
 gb|ESQ43847.1| hypothetical protein EUTSA_v10006281mg [Eutrema salsugineum]
Length=160

 Score =   298 bits (762),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERKAWRKNHPH FVAKPET  DGT NLMVW C IPGK+GTDWEGG YP
Sbjct  1    MSGGIARGRLTEERKAWRKNHPHAFVAKPETSSDGTNNLMVWQCIIPGKSGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD+PNP DPAQTEGY LF+QD  EYKR+VRQQAKQYPP++
Sbjct  121  LDEPNPNDPAQTEGYQLFVQDKTEYKRKVRQQAKQYPPIL  160



>ref|XP_001768256.1| predicted protein [Physcomitrella patens]
 gb|EDQ66870.1| predicted protein [Physcomitrella patens]
Length=160

 Score =   297 bits (761),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVA+PET  DG +NLMVW CT+PGK GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVARPETGADGALNLMVWQCTLPGKVGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            + +HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ+L
Sbjct  61   VAIHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQEL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            LD PNPADPAQTE Y LFIQD VEYKRRVRQQAKQYPP
Sbjct  121  LDAPNPADPAQTEAYQLFIQDPVEYKRRVRQQAKQYPP  158



>ref|XP_001776874.1| predicted protein [Physcomitrella patens]
 gb|EDQ58277.1| predicted protein [Physcomitrella patens]
Length=160

 Score =   297 bits (760),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVA+PET  DG +NLMVW CT+PGK GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVARPETCADGALNLMVWQCTLPGKVGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            + +HF+EDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ+L
Sbjct  61   VAIHFTEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQEL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            LD PNPADPAQTE Y LFIQD VEYKRRVRQQAKQYPP
Sbjct  121  LDAPNPADPAQTEAYQLFIQDPVEYKRRVRQQAKQYPP  158



>ref|XP_006473285.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006473286.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Citrus 
sinensis]
Length=159

 Score =   297 bits (760),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 148/160 (93%), Gaps = 1/160 (1%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERKAWRKNHPHGFVAKPET  DG+VNLM+W C IPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLTEERKAWRKNHPHGFVAKPET-KDGSVNLMIWECIIPGKTGTDWEGGYFP  59

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDL
Sbjct  60   LTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDL  119

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP++
Sbjct  120  LDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPVI  159



>ref|XP_010679521.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Beta vulgaris subsp. 
vulgaris]
Length=160

 Score =   296 bits (759),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK WRKNHPHGFVAKP+T  DG++NL+VW C IPGKAGTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKQWRKNHPHGFVAKPDTQADGSMNLLVWQCIIPGKAGTDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTM+FSE+YPSKPPKCKFP  FFHPNVYPSGTVCLSILNED  WRPAITVKQILVGIQDL
Sbjct  61   LTMYFSEEYPSKPPKCKFPAGFFHPNVYPSGTVCLSILNEDCDWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPN ADPAQTEGYHLFIQDT EYKRRVRQQAKQYP  +
Sbjct  121  LDQPNAADPAQTEGYHLFIQDTTEYKRRVRQQAKQYPATI  160



>ref|XP_009390473.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=186

 Score =   297 bits (761),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 152/186 (82%), Gaps = 26/186 (14%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETL DGTVNLM+WHCTIPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLADGTVNLMIWHCTIPGKPGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDS------------------  364
            LT++FSEDYPSKPPKC+FPQ FFHPNVYPSGTVCLSILNEDS                  
Sbjct  61   LTLYFSEDYPSKPPKCRFPQGFFHPNVYPSGTVCLSILNEDSVSYCCKPSSLAYVAVKCV  120

Query  365  --------GWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAK  520
                    GWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD  EY+RRVRQQAK
Sbjct  121  MTCLCHMQGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQDLEEYRRRVRQQAK  180

Query  521  QYPPLV  538
            QYP LV
Sbjct  181  QYPALV  186



>ref|XP_011069737.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Sesamum indicum]
Length=160

 Score =   296 bits (758),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET PDG+VNLMVWHC IPGKA T+WEGG YP
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETSPDGSVNLMVWHCIIPGKANTEWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQNFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
            LDQPNP DPAQT+GY L++Q+  EY RRVRQQAKQYP
Sbjct  121  LDQPNPNDPAQTDGYQLYMQERDEYWRRVRQQAKQYP  157



>ref|XP_004238134.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Solanum lycopersicum]
Length=160

 Score =   296 bits (758),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERKAWRKNHPHGFVAKPET PDG+VNLMVW C+IPGK  TDWEGG+YP
Sbjct  1    MSGGIARGRLTEERKAWRKNHPHGFVAKPETGPDGSVNLMVWQCSIPGKPSTDWEGGHYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +TMHFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   VTMHFSEDYPSKPPKCKFPAGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNP DPAQT+GY L++QD  EYK+RV+QQAKQYP L+
Sbjct  121  LDQPNPDDPAQTDGYQLYMQDEFEYKKRVKQQAKQYPALL  160



>ref|XP_010523001.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Tarenaya hassleriana]
Length=160

 Score =   296 bits (757),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK+WRKNHPHGFVAKPETLPDGT NLMVW C IPGK+GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKSWRKNHPHGFVAKPETLPDGTNNLMVWQCIIPGKSGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD+PNP DPAQT+GY L++QD  EY++RV+QQAKQYPP++
Sbjct  121  LDEPNPNDPAQTDGYQLYVQDREEYRKRVKQQAKQYPPII  160



>gb|KDO84093.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
 gb|KDO84094.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
 gb|KDO84095.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
Length=160

 Score =   295 bits (756),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 147/158 (93%), Gaps = 1/158 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRL EERKAWRKNHPHGFVAKPET  DG+VNLM+W C IPGK GTDWEGG +PLT
Sbjct  4    GGIARGRLTEERKAWRKNHPHGFVAKPET-KDGSVNLMIWECIIPGKTGTDWEGGYFPLT  62

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            ++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLD
Sbjct  63   LYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLD  122

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP++
Sbjct  123  QPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPVI  160



>ref|XP_006434720.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
 gb|ESR47960.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
Length=160

 Score =   295 bits (754),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 147/158 (93%), Gaps = 1/158 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRL EERKAWRKNHPHGFVAKPET  DG+VNLM+W C IPGK GTDWEGG +PLT
Sbjct  4    GGIARGRLTEERKAWRKNHPHGFVAKPET-KDGSVNLMIWECIIPGKTGTDWEGGYFPLT  62

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            ++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLD
Sbjct  63   LYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLD  122

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP++
Sbjct  123  QPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPVL  160



>ref|XP_008393782.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Malus domestica]
Length=160

 Score =   294 bits (752),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPET  DG+VNLMVW C IPGK  TDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETASDGSVNLMVWLCIIPGKPSTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTLNFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDKGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            L QPNPADPAQ EGY LFIQ+  EYKRRVRQQAKQYPP++
Sbjct  121  LGQPNPADPAQAEGYQLFIQEPAEYKRRVRQQAKQYPPVL  160



>ref|XP_004252754.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Solanum lycopersicum]
Length=160

 Score =   294 bits (752),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 146/157 (93%), Gaps = 0/157 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRL EERK+WRKNHPHGFVA+PET  DG+VNLMVWHC+IPGKA TDWEGG YP
Sbjct  1    MADGIARGRLTEERKSWRKNHPHGFVARPETGADGSVNLMVWHCSIPGKAKTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +TM+FSED+PSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   ITMYFSEDFPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
            LDQPNP+DPAQTEGY L++QD  EYK+RVRQQAKQYP
Sbjct  121  LDQPNPSDPAQTEGYQLYMQDGAEYKKRVRQQAKQYP  157



>emb|CDX93982.1| BnaC04g21410D [Brassica napus]
Length=160

 Score =   293 bits (751),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERKAWRKNHPH FVAKPET  DGT NLMVW C IPGK+GTDWEGG YP
Sbjct  1    MSGGIARGRLTEERKAWRKNHPHAFVAKPETSSDGTNNLMVWQCIIPGKSGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTLNFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD+PNP DPAQTEGY LF+QD  EYKRRV+QQAKQYP +V
Sbjct  121  LDEPNPNDPAQTEGYQLFVQDKNEYKRRVKQQAKQYPTVV  160



>gb|ABK23228.1| unknown [Picea sitchensis]
 gb|ABK26454.1| unknown [Picea sitchensis]
Length=160

 Score =   293 bits (749),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVA+PET  DG++NLMVW C +PGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVARPETQQDGSLNLMVWQCILPGKPGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDL
Sbjct  61   LTIHFSEDYPSKPPKCKFPTGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNP+DPAQT+ Y LFIQD  EYKRRVRQQAKQYPP V
Sbjct  121  LDQPNPSDPAQTDAYQLFIQDPPEYKRRVRQQAKQYPPPV  160



>ref|XP_009138734.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Brassica rapa]
 emb|CDY66302.1| BnaA04g27280D [Brassica napus]
Length=160

 Score =   292 bits (748),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERKAWRKNHPH FVAKPET  DGT NLMVW C IPGK+GTDWEGG YP
Sbjct  1    MSGGIARGRLTEERKAWRKNHPHAFVAKPETSSDGTNNLMVWQCIIPGKSGTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTLNFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD+PNP DPAQTEGY LF+QD  EYKRRV+QQAKQYP ++
Sbjct  121  LDEPNPNDPAQTEGYQLFVQDKNEYKRRVKQQAKQYPTVL  160



>ref|XP_006342638.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Solanum tuberosum]
Length=160

 Score =   291 bits (746),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVA+PET  DG+VNLMVW+C+IPGKA TDWEGG YP
Sbjct  1    MSDGIARGRLAEERKSWRKNHPHGFVARPETGADGSVNLMVWNCSIPGKAKTDWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +TM+FSED+PSKPPKCKFPQ FFHPNVYPSGT+CLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   ITMNFSEDFPSKPPKCKFPQGFFHPNVYPSGTICLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            L QPNP+DPAQTEG+ L++QD  EYK+RVRQQAKQYP LV
Sbjct  121  LVQPNPSDPAQTEGFQLYMQDGAEYKKRVRQQAKQYPALV  160



>gb|AEI83503.1| ubiquitin-conjugating enzyme E2 I [Wolffia arrhiza]
Length=160

 Score =   291 bits (746),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GG+ARGRL EERK+WRKNHPHGFVA+PETLPDG+VNLM+W C IPGK GTDW+GG +P
Sbjct  1    MSGGVARGRLTEERKSWRKNHPHGFVARPETLPDGSVNLMIWQCLIPGKQGTDWDGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +T+HFSEDYPSKPPKCKFP  FFHPN+YPSGTVCLSILNED GWRPAITVKQIL GIQDL
Sbjct  61   ITLHFSEDYPSKPPKCKFPPGFFHPNIYPSGTVCLSILNEDKGWRPAITVKQILTGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
            LDQPNPADPAQTEGY LFIQD  EYKRRVR QAKQYP
Sbjct  121  LDQPNPADPAQTEGYQLFIQDPTEYKRRVRLQAKQYP  157



>ref|XP_002980875.1| SUMO-conjugating enzyme 1a [Selaginella moellendorffii]
 gb|EFJ18060.1| SUMO-conjugating enzyme 1a [Selaginella moellendorffii]
Length=160

 Score =   291 bits (744),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVA+PET PDG+VNLM WHCT+PGKAGTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVARPETQPDGSVNLMTWHCTLPGKAGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            L +HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQ+L
Sbjct  61   LAIHFSEDYPSKPPKCKFPPNFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQEL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PN ADPAQ++ Y +FIQD  EYKRRVRQQAK YPP V
Sbjct  121  LDAPNAADPAQSDAYQMFIQDRDEYKRRVRQQAKLYPPPV  160



>ref|XP_002301168.1| hypothetical protein POPTR_0002s12510g [Populus trichocarpa]
 gb|ABK94802.1| unknown [Populus trichocarpa]
 gb|ABK96193.1| unknown [Populus trichocarpa]
 gb|EEE80441.1| hypothetical protein POPTR_0002s12510g [Populus trichocarpa]
Length=161

 Score =   290 bits (741),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRLAEERKAWRKNHPHGFVAKP+  PDG+++LM+W C IPGK GTDWEGG +PLT
Sbjct  4    GGIARGRLAEERKAWRKNHPHGFVAKPDNAPDGSLDLMMWKCIIPGKPGTDWEGGYFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQIL+GIQDLLD
Sbjct  64   LHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILIGIQDLLD  123

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNP+DPAQT+GY LF+QD  EY+RRVRQQAK YPP +
Sbjct  124  QPNPSDPAQTDGYQLFVQDPAEYRRRVRQQAKLYPPTL  161



>ref|XP_006374899.1| hypothetical protein POPTR_0014s02500g [Populus trichocarpa]
 gb|ABK95631.1| unknown [Populus trichocarpa]
 gb|ERP52696.1| hypothetical protein POPTR_0014s02500g [Populus trichocarpa]
Length=161

 Score =   288 bits (738),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRLAEERK+WRKNHPHGFVAKP+   DG+++LMVW C IPGK GTDWEGG +PL+
Sbjct  4    GGIARGRLAEERKSWRKNHPHGFVAKPDNAQDGSLDLMVWKCIIPGKPGTDWEGGFFPLS  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD
Sbjct  64   LHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLD  123

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNP+DPAQT+GY LF+QD  EY+RRVRQQAKQYPP +
Sbjct  124  QPNPSDPAQTDGYQLFVQDPTEYRRRVRQQAKQYPPAL  161



>ref|XP_011017169.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Populus euphratica]
Length=161

 Score =   288 bits (736),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRLAEERKAWRKNHPHGFVAKP+  PDG+++LM+W C IPGK GTDWEGG +PLT
Sbjct  4    GGIARGRLAEERKAWRKNHPHGFVAKPDNAPDGSLDLMMWKCIIPGKPGTDWEGGYFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQIL+GIQDLLD
Sbjct  64   LHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILIGIQDLLD  123

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNP+DP QT+GY LF+QD  EY+RRVRQQAK YPP +
Sbjct  124  QPNPSDPGQTDGYQLFVQDPAEYRRRVRQQAKLYPPTL  161



>ref|XP_006374896.1| hypothetical protein POPTR_0014s02480g [Populus trichocarpa]
 gb|ERP52693.1| hypothetical protein POPTR_0014s02480g [Populus trichocarpa]
Length=161

 Score =   286 bits (732),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRLAEERK+WRKNHPHGFVAKP+   DG+++LMVW C IPGK GTDWEGG +PLT
Sbjct  4    GGIARGRLAEERKSWRKNHPHGFVAKPDNAQDGSLDLMVWKCIIPGKPGTDWEGGFFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD
Sbjct  64   LHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLD  123

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNPADPAQT+GY LF+QD  EY+R+VRQQAKQYPP +
Sbjct  124  QPNPADPAQTDGYQLFVQDPTEYRRKVRQQAKQYPPAL  161



>ref|XP_011029489.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Populus euphratica]
Length=161

 Score =   286 bits (731),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRLAEERK+WRKNHPHGFVAKP+   DG+++LMVW C IPGK GTDWEGG +PLT
Sbjct  4    GGIARGRLAEERKSWRKNHPHGFVAKPDNAQDGSLDLMVWKCIIPGKPGTDWEGGFFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD
Sbjct  64   LHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLD  123

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNP+DPAQT+GY LF+QD  EY+R  RQQAKQYPP +
Sbjct  124  QPNPSDPAQTDGYQLFVQDPTEYRRTERQQAKQYPPTI  161



>ref|XP_002534386.1| ubiquitin-conjugating enzyme E2 I, putative [Ricinus communis]
 gb|EEF27994.1| ubiquitin-conjugating enzyme E2 I, putative [Ricinus communis]
Length=196

 Score =   286 bits (732),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGK+GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKSGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDT  484
            LDQPNPADPAQTEGYHLFIQ T
Sbjct  121  LDQPNPADPAQTEGYHLFIQHT  142



>gb|EYU25458.1| hypothetical protein MIMGU_mgv11b023148mg [Erythranthe guttata]
Length=160

 Score =   282 bits (722),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIAR RL EERKAWRKNHPHGFVAKPE+  DG+V+LMVWHC IPGK  TDWEGG YP
Sbjct  1    MSGGIARARLTEERKAWRKNHPHGFVAKPESGADGSVDLMVWHCLIPGKPNTDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYP KPPKCKFP  FFHPN+YPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPIKPPKCKFPPNFFHPNIYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
            LD PNP+DPAQT+GY +FIQ+  EYK+RVRQQAKQYP
Sbjct  121  LDLPNPSDPAQTDGYQIFIQEPDEYKKRVRQQAKQYP  157



>gb|KCW59391.1| hypothetical protein EUGRSUZ_H02096, partial [Eucalyptus grandis]
Length=220

 Score =   284 bits (727),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 138/153 (90%), Gaps = 5/153 (3%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRL EERKAWRKNHPHGFVAKPETLPDGTVNLM+WHC IPGKAGTDWEGG YPL
Sbjct  51   MSGIARGRLTEERKAWRKNHPHGFVAKPETLPDGTVNLMIWHCIIPGKAGTDWEGGFYPL  110

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL
Sbjct  111  TLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  170

Query  422  DQPNPADPAQTEGYHLFIQ-----DTVEYKRRV  505
            DQPNPADPAQTEGYHLFIQ     D   + R V
Sbjct  171  DQPNPADPAQTEGYHLFIQVFSFSDAFNFHRSV  203



>ref|XP_010317791.1| PREDICTED: SUMO-conjugating enzyme SCE1 isoform X1 [Solanum lycopersicum]
Length=161

 Score =   281 bits (719),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERKAWR+NHPHGFVAKPETLPDG+VNLMVWHC+IPGK GTDWEGG YP
Sbjct  1    MSAGIARGRLAEERKAWRRNHPHGFVAKPETLPDGSVNLMVWHCSIPGKTGTDWEGGCYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +T+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   VTIHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEY  493
            LDQPNPADPAQTEGYHLFIQ  + +
Sbjct  121  LDQPNPADPAQTEGYHLFIQSLLVF  145



>ref|XP_007017167.1| Sumo conjugation enzyme 1 isoform 1 [Theobroma cacao]
 gb|EOY14392.1| Sumo conjugation enzyme 1 isoform 1 [Theobroma cacao]
Length=160

 Score =   281 bits (719),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIAR RL EERKAWRKNHPHGFVAKPET  DG+VN+M+WHC IPGK GTDW+GG +P
Sbjct  1    MSGGIARSRLTEERKAWRKNHPHGFVAKPETALDGSVNMMLWHCIIPGKKGTDWDGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPP CKFPQ F HPNVYPSGTVCLSILNED+GW+PAIT+KQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPNCKFPQGFLHPNVYPSGTVCLSILNEDNGWKPAITIKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPN +DPAQTEGY L++ +  EY++RV+QQAKQYPP +
Sbjct  121  LDQPNASDPAQTEGYQLYVSNLDEYRKRVQQQAKQYPPCL  160



>ref|XP_011029476.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Populus euphratica]
Length=161

 Score =   280 bits (717),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRLAEERK+  KNHPHGFVAKP+   DGT++LMVW C IPGK GTDWEGG +PLT
Sbjct  4    GGIARGRLAEERKSRGKNHPHGFVAKPDNAQDGTLDLMVWKCIIPGKPGTDWEGGFFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDLLD
Sbjct  64   LHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDLLD  123

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNPADPAQT+GY LF+QD  EY+R+VRQQAKQYPP +
Sbjct  124  QPNPADPAQTDGYQLFVQDPTEYRRKVRQQAKQYPPAL  161



>ref|XP_004156788.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Cucumis sativus]
Length=272

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK+WRKNHPHGFVAKPET+PDGTVNLM+WHC IPGK GTDWEGG +P
Sbjct  1    MSGGIARGRLAEERKSWRKNHPHGFVAKPETMPDGTVNLMIWHCIIPGKVGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPPKC+FPQ FFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
Sbjct  61   LTLNFSEDYPSKPPKCRFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQ  478
            LDQPNPADPAQTEGYHLFIQ
Sbjct  121  LDQPNPADPAQTEGYHLFIQ  140



>ref|XP_008344316.1| PREDICTED: SUMO-conjugating enzyme SCE1 [Malus domestica]
Length=160

 Score =   278 bits (712),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEE KAW+KNHPHGFVAKPETLPDGTVNLMVWHCTI  K  TDW+GG +P
Sbjct  1    MSRGIARGRLAEEHKAWQKNHPHGFVAKPETLPDGTVNLMVWHCTIXXKTXTDWDGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
             T+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVCLSILNED G RP ITVKQILVGIQDL
Sbjct  61   XTLHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVCLSILNEDXGLRPXITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            +DQPN  DPAQ  GYHLFIQD  EYK+RVR Q+KQYPPLV
Sbjct  121  MDQPNXXDPAQXXGYHLFIQDATEYKKRVRXQSKQYPPLV  160



>ref|XP_006291970.1| hypothetical protein CARUB_v10018157mg [Capsella rubella]
 gb|EOA24868.1| hypothetical protein CARUB_v10018157mg [Capsella rubella]
Length=157

 Score =   275 bits (702),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRLAEERK+WRKNHPHGFVAKPET PDGTVNLMVWHCTIPGKAGTDWEGG +P
Sbjct  1    MASGIARGRLAEERKSWRKNHPHGFVAKPETGPDGTVNLMVWHCTIPGKAGTDWEGGFFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED GWRPAITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDYGWRPAITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQ  478
            LD PNPADPAQT+GYHLF Q
Sbjct  121  LDTPNPADPAQTDGYHLFCQ  140



>ref|XP_010059899.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Eucalyptus 
grandis]
Length=159

 Score =   274 bits (701),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  G+ARGRL+EER+AWRKNHPHGFVAKPET PDG+VNLMVWHCTIPGKAGTDWEGGNYP
Sbjct  1    MSTGVARGRLSEERRAWRKNHPHGFVAKPETAPDGSVNLMVWHCTIPGKAGTDWEGGNYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++F+EDYPSK PKC FP+ FFH NVY SG VCLSILNED GWRP+ITV+QILVG+QDL
Sbjct  61   LTLYFTEDYPSKAPKCMFPKDFFHLNVYGSGMVCLSILNED-GWRPSITVRQILVGVQDL  119

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            L QPNPA PA  + Y LF++D  EY+RRVRQQAKQYPPLV
Sbjct  120  LHQPNPASPANYDEYELFVKDPAEYQRRVRQQAKQYPPLV  159



>gb|KCW66370.1| hypothetical protein EUGRSUZ_F00190 [Eucalyptus grandis]
Length=204

 Score =   275 bits (702),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +2

Query  41   QTQHTKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDW  220
              +   M  G+ARGRL+EER+AWRKNHPHGFVAKPET PDG+VNLMVWHCTIPGKAGTDW
Sbjct  40   SAEREDMSTGVARGRLSEERRAWRKNHPHGFVAKPETAPDGSVNLMVWHCTIPGKAGTDW  99

Query  221  EGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL  400
            EGGNYPLT++F+EDYPSK PKC FP+ FFH NVY SG VCLSILNED GWRP+ITV+QIL
Sbjct  100  EGGNYPLTLYFTEDYPSKAPKCMFPKDFFHLNVYGSGMVCLSILNED-GWRPSITVRQIL  158

Query  401  VGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            VG+QDLL QPNPA PA  + Y LF++D  EY+RRVRQQAKQYPPLV
Sbjct  159  VGVQDLLHQPNPASPANYDEYELFVKDPAEYQRRVRQQAKQYPPLV  204



>ref|XP_008807218.1| PREDICTED: SUMO-conjugating enzyme SCE1-like, partial [Phoenix 
dactylifera]
Length=137

 Score =   268 bits (686),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  128  GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFF  307
            GFVAKPETLPDG+VNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFPQ FF
Sbjct  1    GFVAKPETLPDGSVNLMVWHCTIPGKQGTDWEGGYFPLTLHFSEDYPSKPPKCKFPQGFF  60

Query  308  HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTV  487
            HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD  
Sbjct  61   HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQDPA  120

Query  488  EYKRRVRQQAKQYPPLV  538
            EY+RRVR QAKQYPPLV
Sbjct  121  EYRRRVRHQAKQYPPLV  137



>ref|XP_010059898.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X1 [Eucalyptus 
grandis]
Length=165

 Score =   268 bits (685),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 142/166 (86%), Gaps = 7/166 (4%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAG------TDW  220
            M  G+ARGRL+EER+AWRKNHPHGFVAKPET PDG+VNLMVWHCTIPGKAG      TDW
Sbjct  1    MSTGVARGRLSEERRAWRKNHPHGFVAKPETAPDGSVNLMVWHCTIPGKAGTFFLMQTDW  60

Query  221  EGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL  400
            EGGNYPLT++F+EDYPSK PKC FP+ FFH NVY SG VCLSILNED GWRP+ITV+QIL
Sbjct  61   EGGNYPLTLYFTEDYPSKAPKCMFPKDFFHLNVYGSGMVCLSILNED-GWRPSITVRQIL  119

Query  401  VGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            VG+QDLL QPNPA PA  + Y LF++D  EY+RRVRQQAKQYPPLV
Sbjct  120  VGVQDLLHQPNPASPANYDEYELFVKDPAEYQRRVRQQAKQYPPLV  165



>ref|XP_010318996.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Solanum 
lycopersicum]
Length=161

 Score =   263 bits (671),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 137/161 (85%), Gaps = 1/161 (1%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERKAWRKNHPHGFVA+PET PDG+ NLM+W C IPGK GTDWEGG+YP
Sbjct  1    MAGGIARGRLTEERKAWRKNHPHGFVARPETGPDGSANLMLWRCIIPGKPGTDWEGGHYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPS+PPKCKFP+ FFH NVYPSG VCLSILN   GW PAITVKQILVGIQ+L
Sbjct  61   LTMHFSEDYPSQPPKCKFPRGFFHINVYPSGDVCLSILNTGLGWSPAITVKQILVGIQEL  120

Query  419  LDQPNPADPAQTEGYHLFI-QDTVEYKRRVRQQAKQYPPLV  538
            LD+PNP+  AQ+E Y L++ +D  EYK+RVR QA QYP L+
Sbjct  121  LDEPNPSSSAQSECYKLYVKKDKTEYKKRVRAQANQYPALL  161



>ref|XP_009622849.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Nicotiana tomentosiformis]
Length=160

 Score =   262 bits (670),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M+GGIARGRLAEERKAWRKNHP+GF+AKPET PDG+VNLMVWHCTIPGK GTDWE G+YP
Sbjct  1    MVGGIARGRLAEERKAWRKNHPYGFMAKPETGPDGSVNLMVWHCTIPGKRGTDWERGHYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPS+PPKCKFPQ FFH NVY SG VCLSILN + GW PAITVKQILVGIQ+L
Sbjct  61   LTMHFSEDYPSQPPKCKFPQGFFHINVYGSGDVCLSILNPNYGWSPAITVKQILVGIQEL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
            LD+PNP+  AQ+  + L+ QD  EYKR V++QAK+YP
Sbjct  121  LDEPNPSSAAQSYCHKLYTQDKAEYKRLVKKQAKKYP  157



>gb|KHG16593.1| SUMO-conjugating enzyme SCE1 -like protein [Gossypium arboreum]
Length=160

 Score =   262 bits (670),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIAR RLAEERKAWRKNHPHGFVAKPET  DG+V+LMVWHC IPGK GTDWEGG +P
Sbjct  1    MSDGIARSRLAEERKAWRKNHPHGFVAKPETRADGSVDLMVWHCVIPGKKGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSE+YPSKPPKCKFP  FFHPNVYPSG VCLSIL+E  GWRP+ITVKQILVGIQDL
Sbjct  61   LTLNFSEEYPSKPPKCKFPNGFFHPNVYPSGIVCLSILSERRGWRPSITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
            LDQPN  D AQTEG+ L++ +  EY++RV+QQ  QYP
Sbjct  121  LDQPNATDAAQTEGHQLYVSNPNEYRKRVQQQVLQYP  157



>gb|EMS55983.1| SUMO-conjugating enzyme SCE1 [Triticum urartu]
Length=140

 Score =   261 bits (668),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  128  GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFF  307
            GFVAKPET+ DG+VNLM+W+CTIPGK GTDWE G YPLT+HFSEDYPSKPPKCKFPQ FF
Sbjct  4    GFVAKPETVADGSVNLMIWNCTIPGKQGTDWESGYYPLTLHFSEDYPSKPPKCKFPQGFF  63

Query  308  HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTV  487
            HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYHLFIQD  
Sbjct  64   HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHLFIQDPA  123

Query  488  EYKRRVRQQAKQYPPLV  538
            EYKRR+R QAKQYP LV
Sbjct  124  EYKRRIRLQAKQYPALV  140



>gb|KJB21461.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
 gb|KJB21463.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
 gb|KJB21464.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
 gb|KJB21466.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
 gb|KJB21468.1| hypothetical protein B456_004G179100 [Gossypium raimondii]
Length=160

 Score =   261 bits (666),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIAR RL EERKAWRKNHPHGFVAKPET  DG+V+LMVWHC IPGK GTDWEGG +P
Sbjct  1    MSDGIARSRLVEERKAWRKNHPHGFVAKPETRVDGSVDLMVWHCVIPGKKGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSE+YPSKPPKCKFP  FFHPNVYPSG VCLSIL+E  GWRP+ITVKQILVGIQDL
Sbjct  61   LTLNFSEEYPSKPPKCKFPNGFFHPNVYPSGIVCLSILSERRGWRPSITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
            LDQPN  D AQTEG+ L+I +  EY++RV+QQ  QYP
Sbjct  121  LDQPNATDAAQTEGHQLYISNPNEYRKRVQQQVLQYP  157



>gb|KDO84097.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
Length=146

 Score =   260 bits (664),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRL EERKAWRKNHPHGFVAKPET  DG+VNLM+W C IPGK GTDWEGG +PLT
Sbjct  4    GGIARGRLTEERKAWRKNHPHGFVAKPET-KDGSVNLMIWECIIPGKTGTDWEGGYFPLT  62

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            ++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLD
Sbjct  63   LYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLD  122

Query  425  QPNPADPAQTEGYHLFIQ  478
            QPNPADPAQT+GY LFIQ
Sbjct  123  QPNPADPAQTDGYQLFIQ  140



>gb|KHG25846.1| SUMO-conjugating enzyme SCE1 -like protein [Gossypium arboreum]
Length=160

 Score =   259 bits (661),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIAR RLAEERKAWRKNHPHGFVAKP + PDG+VNL+VWHC IPGK GTDWEGG +P
Sbjct  1    MSDGIARSRLAEERKAWRKNHPHGFVAKPMSAPDGSVNLLVWHCVIPGKVGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPP CKFP  FFHPNVYPSG VCLSIL+E  GWRP+ITV QILVGIQDL
Sbjct  61   LTINFSEDYPSKPPICKFPNGFFHPNVYPSGNVCLSILSERRGWRPSITVTQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            LDQPN +D AQTEGY L++ +   Y+ RV+QQ  QYPP
Sbjct  121  LDQPNASDYAQTEGYRLYVSNPDLYRERVQQQVLQYPP  158



>gb|ACA04892.1| putative ubiquitin-conjugating enzyme E2 I protein [Picea abies]
Length=143

 Score =   257 bits (657),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  110  RKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCK  289
            RKNHPHGFVA+PET  DG++NLMVW C +PGK GTDWEGG +PLT+HFSEDYPSKPPKCK
Sbjct  1    RKNHPHGFVARPETQQDGSLNLMVWQCILPGKPGTDWEGGYFPLTIHFSEDYPSKPPKCK  60

Query  290  FPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHL  469
            FP  FFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL+GIQDLLDQPNP+D AQT+ Y L
Sbjct  61   FPTGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILIGIQDLLDQPNPSDXAQTDAYQL  120

Query  470  FIQDTVEYKRRVRQQAKQYPPLV  538
            FIQD  EYKRRVRQQAKQYPP V
Sbjct  121  FIQDPPEYKRRVRQQAKQYPPPV  143



>gb|KJB53560.1| hypothetical protein B456_009G214500 [Gossypium raimondii]
Length=160

 Score =   258 bits (658),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIAR RLAEERKAWRKNHPHGFVAKP + PDG+VNL+VWHC IPGK GTDWEGG +P
Sbjct  1    MSDGIARSRLAEERKAWRKNHPHGFVAKPMSAPDGSVNLLVWHCVIPGKIGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPP CKFP  FFHPNVYPSG VCLSIL+E  GWRP+ITV QILVGIQDL
Sbjct  61   LTINFSEDYPSKPPICKFPNGFFHPNVYPSGNVCLSILSERHGWRPSITVTQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            LDQPN +D AQTEGY +++ +   Y++RV+QQ  QYPP
Sbjct  121  LDQPNASDYAQTEGYRVYVSNPDLYRKRVQQQVLQYPP  158



>gb|EYU25459.1| hypothetical protein MIMGU_mgv1a015370mg [Erythranthe guttata]
Length=160

 Score =   256 bits (653),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERK+WRKNHPHGFVAKPET PDGTVNLMVW C IPGK+GTDWEGG YP
Sbjct  1    MSGGIARGRLAEERKSWRKNHPHGFVAKPETSPDGTVNLMVWRCVIPGKSGTDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYP KPP+CKFP  FFHPNVY SG+VCLSILNE  GWRP+ITVKQILVGIQDL
Sbjct  61   LTMHFSEDYPGKPPECKFPPNFFHPNVYSSGSVCLSILNEALGWRPSITVKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
            LD+PNP   A      LF++   EYK++V Q AK+YP
Sbjct  121  LDKPNPDSAAHPYSNQLFLKQRDEYKKQVCQLAKRYP  157



>ref|XP_007017168.1| Sumo conjugation enzyme 1 isoform 2 [Theobroma cacao]
 gb|EOY14393.1| Sumo conjugation enzyme 1 isoform 2 [Theobroma cacao]
Length=166

 Score =   256 bits (654),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIAR RL EERKAWRKNHPHGFVAKPET  DG+VN+M+WHC IPGK GTDW+GG +P
Sbjct  1    MSGGIARSRLTEERKAWRKNHPHGFVAKPETALDGSVNMMLWHCIIPGKKGTDWDGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT+HFSEDYPSKPP CKFPQ F HPNVYPSGTVCLSILNED+GW+PAIT+KQILVGIQDL
Sbjct  61   LTLHFSEDYPSKPPNCKFPQGFLHPNVYPSGTVCLSILNEDNGWKPAITIKQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTV  487
            LDQPN +DPAQTEGY L++  ++
Sbjct  121  LDQPNASDPAQTEGYQLYVSMSI  143



>ref|XP_006344423.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Solanum tuberosum]
Length=161

 Score =   255 bits (651),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRLAEERKAWRKNHPHGFVA+PET PDG+ NLMVW C IPGK GTDWEGG+YP
Sbjct  1    MAGGIARGRLAEERKAWRKNHPHGFVARPETGPDGSANLMVWRCIIPGKPGTDWEGGHYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            L M FSEDYPS+PPKCKFP  FFH NVYPSG VCLSILN   GW PAITV QILVGIQ+L
Sbjct  61   LIMLFSEDYPSQPPKCKFPPGFFHINVYPSGDVCLSILNTGLGWSPAITVTQILVGIQEL  120

Query  419  LDQPNPADPAQTEGYHLFIQ-DTVEYKRRVRQQAKQYPPLV  538
            LD+PNP+  AQ E + L++Q D  EYK+RV+ QAKQYP L+
Sbjct  121  LDEPNPSSSAQFECHKLYVQKDKTEYKKRVKAQAKQYPALL  161



>ref|XP_002506123.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67381.1| predicted protein [Micromonas sp. RCC299]
Length=157

 Score =   254 bits (648),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIARGRLAEERK WRK+ PHGFVA+PET+ DG VNL+ W C+IPG+  T W GG YPL
Sbjct  1    MSGIARGRLAEERKVWRKDRPHGFVARPETV-DGAVNLLRWECSIPGRKDTLWAGGFYPL  59

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TM FSEDYPSKPPKCKFPQ FFHPN+YPSGTVCLSILNED GWRP+ITVKQIL+GIQDLL
Sbjct  60   TMEFSEDYPSKPPKCKFPQGFFHPNIYPSGTVCLSILNEDEGWRPSITVKQILMGIQDLL  119

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPL  535
            D PNPA PAQ+E Y LF  D  +Y R+V++Q+ +YP L
Sbjct  120  DSPNPASPAQSEAYMLFTNDRADYDRKVKEQSLRYPAL  157



>gb|AAB63513.1| ubiquitin-conjugating enzyme [Prunus armeniaca]
Length=126

 Score =   250 bits (638),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +2

Query  161  GTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVC  340
            GTVNLMVWHCTIPGK GTDWEGG +PLT+HFSEDYPSKPPKCKFP  FFHPNVYPSGTVC
Sbjct  1    GTVNLMVWHCTIPGKTGTDWEGGFFPLTLHFSEDYPSKPPKCKFPPGFFHPNVYPSGTVC  60

Query  341  LSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAK  520
            LSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  EYK+RVRQQAK
Sbjct  61   LSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDATEYKKRVRQQAK  120

Query  521  QYPPLV  538
            QYPPLV
Sbjct  121  QYPPLV  126



>ref|XP_002448378.1| hypothetical protein SORBIDRAFT_06g026280 [Sorghum bicolor]
 gb|EES12706.1| hypothetical protein SORBIDRAFT_06g026280 [Sorghum bicolor]
Length=159

 Score =   250 bits (638),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 135/158 (85%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GG+AR RLAEERK+WR++HPHGFVAKP TLPDG+VNLM+W+C +PGK  TDWEGG++PLT
Sbjct  4    GGVARARLAEERKSWRRSHPHGFVAKPATLPDGSVNLMLWNCIVPGKKDTDWEGGHFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HF+EDYPS+PP CKFP  FFH NVY +G+VCLSIL +   W+P+ITV+QIL+GIQDLLD
Sbjct  64   LHFTEDYPSRPPDCKFPAGFFHVNVYNTGSVCLSILAD--AWKPSITVRQILIGIQDLLD  121

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
             PNPA PAQ   Y LF Q+T EYK RVRQQAK+YPPLV
Sbjct  122  NPNPASPAQNLCYVLFTQNTPEYKNRVRQQAKRYPPLV  159



>gb|EWM21470.1| ubiquitin-conjugating enzyme e2 i [Nannochloropsis gaditana]
Length=160

 Score =   249 bits (635),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERKAWRK+HPHGFVA+P    DG++NLM W C+IPGK GTDWEGG + 
Sbjct  1    MSGGIARGRLQEERKAWRKDHPHGFVARPVLDADGSMNLMSWDCSIPGKEGTDWEGGVFK  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            +TM FSEDYPSKPPKCKF  A FHPNVYPSGTVCLSILNED  WRPAITVKQ+L+GIQDL
Sbjct  61   VTMEFSEDYPSKPPKCKFVPALFHPNVYPSGTVCLSILNEDEDWRPAITVKQMLLGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            LD PNP  PAQ + Y LF+ +  EY+RRVR +AK+  P
Sbjct  121  LDSPNPESPAQAQAYQLFVTNREEYRRRVRIEAKRNTP  158



>gb|AFK49150.1| unknown [Lotus japonicus]
Length=122

 Score =   246 bits (628),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/122 (94%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  173  LMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSIL  352
            +MVWHCTIPGK GTDWE G YPLTMHFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSIL
Sbjct  1    MMVWHCTIPGKTGTDWENGYYPLTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSIL  60

Query  353  NEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            NEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYPP
Sbjct  61   NEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDATEYKRRVRQQAKQYPP  120

Query  533  LV  538
            LV
Sbjct  121  LV  122



>ref|XP_010094645.1| Serine palmitoyltransferase 1 [Morus notabilis]
 gb|EXB56496.1| Serine palmitoyltransferase 1 [Morus notabilis]
Length=603

 Score =   260 bits (665),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  128  GFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFF  307
            GFVAKPET PDG+VNLMVW C IPGK GTDWEGG +PLT+HFSEDYPSKPPKC+FP  FF
Sbjct  467  GFVAKPETAPDGSVNLMVWQCIIPGKPGTDWEGGYFPLTLHFSEDYPSKPPKCRFPPGFF  526

Query  308  HPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTV  487
            HPNVYPSGTVCLSIL+EDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQ+ V
Sbjct  527  HPNVYPSGTVCLSILSEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQEPV  586

Query  488  EYKRRVRQQAKQYPPLV  538
            EYKRRVRQQAKQYP ++
Sbjct  587  EYKRRVRQQAKQYPQII  603



>ref|XP_005649108.1| E2 ubiquitin-conjugating-like enzyme [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24564.1| E2 ubiquitin-conjugating-like enzyme [Coccomyxa subellipsoidea 
C-169]
Length=159

 Score =   246 bits (629),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + G+ARGRLAEERKAWRK+ P GF A+PET  DG+VNLM W+C IPGK GTDWEGG +PL
Sbjct  1    MSGVARGRLAEERKAWRKDKPFGFFARPETAADGSVNLMKWNCHIPGKPGTDWEGGYFPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TM FS++YP+KPPKCKF  +FFHPN+YPSGTVCLSILNED GWRP+ITVK IL GIQDLL
Sbjct  61   TMEFSDEYPAKPPKCKFKPSFFHPNIYPSGTVCLSILNEDEGWRPSITVKNILTGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
            D PNP  PAQ E + +F Q  VEY++RV+QQA + P
Sbjct  121  DDPNPKSPAQAEAFMMFTQQKVEYRKRVKQQALRNP  156



>gb|ABG66220.1| Ubiquitin-conjugating enzyme E2 I, putative, expressed [Oryza 
sativa Japonica Group]
Length=129

 Score =   245 bits (626),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +2

Query  152  LPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSG  331
            + DG+ NLM+WHCTIPGK GTDWEGG YPLT+HFSEDYPSKPPKCKFPQ FFHPNVYPSG
Sbjct  1    MADGSANLMIWHCTIPGKQGTDWEGGYYPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSG  60

Query  332  TVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQ  511
            TVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQT+GYH+FIQD  EYKRRVR 
Sbjct  61   TVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYHIFIQDKPEYKRRVRV  120

Query  512  QAKQYPPLV  538
            QAKQYP L+
Sbjct  121  QAKQYPALL  129



>ref|XP_010059901.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X3 [Eucalyptus 
grandis]
Length=156

 Score =   245 bits (625),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 133/166 (80%), Gaps = 16/166 (10%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAG------TDW  220
            M  G+ARGRL+EER+AWRKNHPHGFVAKPET PDG+VNLMVWHCTIPGKAG      TDW
Sbjct  1    MSTGVARGRLSEERRAWRKNHPHGFVAKPETAPDGSVNLMVWHCTIPGKAGTFFLMQTDW  60

Query  221  EGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL  400
            EGGNYPLT++F+EDYPSK PKC FP+ FFH NVY SG           GWRP+ITV+QIL
Sbjct  61   EGGNYPLTLYFTEDYPSKAPKCMFPKDFFHLNVYGSGM----------GWRPSITVRQIL  110

Query  401  VGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            VG+QDLL QPNPA PA  + Y LF++D  EY+RRVRQQAKQYPPLV
Sbjct  111  VGVQDLLHQPNPASPANYDEYELFVKDPAEYQRRVRQQAKQYPPLV  156



>ref|XP_008668997.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Zea mays]
 tpg|DAA36340.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=159

 Score =   244 bits (622),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GG+AR RLAEERK+WR++HPHGF+AKP TLPDG+VNLM+W+C +PGK GTDWEGG++PLT
Sbjct  4    GGVARARLAEERKSWRRSHPHGFMAKPATLPDGSVNLMLWNCVVPGKQGTDWEGGHFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HF EDYPS+PP CKFP  FFH NVY +G+VCLSIL +   W+P+ITV+Q L+GIQDLLD
Sbjct  64   LHFDEDYPSRPPHCKFPAGFFHVNVYNTGSVCLSILGD--AWKPSITVRQTLIGIQDLLD  121

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
             PNPA PAQ   Y LF Q+  EY  RVRQQAK+YP LV
Sbjct  122  NPNPASPAQNLSYVLFTQNMPEYASRVRQQAKRYPSLV  159



>ref|XP_001694849.1| E2 ubiquitin-conjugating-like enzyme [Chlamydomonas reinhardtii]
 gb|EDP02001.1| E2 ubiquitin-conjugating-like enzyme [Chlamydomonas reinhardtii]
Length=159

 Score =   243 bits (621),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + G+AR RL EERKAWR++ P GF A+PET  DG+VNLM W C IPGK GTDWEGG YPL
Sbjct  1    MSGVARSRLQEERKAWRRDKPFGFHARPETADDGSVNLMKWKCHIPGKQGTDWEGGFYPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TM FSEDYP+KPPKCKFP  FFHPN+YPSGTVCLSILNED GWRP+IT+KQ+L+GIQ+LL
Sbjct  61   TMEFSEDYPTKPPKCKFPAGFFHPNIYPSGTVCLSILNEDEGWRPSITIKQLLLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            D PNP  PAQ++ + LF Q   EY ++V++QA  YPP
Sbjct  121  DTPNPGSPAQSDAFVLFTQQKAEYVKKVKRQALNYPP  157



>ref|XP_002954400.1| hypothetical protein VOLCADRAFT_102189 [Volvox carteri f. nagariensis]
 gb|EFJ44550.1| hypothetical protein VOLCADRAFT_102189 [Volvox carteri f. nagariensis]
Length=159

 Score =   243 bits (621),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + G+AR RL EERKAWRK+ P GF A+PET  DG++NLM W C IPGK GTDWEGG +PL
Sbjct  1    MSGVARSRLQEERKAWRKDKPFGFHARPETAEDGSINLMKWKCHIPGKQGTDWEGGFFPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TM FSEDYP+KPPKCKFP  FFHPN+YPSGTVCLSILNED GWRP+ITVKQ+L+GIQ+LL
Sbjct  61   TMEFSEDYPTKPPKCKFPAGFFHPNIYPSGTVCLSILNEDEGWRPSITVKQLLLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            D PNP  PAQ++ + L+ Q   EY ++V++QA QYPP
Sbjct  121  DTPNPNSPAQSDAFLLYTQQKAEYCKKVKRQALQYPP  157



>emb|CAD41164.2| OSJNBa0064M23.9 [Oryza sativa Japonica Group]
 gb|EAY95270.1| hypothetical protein OsI_17093 [Oryza sativa Indica Group]
 gb|EAZ31738.1| hypothetical protein OsJ_15891 [Oryza sativa Japonica Group]
Length=160

 Score =   243 bits (620),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 126/155 (81%), Gaps = 2/155 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIAR RLAEERKAWRKNHPHGFVAKPETLPDG+VNLMVW C IPGK GTDWEGG +PLT
Sbjct  5    GGIARARLAEERKAWRKNHPHGFVAKPETLPDGSVNLMVWRCIIPGKEGTDWEGGYFPLT  64

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            M F+EDYP+  P CKFP  FFH NVY SG VCLSIL+  + W+P+ITV+QIL+GIQ+L D
Sbjct  65   MQFTEDYPTNAPSCKFPSGFFHINVYDSGAVCLSILS--TAWKPSITVRQILIGIQELFD  122

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
             PNP   AQ   Y L+ +D  EY++RVRQQAK+YP
Sbjct  123  DPNPNSAAQNISYELYRKDMEEYRKRVRQQAKKYP  157



>ref|XP_006425959.1| hypothetical protein CICLE_v10026671mg [Citrus clementina]
 gb|ESR39199.1| hypothetical protein CICLE_v10026671mg [Citrus clementina]
Length=121

 Score =   241 bits (616),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +2

Query  176  MVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILN  355
            MVWHCTIPGKAGTDWEGG +PLT+HFSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILN
Sbjct  1    MVWHCTIPGKAGTDWEGGFFPLTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILN  60

Query  356  EDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPL  535
            ED+GWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQD  EYKRRVRQQAKQYP L
Sbjct  61   EDNGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDAAEYKRRVRQQAKQYPAL  120

Query  536  V  538
            +
Sbjct  121  L  121



>ref|XP_003056766.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58411.1| predicted protein [Micromonas pusilla CCMP1545]
Length=158

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIAR RL EERK WRK+ PHGF A+P T+ DG+V+++ W C IPGK  TDW GG YPL
Sbjct  1    MSGIARSRLMEERKVWRKDKPHGFYARPVTVGDGSVDILKWECQIPGKKDTDWHGGYYPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TM FSEDYPSKPPKCKFP+ FFHPN+YPSGTVCLSILNED GWRP+IT+KQIL+GIQ+LL
Sbjct  61   TMEFSEDYPSKPPKCKFPEKFFHPNIYPSGTVCLSILNEDDGWRPSITLKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
              PN A PAQ+E Y +F  D  +YK RVRQQA +YP
Sbjct  121  STPNSASPAQSEAYMMFTTDEKQYKIRVRQQAAKYP  156



>ref|XP_002448376.1| hypothetical protein SORBIDRAFT_06g026250 [Sorghum bicolor]
 gb|EES12704.1| hypothetical protein SORBIDRAFT_06g026250 [Sorghum bicolor]
Length=159

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 130/158 (82%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRLAEERK+WRK+HPHGFVAKPETLPDG+VNLMVW C IPGK GTDW+GG +PLT
Sbjct  4    GGIARGRLAEERKSWRKSHPHGFVAKPETLPDGSVNLMVWKCVIPGKEGTDWDGGYFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HF EDYPS PP CKFP  FFH NVYP+G VCLSIL+  S W+ +ITV+QIL+GIQDLLD
Sbjct  64   LHFPEDYPSSPPICKFPAGFFHVNVYPTGAVCLSILS--SAWKASITVRQILIGIQDLLD  121

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
             PNPA  AQ   Y L+ +D  +YK  VRQQAK+YP +V
Sbjct  122  NPNPASAAQDICYRLYKKDMPKYKDHVRQQAKRYPSVV  159



>ref|XP_004976583.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Setaria italica]
Length=159

 Score =   242 bits (618),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 127/158 (80%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIAR RLAEERK WR++HPHGFVAKPETLPDG+VNLMVW C +PGK GTDWEGG +PLT
Sbjct  4    GGIARSRLAEERKKWRRSHPHGFVAKPETLPDGSVNLMVWKCVVPGKEGTDWEGGYFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            + F EDYPS  P CKFP  FFH NVYP+G VCLSIL+  + W+P+ITV QIL+GIQDLLD
Sbjct  64   LQFPEDYPSNAPVCKFPAGFFHVNVYPTGAVCLSILS--NAWKPSITVCQILIGIQDLLD  121

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
             PNPA PAQ   Y L+ +D   YK RVRQQAKQYP LV
Sbjct  122  HPNPASPAQDACYRLYKKDMRSYKDRVRQQAKQYPSLV  159



>ref|XP_002448377.1| hypothetical protein SORBIDRAFT_06g026270 [Sorghum bicolor]
 gb|EES12705.1| hypothetical protein SORBIDRAFT_06g026270 [Sorghum bicolor]
Length=159

 Score =   242 bits (617),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 130/158 (82%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GG ARGRLAEERKAWRK HPHGFVAKP TLPDG+VNLM+W+C +PGK GTDWEGG +PLT
Sbjct  4    GGAARGRLAEERKAWRKRHPHGFVAKPATLPDGSVNLMLWNCVVPGKEGTDWEGGYFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HF+E+YPS PP CKFP+ FFH NVY SG VCLSIL +   W P+ITV QIL+GIQ+LLD
Sbjct  64   LHFTENYPSNPPTCKFPRRFFHVNVYDSGDVCLSILGD--AWAPSITVPQILIGIQELLD  121

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
             PNPA PAQ   Y +F ++  EYKRRVR+QAK+YP LV
Sbjct  122  NPNPASPAQDFAYDVFAKNMPEYKRRVREQAKRYPSLV  159



>gb|KJB53563.1| hypothetical protein B456_009G214500 [Gossypium raimondii]
Length=155

 Score =   241 bits (616),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 129/158 (82%), Gaps = 5/158 (3%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIAR RLAEERKAWRKNHPH     P + PDG+VNL+VWHC IPGK GTDWEGG +P
Sbjct  1    MSDGIARSRLAEERKAWRKNHPH-----PMSAPDGSVNLLVWHCVIPGKIGTDWEGGYFP  55

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPP CKFP  FFHPNVYPSG VCLSIL+E  GWRP+ITV QILVGIQDL
Sbjct  56   LTINFSEDYPSKPPICKFPNGFFHPNVYPSGNVCLSILSERHGWRPSITVTQILVGIQDL  115

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            LDQPN +D AQTEGY +++ +   Y++RV+QQ  QYPP
Sbjct  116  LDQPNASDYAQTEGYRVYVSNPDLYRKRVQQQVLQYPP  153



>ref|XP_006652687.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Oryza brachyantha]
Length=161

 Score =   241 bits (616),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 127/155 (82%), Gaps = 2/155 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIAR RLAEERKAWRKNHPHGFVAKPETLPDG+VNLM+W C IPGK GTDWEGG +PLT
Sbjct  6    GGIARARLAEERKAWRKNHPHGFVAKPETLPDGSVNLMLWRCIIPGKEGTDWEGGYFPLT  65

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            M F+EDYP+ PP CKFP  FFH NVY SG VCLSIL+  SGW+P+ITVKQIL+GIQ+L D
Sbjct  66   MQFTEDYPNSPPSCKFPSGFFHINVYDSGAVCLSILS--SGWKPSITVKQILMGIQELFD  123

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
             PNP   AQ   Y L+ ++  EY++ VRQQAK+YP
Sbjct  124  DPNPMSAAQNLSYELYKKNMPEYRKCVRQQAKKYP  158



>gb|KJB53564.1| hypothetical protein B456_009G214500 [Gossypium raimondii]
Length=157

 Score =   240 bits (613),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIAR RLAEERKAWRKNHPHGFVAKP + PDG+VNL+VWHC IPGK GTDWEGG +P
Sbjct  1    MSDGIARSRLAEERKAWRKNHPHGFVAKPMSAPDGSVNLLVWHCVIPGKIGTDWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPP CKFP  FFHPNVYPSG VCLSIL+E  GWRP+ITV QILVGIQDL
Sbjct  61   LTINFSEDYPSKPPICKFPNGFFHPNVYPSGNVCLSILSERHGWRPSITVTQILVGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQ  478
            LDQPN +D AQTEGY +++ 
Sbjct  121  LDQPNASDYAQTEGYRVYVS  140



>ref|XP_006473287.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X3 [Citrus 
sinensis]
Length=132

 Score =   239 bits (610),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 125/160 (78%), Gaps = 28/160 (18%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERKAWRKNHPH                            TDWEGG +P
Sbjct  1    MSGGIARGRLTEERKAWRKNHPH----------------------------TDWEGGYFP  32

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDL
Sbjct  33   LTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDL  92

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LDQPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP++
Sbjct  93   LDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPVI  132



>gb|KDO84096.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
Length=133

 Score =   238 bits (606),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 124/158 (78%), Gaps = 28/158 (18%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRL EERKAWRKNHPH                            TDWEGG +PLT
Sbjct  4    GGIARGRLTEERKAWRKNHPH----------------------------TDWEGGYFPLT  35

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            ++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLD
Sbjct  36   LYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLD  95

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP++
Sbjct  96   QPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPVI  133



>ref|XP_004242945.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Solanum lycopersicum]
Length=161

 Score =   238 bits (608),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M G IAR RLAEER+ WR +HPHGFVAKPET PDG+VNLMVWHC IPGK  +DWEGG YP
Sbjct  1    MAGRIARLRLAEERRLWRMDHPHGFVAKPETAPDGSVNLMVWHCFIPGKPASDWEGGYYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCL-SILNEDSGWRPAITVKQILVGIQD  415
            +T+HFSE+YP  PPKCKFPQ FFHPNVYPSG VCL S+ N+  GW P ITVK+IL+ I  
Sbjct  61   MTIHFSENYPFMPPKCKFPQGFFHPNVYPSGKVCLQSLFNQGHGWSPTITVKEILIAIPY  120

Query  416  LLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LLD P+P   AQT+ Y+++IQD  EY+RRVRQQA+QYP   
Sbjct  121  LLDWPSPNYKAQTDSYNMYIQDNAEYRRRVRQQAEQYPAFF  161



>ref|XP_010318995.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X1 [Solanum 
lycopersicum]
Length=164

 Score =   238 bits (607),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIARGRL EERKAWRKNHPHGFVA+PET PDG+ NLM+W C IPGK GTDWEGG+YP
Sbjct  1    MAGGIARGRLTEERKAWRKNHPHGFVARPETGPDGSANLMLWRCIIPGKPGTDWEGGHYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTMHFSEDYPS+PPKCKFP+ FFH NVYPSG VCLSILN   GW PAITVKQILVGIQ+L
Sbjct  61   LTMHFSEDYPSQPPKCKFPRGFFHINVYPSGDVCLSILNTGLGWSPAITVKQILVGIQEL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTV  487
            LD+PNP+  AQ+E Y L+++  +
Sbjct  121  LDEPNPSSSAQSECYKLYVKKLL  143



>ref|XP_006434721.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
 gb|ESR47961.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
Length=133

 Score =   237 bits (604),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 124/158 (78%), Gaps = 28/158 (18%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIARGRL EERKAWRKNHPH                            TDWEGG +PLT
Sbjct  4    GGIARGRLTEERKAWRKNHPH----------------------------TDWEGGYFPLT  35

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            ++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILNED+GWRPAITVKQILVGIQDLLD
Sbjct  36   LYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLD  95

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            QPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP++
Sbjct  96   QPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPVL  133



>ref|XP_003580378.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X2 [Brachypodium 
distachyon]
Length=159

 Score =   237 bits (605),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 128/158 (81%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GGIAR RLAEERK+WRKNHPHGFVAKP+TLPDG+VNLMVW C IPGK GTDWEGG +PLT
Sbjct  4    GGIARARLAEERKSWRKNHPHGFVAKPDTLPDGSVNLMVWRCVIPGKQGTDWEGGYFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            + F++DYP+ PP CKFP  FFH NVY SG VCLSIL+  SGW+P+ITVKQ+LVGIQ+LLD
Sbjct  64   LEFNDDYPTVPPVCKFPSGFFHVNVYDSGLVCLSILS--SGWKPSITVKQVLVGIQELLD  121

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
              NP   AQ   Y L+ ++  EYK RVR+QAK+YP  V
Sbjct  122  DANPNSAAQQRCYELYKKNMPEYKNRVREQAKRYPSRV  159



>ref|NP_001159056.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 gb|ACG43792.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
 tpg|DAA36341.1| TPA: putative ubiquitin-conjugating enzyme family [Zea mays]
Length=159

 Score =   237 bits (605),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 130/158 (82%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GG ARGRLAEERKAWRK+HP GFVAKP  LPDG+VNLM+W+C +PGK GTDWEGG +P+T
Sbjct  4    GGAARGRLAEERKAWRKSHPLGFVAKPAMLPDGSVNLMLWNCVVPGKEGTDWEGGYFPVT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HF+E+YPS PP CKFP+ FFH NVY SG VCLSIL +   W P+ITV+QIL+GIQ+LL+
Sbjct  64   LHFTENYPSNPPTCKFPRRFFHVNVYDSGDVCLSILGD--AWAPSITVRQILIGIQELLE  121

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
             PNPA PAQ   Y +F ++  EYKRRVR+QAK+YP LV
Sbjct  122  NPNPASPAQDFAYDVFAENMPEYKRRVREQAKRYPSLV  159



>gb|ACG43810.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
Length=159

 Score =   236 bits (603),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 129/158 (82%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GG ARGRLAEERKAWRK+HP GFVAKP  LPDG+VNLM+W C +PGK GTDWEGG +P+T
Sbjct  4    GGAARGRLAEERKAWRKSHPLGFVAKPAMLPDGSVNLMLWDCVVPGKEGTDWEGGYFPVT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HF+E+YPS PP CKFP+ FFH NVY SG VCLSIL +   W P+ITV+QIL+GIQ+LL+
Sbjct  64   LHFTENYPSNPPTCKFPRRFFHVNVYDSGDVCLSILGD--AWAPSITVRQILIGIQELLE  121

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
             PNPA PAQ   Y +F ++  EYKRRVR+QAK+YP LV
Sbjct  122  NPNPASPAQDFAYDVFAENMPEYKRRVREQAKRYPSLV  159



>ref|XP_003293385.1| hypothetical protein DICPUDRAFT_58449 [Dictyostelium purpureum]
 gb|EGC30098.1| hypothetical protein DICPUDRAFT_58449 [Dictyostelium purpureum]
Length=159

 Score =   235 bits (599),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GI+  RL+EERK WRK+HP+GF A+P T  DG++NL VW C IPGK  T WE G YPL
Sbjct  1    MAGISSARLSEERKNWRKDHPYGFYARPTTNTDGSLNLFVWSCGIPGKKDTIWENGVYPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TM F+EDYPSKPPKC+FP+ FFHPNVYPSGTVCLSILNE+S W+P+IT+K +L+GIQDLL
Sbjct  61   TMEFTEDYPSKPPKCRFPKDFFHPNVYPSGTVCLSILNEESDWKPSITIKTVLLGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYP  529
            D PNP  PAQ    HLF+QD  EY ++VRQQAK YP
Sbjct  121  DNPNPKSPAQQLPIHLFLQDKDEYVKKVRQQAKSYP  156



>ref|XP_010059902.1| PREDICTED: SUMO-conjugating enzyme SCE1-like isoform X4 [Eucalyptus 
grandis]
Length=151

 Score =   234 bits (596),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 124/146 (85%), Gaps = 7/146 (5%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAG------TDW  220
            M  G+ARGRL+EER+AWRKNHPHGFVAKPET PDG+VNLMVWHCTIPGKAG      TDW
Sbjct  1    MSTGVARGRLSEERRAWRKNHPHGFVAKPETAPDGSVNLMVWHCTIPGKAGTFFLMQTDW  60

Query  221  EGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL  400
            EGGNYPLT++F+EDYPSK PKC FP+ FFH NVY SG VCLSILNED GWRP+ITV+QIL
Sbjct  61   EGGNYPLTLYFTEDYPSKAPKCMFPKDFFHLNVYGSGMVCLSILNED-GWRPSITVRQIL  119

Query  401  VGIQDLLDQPNPADPAQTEGYHLFIQ  478
            VG+QDLL QPNPA PA  + Y LF++
Sbjct  120  VGVQDLLHQPNPASPANYDEYELFVK  145



>gb|EFA82218.1| putative E2 enzyme Ubc9 [Polysphondylium pallidum PN500]
Length=159

 Score =   233 bits (594),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RL EERK WRK+HP GF A+P+   DG+ NL +W C IPG  GT WEGG YPL
Sbjct  1    MSGIALARLTEERKNWRKDHPFGFYARPKNNADGSANLFMWECGIPGVTGTLWEGGVYPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TM FSEDYPSKPPKC+FP+ FFHPN+YPSGTVCLSI+NED  W+P+I+VKQIL+GIQ+LL
Sbjct  61   TMEFSEDYPSKPPKCRFPKDFFHPNIYPSGTVCLSIVNEDGNWKPSISVKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PNP  PAQ     LFI D  EYK++VR+Q KQYPP
Sbjct  121  NEPNPKSPAQQLAITLFIHDMEEYKKKVREQTKQYPP  157



>ref|XP_011398219.1| SUMO-conjugating enzyme SCE1 [Auxenochlorella protothecoides]
 gb|KFM25326.1| SUMO-conjugating enzyme SCE1 [Auxenochlorella protothecoides]
Length=160

 Score =   232 bits (591),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M   +AR RL EERK WRKN P GF A+PET   G  NL+ W+C IPGK  T WEGG YP
Sbjct  1    MSLSVARSRLTEERKQWRKNKPFGFHARPETTSTGETNLLKWNCHIPGKENTLWEGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTM FSE+YP++PPKCKFP  FFHPN+YPSGTVCLSILNED GWRP+ITVKQILVGIQ+L
Sbjct  61   LTMEFSEEYPARPPKCKFPAGFFHPNIYPSGTVCLSILNEDEGWRPSITVKQILVGIQEL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            LD PNP  PAQ++ Y +F Q   EYKR+++  A +YPP
Sbjct  121  LDTPNPHSPAQSDAYLMFTQRLTEYKRKIKDVASKYPP  158



>gb|KDO84100.1| hypothetical protein CISIN_1g031420mg [Citrus sinensis]
Length=121

 Score =   230 bits (587),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  176  MVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILN  355
            M+W C IPGK GTDWEGG +PLT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILN
Sbjct  1    MIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILN  60

Query  356  EDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPL  535
            ED+GWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP+
Sbjct  61   EDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPV  120

Query  536  V  538
            +
Sbjct  121  I  121



>ref|XP_006434722.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
 gb|ESR47962.1| hypothetical protein CICLE_v10002741mg [Citrus clementina]
Length=121

 Score =   230 bits (586),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  176  MVWHCTIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILN  355
            M+W C IPGK GTDWEGG +PLT++FSEDYPSKPPKCKFPQ FFHPNVYPSGTVCLSILN
Sbjct  1    MIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILN  60

Query  356  EDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPL  535
            ED+GWRPAITVKQILVGIQDLLDQPNPADPAQT+GY LFIQD  EYKRRVRQQAKQYPP+
Sbjct  61   EDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPV  120

Query  536  V  538
            +
Sbjct  121  L  121



>ref|XP_001899558.1| ube2i2 protein [Brugia malayi]
 emb|CDQ00568.1| Protein BM-UBC-9, isoform b [Brugia malayi]
Length=168

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIA GRLAEERKAWRKNHP GF+AKP + PDGT NL +W C IPGK GT WEGG Y 
Sbjct  1    MSGGIAAGRLAEERKAWRKNHPFGFIAKPSSNPDGTRNLFIWECAIPGKKGTIWEGGLYK  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            + M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL+E+  W+P+I+V+Q+L+GIQDL
Sbjct  61   IRMQFKDDYPSTPPKCKFDPPLFHPNVYPSGTVCLSILDENKDWKPSISVRQLLIGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQY  526
            L  PN  DPAQ + Y ++ Q+ VEY++RVR+QA+Q+
Sbjct  121  LTNPNVDDPAQADAYQIYCQNRVEYEKRVRRQAQQF  156



>ref|XP_004873904.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Heterocephalus 
glaber]
Length=195

 Score =   232 bits (591),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = +2

Query  11   HPLVPKKPRNQTQHTKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHC  190
             P +P +P  Q Q T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C
Sbjct  21   QPPLPHRPVLQDQGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWEC  80

Query  191  TIPGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGW  370
             IPGK GT WEGG + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  W
Sbjct  81   AIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDW  140

Query  371  RPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            RPAIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  141  RPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  194



>ref|XP_002288880.1| ubiquitin conjugating enzyme [Thalassiosira pseudonana CCMP1335]
 gb|EED94316.1| ubiquitin conjugating enzyme [Thalassiosira pseudonana CCMP1335]
Length=161

 Score =   230 bits (586),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +2

Query  68   GIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLTM  247
            GIARGRLAEERKAWR++HP+GF A+P +  DG+ +LM W   IPGK GTDWE G Y + +
Sbjct  5    GIARGRLAEERKAWRRDHPYGFYARPVSRGDGSSDLMKWETGIPGKEGTDWESGVYKVML  64

Query  248  HFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQ  427
             FS++YPSKPPKCKF    FHPNVYPSGT+CLSILNE+ GWRPAITVKQ+L+GIQDLLD 
Sbjct  65   EFSDEYPSKPPKCKFVPPLFHPNVYPSGTICLSILNEEEGWRPAITVKQMLLGIQDLLDT  124

Query  428  PNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            PNP  PAQ+E Y+LFI +  EYKRRV+ +A++  P
Sbjct  125  PNPNSPAQSEAYNLFINNKAEYKRRVKAEARKNTP  159



>gb|KJB70051.1| hypothetical protein B456_011G056100 [Gossypium raimondii]
Length=135

 Score =   229 bits (583),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIAR RLAEERKAWRKNHPHGFVAKP+T  DG+V+LMVWHC IPGK G +WEGG +P
Sbjct  1    MSDGIARSRLAEERKAWRKNHPHGFVAKPKTRADGSVDLMVWHCVIPGKKGVNWEGGYFP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LT++FSE+YPSKPPKCKFP  F HPNVYPSG VCLSI++E  GWRP+ITVKQI+VGIQDL
Sbjct  61   LTLNFSEEYPSKPPKCKFPNGFLHPNVYPSGIVCLSIISERRGWRPSITVKQIIVGIQDL  120

Query  419  LDQPNPADPAQTEGY  463
            LDQPN  D AQTEG+
Sbjct  121  LDQPNATDAAQTEGH  135



>ref|XP_007908470.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Callorhinchus milii]
 ref|XP_007908471.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Callorhinchus milii]
Length=158

 Score =   229 bits (585),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG Y L
Sbjct  1    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTLNLMNWECAIPGKKGTAWEGGQYKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  61   RMLFKDDYPSSPPKCKFEPPIFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  121  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  157



>ref|XP_005448278.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Oreochromis 
niloticus]
Length=166

 Score =   229 bits (585),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 126/164 (77%), Gaps = 0/164 (0%)
 Frame = +2

Query  41   QTQHTKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDW  220
            Q +  +++ GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT W
Sbjct  2    QVRSPQIMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPW  61

Query  221  EGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQIL  400
            EGG + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL
Sbjct  62   EGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQIL  121

Query  401  VGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +GIQ+LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  122  LGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFSP  165



>ref|XP_009858945.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Ciona intestinalis]
Length=160

 Score =   229 bits (584),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RL+EERK+WRK+HP GFVAKP   PD T+NLM W C IPGK GT WEGG Y +
Sbjct  1    MNGIATARLSEERKSWRKDHPFGFVAKPTKNPDHTLNLMNWECAIPGKKGTSWEGGLYKI  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKC+F  A FHPNVYPSGTVCLSIL+ED  WRPAIT+KQIL+GIQDLL
Sbjct  61   RMIFKDDYPSSPPKCRFEPALFHPNVYPSGTVCLSILDEDKDWRPAITIKQILLGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPL  535
             +PN  DPAQ E Y ++ Q+ VEY +RV++QAKQ+  L
Sbjct  121  TEPNINDPAQAEAYAIYSQNKVEYDKRVKEQAKQFSGL  158



>ref|XP_005851683.1| hypothetical protein CHLNCDRAFT_59526 [Chlorella variabilis]
 gb|EFN59581.1| hypothetical protein CHLNCDRAFT_59526 [Chlorella variabilis]
Length=160

 Score =   229 bits (584),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 126/160 (79%), Gaps = 1/160 (1%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPD-GTVNLMVWHCTIPGKAGTDWEGGNYP  238
            + G+AR RLAEERKAWRK+ P GF A+PE   + G  N+M W C IPGK  T W+GG YP
Sbjct  1    MAGVARSRLAEERKAWRKDKPFGFHARPELNEETGETNMMRWKCYIPGKEDTIWQGGFYP  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            LTM F+EDYP+KPPKCK P  FFHPN+YPSGTVCLSILNED GWRP+ITVKQIL+GIQ+L
Sbjct  61   LTMEFTEDYPAKPPKCKLPAGFFHPNIYPSGTVCLSILNEDEGWRPSITVKQILLGIQEL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            LD PNP  PAQ++ + +F Q   EYK+RV+Q+A +YPP V
Sbjct  121  LDNPNPLSPAQSDAFVMFQQRLEEYKKRVKQEAAKYPPPV  160



>ref|XP_004976582.1| PREDICTED: SUMO-conjugating enzyme SCE1-like [Setaria italica]
Length=159

 Score =   229 bits (583),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 125/158 (79%), Gaps = 2/158 (1%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPLT  244
            GG+A  RLAEERK+WRK+HPHGFVAKPETLPDG+VNL++W C IPGK GTDWEGG +PLT
Sbjct  4    GGVAVCRLAEERKSWRKSHPHGFVAKPETLPDGSVNLLLWKCVIPGKKGTDWEGGYFPLT  63

Query  245  MHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLD  424
            +HFSE+YP  PP CKFP  FFH NVY  G VCLSIL +   W P+ITV QILV IQDLLD
Sbjct  64   VHFSENYPDHPPICKFPAGFFHVNVYDPGAVCLSILGD--AWNPSITVPQILVCIQDLLD  121

Query  425  QPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
             PNP   AQ   YHL+ ++  EYK+RVRQQAK+YP LV
Sbjct  122  NPNPISRAQRFIYHLYAKNMPEYKKRVRQQAKRYPSLV  159



>ref|XP_007576679.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Poecilia 
formosa]
 ref|XP_008434542.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Poecilia 
reticulata]
Length=162

 Score =   228 bits (582),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  5    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  64

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  65   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  124

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK+Y P
Sbjct  125  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKYSP  161



>gb|ACI67992.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
Length=157

 Score =   228 bits (582),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  1    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  61   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ QD VEY++RVR QAK++ P
Sbjct  121  NEPNIQDPAQAEAYTIYCQDRVEYEKRVRAQAKKFSP  157



>pdb|4L83|A Chain A, Structure Of A Putative Ubiquitin-conjugating Enzyme 
E2 From Brugia Malayi
Length=175

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA GRLAEERKAWRKNHP GF+AKP + PDGT NL +W C IPGK GT WEGG Y +
Sbjct  9    MSGIAAGRLAEERKAWRKNHPFGFIAKPSSNPDGTRNLFIWECAIPGKKGTIWEGGLYKI  68

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL+E+  W+P+I+V+Q+L+GIQDLL
Sbjct  69   RMQFKDDYPSTPPKCKFDPPLFHPNVYPSGTVCLSILDENKDWKPSISVRQLLIGIQDLL  128

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQY  526
              PN  DPAQ + Y ++ Q+ VEY++RVR+QA+Q+
Sbjct  129  TNPNVDDPAQADAYQIYCQNRVEYEKRVRRQAQQF  163



>ref|NP_001147178.1| LOC100280784 [Zea mays]
 gb|ACG25870.1| ubiquitin-conjugating enzyme E2 I [Zea mays]
Length=172

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 130/171 (76%), Gaps = 15/171 (9%)
 Frame = +2

Query  65   GGIARGRLAEERKAWRKNHPH-------------GFVAKPETLPDGTVNLMVWHCTIPGK  205
            GG ARGRLAEERKAWRK+HP              GFVAKP  LPDG+VNLM+W+C +PGK
Sbjct  4    GGAARGRLAEERKAWRKSHPLVGAVILSASSLLLGFVAKPAMLPDGSVNLMLWNCVVPGK  63

Query  206  AGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAIT  385
             GTDWEGG +P+T+HF+E+YPS PP CKFP+ FFH NVY SG VCLSIL +   W P+IT
Sbjct  64   EGTDWEGGYFPVTLHFTENYPSIPPTCKFPRRFFHVNVYDSGDVCLSILGD--AWAPSIT  121

Query  386  VKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            V+QIL+GIQ+LL+ PNPA PAQ   Y +F ++  EYKRRVR+QAK+YP LV
Sbjct  122  VRQILIGIQELLENPNPASPAQDFAYDVFAENMPEYKRRVREQAKRYPSLV  172



>ref|XP_010390839.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Corvus cornix cornix]
Length=190

 Score =   229 bits (584),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 124/163 (76%), Gaps = 0/163 (0%)
 Frame = +2

Query  44   TQHTKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWE  223
             Q T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WE
Sbjct  27   NQGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWE  86

Query  224  GGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILV  403
            GG + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+
Sbjct  87   GGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILL  146

Query  404  GIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            GIQ+LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  147  GIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  189



>ref|XP_005803294.1| PREDICTED: SUMO-conjugating enzyme UBC9-like [Xiphophorus maculatus]
 ref|XP_007576680.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Poecilia 
formosa]
 ref|XP_007576681.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Poecilia 
formosa]
 ref|XP_008434543.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Poecilia 
reticulata]
Length=158

 Score =   228 bits (581),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  1    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  61   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK+Y P
Sbjct  121  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKYSP  157



>ref|XP_637050.1| hypothetical protein DDB_G0287693 [Dictyostelium discoideum AX4]
 sp|Q9NGP4.1|UBC9_DICDI RecName: Full=Sumo-conjugating enzyme ubc9; AltName: Full=Sumo-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9 
[Dictyostelium discoideum]
 gb|AAF65153.1|AF246690_1 putative E2 enzyme Ubc9 [Dictyostelium discoideum]
 gb|EAL63493.1| hypothetical protein DDB_G0287693 [Dictyostelium discoideum AX4]
Length=159

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GI+  RL+EERK WR++HP+GF A+P T  DG++NL VW+C IPGK  T+WEGG YPL
Sbjct  1    MAGISSARLSEERKNWRRDHPYGFFARPSTNTDGSLNLYVWNCGIPGKTKTNWEGGVYPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F+EDYPSKPPKC+FP+ FFHPNVYPSGTVCLSILNE++ W+P++T+K +L+GIQDLL
Sbjct  61   IMEFTEDYPSKPPKCRFPKDFFHPNVYPSGTVCLSILNEEADWKPSVTIKTVLLGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            D PNP  PAQ    HLF+ +  EY ++V+ Q+K YPP
Sbjct  121  DNPNPKSPAQQLPIHLFLTNKEEYDKKVKAQSKVYPP  157



>ref|XP_005697407.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Capra hircus]
Length=171

 Score =   228 bits (581),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +2

Query  38   NQTQHTKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTD  217
            N  +    + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT 
Sbjct  6    NSFREDANMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTP  65

Query  218  WEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQI  397
            WEGG + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQI
Sbjct  66   WEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQI  125

Query  398  LVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            L+GIQ+LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  126  LLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  170



>ref|XP_010568841.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Haliaeetus 
leucocephalus]
Length=177

 Score =   228 bits (582),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 128/172 (74%), Gaps = 0/172 (0%)
 Frame = +2

Query  17   LVPKKPRNQTQHTKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTI  196
            ++P++  +       + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C I
Sbjct  5    VIPRRRSSADGGILNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAI  64

Query  197  PGKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRP  376
            PGK GT WEGG + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRP
Sbjct  65   PGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRP  124

Query  377  AITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            AIT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  125  AITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  176



>ref|XP_007063734.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Chelonia 
mydas]
Length=167

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  10   MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  69

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  70   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  129

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  130  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  166



>gb|EFO23090.2| SUMO-conjugating enzyme UBC9 [Loa loa]
Length=168

 Score =   228 bits (580),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIA GRLAEERKAWRKNHP GF+AKP + PDGT NL  W C IPGK GT WEGG Y 
Sbjct  1    MSGGIAAGRLAEERKAWRKNHPFGFIAKPSSNPDGTRNLFNWECAIPGKKGTIWEGGLYK  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            + M F +DYPS PPKCKF    FHPNVYPSGTVCLS+L+E+  W+P+++V+Q+L+GIQDL
Sbjct  61   IRMQFKDDYPSTPPKCKFDPPLFHPNVYPSGTVCLSLLDENKDWKPSVSVRQLLIGIQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            L  PN  DPAQ + Y ++ Q+ VEY++RVR+QA+Q+   V
Sbjct  121  LTNPNVEDPAQADAYQIYCQNRVEYEKRVRRQAQQFAAEV  160



>ref|XP_004562508.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Maylandia 
zebra]
Length=176

 Score =   228 bits (581),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +2

Query  56   KMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNY  235
            +++ GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG +
Sbjct  17   QIMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLF  76

Query  236  PLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQD  415
             L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+
Sbjct  77   KLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQE  136

Query  416  LLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  137  LLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFSP  175



>ref|XP_006245980.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Rattus norvegicus]
Length=182

 Score =   228 bits (581),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  22   TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  81

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  82   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  141

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  142  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  181



>ref|XP_006123351.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pelodiscus sinensis]
Length=167

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  10   MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  69

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  70   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  129

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  130  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  166



>dbj|BAD92225.1| ubiquitin-conjugating enzyme E2I variant [Homo sapiens]
Length=171

 Score =   228 bits (580),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  11   TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  70

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  71   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  130

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  131  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  170



>ref|XP_005621791.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform X4 [Canis lupus 
familiaris]
Length=168

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  8    TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  67

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  68   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  127

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  128  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  167



>ref|XP_011500210.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Ceratosolen solmsi 
marchali]
 ref|XP_011500211.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Ceratosolen solmsi 
marchali]
Length=159

 Score =   227 bits (578),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLAEERKAWRK+HP GFVA+P   PDGT+NLM W C IPGK GT WEGG Y L
Sbjct  1    MSGIAIARLAEERKAWRKDHPFGFVARPTKNPDGTLNLMSWECAIPGKKGTPWEGGLYKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLS+L+E+  WRPAIT+KQIL+GIQDLL
Sbjct  61   RMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ +EY++RVR QA+   P
Sbjct  121  NEPNVKDPAQAEAYTIYCQNRLEYEKRVRAQARAMAP  157



>ref|XP_007100183.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Physeter 
catodon]
Length=254

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = +2

Query  35   RNQTQHTKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGT  214
            R+  Q    + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT
Sbjct  88   RSLVQRDANMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGT  147

Query  215  DWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQ  394
             WEGG + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQ
Sbjct  148  PWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQ  207

Query  395  ILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            IL+GIQ+LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  208  ILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  253



>ref|XP_006037209.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Alligator 
sinensis]
 ref|XP_006268488.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Alligator 
mississippiensis]
Length=169

 Score =   227 bits (579),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  9    TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  68

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  69   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  128

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  129  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  168



>ref|XP_005866608.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Myotis brandtii]
Length=164

 Score =   227 bits (578),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  4    TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  63

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  64   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  123

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  124  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  163



>ref|XP_005697408.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Capra hircus]
Length=165

 Score =   227 bits (579),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  8    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  67

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  68   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  127

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  128  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  164



>gb|KFP20677.1| SUMO-conjugating enzyme UBC9, partial [Egretta garzetta]
Length=162

 Score =   227 bits (578),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  2    TVNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  61

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  62   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  121

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  122  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  161



>gb|EMC86701.1| SUMO-conjugating enzyme UBC9, partial [Columba livia]
 gb|KFO59142.1| SUMO-conjugating enzyme UBC9, partial [Corvus brachyrhynchos]
 gb|KFO81001.1| SUMO-conjugating enzyme UBC9, partial [Cuculus canorus]
 gb|KFO94285.1| SUMO-conjugating enzyme UBC9, partial [Buceros rhinoceros silvestris]
 gb|KFP24952.1| SUMO-conjugating enzyme UBC9, partial [Colius striatus]
 gb|KFP41832.1| SUMO-conjugating enzyme UBC9, partial [Chlamydotis macqueenii]
 gb|KFP63080.1| SUMO-conjugating enzyme UBC9, partial [Cariama cristata]
 gb|KFP71123.1| SUMO-conjugating enzyme UBC9, partial [Acanthisitta chloris]
 gb|KFP74994.1| SUMO-conjugating enzyme UBC9, partial [Apaloderma vittatum]
 gb|KFP99428.1| SUMO-conjugating enzyme UBC9, partial [Leptosomus discolor]
 gb|KFQ20145.1| SUMO-conjugating enzyme UBC9, partial [Mesitornis unicolor]
 gb|KFQ20945.1| SUMO-conjugating enzyme UBC9, partial [Merops nubicus]
 gb|KFQ66495.1| SUMO-conjugating enzyme UBC9, partial [Pelecanus crispus]
 gb|KFQ66785.1| SUMO-conjugating enzyme UBC9, partial [Phaethon lepturus]
 gb|KFQ87332.1| SUMO-conjugating enzyme UBC9, partial [Phoenicopterus ruber ruber]
 gb|KFQ99985.1| SUMO-conjugating enzyme UBC9, partial [Nipponia nippon]
 gb|KFR16481.1| SUMO-conjugating enzyme UBC9, partial [Opisthocomus hoazin]
 gb|KFV05403.1| SUMO-conjugating enzyme UBC9, partial [Tauraco erythrolophus]
 gb|KFV06404.1| SUMO-conjugating enzyme UBC9, partial [Pterocles gutturalis]
 gb|KFV42659.1| SUMO-conjugating enzyme UBC9, partial [Gavia stellata]
 gb|KFV61532.1| SUMO-conjugating enzyme UBC9, partial [Picoides pubescens]
 gb|KFV90352.1| SUMO-conjugating enzyme UBC9, partial [Eurypyga helias]
 gb|KFV95287.1| SUMO-conjugating enzyme UBC9, partial [Fulmarus glacialis]
 gb|KFW64662.1| SUMO-conjugating enzyme UBC9, partial [Pygoscelis adeliae]
 gb|KFW84556.1| SUMO-conjugating enzyme UBC9, partial [Manacus vitellinus]
 gb|KFW92898.1| SUMO-conjugating enzyme UBC9, partial [Phalacrocorax carbo]
 gb|KFZ63056.1| SUMO-conjugating enzyme UBC9, partial [Podiceps cristatus]
Length=162

 Score =   227 bits (578),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  2    TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  61

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  62   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  121

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  122  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  161



>pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed 
By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 
And Rangap1
 pdb|1KPS|C Chain C, Structural Basis For E2-Mediated Sumo Conjugation Revealed 
By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 
And Rangap1
Length=159

 Score =   227 bits (578),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  2    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  61

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  62   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  121

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  122  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  158



>ref|XP_010873204.1| PREDICTED: SUMO-conjugating enzyme UBC9-B-like [Esox lucius]
Length=157

 Score =   226 bits (577),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  1    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  61   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  121  NEPNVQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFSP  157



>ref|NP_001187932.1| sumo-conjugating enzyme ubc9 [Ictalurus punctatus]
 ref|XP_003438817.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Oreochromis 
niloticus]
 ref|XP_004080405.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Oryzias latipes]
 ref|XP_004562509.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Maylandia 
zebra]
 ref|XP_004562510.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X3 [Maylandia 
zebra]
 ref|XP_004562511.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X4 [Maylandia 
zebra]
 ref|XP_005448279.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X3 [Oreochromis 
niloticus]
 ref|XP_005448280.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X4 [Oreochromis 
niloticus]
 ref|XP_005721637.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005721638.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Pundamilia 
nyererei]
 ref|XP_005721639.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X3 [Pundamilia 
nyererei]
 ref|XP_005939577.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_005939578.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_006637129.1| PREDICTED: SUMO-conjugating enzyme UBC9-like [Lepisosteus oculatus]
 ref|XP_006801101.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Neolamprologus 
brichardi]
 ref|XP_006801102.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Neolamprologus 
brichardi]
 ref|XP_008301925.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Stegastes partitus]
 ref|XP_008312442.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Cynoglossus semilaevis]
 ref|XP_010734550.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Larimichthys crocea]
 ref|XP_010770433.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Notothenia coriiceps]
 ref|XP_010887168.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Esox lucius]
 ref|XP_011486461.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Oryzias latipes]
 gb|ACM08908.1| SUMO-conjugating enzyme UBC9 [Salmo salar]
 gb|ACM09251.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
 gb|ACM09362.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
 gb|ACO08197.1| SUMO-1-conjugating enzyme UBC9 [Oncorhynchus mykiss]
 gb|ACO08675.1| SUMO-1-conjugating enzyme UBC9 [Oncorhynchus mykiss]
 gb|ACO08888.1| SUMO-1-conjugating enzyme UBC9 [Osmerus mordax]
 gb|ACQ58614.1| SUMO-conjugating enzyme UBC9 [Anoplopoma fimbria]
 gb|ADO29316.1| sumo-conjugating enzyme ubc9 [Ictalurus punctatus]
 emb|CBN81292.1| SUMO-conjugating enzyme UBC9 [Dicentrarchus labrax]
 gb|AGH92631.1| SUMO-conjugating enzyme UBC9 [Salmo salar]
Length=158

 Score =   226 bits (577),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  1    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  61   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  121  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFSP  157



>ref|XP_010282674.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Phaethon 
lepturus]
Length=165

 Score =   227 bits (578),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  5    TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  64

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  65   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  124

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  125  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  164



>gb|KFQ56066.1| SUMO-conjugating enzyme UBC9, partial [Nestor notabilis]
Length=160

 Score =   227 bits (578),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  3    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  62

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  63   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  122

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  123  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  159



>ref|NP_003336.1| SUMO-conjugating enzyme UBC9 [Homo sapiens]
 ref|NP_037182.1| SUMO-conjugating enzyme UBC9 [Rattus norvegicus]
 ref|NP_035795.1| SUMO-conjugating enzyme UBC9 [Mus musculus]
 ref|NP_919235.1| SUMO-conjugating enzyme UBC9 [Homo sapiens]
 ref|NP_919236.1| SUMO-conjugating enzyme UBC9 [Homo sapiens]
 ref|NP_919237.1| SUMO-conjugating enzyme UBC9 [Homo sapiens]
 ref|NP_989596.1| SUMO-conjugating enzyme UBC9 [Gallus gallus]
 ref|NP_001016408.1| SUMO-conjugating enzyme UBC9 [Xenopus (Silurana) tropicalis]
 ref|NP_001080758.1| SUMO-conjugating enzyme UBC9 [Xenopus laevis]
 ref|NP_001092842.1| SUMO-conjugating enzyme UBC9 [Bos taurus]
 ref|NP_001171080.1| SUMO-conjugating enzyme UBC9 [Mus musculus]
 ref|NP_001171081.1| SUMO-conjugating enzyme UBC9 [Mus musculus]
 ref|NP_001181765.1| SUMO-conjugating enzyme UBC9 [Macaca mulatta]
 ref|NP_001191298.1| SUMO-conjugating enzyme UBC9 [Sus scrofa]
 ref|NP_001269197.1| SUMO-conjugating enzyme UBC9 [Ictidomys tridecemlineatus]
 ref|XP_001362136.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform X1 [Monodelphis 
domestica]
 ref|XP_001497036.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Equus caballus]
 ref|XP_002708678.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Oryctolagus cuniculus]
 ref|XP_002802397.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform 3 [Macaca 
mulatta]
 ref|XP_001118584.2| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform 1 [Macaca 
mulatta]
 ref|XP_002825992.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pongo abelii]
 ref|XP_002920223.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Ailuropoda melanoleuca]
 ref|XP_003228308.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Anolis carolinensis]
 ref|XP_003314952.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan troglodytes]
 ref|XP_003314953.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan troglodytes]
 ref|XP_003314954.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan troglodytes]
 ref|XP_003314955.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan troglodytes]
 ref|XP_003478486.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Cavia porcellus]
 ref|XP_003501621.1| PREDICTED: SUMO-conjugating enzyme UBC9-like [Cricetulus griseus]
 ref|XP_003762040.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Sarcophilus harrisii]
 ref|XP_003790814.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 1 [Otolemur garnettii]
 ref|XP_003790815.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 2 [Otolemur garnettii]
 ref|XP_003807672.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan paniscus]
 ref|XP_003807675.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pan paniscus]
 ref|XP_003928414.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Saimiri boliviensis 
boliviensis]
 ref|XP_004020754.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform 1 [Ovis 
aries]
 ref|XP_004020755.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform 2 [Ovis 
aries]
 ref|XP_004056984.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004056985.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 3 [Gorilla gorilla 
gorilla]
 ref|XP_004056986.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 4 [Gorilla gorilla 
gorilla]
 ref|XP_004056987.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 5 [Gorilla gorilla 
gorilla]
 ref|XP_004056988.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 6 [Gorilla gorilla 
gorilla]
 ref|XP_004056989.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 7 [Gorilla gorilla 
gorilla]
 ref|XP_004270391.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Orcinus orca]
 ref|XP_004373204.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Trichechus manatus latirostris]
 ref|XP_004403169.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 1 [Odobenus rosmarus 
divergens]
 ref|XP_004438268.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004466439.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform 2 [Dasypus 
novemcinctus]
 ref|XP_004466441.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform 4 [Dasypus 
novemcinctus]
 ref|XP_004596658.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Ochotona princeps]
 ref|XP_004604259.1| PREDICTED: SUMO-conjugating enzyme UBC9-like [Sorex araneus]
 ref|XP_004652200.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Jaculus jaculus]
 ref|XP_004627971.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Octodon degus]
 ref|XP_004705847.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Echinops telfairi]
 ref|XP_004750875.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Mustela putorius 
furo]
 ref|XP_004750876.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Mustela putorius 
furo]
 ref|XP_004821061.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Mustela putorius 
furo]
 ref|XP_004821062.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Mustela putorius 
furo]
 ref|XP_004873905.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004873906.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Heterocephalus 
glaber]
 ref|XP_005007427.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Cavia porcellus]
 ref|XP_005018677.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Anas platyrhynchos]
 ref|XP_005054678.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Ficedula 
albicollis]
 ref|XP_005054679.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Ficedula 
albicollis]
 ref|XP_005054680.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Ficedula 
albicollis]
 ref|XP_005054681.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X4 [Ficedula 
albicollis]
 ref|XP_005142194.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Melopsittacus undulatus]
 ref|XP_005240263.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Falco peregrinus]
 ref|XP_005288940.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Chrysemys picta bellii]
 ref|XP_005349160.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform X2 [Microtus 
ochrogaster]
 ref|XP_005349161.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform X3 [Microtus 
ochrogaster]
 ref|XP_005391642.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Chinchilla 
lanigera]
 ref|XP_005391643.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Chinchilla 
lanigera]
 ref|XP_005391644.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X4 [Chinchilla 
lanigera]
 ref|XP_005443636.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Falco cherrug]
 ref|XP_005494552.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Zonotrichia albicollis]
 ref|XP_005426030.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Geospiza 
fortis]
 ref|XP_005523174.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Pseudopodoces 
humilis]
 ref|XP_005523175.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pseudopodoces 
humilis]
 ref|XP_005505754.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Columba livia]
 ref|XP_005590899.1| PREDICTED: SUMO-conjugating enzyme UBC9-B isoform X2 [Macaca 
fascicularis]
 ref|XP_005655187.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Sus scrofa]
 ref|XP_005655188.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Sus scrofa]
 ref|XP_005655189.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Sus scrofa]
 ref|XP_005655190.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X4 [Sus scrofa]
 ref|XP_005957665.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pantholops hodgsonii]
 ref|XP_006107145.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Myotis lucifugus]
 ref|XP_006174069.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Camelus ferus]
 ref|XP_006204311.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Vicugna pacos]
 ref|XP_006146425.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Tupaia chinensis]
 ref|XP_006245981.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Rattus norvegicus]
 ref|XP_006245982.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Rattus norvegicus]
 ref|XP_006543476.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Mus musculus]
 ref|XP_006524111.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Mus musculus]
 ref|XP_006524112.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Mus musculus]
 ref|XP_006721002.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X4 [Homo sapiens]
 ref|XP_006764003.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Myotis davidii]
 ref|XP_006901973.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Elephantulus edwardii]
 ref|XP_006873913.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Chrysochloris asiatica]
 ref|XP_006971735.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Peromyscus maniculatus 
bairdii]
 ref|XP_006978856.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006978857.1| PREDICTED: SUMO-conjugating enzyme UBC9-like isoform X2 [Peromyscus 
maniculatus bairdii]
 ref|XP_007098722.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Panthera tigris altaica]
 ref|XP_007063735.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Chelonia 
mydas]
 ref|XP_007063736.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Chelonia 
mydas]
 ref|XP_007100185.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Physeter 
catodon]
 ref|XP_007100186.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X4 [Physeter 
catodon]
 ref|XP_007100187.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X5 [Physeter 
catodon]
 ref|XP_007100188.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X6 [Physeter 
catodon]
 ref|XP_007100189.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X7 [Physeter 
catodon]
 ref|XP_007100190.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X8 [Physeter 
catodon]
 ref|XP_006043825.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Bubalus bubalis]
 ref|XP_006043826.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Bubalus bubalis]
 ref|XP_007181803.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007181804.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007528059.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Erinaceus europaeus]
 ref|XP_007640349.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Cricetulus 
griseus]
 ref|XP_007606686.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Cricetulus 
griseus]
 ref|XP_007606687.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Cricetulus 
griseus]
 ref|XP_007937697.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Orycteropus afer afer]
 ref|XP_008120065.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Anolis carolinensis]
 ref|XP_008068489.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Tarsius syrichta]
 ref|XP_008144582.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Eptesicus fuscus]
 ref|XP_008488620.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Calypte anna]
 ref|XP_008488627.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Calypte anna]
 ref|XP_008507395.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Equus przewalskii]
 ref|XP_008579457.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Galeopterus 
variegatus]
 ref|XP_008579465.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Galeopterus 
variegatus]
 ref|XP_008579471.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X3 [Galeopterus 
variegatus]
 ref|XP_008631762.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Corvus brachyrhynchos]
 ref|XP_008631764.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Corvus brachyrhynchos]
 ref|XP_008854385.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Nannospalax galili]
 ref|XP_008854386.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Nannospalax galili]
 ref|XP_008926353.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Manacus vitellinus]
 ref|XP_008945297.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Merops nubicus]
 ref|XP_009007131.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Callithrix jacchus]
 ref|XP_009007133.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Callithrix jacchus]
 ref|XP_009007134.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Callithrix jacchus]
 ref|XP_009078931.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Acanthisitta chloris]
 ref|XP_009089966.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Serinus canaria]
 ref|XP_009089967.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Serinus canaria]
 ref|XP_009193899.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Papio anubis]
 ref|XP_009193900.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Papio anubis]
 ref|XP_003916379.2| PREDICTED: SUMO-conjugating enzyme UBC9 [Papio anubis]
 ref|XP_009284790.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Aptenodytes 
forsteri]
 ref|XP_009248552.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pongo abelii]
 ref|XP_009318786.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pygoscelis adeliae]
 ref|XP_009489665.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pelecanus crispus]
 ref|XP_009466139.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Nipponia nippon]
 ref|XP_009466140.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Nipponia nippon]
 ref|XP_009506456.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Phalacrocorax carbo]
 ref|XP_009565758.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Cuculus canorus]
 ref|XP_009582677.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Fulmarus glacialis]
 ref|XP_009642754.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Egretta garzetta]
 ref|XP_009809901.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Gavia stellata]
 ref|XP_009694527.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Cariama cristata]
 ref|XP_009865051.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Apaloderma vittatum]
 ref|XP_009893125.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Charadrius vociferus]
 ref|XP_009897212.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Picoides pubescens]
 ref|XP_009918273.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Haliaeetus 
albicilla]
 ref|XP_009940264.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Opisthocomus hoazin]
 ref|XP_009951723.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Leptosomus discolor]
 ref|XP_009986405.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Tauraco erythrolophus]
 ref|XP_010019930.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Nestor notabilis]
 ref|XP_009961917.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Tyto alba]
 ref|XP_010000861.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Chaetura pelagica]
 ref|XP_010141728.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Buceros rhinoceros silvestris]
 ref|XP_010158047.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Eurypyga helias]
 ref|XP_010169641.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Caprimulgus carolinensis]
 ref|XP_010071158.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Pterocles gutturalis]
 ref|XP_010191869.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Mesitornis unicolor]
 ref|XP_010118496.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Chlamydotis macqueenii]
 ref|XP_010196900.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Colius striatus]
 ref|XP_010220356.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Tinamus guttatus]
 ref|XP_010282673.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Phaethon 
lepturus]
 ref|XP_010386100.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Rhinopithecus roxellana]
 ref|XP_010568842.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Haliaeetus 
leucocephalus]
 ref|XP_010568843.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Haliaeetus 
leucocephalus]
 ref|XP_010568844.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Haliaeetus 
leucocephalus]
 ref|XP_010618830.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Fukomys damarensis]
 ref|XP_010595744.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Loxodonta 
africana]
 ref|XP_010717788.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Meleagris gallopavo]
 ref|XP_010834846.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Bison bison bison]
 ref|XP_010834854.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Bison bison bison]
 ref|XP_010948232.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Camelus bactrianus]
 ref|XP_010990946.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Camelus dromedarius]
 ref|XP_011224461.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Ailuropoda melanoleuca]
 ref|XP_011289040.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Felis catus]
 ref|XP_011375128.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Pteropus 
vampyrus]
 sp|P63281.1|UBC9_RAT RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-conjugating 
enzyme UbcE2A; AltName: Full=Ubiquitin-protein ligase 
I [Rattus norvegicus]
 sp|P63279.1|UBC9_HUMAN RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I; AltName: Full=p18 [Homo sapiens]
 sp|P63280.1|UBC9_MOUSE RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
Short=mUBC9; AltName: Full=Ubiquitin carrier protein I; AltName: 
Full=Ubiquitin-conjugating enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I [Mus musculus]
 sp|P63282.1|UBC9_XENLA RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I [Xenopus laevis]
 sp|P63283.1|UBC9_CHICK RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I [Gallus gallus]
 sp|Q2EF73.1|UBC9_SPETR RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I [Ictidomys tridecemlineatus]
 sp|Q28CQ4.1|UBC9_XENTR RecName: Full=SUMO-conjugating enzyme UBC9; AltName: Full=SUMO-protein 
ligase; AltName: Full=Ubiquitin carrier protein 9; 
AltName: Full=Ubiquitin carrier protein I; AltName: Full=Ubiquitin-conjugating 
enzyme E2 I; AltName: Full=Ubiquitin-protein 
ligase I [Xenopus (Silurana) tropicalis]
 pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, 
Rangap1 And Nup358RANBP2
 pdb|2PX9|B Chain B, The Intrinsic Affinity Between E2 And The Cys Domain 
Of E1 In Ubiquitin-Like Modifications
 pdb|2VRR|A Chain A, Structure Of Sumo Modified Ubc9
 pdb|2XWU|A Chain A, Crystal Structure Of Importin 13 - Ubc9 Complex
 pdb|3UIN|A Chain A, Complex Between Human Rangap1-sumo2, Ubc9 And The Ir1 
Domain From Ranbp2
 gb|AAK61274.1|AE006466_9 ubiquitin conjugating enzyme E2 [Homo sapiens]
 gb|AAL85282.1|AF461016_1 ubiquitin-conjugating enzyme [Gallus gallus]
 gb|AAC51361.1| ubiquitin conjugating enzyme [Homo sapiens]
 gb|AAA86662.1| ubiquitin-conjugating enzyme [Homo sapiens]
 dbj|BAA08091.1| ubiquitin conjugating enzyme [Homo sapiens]
 gb|AAB02181.1| ubiquitin conjugating enzyme homolog [Homo sapiens]
 gb|AAB02182.1| ubiquitin conjugating enzyme homolog [Mus musculus]
 emb|CAA65287.1| ubiquitin conjugating enzyme [Homo sapiens]
 emb|CAA68072.1| ubiquitin conjugating enzyme [Mus musculus]
 gb|AAC50715.1| ubiquitin conjugating enzyme 9 [Homo sapiens]
 gb|AAC50716.1| ubiquitin conjugating enzyme 9 [Homo sapiens]
 gb|AAB09410.1| RAD6 homolog; May be involved in ubiquitin conjugation; Interacts 
with RAD52 and RAD51 proteins; Method: conceptual translation 
supplied by author [Homo sapiens]
 gb|AAB18790.1| ubiquitin conjugating enzyme mUBC9 [Mus musculus]
 gb|AAB48446.1| ubiquitin-conjugating enzyme mE2 [Mus musculus]
 gb|AAB52424.1| ubiquitin conjugating enzyme UBC9 [Mus musculus]
 gb|AAB57736.1| E2 ubiquitin conjugating enzyme [Xenopus laevis]
 emb|CAA66188.1| ubiquitin-conjugating enzyme [Mus musculus]
 emb|CAA05359.1| ubiquitin-conjugating enzyme, UBC9 [Homo sapiens]
 gb|AAC98704.1| ubiquitin-conjugating enzyme UbcE2A [Rattus norvegicus]
 gb|AAH00427.1| Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [Homo 
sapiens]
 dbj|BAB22599.1| unnamed protein product [Mus musculus]
 dbj|BAB23783.1| unnamed protein product [Mus musculus]
 dbj|BAB27487.1| unnamed protein product [Mus musculus]
 dbj|BAB28140.1| unnamed protein product [Mus musculus]
 gb|AAH04429.1| Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [Homo 
sapiens]
 dbj|BAB68210.1| ubiquitin-conjugating enzyme 9 [Gallus gallus]
 dbj|BAC40395.1| unnamed protein product [Mus musculus]
 gb|AAH46273.1| Ube2i protein [Xenopus laevis]
 gb|AAP35578.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [Homo 
sapiens]
 gb|AAS21651.1| ubiquitin-conjugating enzyme E2I [Mus musculus]
 gb|AAH86324.1| Ubiquitin-conjugating enzyme E2I [Rattus norvegicus]
 gb|AAH86592.1| Ubiquitin-conjugating enzyme E2I [Rattus norvegicus]
 gb|AAX32600.1| ubiquitin-conjugating enzyme E2I [synthetic construct]
 dbj|BAE38521.1| unnamed protein product [Mus musculus]
 dbj|BAE36134.1| unnamed protein product [Mus musculus]
 dbj|BAE29670.1| unnamed protein product [Mus musculus]
 dbj|BAE38922.1| unnamed protein product [Mus musculus]
 dbj|BAE39124.1| unnamed protein product [Mus musculus]
 dbj|BAE39303.1| unnamed protein product [Mus musculus]
 dbj|BAE40170.1| unnamed protein product [Mus musculus]
 dbj|BAE35560.1| unnamed protein product [Mus musculus]
 dbj|BAE40548.1| unnamed protein product [Mus musculus]
 dbj|BAE40602.1| unnamed protein product [Mus musculus]
 dbj|BAE38295.1| unnamed protein product [Mus musculus]
 dbj|BAE38290.1| unnamed protein product [Mus musculus]
 gb|ABD39323.1| Ubc9 [Ictidomys tridecemlineatus]
 emb|CAJ81434.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [Xenopus 
(Silurana) tropicalis]
 emb|CAJ81669.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [Xenopus 
(Silurana) tropicalis]
 gb|EAW85673.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|EAW85676.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|EAW85677.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|EAW85678.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|EAW85679.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), isoform 
CRA_a [Homo sapiens]
 gb|ABM82299.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [synthetic 
construct]
 gb|ABM85478.1| ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) [synthetic 
construct]
 gb|EDK97005.1| mCG121199 [Mus musculus]
 gb|EDL22415.1| mCG17660, isoform CRA_d [Mus musculus]
 gb|AAI46108.1| UBE2I protein [Bos taurus]
 gb|EDM03919.1| rCG35051, isoform CRA_a [Rattus norvegicus]
 gb|EDM03920.1| rCG35051, isoform CRA_a [Rattus norvegicus]
 tpg|DAA15584.1| TPA: SUMO-conjugating enzyme UBC9 [Bos taurus]
 gb|ELK10831.1| SUMO-conjugating enzyme UBC9 [Pteropus alecto]
 gb|AIC49932.1| UBE2I, partial [synthetic construct]
Length=158

 Score =   226 bits (577),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  1    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  61   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  121  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  157



>ref|NP_571908.1| SUMO-conjugating enzyme UBC9-B [Danio rerio]
 sp|Q9DDJ0.1|UBC9B_DANRE RecName: Full=SUMO-conjugating enzyme UBC9-B; AltName: Full=SUMO-protein 
ligase B; AltName: Full=Ubiquitin carrier protein 
9-B; AltName: Full=Ubiquitin carrier protein I-B; AltName: 
Full=Ubiquitin-conjugating enzyme E2 I-B; AltName: Full=Ubiquitin-protein 
ligase I-B [Danio rerio]
 gb|AAG48365.1|AF332623_1 ubiquitin-conjugating enzyme 9-2 [Danio rerio]
 gb|AAH58302.1| Ubiquitin-conjugating enzyme E2I2 [Danio rerio]
 gb|AAH66609.1| Ube2i2 protein [Danio rerio]
 gb|ACI69186.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
 gb|ACM08750.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
 gb|ACM09698.1| SUMO-conjugating enzyme UBC9-B [Salmo salar]
 gb|ACO08035.1| SUMO-1-conjugating enzyme UBC9 [Oncorhynchus mykiss]
 gb|ACO08745.1| SUMO-1-conjugating enzyme UBC9 [Oncorhynchus mykiss]
 emb|CDQ77658.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ71883.1| unnamed protein product [Oncorhynchus mykiss]
Length=157

 Score =   226 bits (577),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  1    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  61   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  121  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFSP  157



>gb|AAP36303.1| Homo sapiens ubiquitin-conjugating enzyme E2I (UBC9 homolog, 
yeast) [synthetic construct]
 gb|AAX29193.1| ubiquitin-conjugating enzyme E2I, partial [synthetic construct]
Length=159

 Score =   226 bits (577),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  1    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  61   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  121  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  157



>ref|XP_009665363.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Struthio 
camelus australis]
Length=210

 Score =   228 bits (582),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = +2

Query  20   VPKKPRNQTQHTKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIP  199
            V ++P+N ++ T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IP
Sbjct  40   VMQEPQN-SKGTPNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIP  98

Query  200  GKAGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPA  379
            GK GT WEGG + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPA
Sbjct  99   GKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPA  158

Query  380  ITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            IT+KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  159  ITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  209



>ref|XP_008579450.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Galeopterus 
variegatus]
Length=168

 Score =   227 bits (578),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  8    TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  67

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  68   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  127

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  128  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  167



>ref|NP_571426.1| SUMO-conjugating enzyme UBC9-A [Danio rerio]
 ref|XP_005174251.1| PREDICTED: SUMO-conjugating enzyme UBC9-A isoform X1 [Danio rerio]
 sp|Q9W6H5.1|UBC9A_DANRE RecName: Full=SUMO-conjugating enzyme UBC9-A; AltName: Full=SUMO-protein 
ligase A; AltName: Full=Ubiquitin carrier protein 
9-A; AltName: Full=Ubiquitin carrier protein I-A; AltName: 
Full=Ubiquitin-conjugating enzyme E2 I-A; AltName: Full=Ubiquitin-protein 
ligase I-A [Danio rerio]
 gb|AAD28601.1|AF128240_1 ubiquitin-conjugating enzyme 9 [Danio rerio]
 gb|AAH59506.1| Ubiquitin-conjugating enzyme E2I [Danio rerio]
Length=158

 Score =   226 bits (577),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  1    MSGIALSRLAQERKAWRKDHPFGFVAVPMKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  61   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  121  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFSP  157



>gb|KFM12519.1| SUMO-conjugating enzyme UBC9, partial [Aptenodytes forsteri]
 gb|KFQ04881.1| SUMO-conjugating enzyme UBC9, partial [Haliaeetus albicilla]
Length=162

 Score =   226 bits (577),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  5    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  64

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  65   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  124

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  125  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  161



>pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9
 pdb|1U9B|A Chain A, MurineHUMAN UBIQUITIN-Conjugating Enzyme Ubc9
 gb|KFO95587.1| SUMO-conjugating enzyme UBC9, partial [Calypte anna]
 gb|KFU93317.1| SUMO-conjugating enzyme UBC9, partial [Chaetura pelagica]
Length=160

 Score =   226 bits (577),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  3    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  62

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  63   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  122

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  123  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  159



>ref|XP_006006938.1| PREDICTED: SUMO-conjugating enzyme UBC9-B-like isoform X1 [Latimeria 
chalumnae]
Length=158

 Score =   226 bits (577),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  +LA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG Y L
Sbjct  1    MSGIALSKLAQERKAWRKDHPFGFVAVPTKNPDGTLNLMNWECAIPGKKGTPWEGGLYKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  61   RMLFKDDYPSSPPKCKFEPPIFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  121  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  157



>ref|XP_004056983.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform 1 [Gorilla gorilla 
gorilla]
Length=164

 Score =   226 bits (577),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  4    TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  63

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  64   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  123

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  124  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  163



>gb|KGL86044.1| SUMO-conjugating enzyme UBC9, partial [Charadrius vociferus]
Length=162

 Score =   226 bits (577),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  2    TPNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  61

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  62   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  121

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  122  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  161



>pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With 
Sumo-1- Conjugating Enzyme Ubc9
 pdb|2O25|D Chain D, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With 
Sumo-1- Conjugating Enzyme Ubc9
 pdb|1A3S|A Chain A, Human Ubc9
Length=160

 Score =   226 bits (577),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  3    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  62

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  63   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  122

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  123  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  159



>ref|XP_007100184.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Physeter 
catodon]
Length=179

 Score =   227 bits (578),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = +2

Query  26   KKPRNQTQHTKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGK  205
            + PR+  +   M  GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK
Sbjct  11   RTPRSGDRDANM-SGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGK  69

Query  206  AGTDWEGGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAIT  385
             GT WEGG + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT
Sbjct  70   KGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAIT  129

Query  386  VKQILVGIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +KQIL+GIQ+LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  130  IKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  178



>ref|XP_006037208.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Alligator 
sinensis]
 ref|XP_006268487.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Alligator 
mississippiensis]
Length=177

 Score =   227 bits (578),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  17   TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  76

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  77   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  136

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  137  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  176



>pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex
 pdb|3A4S|B Chain B, The Crystal Structure Of The Sld2:ubc9 Complex
Length=163

 Score =   226 bits (576),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  6    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  65

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  66   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  125

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  126  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  162



>pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9
 pdb|2PE6|A Chain A, Non-Covalent Complex Between Human Sumo-1 And Human 
Ubc9
Length=161

 Score =   226 bits (576),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  4    MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  63

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  64   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  123

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  124  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  160



>ref|XP_009665371.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X2 [Struthio 
camelus australis]
Length=171

 Score =   226 bits (577),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  11   TPNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  70

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  71   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  130

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  131  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  170



>ref|XP_011300412.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Fopius arisanus]
 ref|XP_011300413.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Fopius arisanus]
Length=159

 Score =   226 bits (576),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLAEERKAWRK+HP GFVA+P   PDGT+NLM W C IPGK  T WEGG Y L
Sbjct  1    MSGIASARLAEERKAWRKDHPFGFVARPTKNPDGTLNLMSWECAIPGKKSTPWEGGLYKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLS+L+E+  WRPAIT+KQIL+GIQDLL
Sbjct  61   RMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ +EY++RVR QA+   P
Sbjct  121  NEPNVKDPAQAEAYTIYCQNRLEYEKRVRAQARAMAP  157



>dbj|GAM24255.1| hypothetical protein SAMD00019534_074300 [Acytostelium subglobosum 
LB1]
Length=159

 Score =   226 bits (576),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GI+  RL EERK WRK+HP GF A+P+   DG+ NL VW C IPG  GT WEGG YPL
Sbjct  1    MSGISLARLTEERKQWRKDHPFGFFARPQNNKDGSTNLFVWDCGIPGITGTLWEGGTYPL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TM FSE+YPSKPPKC+FP+ FFHPNVYPSGTVCLSI+N+D  W+P+I+VKQIL+GIQDLL
Sbjct  61   TMEFSEEYPSKPPKCRFPKDFFHPNVYPSGTVCLSIVNDDGDWKPSISVKQILLGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPPLV  538
            + PNP  PAQ     LF+ +  EYKR+V++Q K YPP V
Sbjct  121  NAPNPKSPAQQLPITLFVNNIEEYKRKVKEQVKLYPPPV  159



>gb|EDL22414.1| mCG17660, isoform CRA_c [Mus musculus]
Length=177

 Score =   226 bits (577),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 125/163 (77%), Gaps = 0/163 (0%)
 Frame = +2

Query  44   TQHTKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWE  223
            ++ T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WE
Sbjct  14   SKGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWE  73

Query  224  GGNYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILV  403
            GG + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+
Sbjct  74   GGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILL  133

Query  404  GIQDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            GIQ+LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  134  GIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  176



>ref|XP_005391641.1| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Chinchilla 
lanigera]
Length=170

 Score =   226 bits (577),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  10   TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  69

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  70   FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  129

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  130  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  169



>ref|NP_001232317.1| putative ubiquitin-conjugating enzyme E2I cluster 2 [Taeniopygia 
guttata]
 gb|ACH44578.1| putative ubiquitin-conjugating enzyme E2I cluster 2 [Taeniopygia 
guttata]
Length=158

 Score =   226 bits (575),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA   LA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  1    MSGIALSTLAQERKAWRKDHPWGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
            TM F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED+ WRPAIT+KQIL+GIQ+LL
Sbjct  61   TMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDNDWRPAITIKQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  121  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  157



>gb|KFO34746.1| SUMO-conjugating enzyme UBC9 [Fukomys damarensis]
Length=206

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  46   TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  105

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  106  FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  165

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  166  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  205



>ref|XP_003417832.2| PREDICTED: SUMO-conjugating enzyme UBC9 isoform X1 [Loxodonta 
africana]
Length=189

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 123/161 (76%), Gaps = 0/161 (0%)
 Frame = +2

Query  50   HTKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGG  229
             T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG
Sbjct  28   RTWTMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGG  87

Query  230  NYPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGI  409
             + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GI
Sbjct  88   LFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGI  147

Query  410  QDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            Q+LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  148  QELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  188



>gb|ACO07807.1| SUMO-1-conjugating enzyme UBC9 [Oncorhynchus mykiss]
Length=157

 Score =   226 bits (575),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  1    MSGIALSRLAQERKAWRKDHPFGFVAAPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT++QIL+GIQ+LL
Sbjct  61   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIEQILLGIQELL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  121  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFSP  157



>gb|EHJ63743.1| ubiquitin-conjugating enzyme E2 [Danaus plexippus]
Length=159

 Score =   226 bits (575),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLAEERKAWRK+HP GFVA+P   PDG++NLM W C IPGK GT WEGG Y L
Sbjct  1    MSGIASARLAEERKAWRKDHPFGFVARPMKNPDGSLNLMTWECAIPGKKGTPWEGGLYKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLS+L+E+  WRPAIT+KQIL+GIQDLL
Sbjct  61   RMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAK  520
            ++PN  DPAQ E Y ++ Q+ +EY +RVR QA+
Sbjct  121  NEPNVKDPAQAEAYTIYCQNRLEYDKRVRAQAR  153



>emb|CEG64484.1| Putative SUMO-conjugating enzyme ubc9 [Rhizopus microsporus]
Length=158

 Score =   226 bits (575),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M  GIARGRL EERK WRK+HPHGF A+P   PD +++LM W C IPGK GT WE G Y 
Sbjct  1    MSSGIARGRLMEERKQWRKDHPHGFWARPGKSPDNSLDLMTWTCGIPGKEGTPWEKGVYK  60

Query  239  LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL  418
            L M F EDYPSKPPKCKF    FHPNVYPSGTVCLSILNED GW+PAITVKQIL+G+QDL
Sbjct  61   LVMTFPEDYPSKPPKCKFVPPLFHPNVYPSGTVCLSILNEDEGWKPAITVKQILIGVQDL  120

Query  419  LDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQA  517
            L+ PNP  PAQ + Y L+ +D  EY+RRVR+QA
Sbjct  121  LNDPNPESPAQQDAYMLYRKDRKEYERRVREQA  153



>ref|XP_007979401.1| PREDICTED: SUMO-conjugating enzyme UBC9 [Chlorocebus sabaeus]
Length=208

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   TKMLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGN  232
            T  + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG 
Sbjct  48   TLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGL  107

Query  233  YPLTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQ  412
            + L M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ
Sbjct  108  FKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQ  167

Query  413  DLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            +LL++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  168  ELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  207



>gb|EJW88467.1| ubiquitin carrier protein [Wuchereria bancrofti]
Length=171

 Score =   226 bits (576),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 124/159 (78%), Gaps = 3/159 (2%)
 Frame = +2

Query  59   MLGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYP  238
            M GGIA GRLAEERKAWRKNHP GF+AKP + PDGT NL +W C IPGK GT WEGG Y 
Sbjct  1    MSGGIAAGRLAEERKAWRKNHPFGFIAKPSSNPDGTRNLFIWECAIPGKKGTIWEGGLYK  60

Query  239  ---LTMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGI  409
               + M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL+E+  W+P+I+V+Q+L+GI
Sbjct  61   ANFIRMQFKDDYPSTPPKCKFDPPLFHPNVYPSGTVCLSILDENKDWKPSISVRQLLIGI  120

Query  410  QDLLDQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQY  526
            QDLL  PN  DPAQ + Y ++ Q+ VEY++RVR+QA+Q+
Sbjct  121  QDLLTNPNVDDPAQADAYQIYCQNRVEYEKRVRRQAQQF  159



>gb|AAH51289.3| Ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), partial 
[Homo sapiens]
Length=188

 Score =   226 bits (577),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLA+ERKAWRK+HP GFVA P   PDGT+NLM W C IPGK GT WEGG + L
Sbjct  31   MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL  90

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLSIL ED  WRPAIT+KQIL+GIQ+LL
Sbjct  91   RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELL  150

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAKQYPP  532
            ++PN  DPAQ E Y ++ Q+ VEY++RVR QAK++ P
Sbjct  151  NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAP  187



>dbj|BAM19143.1| lesswright [Papilio polytes]
Length=159

 Score =   225 bits (574),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLAEERKAWRK+HP GFVA+P   PDG++NLM W C IPGK GT WEGG Y L
Sbjct  1    MSGIASARLAEERKAWRKDHPFGFVARPMKNPDGSLNLMTWECAIPGKKGTPWEGGLYKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F +DYPS PPKCKF    FHPNVYPSGTVCLS+L+E+  WRPAIT+KQIL+GIQDLL
Sbjct  61   RMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAK  520
            ++PN  DPAQ E Y ++ Q+ +EY +RVR QA+
Sbjct  121  NEPNVKDPAQAEAYTIYCQNRLEYDKRVRAQAR  153



>ref|XP_967918.1| PREDICTED: SUMO-conjugating enzyme UBC9-B [Tribolium castaneum]
 gb|EFA09218.1| lesswright [Tribolium castaneum]
Length=160

 Score =   225 bits (574),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +2

Query  62   LGGIARGRLAEERKAWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGNYPL  241
            + GIA  RLAEERKAWRK HP GFVA+P   PDG++NLM W C+IPGK GT WEGGNY L
Sbjct  1    MSGIAPARLAEERKAWRKEHPFGFVARPSKNPDGSLNLMNWECSIPGKKGTPWEGGNYKL  60

Query  242  TMHFSEDYPSKPPKCKFPQAFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLL  421
             M F ++YPS PPKCKF    FHPNVYPSGTVCLS+L+E+  WRPAIT+KQIL+GIQDLL
Sbjct  61   RMLFKDEYPSIPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWRPAITIKQILLGIQDLL  120

Query  422  DQPNPADPAQTEGYHLFIQDTVEYKRRVRQQAK  520
            ++PN  DPAQ E Y ++ Q+ +EY++RVR QA+
Sbjct  121  NEPNVKDPAQAEAYTIYCQNRLEYEKRVRAQAR  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880