BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M21

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773400.1|  PREDICTED: pectinesterase 1                        114   3e-26   Nicotiana sylvestris
ref|XP_009606551.1|  PREDICTED: pectinesterase 3                        108   4e-24   Nicotiana tomentosiformis
gb|AFI23414.1|  pectin methylesterase                                   101   1e-21   Coffea arabica [arabica coffee]
emb|CDO97788.1|  unnamed protein product                                101   2e-21   Coffea canephora [robusta coffee]
ref|XP_010273808.1|  PREDICTED: pectinesterase 3                      97.4    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_008228106.1|  PREDICTED: pectinesterase 3                      91.7    3e-18   Prunus mume [ume]
ref|XP_002265217.1|  PREDICTED: pectinesterase 3                      91.7    4e-18   Vitis vinifera
ref|XP_007215024.1|  hypothetical protein PRUPE_ppa003307mg           90.1    1e-17   Prunus persica
ref|XP_011036546.1|  PREDICTED: pectinesterase 3-like                 89.7    1e-17   Populus euphratica
ref|XP_002304256.1|  pectinesterase family protein                    89.7    1e-17   Populus trichocarpa [western balsam poplar]
gb|KHN01475.1|  Pectinesterase 3                                      89.4    2e-17   Glycine soja [wild soybean]
ref|XP_003528738.1|  PREDICTED: pectinesterase 3                      89.4    2e-17   
ref|XP_003547912.1|  PREDICTED: pectinesterase 3                      89.0    3e-17   Glycine max [soybeans]
ref|XP_006342896.1|  PREDICTED: pectinesterase 3-like                 88.2    5e-17   Solanum tuberosum [potatoes]
ref|XP_004303759.1|  PREDICTED: pectinesterase 3                      87.8    7e-17   Fragaria vesca subsp. vesca
gb|KDP40628.1|  hypothetical protein JCGZ_24627                       87.4    9e-17   Jatropha curcas
ref|XP_004235526.1|  PREDICTED: pectinesterase 3                      87.0    1e-16   Solanum lycopersicum
ref|XP_011048628.1|  PREDICTED: pectinesterase 3                      86.3    3e-16   Populus euphratica
ref|XP_006426799.1|  hypothetical protein CICLE_v10025232mg           85.9    3e-16   Citrus clementina [clementine]
ref|XP_004510571.1|  PREDICTED: pectinesterase 3-like                 85.9    3e-16   Cicer arietinum [garbanzo]
ref|XP_008380734.1|  PREDICTED: pectinesterase 3                      85.5    5e-16   Malus domestica [apple tree]
gb|EYU45917.1|  hypothetical protein MIMGU_mgv1a003666mg              84.3    9e-16   Erythranthe guttata [common monkey flower]
gb|KJB67055.1|  hypothetical protein B456_010G173200                  83.6    2e-15   Gossypium raimondii
ref|XP_010501046.1|  PREDICTED: pectinesterase 1-like                 82.8    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006465803.1|  PREDICTED: pectinesterase 3-like                 82.4    5e-15   Citrus sinensis [apfelsine]
gb|KDO37799.1|  hypothetical protein CISIN_1g046024mg                 82.4    6e-15   Citrus sinensis [apfelsine]
gb|AAM65650.1|  pectinesterase, putative                              82.4    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175787.1|  pectin methylesterase 1                             82.0    6e-15   Arabidopsis thaliana [mouse-ear cress]
gb|EYU21271.1|  hypothetical protein MIMGU_mgv1a022830mg              81.6    1e-14   Erythranthe guttata [common monkey flower]
ref|XP_010462290.1|  PREDICTED: pectinesterase 1                      81.3    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010479962.1|  PREDICTED: pectinesterase 1-like                 80.9    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006307084.1|  hypothetical protein CARUB_v10008670mg           80.5    2e-14   Capsella rubella
ref|XP_002891775.1|  ATPME1                                           79.3    6e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_008460354.1|  PREDICTED: pectinesterase 3                      77.8    2e-13   Cucumis melo [Oriental melon]
ref|XP_004144445.1|  PREDICTED: pectinesterase 3-like                 77.4    2e-13   Cucumis sativus [cucumbers]
emb|CDY51799.1|  BnaC06g41950D                                        76.3    6e-13   Brassica napus [oilseed rape]
gb|KFK35692.1|  hypothetical protein AALP_AA4G024800                  75.9    8e-13   Arabis alpina [alpine rockcress]
ref|XP_002885032.1|  hypothetical protein ARALYDRAFT_318218           75.5    1e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_010917367.1|  PREDICTED: pectinesterase 3 isoform X1           75.1    2e-12   Elaeis guineensis
ref|XP_010917368.1|  PREDICTED: pectinesterase 3 isoform X2           74.7    2e-12   Elaeis guineensis
ref|XP_003627449.1|  Pectinesterase                                   74.7    2e-12   Medicago truncatula
ref|XP_006392744.1|  hypothetical protein EUTSA_v10011342mg           73.9    3e-12   Eutrema salsugineum [saltwater cress]
ref|XP_009123647.1|  PREDICTED: pectinesterase 1                      73.9    3e-12   Brassica rapa
ref|XP_009147579.1|  PREDICTED: pectinesterase 1                      73.6    5e-12   Brassica rapa
gb|AIA91245.1|  PMEI                                                  69.7    8e-12   uncultured bacterium
gb|KHG28352.1|  Pectinesterase 3                                      72.8    9e-12   Gossypium arboreum [tree cotton]
emb|CDY24071.1|  BnaA06g00690D                                        72.8    9e-12   Brassica napus [oilseed rape]
ref|XP_002532945.1|  Pectinesterase-3 precursor, putative             72.4    1e-11   Ricinus communis
ref|XP_010542351.1|  PREDICTED: pectinesterase 1                      72.0    2e-11   Tarenaya hassleriana [spider flower]
ref|XP_006297279.1|  hypothetical protein CARUB_v10013297mg           71.6    3e-11   Capsella rubella
ref|XP_007024769.1|  Pectinesterase 3                                 70.5    5e-11   
emb|CDO97789.1|  unnamed protein product                              70.1    6e-11   Coffea canephora [robusta coffee]
gb|EPS63460.1|  hypothetical protein M569_11324                       68.2    1e-10   Genlisea aurea
ref|NP_188047.1|  pectin methylesterase 26                            69.7    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010940182.1|  PREDICTED: pectinesterase 3-like                 68.2    4e-10   
ref|XP_010465322.1|  PREDICTED: pectinesterase 1-like                 68.2    4e-10   Camelina sativa [gold-of-pleasure]
emb|CDY36608.1|  BnaC06g06610D                                        67.8    4e-10   Brassica napus [oilseed rape]
gb|KJB57092.1|  hypothetical protein B456_009G147800                  67.8    4e-10   Gossypium raimondii
ref|XP_010261670.1|  PREDICTED: pectinesterase 3-like                 65.5    5e-10   Nelumbo nucifera [Indian lotus]
gb|KHG08632.1|  Pectinesterase 3                                      67.4    6e-10   Gossypium arboreum [tree cotton]
ref|XP_006828611.1|  hypothetical protein AMTR_s00129p00070300        67.4    7e-10   
sp|Q43111.1|PME3_PHAVU  RecName: Full=Pectinesterase 3; Short=PE ...  67.0    7e-10   Phaseolus vulgaris [French bean]
ref|XP_007135363.1|  hypothetical protein PHAVU_010G123100g           67.0    1e-09   Phaseolus vulgaris [French bean]
ref|XP_010487229.1|  PREDICTED: pectinesterase 1-like                 66.2    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_011079312.1|  PREDICTED: pectinesterase 1-like                 65.9    2e-09   Sesamum indicum [beniseed]
ref|XP_006369082.1|  hypothetical protein POPTR_0001s16291g           64.7    4e-09   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700        63.2    2e-08   Amborella trichopoda
emb|CDP12348.1|  unnamed protein product                              60.1    4e-08   Coffea canephora [robusta coffee]
ref|XP_010033654.1|  PREDICTED: pectinesterase 3-like                 60.5    1e-07   Eucalyptus grandis [rose gum]
ref|XP_008375511.1|  PREDICTED: putative pectinesterase/pectinest...  59.3    2e-07   
ref|XP_008797350.1|  PREDICTED: pectinesterase 3                      59.7    2e-07   Phoenix dactylifera
ref|XP_010501837.1|  PREDICTED: pectinesterase 1-like                 59.7    2e-07   Camelina sativa [gold-of-pleasure]
gb|KEH19215.1|  pectinesterase/pectinesterase inhibitor               58.9    3e-07   Medicago truncatula
ref|XP_008375414.1|  PREDICTED: putative pectinesterase/pectinest...  58.9    3e-07   
ref|XP_008356804.1|  PREDICTED: putative pectinesterase/pectinest...  58.9    3e-07   
ref|XP_007012507.1|  Pectinesterase, putative                         58.9    4e-07   
ref|XP_009339254.1|  PREDICTED: putative pectinesterase/pectinest...  57.8    7e-07   Pyrus x bretschneideri [bai li]
ref|XP_008231878.1|  PREDICTED: probable pectinesterase/pectinest...  57.8    8e-07   Prunus mume [ume]
ref|XP_002515781.1|  Pectinesterase-3 precursor, putative             57.4    1e-06   Ricinus communis
gb|KJB54561.1|  hypothetical protein B456_009G038900                  57.4    1e-06   Gossypium raimondii
ref|XP_007219746.1|  hypothetical protein PRUPE_ppa024156mg           57.4    1e-06   Prunus persica
ref|XP_006828609.1|  hypothetical protein AMTR_s00129p00068690        57.4    1e-06   
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...  56.2    3e-06   Glycine max [soybeans]
ref|XP_011470454.1|  PREDICTED: probable pectinesterase/pectinest...  55.8    3e-06   Fragaria vesca subsp. vesca
gb|KFK28345.1|  hypothetical protein AALP_AA8G504100                  55.8    4e-06   Arabis alpina [alpine rockcress]
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g           55.8    4e-06   Phaseolus vulgaris [French bean]
ref|XP_007133558.1|  hypothetical protein PHAVU_011G1890000g          54.3    8e-06   Phaseolus vulgaris [French bean]
ref|XP_009391197.1|  PREDICTED: pectinesterase 3                      52.4    5e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009355064.1|  PREDICTED: putative pectinesterase/pectinest...  52.4    5e-05   Pyrus x bretschneideri [bai li]
ref|XP_011046484.1|  PREDICTED: putative pectinesterase/pectinest...  52.0    6e-05   Populus euphratica
ref|XP_008346146.1|  PREDICTED: putative pectinesterase/pectinest...  52.0    6e-05   
ref|XP_002316458.2|  pectinesterase family protein                    52.0    6e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...  51.6    8e-05   Nelumbo nucifera [Indian lotus]
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24   51.6    8e-05   Glycine soja [wild soybean]
ref|XP_011005059.1|  PREDICTED: pectinesterase 3-like                 51.6    9e-05   Populus euphratica
ref|XP_010092049.1|  Pectinesterase 1                                 50.8    9e-05   Morus notabilis
ref|XP_006381544.1|  hypothetical protein POPTR_0006s13700g           51.2    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_002516960.1|  Pectinesterase precursor, putative               50.8    1e-04   Ricinus communis
ref|XP_011032980.1|  PREDICTED: putative pectinesterase/pectinest...  50.8    1e-04   Populus euphratica
gb|KFK38796.1|  hypothetical protein AALP_AA3G161400                  50.8    2e-04   Arabis alpina [alpine rockcress]
ref|XP_006852911.1|  hypothetical protein AMTR_s00033p00227850        50.4    2e-04   
ref|XP_010067063.1|  PREDICTED: probable pectinesterase/pectinest...  50.8    2e-04   Eucalyptus grandis [rose gum]
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg              50.8    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...  50.8    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002311918.1|  pectinesterase family protein                    50.4    2e-04   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg              50.4    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_008239809.1|  PREDICTED: pectinesterase 1                      49.7    2e-04   Prunus mume [ume]
ref|XP_006407095.1|  hypothetical protein EUTSA_v10022003mg           50.1    2e-04   Eutrema salsugineum [saltwater cress]
gb|KDP34079.1|  hypothetical protein JCGZ_07650                       50.1    3e-04   Jatropha curcas
ref|XP_009135375.1|  PREDICTED: pectinesterase 1-like                 50.1    3e-04   Brassica rapa
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...  49.7    4e-04   Prunus mume [ume]
ref|XP_009773321.1|  PREDICTED: pectinesterase 1-like                 48.9    4e-04   Nicotiana sylvestris
gb|KDP27833.1|  hypothetical protein JCGZ_18913                       49.3    5e-04   Jatropha curcas
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...  49.3    5e-04   Phoenix dactylifera
ref|XP_009398948.1|  PREDICTED: probable pectinesterase/pectinest...  49.3    5e-04   
ref|XP_007011069.1|  Root hair specific 12                            48.9    6e-04   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg           48.9    6e-04   Eutrema salsugineum [saltwater cress]
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...  48.5    8e-04   Prunus mume [ume]
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg           48.5    8e-04   Prunus persica
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...  48.5    8e-04   Pyrus x bretschneideri [bai li]
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg           48.5    9e-04   Prunus persica
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...  48.5    0.001   Eucalyptus grandis [rose gum]
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...  48.5    0.001   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...  48.5    0.001   Prunus mume [ume]



>ref|XP_009773400.1| PREDICTED: pectinesterase 1 [Nicotiana sylvestris]
Length=580

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDTI SFKGYGKVD A EQAFR+KTRKRIIIL VSA+LL+  V+ IV GTV+HK N+ + 
Sbjct  1    MDTIKSFKGYGKVDEAEEQAFRKKTRKRIIILIVSAILLLIAVVAIVVGTVVHKNNQKDS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S S +   +T STS+S++A+CSVTEYKDSC+SSLS++A   TTDP+ LF+LSL+LA DSL
Sbjct  61   SNSKQIP-STTSTSQSLEALCSVTEYKDSCISSLSKLAASNTTDPETLFILSLKLAKDSL  119

Query  480  KKLASQPAGW  509
              L+S    W
Sbjct  120  VNLSSVQQNW  129



>ref|XP_009606551.1| PREDICTED: pectinesterase 3 [Nicotiana tomentosiformis]
Length=577

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDTI SFKGYGKVD   EQAFR+KTRKR+IIL VSA+LL+  V+ IV GTV+HK N+ + 
Sbjct  1    MDTIKSFKGYGKVDEVEEQAFRKKTRKRLIILIVSAILLLIAVVAIVVGTVVHKNNQKDS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S S +   +T S ++S++A+CSVTEYKDSC SSLS +A   TTDP+ LF+LSL+LA DSL
Sbjct  61   SNSKQIP-STTSNAQSLEALCSVTEYKDSCFSSLSNLAASNTTDPEALFILSLKLAKDSL  119

Query  480  KKLASQPAGW  509
              L+S    W
Sbjct  120  VNLSSVQQNW  129



>gb|AFI23414.1| pectin methylesterase [Coffea arabica]
Length=582

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 98/132 (74%), Gaps = 5/132 (4%)
 Frame = +3

Query  117  VMDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkne  296
            +MDTI SFKGYGKVDP  EQAFRRKTR+RII+L VS +LLV L++G+V  TV HKK  ++
Sbjct  1    MMDTIKSFKGYGKVDPVEEQAFRRKTRRRIIVLLVSLLLLVALIVGVVVATVAHKKKNSK  60

Query  297  gsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQV-AGEKTTDPKKLFVLSLQLAVD  473
            G+ +    DA  S S+S++AICSVT + DSC +S+S + A   TTDP+KLF LSLQ+   
Sbjct  61   GNAN----DAPTSPSQSLRAICSVTVHPDSCYTSISSLEASNSTTDPEKLFQLSLQVVHA  116

Query  474  SLKKLASQPAGW  509
            SL+KL++ P  W
Sbjct  117  SLQKLSTLPQHW  128



>emb|CDO97788.1| unnamed protein product [Coffea canephora]
Length=632

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 96/131 (73%), Gaps = 5/131 (4%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDTI SFKGYGKVDP  EQAFRRKTR+R I+L VS +LLV L++G+V  TV HKK  ++G
Sbjct  1    MDTIKSFKGYGKVDPVEEQAFRRKTRRRTIVLLVSLLLLVALIVGVVVATVAHKKKNSKG  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQV-AGEKTTDPKKLFVLSLQLAVDS  476
            + +    DA  S S+S++AICSVT + DSC +S+S + A   TTDP+KLF LSLQ+   S
Sbjct  61   NAN----DAPTSPSQSLRAICSVTVHPDSCYTSISSLEASNSTTDPEKLFQLSLQVVHAS  116

Query  477  LKKLASQPAGW  509
            L+KL++ P  W
Sbjct  117  LQKLSTLPQHW  127



>ref|XP_010273808.1| PREDICTED: pectinesterase 3 [Nelumbo nucifera]
Length=590

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 96/128 (75%), Gaps = 1/128 (1%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDT+ SFKGYGKVD   +  FRRKTRKR+II++VS +LL+ +++G V GTVIHK   ++ 
Sbjct  1    MDTVKSFKGYGKVDEHEDLEFRRKTRKRLIIISVSVILLLTIIVGAVVGTVIHKSKNDDD  60

Query  300  sgsgeggDATR-STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDS  476
              + +   ++  S ++S++A+CSVT+Y +SC SSLS +A +KTTDP++LF LSLQ+A+  
Sbjct  61   GQNEQTPSSSETSVAQSIKAVCSVTQYPNSCFSSLSSLAAQKTTDPEELFKLSLQVALTE  120

Query  477  LKKLASQP  500
            L KLAS P
Sbjct  121  LSKLASLP  128



>ref|XP_008228106.1| PREDICTED: pectinesterase 3 [Prunus mume]
Length=587

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 90/131 (69%), Gaps = 0/131 (0%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ SFKGYGKVD   EQAFRRK RKR+IIL VS ++L+ ++IG VAG +IHK++ +  
Sbjct  1    MDSMKSFKGYGKVDELEEQAFRRKARKRVIILTVSTIVLLAVIIGAVAGVLIHKRSNSSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
                     T + S S++A+C VT+Y +SC SS+S +    TTDP+ +F LSL +A+++ 
Sbjct  61   PTPNSAPTTTLTPSASLKAVCDVTQYPNSCFSSISSLETSNTTDPEVIFKLSLHVAINAA  120

Query  480  KKLASQPAGWR  512
             KLA  P+ +R
Sbjct  121  SKLAGLPSKFR  131



>ref|XP_002265217.1| PREDICTED: pectinesterase 3 [Vitis vinifera]
Length=578

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 92/127 (72%), Gaps = 4/127 (3%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+I SFKGYGKVD   E+AF+RKTRKR+IIL +S+V+LV ++IG VAGT+IHK      
Sbjct  1    MDSIKSFKGYGKVDELEERAFKRKTRKRLIILIISSVVLVAVIIGAVAGTLIHKSKSESN  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S       +  S + S++A+CSVT+Y DSCVSS+S +    TTDP++LF L+L++A+  L
Sbjct  61   SVPA----SPVSPATSIKAVCSVTQYPDSCVSSISSLDTSNTTDPEELFRLTLRVAIAEL  116

Query  480  KKLASQP  500
             KL+S P
Sbjct  117  SKLSSLP  123



>ref|XP_007215024.1| hypothetical protein PRUPE_ppa003307mg [Prunus persica]
 gb|EMJ16223.1| hypothetical protein PRUPE_ppa003307mg [Prunus persica]
Length=586

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ SFKGYGKVD   EQAFRRK RKR+IIL VS ++L+ ++IG VAG +IHK++ +  
Sbjct  1    MDSMKSFKGYGKVDELEEQAFRRKARKRVIILTVSTIVLLAVIIGAVAGVLIHKRSNSSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
                       + S S++A+C VT+Y +SC SS+S +    TTDP+ +F LSL +A+++ 
Sbjct  61   PTPNSAPTTVLTPSASLKAVCDVTQYPNSCFSSISSLETSNTTDPEVIFKLSLHVAINAA  120

Query  480  KKLASQPAGWR  512
             KLA  P+ +R
Sbjct  121  SKLAGLPSKFR  131



>ref|XP_011036546.1| PREDICTED: pectinesterase 3-like [Populus euphratica]
Length=588

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+INSFKGYGKVD A +QAFR+++RKR+II+ VS+++L+ ++IG V G V+HK+N    
Sbjct  1    MDSINSFKGYGKVDEAEQQAFRKRSRKRLIIIVVSSIVLLAVIIGAVIGVVVHKRNNKSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S      + T +TS  ++A+CSVT+Y  SC SS+S +    TTDP+ LF LSL++AV+ L
Sbjct  61   SNPVPPPELTPATS--LKAVCSVTQYPASCFSSISALEMGNTTDPEVLFKLSLRVAVNEL  118

Query  480  KKLASQP  500
             KL   P
Sbjct  119  SKLKDYP  125



>ref|XP_002304256.1| pectinesterase family protein [Populus trichocarpa]
 gb|EEE79235.1| pectinesterase family protein [Populus trichocarpa]
Length=588

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+INSFKGYGKVD A +QAFR+K+RKR+II+ VS+++L+ ++IG V G V+HK+N    
Sbjct  1    MDSINSFKGYGKVDEAEQQAFRKKSRKRLIIIVVSSIVLLAVIIGAVIGAVVHKRNNKSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S      + T +TS  ++A+CSVT+Y  SC SS+S +    TTDP+ LF LSL++A++ L
Sbjct  61   SNPVPPPELTPATS--LKAVCSVTQYPASCFSSISALETGNTTDPEVLFKLSLRVAMNEL  118

Query  480  KKLASQP  500
             KL   P
Sbjct  119  SKLKDYP  125



>gb|KHN01475.1| Pectinesterase 3 [Glycine soja]
Length=486

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 91/131 (69%), Gaps = 0/131 (0%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDTI SFKGYGKVD   +QA+++KTRKR+II+A S+++L  ++I  VAG VIHK+N +  
Sbjct  1    MDTIKSFKGYGKVDELEQQAYQKKTRKRLIIIAGSSIVLFAVIIAAVAGVVIHKRNTSSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              S        + + S++A+C VT+Y +SC S++S +    TTDP+ LF LSL++A+D L
Sbjct  61   PSSDSPPQTELTPAASLKAVCHVTQYPNSCFSAISSLPESNTTDPELLFKLSLRVAIDEL  120

Query  480  KKLASQPAGWR  512
             KL+S P+  R
Sbjct  121  SKLSSFPSKLR  131



>ref|XP_003528738.1| PREDICTED: pectinesterase 3 [Glycine max]
Length=587

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDTI SFKGYGKVD   +QA+++KTRKR+II+AVS+++L  ++I  VAG VIHK+N +  
Sbjct  1    MDTIKSFKGYGKVDELEQQAYQKKTRKRLIIIAVSSIVLFAVIIAAVAGVVIHKRNTSSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              S        + + S++A+C VT+Y +SC S++S +    TTDP+ LF LSL++A+D L
Sbjct  61   PSSDSPPQTELTPAASLKAVCHVTQYPNSCFSAISSLPESNTTDPELLFKLSLRVAIDEL  120

Query  480  KKLASQPAGWR  512
             KL+S P+  R
Sbjct  121  SKLSSFPSKLR  131



>ref|XP_003547912.1| PREDICTED: pectinesterase 3 [Glycine max]
Length=586

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDTI SFKGYGKVD   +QA+++KTRKR+II+ VS+++L+ ++I  +AG VIHK+N +  
Sbjct  1    MDTIKSFKGYGKVDELEQQAYQKKTRKRLIIITVSSIVLIAVIIAAIAGVVIHKRNTSSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              S        + + S++A+C VT+Y +SC S++S +    TTDP+ LF LSL++A+D L
Sbjct  61   PSSDSPPQTELTPAASLKAVCDVTQYPNSCFSAISSLPDSNTTDPELLFKLSLRVAIDEL  120

Query  480  KKLASQPAGWR  512
             KL+S P+  R
Sbjct  121  SKLSSFPSKLR  131



>ref|XP_006342896.1| PREDICTED: pectinesterase 3-like [Solanum tuberosum]
Length=569

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 96/130 (74%), Gaps = 12/130 (9%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDTI SFKGYGKVD   EQAFR+KTRKR+IIL VSA+LL+  V+GIV GTV+HK N ++ 
Sbjct  1    MDTIKSFKGYGKVDELEEQAFRKKTRKRLIILIVSAILLLIAVVGIVVGTVVHKNNDSKQ  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
                     T ST++S++ +CS+TEYKDSC+SSLS       TDP+ LFVLSL++A+D++
Sbjct  61   ---------TSSTAQSLEVLCSLTEYKDSCLSSLSS---SNITDPETLFVLSLKIAMDAV  108

Query  480  KKLASQPAGW  509
            K ++S P  W
Sbjct  109  KNMSSGPQNW  118



>ref|XP_004303759.1| PREDICTED: pectinesterase 3 [Fragaria vesca subsp. vesca]
Length=585

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ SFKGYGKVD   EQAFRRKTRKR II+ VS ++LV ++IG V GTVIH +N +  
Sbjct  1    MDSMTSFKGYGKVDELEEQAFRRKTRKRFIIVIVSIIVLVAVIIGAVTGTVIHNRNSSSS  60

Query  300  sgsgeggDATRST-SKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDS  476
                E   AT+ T S S++A+C VT Y +SC SS+S +    TTDP+ LF LSL +A+D 
Sbjct  61   PSPTEP--ATQLTPSSSLKAVCDVTLYPNSCFSSISSLKNSNTTDPEALFKLSLHVAIDE  118

Query  477  LKKLASQPA  503
            + KL   P+
Sbjct  119  VSKLKDLPS  127



>gb|KDP40628.1| hypothetical protein JCGZ_24627 [Jatropha curcas]
Length=587

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 91/128 (71%), Gaps = 2/128 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+INSFKGYGKVD   EQAF+RKTRKR+IIL V++V+LV ++IG V GTV+HK+N    
Sbjct  1    MDSINSFKGYGKVDEPEEQAFKRKTRKRLIILIVASVVLVAVIIGAVVGTVLHKRNNESS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            + S    + T   + S++A+C VT+Y  SC SS+S +    TTDP+ LF LSL++A++ L
Sbjct  61   TDSVAPTELT--PAASLKAVCRVTQYPASCFSSISALETANTTDPEILFKLSLRVAMNEL  118

Query  480  KKLASQPA  503
             +L   P+
Sbjct  119  SRLKDYPS  126



>ref|XP_004235526.1| PREDICTED: pectinesterase 3 [Solanum lycopersicum]
Length=567

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 96/130 (74%), Gaps = 12/130 (9%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDT+ SFKGYGKVD   E+AFR+KTRKR+IIL VSAVLL+  V+GIV GTV+HK N ++ 
Sbjct  1    MDTMKSFKGYGKVDELEEEAFRKKTRKRLIILIVSAVLLLIAVVGIVVGTVVHKNNDSKQ  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
                       ST++S+Q +CS+TEYKDSC+SSLS       TDP+ LFVLSL++A+D++
Sbjct  61   PS---------STAQSLQVLCSLTEYKDSCLSSLSS---SNVTDPETLFVLSLKIAMDAV  108

Query  480  KKLASQPAGW  509
            KKL+S P  W
Sbjct  109  KKLSSGPQNW  118



>ref|XP_011048628.1| PREDICTED: pectinesterase 3 [Populus euphratica]
Length=588

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 85/127 (67%), Gaps = 2/127 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+I SFKGYGKVD   +QAFRRKTRKR+II+ VS V+L+ ++IG V G V+H +N N  
Sbjct  1    MDSITSFKGYGKVDEVEQQAFRRKTRKRLIIVVVSFVVLLAVIIGAVIGVVVHNRNNNSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S      + T   + S++A+CSVT Y  SC SS+S +    TTDP+ LF LSL +A++ L
Sbjct  61   SNPVPPPELT--PAASLKAVCSVTRYPTSCFSSISALETGNTTDPEVLFKLSLHVAMNEL  118

Query  480  KKLASQP  500
             KL   P
Sbjct  119  SKLKDYP  125



>ref|XP_006426799.1| hypothetical protein CICLE_v10025232mg [Citrus clementina]
 gb|ESR40039.1| hypothetical protein CICLE_v10025232mg [Citrus clementina]
 gb|KDO53766.1| hypothetical protein CISIN_1g007830mg [Citrus sinensis]
Length=588

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            M+TI SFKGYGKVD   +QAFRRKTRKR+IIL +S+++LV ++IG V G V+HK   +  
Sbjct  1    METIRSFKGYGKVDELEQQAFRRKTRKRVIILIISSIVLVAVIIGAVIGVVVHKNKNDSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQV-AGEKTTDPKKLFVLSLQLAVDS  476
            S +      T   + S++A+CSVT Y DSC SS+S + A   T DP+ LF LSLQ+A++ 
Sbjct  61   SDNMPATQLT--PAASLKAVCSVTRYPDSCFSSISSIDASNVTKDPEILFKLSLQVAMNE  118

Query  477  LKKLASQPA  503
            L KL + P+
Sbjct  119  LGKLQNYPS  127



>ref|XP_004510571.1| PREDICTED: pectinesterase 3-like [Cicer arietinum]
Length=584

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 88/129 (68%), Gaps = 1/129 (1%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDTI SFKGYGKVD   +QAF++KTRKR+I + +S+V+L+ ++I  VAG +IHK+     
Sbjct  1    MDTIKSFKGYGKVDEIEQQAFQKKTRKRMITIIISSVILLAVIIAAVAGVLIHKRTTQSS  60

Query  300  sgsgeggDATR-STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDS  476
              S +    T  + + S++A+C  T+Y +SC S++S +    TTDP++LF LSL++A+D 
Sbjct  61   PSSSDSLPNTELNPAASLKAVCHATQYPNSCFSAISSLPDSNTTDPEQLFKLSLKVAIDE  120

Query  477  LKKLASQPA  503
            L KL   P+
Sbjct  121  LAKLTRFPS  129



>ref|XP_008380734.1| PREDICTED: pectinesterase 3 [Malus domestica]
Length=585

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ SFKGYGKVD   EQAF+RKTRKR+IIL+VS V+L+ ++IG+VAG +IHK+N +  
Sbjct  1    MDSVKSFKGYGKVDELEEQAFKRKTRKRLIILSVSTVVLLAVIIGVVAGVIIHKRNNSSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S          + + S++A+C VT+Y  SC SS+S +    +TDP+ +F LSLQ+A+ + 
Sbjct  61   SVPNSTPGPELTPAASLKAVCGVTQYPSSCFSSISALETSNSTDPEVIFKLSLQVAIHAA  120

Query  480  KKLASQPA  503
             KL   PA
Sbjct  121  AKLPGLPA  128



>gb|EYU45917.1| hypothetical protein MIMGU_mgv1a003666mg [Erythranthe guttata]
Length=570

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 92/129 (71%), Gaps = 9/129 (7%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            M+T+NSFKGYGKVD   E AFRR+TRKR+IILAVS VLLV L++G+VAGTV H+++K   
Sbjct  1    METVNSFKGYGKVDALEEAAFRRRTRKRVIILAVSLVLLVVLIVGVVAGTVAHRRSKGGV  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              +        STS +++++CSVT+Y DSC +SL       +T+P  +F LSL +AVDSL
Sbjct  61   PATPT------STSAAIKSVCSVTQYPDSCFASLES---GNSTNPGNIFKLSLMVAVDSL  111

Query  480  KKLASQPAG  506
            K+L++   G
Sbjct  112  KRLSAAFPG  120



>gb|KJB67055.1| hypothetical protein B456_010G173200 [Gossypium raimondii]
Length=586

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 78/127 (61%), Gaps = 3/127 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+INSFKGYGKVD   E AFRRK R+R+I L +  +LL+ L+   V G  +H   K   
Sbjct  1    MDSINSFKGYGKVDEVEELAFRRKKRRRLITLIILILLLLTLITAAVVGIFLH---KRSS  57

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S          + + S++A+CSVT+Y  SC SS+S +A   TT P+ LF LSL++A+D L
Sbjct  58   SSPNTLPPPVLTPAASLKAVCSVTQYPASCFSSISSIAPSNTTVPELLFKLSLKVAIDEL  117

Query  480  KKLASQP  500
              L+  P
Sbjct  118  SSLSHYP  124



>ref|XP_010501046.1| PREDICTED: pectinesterase 1-like [Camelina sativa]
Length=587

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 89/133 (67%), Gaps = 16/133 (12%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++NSFKGYGKVD A + A ++KTRKRI++L+VS V+L+ ++I  V  TV+HKK+    
Sbjct  1    MDSVNSFKGYGKVDEAQDSALKKKTRKRILLLSVSVVVLIAVIIAAVVATVVHKKDN---  57

Query  300  sgsgeggDATRST------SKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQ  461
                   D+T S+      S S++ ICSVT Y +SC+SS+S++    TTDP+ LF LSL+
Sbjct  58   -------DSTASSPHGLTPSTSLKTICSVTRYPESCISSISKLPSSNTTDPETLFKLSLK  110

Query  462  LAVDSLKKLASQP  500
            + +D L  ++  P
Sbjct  111  VIIDELDSISDLP  123



>ref|XP_006465803.1| PREDICTED: pectinesterase 3-like [Citrus sinensis]
Length=588

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            M+TI SFKGYGKVD   +Q FRRKTRKR+IIL +S+++LV ++IG V G V++K   +  
Sbjct  1    METIRSFKGYGKVDELEQQTFRRKTRKRVIILIISSIVLVAVIIGTVIGVVVNKNKNDSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQV-AGEKTTDPKKLFVLSLQLAVDS  476
            S +      T   + S++A+CSVT Y DSC SS+S + A   T DP+ LF LSLQ+A++ 
Sbjct  61   SDNTPATQLT--PAASLKAVCSVTRYPDSCFSSISSIDASNVTKDPEILFKLSLQVAMNE  118

Query  477  LKKLASQPA  503
            L+KL + P+
Sbjct  119  LEKLQNYPS  127



>gb|KDO37799.1| hypothetical protein CISIN_1g046024mg [Citrus sinensis]
Length=581

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            M+TI SFKGYGKVD   +Q FRRKTRKR+IIL +S+++LV ++IG V G V++K   +  
Sbjct  1    METIRSFKGYGKVDELEQQTFRRKTRKRVIILIISSIVLVAVIIGTVIGVVVNKNKNDSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQV-AGEKTTDPKKLFVLSLQLAVDS  476
            S +      T   + S++A+CSVT Y DSC SS+S + A   T DP+ LF LSLQ+A++ 
Sbjct  61   SDNTPATQLT--PAASLKAVCSVTRYPDSCFSSISSIDASNVTKDPEILFKLSLQVAMNE  118

Query  477  LKKLASQPA  503
            L+KL + P+
Sbjct  119  LEKLQNYPS  127



>gb|AAM65650.1| pectinesterase, putative [Arabidopsis thaliana]
Length=586

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 84/127 (66%), Gaps = 4/127 (3%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++NSFKGYGKVD A + A ++KTRKR+++L++S V+L+ ++I  V  TV+HK      
Sbjct  1    MDSVNSFKGYGKVDEAQDLALKKKTRKRLLLLSISVVVLIAVIIAAVVATVVHKNKNEST  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
                       + S S++AICSVT + +SC+SS+S++    TTDP+ LF LSL++ +D L
Sbjct  61   PSPPPEL----TPSTSLKAICSVTRFPESCISSISKLPSSNTTDPETLFKLSLKVIIDEL  116

Query  480  KKLASQP  500
              ++  P
Sbjct  117  DSISDLP  123



>ref|NP_175787.1| pectin methylesterase 1 [Arabidopsis thaliana]
 sp|Q43867.1|PME1_ARATH RecName: Full=Pectinesterase 1; Short=PE 1; AltName: Full=Pectin 
methylesterase 1; Short=AtPME1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02857.1|AC009324_6 Pectinesterase 1 [Arabidopsis thaliana]
 emb|CAA57275.1| ATPME1 [Arabidopsis thaliana]
 gb|AAC50024.1| ATPME1 precursor [Arabidopsis thaliana]
 gb|AAL06858.1| At1g53840/T18A20_7 [Arabidopsis thaliana]
 dbj|BAE98571.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE33008.1| pectin methylesterase 1 [Arabidopsis thaliana]
Length=586

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 84/127 (66%), Gaps = 4/127 (3%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++NSFKGYGKVD A + A ++KTRKR+++L++S V+L+ ++I  V  TV+HK      
Sbjct  1    MDSVNSFKGYGKVDEAQDLALKKKTRKRLLLLSISVVVLIAVIIAAVVATVVHKNKNEST  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
                       + S S++AICSVT + +SC+SS+S++    TTDP+ LF LSL++ +D L
Sbjct  61   PSPPPEL----TPSTSLKAICSVTRFPESCISSISKLPSSNTTDPETLFKLSLKVIIDEL  116

Query  480  KKLASQP  500
              ++  P
Sbjct  117  DSISDLP  123



>gb|EYU21271.1| hypothetical protein MIMGU_mgv1a022830mg [Erythranthe guttata]
Length=551

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 92/127 (72%), Gaps = 9/127 (7%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++NSFKGYGKVD   E AF+RKTR+R+IIL+VS VL +GLVIG+V G V+H K   + 
Sbjct  1    MDSVNSFKGYGKVDEIEEAAFKRKTRRRVIILSVSVVLFIGLVIGVVVGAVVHSKKSGDV  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S       ++++ S +++++CSVT+Y +SC +SL +     +TDP+K+F  S+ +A+DSL
Sbjct  61   S------GSSKTPSAAIKSVCSVTQYPESCFTSLHE---SNSTDPEKIFQYSMTVAMDSL  111

Query  480  KKLASQP  500
             K++S P
Sbjct  112  VKVSSFP  118



>ref|XP_010462290.1| PREDICTED: pectinesterase 1 [Camelina sativa]
Length=587

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 89/133 (67%), Gaps = 16/133 (12%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++NSFKGYGKVD A + A ++KTRKRI++L++S V+L+ ++I  V  TV+HKK+    
Sbjct  1    MDSVNSFKGYGKVDEAQDSALKKKTRKRILLLSISVVVLIAVIIAAVVATVVHKKDN---  57

Query  300  sgsgeggDATRST------SKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQ  461
                   D+T S+      S S++ ICSVT + +SC+SS+S++    TTDP+ LF LSL+
Sbjct  58   -------DSTPSSPHGLTPSTSLKTICSVTRFPESCISSISKLPSSNTTDPETLFKLSLK  110

Query  462  LAVDSLKKLASQP  500
            + +D L  ++  P
Sbjct  111  VIIDELDSISDLP  123



>ref|XP_010479962.1| PREDICTED: pectinesterase 1-like [Camelina sativa]
Length=589

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 88/127 (69%), Gaps = 4/127 (3%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++NSFKGYGKVD A + A ++KTRKRI++L++S V+L+ ++I  V  TV+HKK+K   
Sbjct  1    MDSVNSFKGYGKVDEAQDSALKKKTRKRILLLSISVVVLIAVIIAAVVATVVHKKDKEST  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              S  G     + S S++ ICSVT + +SC+SS+S++    TTDP+ LF LSL++ +D L
Sbjct  61   PSSPHGL----TPSTSLKTICSVTRFPESCISSISKLPSSNTTDPETLFKLSLKVIIDEL  116

Query  480  KKLASQP  500
              ++  P
Sbjct  117  DSISDLP  123



>ref|XP_006307084.1| hypothetical protein CARUB_v10008670mg [Capsella rubella]
 gb|EOA39982.1| hypothetical protein CARUB_v10008670mg [Capsella rubella]
Length=586

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 85/127 (67%), Gaps = 4/127 (3%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++NSFKGYGKVD A + A ++KTRKRI++L +S V+LV ++I  V  TV+H KN    
Sbjct  1    MDSVNSFKGYGKVDEAQDLALKKKTRKRILLLTISVVVLVAVIIAAVIATVVHNKNDESA  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
             GS        + S S++ ICSVT + +SC+SS+S++    TTDP+ LF LSL++ +D L
Sbjct  61   PGSPHEL----TPSTSLKTICSVTRFPESCISSISKLPSSNTTDPETLFKLSLRVIIDEL  116

Query  480  KKLASQP  500
              ++  P
Sbjct  117  DSISDLP  123



>ref|XP_002891775.1| ATPME1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68034.1| ATPME1 [Arabidopsis lyrata subsp. lyrata]
Length=585

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 87/127 (69%), Gaps = 4/127 (3%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++NSFKGYGKV+ A + A ++KTRKR+++L++S V+LV ++I  V  TV+HKKN    
Sbjct  1    MDSVNSFKGYGKVNEAEDLALKKKTRKRLLLLSISVVVLVAVIIAAVVATVVHKKNNEST  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              S        + S S++AICSVT + +SC+SS+S++    T+DP+ LF LSL++ +D L
Sbjct  61   PSSPPEL----TPSTSLKAICSVTRFPESCISSISKLPSSNTSDPETLFKLSLKVIIDEL  116

Query  480  KKLASQP  500
              ++  P
Sbjct  117  DSISDLP  123



>ref|XP_008460354.1| PREDICTED: pectinesterase 3 [Cucumis melo]
Length=576

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDT+ SFKGYGKVD   +QAFR+KTR+R+II+++S VLL+ L+IG V G V+HK+N +  
Sbjct  1    MDTVKSFKGYGKVDELEQQAFRQKTRRRLIIISISVVLLIALLIGAVVGIVLHKRNSSSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S +        +   S++ +CSVT+Y  SC SSL       TTDP  LF LSL++A DSL
Sbjct  61   STTTSPPPTELTPPASLKTLCSVTQYPSSCQSSLQN---SNTTDPVFLFKLSLRVATDSL  117

Query  480  KKLA  491
             KL+
Sbjct  118  SKLS  121



>ref|XP_004144445.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 ref|XP_004171375.1| PREDICTED: pectinesterase 3-like [Cucumis sativus]
 gb|KGN58475.1| hypothetical protein Csa_3G646620 [Cucumis sativus]
Length=576

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 83/124 (67%), Gaps = 3/124 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDT+ SFKGYGKVD   +QAFR+KTR+R+II+ +S +LL+ L++G V G V+HK+N +  
Sbjct  1    MDTVKSFKGYGKVDELEQQAFRQKTRRRLIIIFISLLLLIALLVGAVVGIVVHKRNSSSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S +        +   S++ +CSVT+Y  SC SSL       TTDP  LF LSL++A DSL
Sbjct  61   STTTSPPPTELTPPASLKTLCSVTQYPSSCQSSLQN---SNTTDPVFLFKLSLRVATDSL  117

Query  480  KKLA  491
             KL+
Sbjct  118  SKLS  121



>emb|CDY51799.1| BnaC06g41950D [Brassica napus]
Length=586

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 85/127 (67%), Gaps = 1/127 (1%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ SFKGYGKVD A + A ++KTRKR+I+L VS V+LV ++I  V GTV+H KNKN  
Sbjct  1    MDSVTSFKGYGKVDEAQDLALKKKTRKRLILLTVSGVILVAVIIAAVVGTVVHNKNKNSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              +        + S S++ ICSVT + +SC +S+S++    TTDP+ LF LSL++ +D L
Sbjct  61   EPTPSSP-PELTPSTSLKTICSVTRFPESCFNSISKLPSSNTTDPEVLFKLSLKVIIDEL  119

Query  480  KKLASQP  500
              ++  P
Sbjct  120  DSISDLP  126



>gb|KFK35692.1| hypothetical protein AALP_AA4G024800 [Arabis alpina]
Length=563

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 83/127 (65%), Gaps = 6/127 (5%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++NSFKGYGKVD A   A ++KTRKRII+LAVS VLL+ L+I  V  TV+HK + +  
Sbjct  1    MDSVNSFKGYGKVDEAQNIALKKKTRKRIILLAVSVVLLIVLIIAAVIATVVHKSSSSSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              +          S +++ +CSVT Y +SC+ S+S++    TTDP+ LF LSL++ ++ L
Sbjct  61   KTTSPFE------STTLKTMCSVTRYPESCIYSISKLPSSNTTDPETLFKLSLKVIINEL  114

Query  480  KKLASQP  500
              ++  P
Sbjct  115  DSISDLP  121



>ref|XP_002885032.1| hypothetical protein ARALYDRAFT_318218 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61291.1| hypothetical protein ARALYDRAFT_318218 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 80/128 (63%), Gaps = 2/128 (2%)
 Frame = +3

Query  120  MDTINSF-KGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkne  296
            MDT+ S  KGYGKVD A + A +RKTRKR+ ++ VS V+LV ++I  V    +H +  N 
Sbjct  1    MDTVKSINKGYGKVDEAEDLALKRKTRKRLFLIGVSVVVLVSILISSVVAVAVHSRKNNS  60

Query  297  gsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDS  476
             + +    +   + + S++ +CSVT Y  SC+SS+S++    TTDP+ LF LSLQ+ VD 
Sbjct  61   PNPTPSSVNEL-TPAASLRTVCSVTRYPASCISSISKLPSSNTTDPEVLFRLSLQVVVDE  119

Query  477  LKKLASQP  500
            L  +A  P
Sbjct  120  LNSIADLP  127



>ref|XP_010917367.1| PREDICTED: pectinesterase 3 isoform X1 [Elaeis guineensis]
Length=604

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 60/126 (48%), Positives = 82/126 (65%), Gaps = 10/126 (8%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDT+ SFKGYGKV+ A ++ FRRKTRKR+II+AVSAVLLV +V  I+   V         
Sbjct  23   MDTMKSFKGYGKVNEADDREFRRKTRKRLIIIAVSAVLLVAIVGIIIGVMVS--------  74

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEK-TTDPKKLFVLSLQLAVDS  476
               G    ++ + S S++A+CSVT Y DSC SS+S   G   T DP++LF  SL +A D+
Sbjct  75   -KHGNNASSSTTPSDSIKAMCSVTRYPDSCYSSISSAKGANLTNDPEELFKFSLTVAADA  133

Query  477  LKKLAS  494
            L K+++
Sbjct  134  LSKISA  139



>ref|XP_010917368.1| PREDICTED: pectinesterase 3 isoform X2 [Elaeis guineensis]
Length=593

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 60/126 (48%), Positives = 82/126 (65%), Gaps = 10/126 (8%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            +DTI SFKGYGKV+ A ++ FRRKTRKR+II+AVSAVLLV +V  I+   V         
Sbjct  12   LDTIKSFKGYGKVNEADDREFRRKTRKRLIIIAVSAVLLVAIVGIIIGVMVS--------  63

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEK-TTDPKKLFVLSLQLAVDS  476
               G    ++ + S S++A+CSVT Y DSC SS+S   G   T DP++LF  SL +A D+
Sbjct  64   -KHGNNASSSTTPSDSIKAMCSVTRYPDSCYSSISSAKGANLTNDPEELFKFSLTVAADA  122

Query  477  LKKLAS  494
            L K+++
Sbjct  123  LSKISA  128



>ref|XP_003627449.1| Pectinesterase [Medicago truncatula]
 gb|AET01925.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=582

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDT+ SFKGYGKVD   +QAF++KTRKRI I+ +S+++LV ++I  VAG +IHK N    
Sbjct  1    MDTMKSFKGYGKVDEIEQQAFQKKTRKRITIIIISSIILVAVIIAAVAGILIHKHNTESS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S      +   + + S++A+C  T+Y +SC SS+S +    TTDP++LF LSL++A+D L
Sbjct  61   SSPNSLPNTELTPATSLKAVCESTQYPNSCFSSISSLPDSNTTDPEQLFKLSLKVAIDEL  120

Query  480  KKLA  491
             KL+
Sbjct  121  SKLS  124



>ref|XP_006392744.1| hypothetical protein EUTSA_v10011342mg [Eutrema salsugineum]
 gb|ESQ30030.1| hypothetical protein EUTSA_v10011342mg [Eutrema salsugineum]
Length=585

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 86/127 (68%), Gaps = 1/127 (1%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++NSFKGYGKVD A + A ++KTRKR+IIL+VS V+LV ++I  V  TV+H K KN  
Sbjct  1    MDSVNSFKGYGKVDEAQDLALKKKTRKRLIILSVSVVILVAVIIAAVVATVVHNKKKNSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              +     +  S S S+++ICSVT + +SC  S+S++    TTDP+ LF LSL++ +D L
Sbjct  61   ESTPSSP-SELSPSTSLKSICSVTRFPESCFYSISKLPSSNTTDPEILFKLSLKVIIDEL  119

Query  480  KKLASQP  500
              ++  P
Sbjct  120  DSISDLP  126



>ref|XP_009123647.1| PREDICTED: pectinesterase 1 [Brassica rapa]
 emb|CDY08207.1| BnaA05g14120D [Brassica napus]
Length=586

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 86/127 (68%), Gaps = 1/127 (1%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ SFKGYGKVD A + A ++KTRKR+I+L VS V+LV ++IG V GTV+H KNKN  
Sbjct  1    MDSVTSFKGYGKVDEAQDLALKKKTRKRLILLTVSGVILVAVIIGAVVGTVVHNKNKNST  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              +        + S S++ ICSVT Y +SC +S+S++    TTDP+ LF LSL++ +D L
Sbjct  61   EPTPSSPPEL-TPSTSLKTICSVTRYPESCFNSISKLPSSNTTDPEVLFKLSLKVIIDEL  119

Query  480  KKLASQP  500
              ++  P
Sbjct  120  DGISDLP  126



>ref|XP_009147579.1| PREDICTED: pectinesterase 1 [Brassica rapa]
Length=586

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 80/127 (63%), Gaps = 1/127 (1%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ SFKGYGKVD A + A ++ TR R+I+L++S ++L+ ++I  V   V+H KNKN  
Sbjct  1    MDSVQSFKGYGKVDEAQDLALKKNTRTRLILLSISGLILLAVIISAVVAAVVHTKNKNSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              +        + S S++ ICSVT Y +SC  S+S++    TTDP  LF LSL+L +D L
Sbjct  61   ESTPSPP-PELTPSTSLKTICSVTRYPESCFYSISKLPASNTTDPAILFKLSLKLIIDEL  119

Query  480  KKLASQP  500
              ++  P
Sbjct  120  DGISDLP  126



>gb|AIA91245.1| PMEI, partial [uncultured bacterium]
Length=162

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 78/126 (62%), Gaps = 9/126 (7%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+I SF+GYGKV+ A ++ F RKTR+R+II+A S VLL+ +V   V   V    + N  
Sbjct  13   MDSIKSFEGYGKVNEAEDRQFFRKTRRRLIIIAASVVLLLAIVGITVGVMVGKHGDGNPS  72

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEK-TTDPKKLFVLSLQLAVDS  476
                     + + S S++A+CSVT Y DSC SS+S   G   T DP++LF  SL +A D+
Sbjct  73   --------PSITFSDSLKAVCSVTRYPDSCYSSISSAKGANLTNDPEELFKFSLAVATDA  124

Query  477  LKKLAS  494
            L K+++
Sbjct  125  LSKISA  130



>gb|KHG28352.1| Pectinesterase 3 [Gossypium arboreum]
Length=586

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 83/127 (65%), Gaps = 3/127 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+INSFKGYGKVD   E AFRRK R+R+I L +  +LL+ L+   V G  +HK++ +  
Sbjct  1    MDSINSFKGYGKVDEVEELAFRRKKRRRLITLIILILLLLTLITAAVVGIFLHKRSSSSP  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            +          + + S++A+CSVT+Y  SC SS+S +A   TTDP+ LF LSL++A+D L
Sbjct  61   NTLPP---PVLTPAASLKAVCSVTQYPASCFSSISSIASSNTTDPELLFKLSLKVAIDEL  117

Query  480  KKLASQP  500
             +L+  P
Sbjct  118  SRLSHYP  124



>emb|CDY24071.1| BnaA06g00690D [Brassica napus]
Length=584

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 82/127 (65%), Gaps = 3/127 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ SFKGYGKVD A + A ++KTR R+I+L++S V+L+ ++I  V   V+H KN  E 
Sbjct  1    MDSVQSFKGYGKVDEAQDLALKKKTRTRLILLSISGVILLAVIIAAVVAAVVHNKNSPES  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            + S        + S S++ IC+VT Y +SC +S+S++    TTDP  LF LSL++ +D L
Sbjct  61   TPSPP---PELTPSTSLKTICTVTRYPESCFNSISKLPASNTTDPAILFKLSLKVIIDEL  117

Query  480  KKLASQP  500
              ++  P
Sbjct  118  DGISDLP  124



>ref|XP_002532945.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF29429.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=589

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 89/128 (70%), Gaps = 2/128 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+INSFKGYGKVD   +QA+RRKTRKR+IIL VS ++LV ++IG V GTVIHK+N +  
Sbjct  1    MDSINSFKGYGKVDELEQQAYRRKTRKRLIILIVSFIVLVAIIIGAVVGTVIHKRNNDSS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              S    + T   + S++A+CSVT++  SC SS+S +    T+DP+ LF LSL + ++ L
Sbjct  61   PNSAVPTELT--PAASLKAVCSVTQFPSSCFSSISSLETANTSDPEVLFKLSLHVVINEL  118

Query  480  KKLASQPA  503
             K+   P+
Sbjct  119  SKIKDYPS  126



>ref|XP_010542351.1| PREDICTED: pectinesterase 1 [Tarenaya hassleriana]
Length=586

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 81/127 (64%), Gaps = 1/127 (1%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ S KGYGKVD A +   +RKTR+R+I+++VSAV+LV ++I  V   V+H +  N  
Sbjct  1    MDSVKSIKGYGKVDEAQDLELKRKTRRRLILISVSAVVLVAVIIAGVIAGVVHSRRNNSP  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              +      T + + S++ +CSVT Y  SC+SS+S++    TTDP+ LF LSL + V+ L
Sbjct  61   ESALTPP-PTLTPAASLRTVCSVTRYPASCISSISKLPSSNTTDPEVLFRLSLTVVVNEL  119

Query  480  KKLASQP  500
              L+  P
Sbjct  120  ASLSDLP  126



>ref|XP_006297279.1| hypothetical protein CARUB_v10013297mg [Capsella rubella]
 gb|EOA30177.1| hypothetical protein CARUB_v10013297mg [Capsella rubella]
Length=590

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 77/128 (60%), Gaps = 2/128 (2%)
 Frame = +3

Query  120  MDTINSF-KGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkne  296
            MDT+ S  KGYGKVD A + A +RKTRKR+I + VS  +LV ++I  V    +H +  N 
Sbjct  1    MDTVKSINKGYGKVDEAQDLALKRKTRKRLIYIGVSVAVLVAIIISSVVAVAVHSRRNNS  60

Query  297  gsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDS  476
               +        + + S++ +CSVT +  SC+SS+S++    TTDP+ LF LSL++ VD 
Sbjct  61   PKSTPSTV-PELTPAASLRTVCSVTRFPASCISSISKLPSSNTTDPEVLFKLSLKVVVDE  119

Query  477  LKKLASQP  500
            L  ++  P
Sbjct  120  LNSISDLP  127



>ref|XP_007024769.1| Pectinesterase 3 [Theobroma cacao]
 gb|EOY27391.1| Pectinesterase 3 [Theobroma cacao]
Length=586

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 88/128 (69%), Gaps = 3/128 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+I SFKGYGKVD   EQAF+RKTR+R+IIL +S  +L+ ++I  VAG +IH K  N  
Sbjct  1    MDSIKSFKGYGKVDELEEQAFKRKTRRRLIILIISIAVLIAVIIAAVAGILIH-KRSNSS  59

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S +    D T   + S++ +CSVT+Y  SC SSLS +A   T+DP+ LF LSL++A++ L
Sbjct  60   SNTVPPTDLT--PAASLKTVCSVTQYPTSCFSSLSSMASSNTSDPEILFKLSLEVAINEL  117

Query  480  KKLASQPA  503
             KL+  P+
Sbjct  118  SKLSQYPS  125



>emb|CDO97789.1| unnamed protein product [Coffea canephora]
Length=567

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 84/126 (67%), Gaps = 5/126 (4%)
 Frame = +3

Query  135  SFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknknegsgsge  314
            SFK YGKVD   +QA +R+ R+++IIL +S V+LV L+IGIV GT  HKKNKN       
Sbjct  4    SFKAYGKVDSLEKQALKRRNRRKMIILLLSLVVLVALIIGIVVGTPNHKKNKNGDDALS-  62

Query  315  ggDATRSTSKSVQAICSVTEYKDSCVSSLSQVA-GEKTTDPKKLFVLSLQLAVDSLKKLA  491
               +T ++++S++A+CSV  Y  SC SSLS       T DP+KLF LSLQ+  DSL+KL+
Sbjct  63   ---STPNSAQSIKAVCSVATYPKSCYSSLSPFGISNSTIDPEKLFHLSLQVVHDSLEKLS  119

Query  492  SQPAGW  509
            + P  W
Sbjct  120  TLPQEW  125



>gb|EPS63460.1| hypothetical protein M569_11324, partial [Genlisea aurea]
Length=336

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 82/128 (64%), Gaps = 13/128 (10%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDT+NSFKGYGKVDPA E AFR+KTRKRIIIL+VS +LL+ LVI IVAGT          
Sbjct  1    MDTVNSFKGYGKVDPAQEAAFRKKTRKRIIILSVSVILLLVLVIAIVAGTAAR-------  53

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
                       +   ++++IC VT Y +SC++SL    G  ++DP+K+F LSL L   SL
Sbjct  54   ---RRTHGGGSTIDAALKSICGVTLYPESCIASL---GGSNSSDPEKVFRLSLSLLASSL  107

Query  480  KKLASQPA  503
            ++L S P 
Sbjct  108  QRLTSFPG  115



>ref|NP_188047.1| pectin methylesterase 26 [Arabidopsis thaliana]
 sp|Q9LUL8.1|PME26_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
26; AltName: Full=AtPMEpcrC; Includes: RecName: Full=Pectinesterase 
inhibitor 26; AltName: Full=Pectin methylesterase 
inhibitor 26; Includes: RecName: Full=Pectinesterase 26; Short=PE 
26; AltName: Full=Pectin methylesterase 26; Short=AtPME26 
[Arabidopsis thaliana]
 dbj|BAB01036.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AEE75499.1| putative pectinesterase/pectinesterase inhibitor 26 [Arabidopsis 
thaliana]
Length=968

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 72/128 (56%), Gaps = 2/128 (2%)
 Frame = +3

Query  120  MDTINSF-KGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkne  296
            MDT+ S  KGYGKVD   + A +RKTRKR+  + +S  +LV ++I       IH +  N 
Sbjct  1    MDTVKSINKGYGKVDETQDLALKRKTRKRLYQIGISVAVLVAIIISSTVTIAIHSRKGNS  60

Query  297  gsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDS  476
               +        + + S++ +CSVT Y  SC SS+S++    TTDP+ +F LSLQ+ +D 
Sbjct  61   PHPTPSSV-PELTPAASLKTVCSVTNYPVSCFSSISKLPLSNTTDPEVIFRLSLQVVIDE  119

Query  477  LKKLASQP  500
            L  +   P
Sbjct  120  LNSIVELP  127


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +3

Query  345  SVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLASQP  500
            S++ +CSVT Y  SCVSS+S++    TTDP+ LF LSLQ+ ++ L  +A  P
Sbjct  270  SLRNVCSVTRYPASCVSSISKLPSSNTTDPEALFRLSLQVVINELNSIAGLP  321


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = +3

Query  339  SKSVQAICSVTEYKDSCVSSLSQVAGEK-TTDPKKLFVLSLQLAVDSLKKLASQP  500
            S  ++ +C+VT Y  SC+SS+S++   K TTDPK LF LSLQ+  D L  +   P
Sbjct  456  SSVLRTVCNVTNYPASCISSISKLPLSKTTTDPKVLFRLSLQVTFDELNSIVGLP  510



>ref|XP_010940182.1| PREDICTED: pectinesterase 3-like [Elaeis guineensis]
Length=787

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 79/126 (63%), Gaps = 6/126 (5%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++NSF GYG++    E+ +R+KTRKR+ I+++S  LL+ ++IGI    + +K + +  
Sbjct  1    MDSMNSFSGYGRMKEFEERIYRQKTRKRLTIISISTFLLLAIIIGITVAALANKHSNSST  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTT-DPKKLFVLSLQLAVDS  476
                       ST  S++A+C+ T Y D C SS+S   G  TT +PK+ F LSLQ+A+++
Sbjct  61   QRPPPI-----STPNSIKALCAATRYPDCCDSSISSAKGSNTTENPKEFFKLSLQVAIEA  115

Query  477  LKKLAS  494
            LK  ++
Sbjct  116  LKNFST  121



>ref|XP_010465322.1| PREDICTED: pectinesterase 1-like [Camelina sativa]
Length=589

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 74/128 (58%), Gaps = 2/128 (2%)
 Frame = +3

Query  120  MDTINSFK-GYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkne  296
            MDT+ S K GYGKVD A + A +RKT KR I + +S  +LV ++IG V    +H ++ N 
Sbjct  1    MDTVKSVKRGYGKVDEAEDLALKRKTAKRFIYMGLSVAVLVAIIIGSVVAVAVHSRSNNS  60

Query  297  gsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDS  476
                        + + S++ +CSVT Y  SC+SS+S+     TTDP+ LF LSL++  D 
Sbjct  61   PKPRPNST-PELTPAASLKTVCSVTRYPSSCISSISKFPASNTTDPEVLFKLSLKVVADE  119

Query  477  LKKLASQP  500
            L  ++  P
Sbjct  120  LNSISDLP  127



>emb|CDY36608.1| BnaC06g06610D [Brassica napus]
Length=581

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 77/127 (61%), Gaps = 5/127 (4%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ SF+GYGKVD A + A ++KTR R+I+L+ S ++L+ ++I  V   V    ++   
Sbjct  1    MDSVQSFEGYGKVDEAQDLALKKKTRTRLILLSASGLILLAVIIAAVVAAVNKNSSEPAL  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S   E   +T     S++ ICSVT Y +SC  S+S++    TTDP  LF LSL++ +D L
Sbjct  61   SQLPELTPST-----SLKTICSVTRYPESCFYSISKLPASNTTDPAILFKLSLKVIIDEL  115

Query  480  KKLASQP  500
              ++  P
Sbjct  116  DGISDLP  122



>gb|KJB57092.1| hypothetical protein B456_009G147800 [Gossypium raimondii]
Length=587

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+I SFKGYGKVD A E+AF+RKTR+R+IIL +S ++L+ ++IG VAGT+IHK+N +  
Sbjct  1    MDSIKSFKGYGKVDEAEERAFKRKTRRRLIILVISIIVLLAVIIGAVAGTLIHKRNNSSP  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              +        + + S++A+C VT+Y  SC SS+S +A     DPK LF LSL++A+D L
Sbjct  61   DTASPTE---LTPAASLKAVCEVTQYPSSCFSSISSIASSNANDPKILFKLSLKVAIDEL  117

Query  480  KKLASQP  500
              L+  P
Sbjct  118  SGLSQYP  124



>ref|XP_010261670.1| PREDICTED: pectinesterase 3-like [Nelumbo nucifera]
Length=263

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 89/129 (69%), Gaps = 2/129 (2%)
 Frame = +3

Query  117  VMDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkne  296
            +MDTI SFKGYGK+D   E+ FRR+TRKR+II+AVSA +LV +++  V G+  HK  KN+
Sbjct  1    MMDTIKSFKGYGKIDEPEEREFRRETRKRLIIIAVSAFILVIIIVAFVVGSTTHKDEKND  60

Query  297  gsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGE-KTTDPKKLFVLSLQLAVD  473
               S     +T S   S++ +C+VT Y  SC+SS+S +  E KTTDP+++F LSLQ+A +
Sbjct  61   SDKSMSIP-STISVGDSIKTVCNVTLYPKSCISSISSLKLEQKTTDPEEIFKLSLQVAFN  119

Query  474  SLKKLASQP  500
             L  L+S P
Sbjct  120  ELSNLSSLP  128



>gb|KHG08632.1| Pectinesterase 3 [Gossypium arboreum]
Length=587

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 88/127 (69%), Gaps = 3/127 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+I SFKGYGKVD A E+AF+RKTR+R+IIL +S ++L+ ++IG VAGT+IHK+N +  
Sbjct  1    MDSIKSFKGYGKVDEAEERAFKRKTRRRLIILVISIIVLLAVIIGAVAGTLIHKRNNSSP  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              +        + + S++A+C VT+Y  SC SS+S VA    TDP+ LF LSL++ +D L
Sbjct  61   DTASPTE---LTPAASLKAVCEVTQYPSSCFSSISSVASSNATDPEILFKLSLKVVIDEL  117

Query  480  KKLASQP  500
              L+  P
Sbjct  118  SGLSQYP  124



>ref|XP_006828611.1| hypothetical protein AMTR_s00129p00070300 [Amborella trichopoda]
 gb|ERM96027.1| hypothetical protein AMTR_s00129p00070300 [Amborella trichopoda]
Length=659

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 85/127 (67%), Gaps = 6/127 (5%)
 Frame = +3

Query  129  INSFKGYGKV--DPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknknegs  302
            INSFKGYGKV  D  A++ ++RKTRKRI I+A+S+V+L+ +++  + G    +    + +
Sbjct  15   INSFKGYGKVNEDLEAKRQYQRKTRKRIAIIALSSVVLIVIIVAAIIGVSRKQGQNGQNA  74

Query  303  gsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLK  482
             +    +   +T+KS++A+CSVT+   SC SSLSQ A     DP+ +F LSL+++++ L+
Sbjct  75   RA----ENLPATAKSIKAVCSVTKNPTSCFSSLSQAADPNQIDPEDIFKLSLKVSMNELE  130

Query  483  KLASQPA  503
            K ++ PA
Sbjct  131  KASTIPA  137



>sp|Q43111.1|PME3_PHAVU RecName: Full=Pectinesterase 3; Short=PE 3; AltName: Full=Pectin 
methylesterase 3; Flags: Precursor [Phaseolus vulgaris]
 emb|CAA59482.1| pectinesterase [Phaseolus vulgaris]
Length=581

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 82/126 (65%), Gaps = 0/126 (0%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDTI SFKGYGKV+   +QA+ +KTRKR+II+AVS+++L+ ++I  VAG VIH +N    
Sbjct  1    MDTIKSFKGYGKVNELEQQAYEKKTRKRLIIIAVSSIVLIAVIIAAVAGVVIHNRNSESS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              S        S + S++A+C  T Y  SC SS+S +    TTDP+ LF LSL++A+D L
Sbjct  61   PSSDSVPQTELSPAASLKAVCDTTRYPSSCFSSISSLPESNTTDPELLFKLSLRVAIDEL  120

Query  480  KKLASQ  497
                S+
Sbjct  121  SSFPSK  126



>ref|XP_007135363.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
 gb|ESW07357.1| hypothetical protein PHAVU_010G123100g [Phaseolus vulgaris]
Length=1192

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = +3

Query  108  SVPVMDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkkn  287
            S+  MDTI SFKGYGKV+   +QA+ +KTRKR+II+AVS+++L+ ++I  VAG VIH +N
Sbjct  608  SLGFMDTIKSFKGYGKVNELEQQAYEKKTRKRLIIIAVSSIVLIAVIIAAVAGVVIHNRN  667

Query  288  knegsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLA  467
                  S        S + S++A+C  T Y  SC SS+S +    TTDP+ LF LSL++A
Sbjct  668  SESSPSSDSVPQTELSPAASLKAVCDTTRYPSSCFSSISSLPESNTTDPELLFKLSLRVA  727

Query  468  VDSLKKLASQ  497
            +D L    S+
Sbjct  728  IDELSSFPSK  737



>ref|XP_010487229.1| PREDICTED: pectinesterase 1-like [Camelina sativa]
Length=588

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 72/128 (56%), Gaps = 2/128 (2%)
 Frame = +3

Query  120  MDTINSFKG-YGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkne  296
            MDT+NS K  YGKV+ A + A +RKT KR I + +S  +LV ++I  V    +H +  N 
Sbjct  1    MDTMNSIKNSYGKVNEAEDLALKRKTAKRFIYMGLSVAVLVAIIISSVVAVAVHSRRNNS  60

Query  297  gsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDS  476
                        + + S++ +CSVT Y  SC+SS+S+     TTDP+ LF LSL++  D 
Sbjct  61   PKPRPNST-PELTPAASLKTVCSVTRYPSSCISSISKFPASNTTDPEVLFKLSLKVVADE  119

Query  477  LKKLASQP  500
            L  ++  P
Sbjct  120  LNSISDLP  127



>ref|XP_011079312.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=569

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 91/127 (72%), Gaps = 8/127 (6%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ SFKGYGKVD     AFRRKTRKR+I++++S VLLV L++G+VAGTV HK  K + 
Sbjct  1    MDSVKSFKGYGKVDELEAAAFRRKTRKRLIVISISVVLLVVLIVGVVAGTVAHKNKKRDS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
              +     +  ST+ ++++ICSVT+Y +SCVSSL       +++P+++F  SL + +DSL
Sbjct  61   GDA-----SATSTAAAIKSICSVTQYPNSCVSSLES---SNSSNPERIFQFSLSVVMDSL  112

Query  480  KKLASQP  500
            +KL++ P
Sbjct  113  EKLSTLP  119



>ref|XP_006369082.1| hypothetical protein POPTR_0001s16291g [Populus trichocarpa]
 gb|ERP65651.1| hypothetical protein POPTR_0001s16291g [Populus trichocarpa]
Length=556

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 76/115 (66%), Gaps = 2/115 (2%)
 Frame = +3

Query  156  VDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknknegsgsgeggDATRS  335
            VD   +QAFRRKTRKR+II+ VS+++L+ ++IG V G V+H +N N  S      + T  
Sbjct  5    VDEVEQQAFRRKTRKRLIIVVVSSIVLLAVIIGAVIGVVLHNRNNNSSSNPVPPPELT--  62

Query  336  TSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLASQP  500
             + S++A+CSVT Y  SC SS+S +    TTDP++LF LSL +A++ L KL   P
Sbjct  63   PAASLKAVCSVTRYPTSCFSSISALETGNTTDPEELFKLSLHVAMNELSKLKDYP  117



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +3

Query  330  RSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLASQPA  503
            + + K+++ IC  T+YK++CVSSL+ VAG  TTDPK+L  LS ++A++ +KK+A Q A
Sbjct  63   QDSMKAIKTICQPTDYKEACVSSLTSVAGSNTTDPKELVKLSFEVALEKVKKVAGQSA  120



>emb|CDP12348.1| unnamed protein product [Coffea canephora]
Length=245

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 1/127 (1%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+IN FKGYGKV+  A        R+R I+LA S  + + +V+G + G +I++      
Sbjct  1    MDSINFFKGYGKVNNPAGNQQPASNRRRRILLAASLAVFLTIVLGAMIGALIYESATEPP  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
                E   A+ S  +S++ +C+VT+Y DSC++S+S +     +DP   F LSLQ++   L
Sbjct  61   ESEEEQLPASDS-GESLKTVCAVTQYLDSCINSISALNDPPKSDPVHFFNLSLQVSQREL  119

Query  480  KKLASQP  500
              LAS P
Sbjct  120  ASLASLP  126



>ref|XP_010033654.1| PREDICTED: pectinesterase 3-like [Eucalyptus grandis]
Length=592

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 88/125 (70%), Gaps = 2/125 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDT+ SFKGYGKVD A E+AFR++TR+R+IIL  S VLL+ +V   VAGT+IH++N +  
Sbjct  1    MDTMKSFKGYGKVDEAEERAFRQRTRRRLIILVASGVLLLAVVAAAVAGTIIHRRNSSGS  60

Query  300  sgsgeggDATR--STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVD  473
               G+GG A    + S +++A+CSVT+Y DSC SS+S       T+P+  F LSL +A+ 
Sbjct  61   GRGGDGGAAPSELTPSATLKAVCSVTQYPDSCFSSISAAETANATNPEHFFRLSLAVAMG  120

Query  474  SLKKL  488
            +L+KL
Sbjct  121  ALQKL  125



>ref|XP_008375511.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Malus domestica]
Length=337

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 79/126 (63%), Gaps = 12/126 (10%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQAFR---RKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            ++SFK YGKVD + EQA     RKTRKR+ I+++S+++LV +V+  V GT +H K+    
Sbjct  1    MSSFKSYGKVDES-EQARLDACRKTRKRVAIISLSSIVLVCIVVAAVVGTTVHNKSGGNS  59

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
             GS          S SV+A+C VT Y+DSC SSLS +       P++LF L++Q+A++ L
Sbjct  60   KGS--------GISTSVKAVCDVTLYQDSCYSSLSPLVNSNNVKPEELFKLAVQVAINEL  111

Query  480  KKLASQ  497
             K AS 
Sbjct  112  TKAASH  117



>ref|XP_008797350.1| PREDICTED: pectinesterase 3 [Phoenix dactylifera]
Length=590

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 78/126 (62%), Gaps = 9/126 (7%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+I SFKGYGKV+ A ++ F R TR+R+II+A S VLL+ +V   V   V    + N  
Sbjct  12   MDSIKSFKGYGKVNEAEDREFLRITRRRLIIIAASVVLLLAIVGITVGVMVGKHGDGNPS  71

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEK-TTDPKKLFVLSLQLAVDS  476
                    ++ + S S++A+CSVT Y DSC SS+S   G   T DP++LF  SL +A D+
Sbjct  72   --------SSITFSDSLKAVCSVTRYPDSCYSSISSAKGANLTNDPEELFKFSLAVATDA  123

Query  477  LKKLAS  494
            L K+++
Sbjct  124  LSKISA  129



>ref|XP_010501837.1| PREDICTED: pectinesterase 1-like [Camelina sativa]
Length=585

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 70/125 (56%), Gaps = 2/125 (2%)
 Frame = +3

Query  129  INSFKG-YGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknknegsg  305
            +NS K  YGKV+ A + A +RKT KR I + +S  +LV ++IG V    +H +  N    
Sbjct  1    MNSIKNSYGKVNEAEDLALKRKTAKRFIYMGLSVAVLVAIIIGSVVAVAVHSRRNNSPKP  60

Query  306  sgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKK  485
                     + + S++ +CSVT Y  SC+SS+S+     TTDP+ LF LSL++  D L  
Sbjct  61   RPNST-PELTPAASLKTVCSVTRYPSSCISSISKFPASNTTDPEVLFKLSLKVVADELNS  119

Query  486  LASQP  500
            ++  P
Sbjct  120  ISDLP  124



>gb|KEH19215.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=581

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 81/122 (66%), Gaps = 3/122 (2%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQAF--RRKTRKRiiilavsavllvglvigivagtviHkknknegs  302
            ++SFK YGKVD +A+  F  RRK+RKRI I+ +S V+L+G+V   V GT+ H   +N+ +
Sbjct  1    MSSFKAYGKVDESAQAMFEVRRKSRKRITIICLSTVVLIGIVFAAVFGTIAHNNARNDDN  60

Query  303  gsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQ-VAGEKTTDPKKLFVLSLQLAVDSL  479
             + E  +  +S S +++A+C VT YKDSC  SLS  V   +   P++LF LS+Q+A+ ++
Sbjct  61   NNNENDNNDQSLSSAIKAVCDVTLYKDSCEKSLSPLVQPGQQIRPEELFKLSIQVALTAV  120

Query  480  KK  485
             K
Sbjct  121  SK  122



>ref|XP_008375414.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Malus domestica]
Length=572

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 78/126 (62%), Gaps = 12/126 (10%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQAFR---RKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            ++SFK YGKVD  +EQA     RKTRKR+ I+++S+ +LV +V+  V GT +H K+    
Sbjct  1    MSSFKSYGKVD-ESEQARLDACRKTRKRVAIISLSSXVLVCIVVAAVVGTTVHNKSGGNS  59

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
             GS          S SV+A+C VT Y+DSC SSLS +       P++LF L++Q+A++ L
Sbjct  60   KGS--------GISTSVKAVCDVTLYQDSCYSSLSPLVNSNNVKPEELFKLAVQVAINEL  111

Query  480  KKLASQ  497
             K AS 
Sbjct  112  TKAASH  117



>ref|XP_008356804.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Malus domestica]
Length=572

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 78/126 (62%), Gaps = 12/126 (10%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQAFR---RKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            ++SFK YGKVD  +EQA     RKTRKR+ I+++S+ +LV +V+  V GT +H K+    
Sbjct  1    MSSFKSYGKVD-ESEQARLDACRKTRKRVAIISLSSXVLVCIVVAAVVGTTVHNKSGGNS  59

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
             GS          S SV+A+C VT Y+DSC SSLS +       P++LF L++Q+A++ L
Sbjct  60   KGS--------GISTSVKAVCDVTLYQDSCYSSLSPLVNSNNVKPEELFKLAVQVAINEL  111

Query  480  KKLASQ  497
             K AS 
Sbjct  112  TKAASH  117



>ref|XP_007012507.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY30126.1| Pectinesterase, putative [Theobroma cacao]
Length=629

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 53/132 (40%), Positives = 76/132 (58%), Gaps = 11/132 (8%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD+  SFK Y KVD   EQA+R+KTRKR+II+ +S ++L+ +VIG V G +         
Sbjct  37   MDSTKSFKSYSKVDELEEQAYRKKTRKRMIIITLSTIILIAIVIGAVLGILF------PV  90

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSC-VSSLSQVAGEKTTDPK----KLFVLSLQL  464
              S    +    T++++ AIC +T Y DSC  S  S  +    TDP     K+F LS+Q+
Sbjct  91   KSSKSQENPANYTAENIDAICIMTRYPDSCDSSIASLRSSSNDTDPSPSPGKIFTLSMQV  150

Query  465  AVDSLKKLASQP  500
            A D L +L+S P
Sbjct  151  ARDELIRLSSLP  162



>ref|XP_009339254.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Pyrus x bretschneideri]
 ref|XP_009339262.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Pyrus x bretschneideri]
Length=572

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 77/126 (61%), Gaps = 12/126 (10%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQA---FRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            ++SFK YGKVD   EQA    RRKTRKR+ I+++S+++LV +V+  V GT +H K+    
Sbjct  1    MSSFKSYGKVD-EYEQARLDARRKTRKRVAIISLSSIVLVCIVVAAVVGTTVHNKSGGNS  59

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
             GS          S SV+A+C VT Y+DSC SSL  +       P++LF L++Q+A + L
Sbjct  60   EGS--------GISTSVKAVCDVTLYQDSCYSSLGPLVNSNNVKPEELFKLAVQVANNEL  111

Query  480  KKLASQ  497
             K AS 
Sbjct  112  TKAASH  117



>ref|XP_008231878.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Prunus mume]
Length=574

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 80/128 (63%), Gaps = 10/128 (8%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQAF--RRKTRKRiiilavsavllvglvigivagtviHkknknegs  302
            ++SFK YGKV+   +     RRKTR+R++I+++S+++LV +V+  V GT IHK N     
Sbjct  1    MSSFKAYGKVNELEQSRLDARRKTRRRVVIISLSSIVLVCVVVAAVVGTTIHKNNSGGKQ  60

Query  303  gsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLK  482
            GS        S S SV+A+C VT Y+DSC SSL  +       P+ LF L++++A++ L 
Sbjct  61   GS--------SLSTSVKAVCDVTLYQDSCYSSLGALVNSTNAKPEDLFKLAIRVAINELS  112

Query  483  KLASQPAG  506
            K AS+ +G
Sbjct  113  KAASRFSG  120



>ref|XP_002515781.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46620.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=573

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 47/123 (38%), Positives = 66/123 (54%), Gaps = 5/123 (4%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknknegsgs  308
            ++SFK YGKVD A +     + R R  I  +S   ++   I + A    H    N  +G 
Sbjct  1    MSSFKAYGKVDEAEQATLEARRRTRKRITIISLSSILLAAIVVAAVVGTHASGGNSNNGG  60

Query  309  geggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKL  488
                D  +  S SV+A+C VT YKDSC SSL+  A      P++LF LS+Q+A+D + K 
Sbjct  61   ----DQAKPISTSVKAVCDVTLYKDSCYSSLAPFAKPNNLQPEELFKLSIQVALDEISK-  115

Query  489  ASQ  497
            ASQ
Sbjct  116  ASQ  118



>gb|KJB54561.1| hypothetical protein B456_009G038900 [Gossypium raimondii]
Length=594

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 52/132 (39%), Positives = 78/132 (59%), Gaps = 11/132 (8%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD++ SF+ Y K D   EQA+RR+TRKR+II+ +S ++L+ ++IG V GT+         
Sbjct  1    MDSMKSFQSYCKADELEEQAYRRRTRKRLIIIGLSTIVLIAIIIGAVFGTLF------PV  54

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSC-VSSLSQVAGEKTTDPK----KLFVLSLQL  464
              S    +    T++S++AIC VT Y DSC  S  +  +    TDP     K+F LS+Q+
Sbjct  55   KSSKSNENPPTYTAESIKAICDVTRYPDSCGSSIAAIRSSSNDTDPNPGPSKVFTLSMQV  114

Query  465  AVDSLKKLASQP  500
            AV  L +L+S P
Sbjct  115  AVGELIRLSSLP  126



>ref|XP_007219746.1| hypothetical protein PRUPE_ppa024156mg [Prunus persica]
 gb|EMJ20945.1| hypothetical protein PRUPE_ppa024156mg [Prunus persica]
Length=574

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 80/128 (63%), Gaps = 10/128 (8%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQAF--RRKTRKRiiilavsavllvglvigivagtviHkknknegs  302
            ++SFK YGKV+   +     RRKTR+R++I+++S+++LV +V+  V GT IHK N     
Sbjct  1    MSSFKAYGKVNELEQSRLDARRKTRRRVVIISLSSIVLVCVVVAAVVGTTIHKNNSGGKP  60

Query  303  gsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLK  482
            GS        S S SV+A+C VT Y+DSC SSL  +       P+ LF L++++A++ L 
Sbjct  61   GS--------SLSTSVKAVCDVTLYQDSCYSSLGALVNSTNAKPEDLFKLAIRVAINELS  112

Query  483  KLASQPAG  506
            K AS+ +G
Sbjct  113  KAASRFSG  120



>ref|XP_006828609.1| hypothetical protein AMTR_s00129p00068690 [Amborella trichopoda]
 gb|ERM96025.1| hypothetical protein AMTR_s00129p00068690 [Amborella trichopoda]
Length=583

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 49/131 (37%), Positives = 75/131 (57%), Gaps = 8/131 (6%)
 Frame = +3

Query  117  VMDTINSFKGYGKVDPAAEQA---FRRKTRKRiiilavsavllvglvigivagtviHkkn  287
            +M    SF+GYGK+D   EQA    R KTRKR+ I+++S ++LV +V+ +  G       
Sbjct  1    MMSNSTSFRGYGKLD-ETEQARLEARHKTRKRMTIISLSTIVLVTIVVAVTVGPTQSHAG  59

Query  288  knegsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLA  467
            K +   S +    +R    S++A+C++  Y DSC SSLS +A     DP+ LF LSL++A
Sbjct  60   KQKPDSSSD----SRPYYSSIKALCNLAVYPDSCFSSLSPIANVNHLDPESLFKLSLEVA  115

Query  468  VDSLKKLASQP  500
            +  +   AS P
Sbjct  116  LKEISNAASLP  126



>ref|XP_003526361.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24-like 
[Glycine max]
Length=575

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 8/121 (7%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQAF--RRKTRKRiiilavsavllvglvigivagtviHkknknegs  302
            ++S K YGKVD   +     RRKTRKRI I+ +S+++L G++   +              
Sbjct  1    MSSLKSYGKVDEHEQMVLEARRKTRKRITIIGLSSIVLAGVIFAAI-----FGIVSTTHD  55

Query  303  gsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLK  482
             S +  DA   TS S++A+C VT YKDSC SSL  V   +   P++LF+LS++LA+  + 
Sbjct  56   NSQDANDAHTVTS-SLRAVCDVTLYKDSCYSSLGSVVDSRQVQPEELFILSMKLALSEVS  114

Query  483  K  485
            K
Sbjct  115  K  115



>ref|XP_011470454.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Fragaria vesca subsp. vesca]
Length=538

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 75/126 (60%), Gaps = 11/126 (9%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQAF--RRKTRKRiiilavsavllvglvigivagtviHkknknegs  302
            ++SFK YGKV  + +     RRKT KR+ I+++S+++LV +V+  V GT  H   K +  
Sbjct  1    MSSFKAYGKVSESDQAKLDARRKTCKRVAIISISSIVLVCVVVAAVVGTATHNSKKGD--  58

Query  303  gsgeggDATRST-SKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
                  D+ + T S SV+A+C VT Y+DSC SSL  V       P+ LF LS+Q+A+  L
Sbjct  59   ------DSGKGTLSASVKAVCDVTLYQDSCYSSLGPVVNTSNFKPEDLFKLSIQVAIAEL  112

Query  480  KKLASQ  497
             K A+Q
Sbjct  113  SKAAAQ  118



>gb|KFK28345.1| hypothetical protein AALP_AA8G504100, partial [Arabis alpina]
Length=835

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 69/128 (54%), Gaps = 1/128 (1%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD +N  KGY KVD   +   R+K +K + I AV AVL+V ++      ++     +N  
Sbjct  1    MDFVNFVKGYFKVDDEHDLVLRKKRKKWLFITAVIAVLVVSIIGIGAGVSLNAHNRRNHS  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQV-AGEKTTDPKKLFVLSLQLAVDS  476
                       + + +++ +C VT Y D+CVSS+S++ +   TTDP  LF LSL++ VD 
Sbjct  61   PHWEPSSSPQLTPAATLKTVCGVTRYPDACVSSISKIPSSNTTTDPLTLFNLSLKVVVDE  120

Query  477  LKKLASQP  500
            L  ++  P
Sbjct  121  LGSISDLP  128



>ref|XP_007148762.1| hypothetical protein PHAVU_005G012000g [Phaseolus vulgaris]
 gb|ESW20756.1| hypothetical protein PHAVU_005G012000g [Phaseolus vulgaris]
Length=570

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 73/123 (59%), Gaps = 9/123 (7%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQAF--RRKTRKRiiilavsavllvglvigivagtviHkknknegs  302
            ++SFK YGKVD   ++    RRKTRKRI I+ +S+++L G+V   V   +         +
Sbjct  1    MSSFKSYGKVDEHEQRVLETRRKTRKRITIIGLSSIVLAGVVFAAVFCILG-------ST  53

Query  303  gsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLK  482
             S EG +   + + SV+A+C VT YKDSC SSL      +   P++LF+LS+++A+  + 
Sbjct  54   NSSEGANDAHTVTNSVKAVCDVTLYKDSCYSSLGSAVDSRQLQPQELFMLSMKVALSEVS  113

Query  483  KLA  491
            K A
Sbjct  114  KAA  116



>ref|XP_007133558.1| hypothetical protein PHAVU_011G1890000g, partial [Phaseolus vulgaris]
 gb|ESW05552.1| hypothetical protein PHAVU_011G1890000g, partial [Phaseolus vulgaris]
Length=436

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 72/116 (62%), Gaps = 9/116 (8%)
 Frame = +3

Query  129  INSFKGYGKVDPA--AEQAFRRKTRKRiiilavsavllvglvigivagtviHkknknegs  302
            ++SFK YGKVD +  A    R K+RKRI I+A+S ++L+G+V   V GTV H    +  +
Sbjct  1    MSSFKSYGKVDESEHAMLEVRSKSRKRITIIALSTIVLIGVVCAAVFGTVAHNNKNSNSN  60

Query  303  gsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAV  470
                  DA  S S SV+A+C VT YK+SC SSL  VA      P+ LF+LS+++A+
Sbjct  61   ------DAP-SVSSSVKAVCDVTLYKNSCYSSLGSVAHSGQLQPQDLFLLSIKVAL  109



>ref|XP_009391197.1| PREDICTED: pectinesterase 3 [Musa acuminata subsp. malaccensis]
Length=578

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 53/126 (42%), Positives = 80/126 (63%), Gaps = 10/126 (8%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD + SF GYGKV   A++ FRR TR+R+ +LA SAV+LV +V+ +     I        
Sbjct  1    MDIVKSFNGYGKVSEIADRHFRRTTRRRLALLAASAVVLVVIVVSVGVVAAI--------  52

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEK-TTDPKKLFVLSLQLAVDS  476
             G G+G  +  S + S++A+C+VT Y DSC SS+S   G   T DP++LF +SL +AVD+
Sbjct  53   -GHGDGSPSPTSIADSIKAMCNVTRYPDSCFSSISTARGANLTDDPEELFRISLAVAVDA  111

Query  477  LKKLAS  494
            + K+++
Sbjct  112  IGKVST  117



>ref|XP_009355064.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Pyrus x bretschneideri]
Length=572

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 77/126 (61%), Gaps = 12/126 (10%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQA---FRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            ++S K YGK+D  +EQA    RRKTR R+ I+++S+++LV +V+  V GT +H K+    
Sbjct  1    MSSIKSYGKID-ESEQARLDNRRKTRMRVAIISLSSIVLVCVVVAAVVGTTVHNKSGGNS  59

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
             GS        + S SV+A+C VT Y+D C SSL  +       P+++F L++Q+A++ L
Sbjct  60   KGS--------AISTSVKAVCDVTLYQDLCYSSLGPLVNSSNVKPEEIFKLAIQVAINEL  111

Query  480  KKLASQ  497
             K A+ 
Sbjct  112  SKAATH  117



>ref|XP_011046484.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Populus euphratica]
Length=569

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  324  ATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLASQ  497
            A +S S SV+A+C VT YKDSC +SL+ VA      P++LF L++Q+A + L K ASQ
Sbjct  61   ADKSLSTSVKAVCDVTLYKDSCYNSLAPVAKPDQLQPEELFKLAIQVAKNELSK-ASQ  117



>ref|XP_008346146.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Malus domestica]
Length=572

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 75/125 (60%), Gaps = 10/125 (8%)
 Frame = +3

Query  129  INSFKGYGKVDPAAEQAF--RRKTRKRiiilavsavllvglvigivagtviHkknknegs  302
            ++S K YGK+D + +      R+TRKR+ I+++S+++LV + +  V GT +H K+     
Sbjct  1    MSSIKSYGKIDESDQARLDAXRETRKRVAIISLSSIVLVCVXVAAVVGTTVHNKSGGNSK  60

Query  303  gsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLK  482
            GS        + S SV+A+C VT Y+DSC SSL  +       P+++F L++Q+A++ L 
Sbjct  61   GS--------AISTSVKAVCDVTLYQDSCYSSLGPLVNSNNVKPEEIFKLAIQVAINELS  112

Query  483  KLASQ  497
            K A+ 
Sbjct  113  KAATH  117



>ref|XP_002316458.2| pectinesterase family protein [Populus trichocarpa]
 gb|EEF02629.2| pectinesterase family protein [Populus trichocarpa]
Length=569

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  324  ATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLASQ  497
            A +S S SV+A+C VT YKDSC +SL+ VA      P++LF L++Q+A + L K ASQ
Sbjct  61   ADKSLSTSVKAVCDVTLYKDSCYNSLAPVAKPDQLQPEELFKLAIQVAKNELSK-ASQ  117



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 40/56 (71%), Gaps = 1/56 (2%)
 Frame = +3

Query  330  RSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLASQ  497
            +S+ K+++AIC  T+YK++CV SLS  AG  TTDPK+L  +  Q+A+  +++  SQ
Sbjct  60   QSSMKAIKAICQPTDYKETCVQSLSSAAG-NTTDPKELVRVGFQVAMKHIREALSQ  114



>gb|KHN26433.1| Putative pectinesterase/pectinesterase inhibitor 24 [Glycine 
soja]
Length=560

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = +3

Query  321  DATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKK  485
            DA   TS S++A+C VT YKDSC SSL  V   +   P++LF+LS++LA+  + K
Sbjct  47   DAHTVTS-SLRAVCDVTLYKDSCYSSLGSVVDSRQVQPEELFILSMKLALSEVSK  100



>ref|XP_011005059.1| PREDICTED: pectinesterase 3-like [Populus euphratica]
Length=595

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 51/133 (38%), Positives = 77/133 (58%), Gaps = 10/133 (8%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD   SF  + KVD  AEQAFRRK RKR+I++ VSAV+LV ++IG + G  +      + 
Sbjct  1    MDLGRSFTSHSKVDEQAEQAFRRKARKRLIVIVVSAVVLVTIIIGALVGIPV----SKDN  56

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKD------SCVSSLSQVAGEKTTDPKKLFVLSLQ  461
              +G+   +  S ++S++A+C+ T Y D      S     S +      DP+ LF+LSLQ
Sbjct  57   KSNGKNPSSQTSEAQSIRAMCNATRYPDSCYSSMSSSLKASSIETNPNPDPRTLFLLSLQ  116

Query  462  LAVDSLKKLASQP  500
            +++  L KL+S P
Sbjct  117  VSLIELTKLSSLP  129



>ref|XP_010092049.1| Pectinesterase 1 [Morus notabilis]
 gb|EXB49963.1| Pectinesterase 1 [Morus notabilis]
Length=239

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 73/128 (57%), Gaps = 6/128 (5%)
 Frame = +3

Query  120  MDTINSFKGYGKV--DPAA-EQAFRRKTRKRiiilavsavllvglvigivagtviHkknk  290
            MD+IN  KGYGKV  +P   E   ++ + KR  ++A+SA+L + L IG+V G +IH+   
Sbjct  1    MDSINFVKGYGKVTVNPNNLENQTQKPSHKRRRLIAISALLFLSLAIGLVIGALIHESAT  60

Query  291  negsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAV  470
                       A+ S   +++ IC+ T + D+CVSS++       +DPK L  LS+++A+
Sbjct  61   ESPELPSL---ASNSADSTIRTICNFTRFPDACVSSMTAANNPPESDPKALLKLSVEVAI  117

Query  471  DSLKKLAS  494
                KL+S
Sbjct  118  TETSKLSS  125



>ref|XP_006381544.1| hypothetical protein POPTR_0006s13700g [Populus trichocarpa]
 gb|ERP59341.1| hypothetical protein POPTR_0006s13700g [Populus trichocarpa]
Length=596

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 54/133 (41%), Positives = 81/133 (61%), Gaps = 10/133 (8%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MD  +SF  + KVD  AEQAFRRK RKR+I++ VSAV+LV ++I  + GT +      + 
Sbjct  1    MDPSHSFTSHSKVDEQAEQAFRRKARKRLIVIVVSAVVLVTIIICALVGTSV----SADN  56

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTD------PKKLFVLSLQ  461
              +G+   +  S ++ ++A+C+ T Y DSC SS+S      + D      PK LF+LSLQ
Sbjct  57   KSNGKNPSSQTSEAQYIRAMCNATRYPDSCYSSMSSSLKASSNDTNPNPDPKTLFLLSLQ  116

Query  462  LAVDSLKKLASQP  500
            +++  L KL+S P
Sbjct  117  VSLIELTKLSSLP  129



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  333  STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLK  482
            +++KS+QAIC  T+YK +C  SL++ AG  T+DP KL     Q+A+D+LK
Sbjct  63   TSTKSIQAICQPTDYKQTCEDSLNKAAGN-TSDPHKLVQAGFQVAIDALK  111



>ref|XP_011032980.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 24 
[Populus euphratica]
Length=569

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  324  ATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLASQ  497
            A +S S SV+A+C VT YKDSC ++L+ VA      P++LF L++Q+A + L K ASQ
Sbjct  61   ADKSLSTSVKAVCDVTLYKDSCYNNLAPVAKPDQLQPEELFKLAIQVAKNELSK-ASQ  117



>gb|KFK38796.1| hypothetical protein AALP_AA3G161400 [Arabis alpina]
Length=590

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  333  STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLASQP  500
            + + S++ +CSVT Y  SC SS+S++    TTDP+ LF LSL++ V+ L  ++  P
Sbjct  72   TPAASLRTVCSVTHYPTSCFSSISKIPSSNTTDPEILFRLSLKVVVNELASISDLP  127



>ref|XP_006852911.1| hypothetical protein AMTR_s00033p00227850 [Amborella trichopoda]
 gb|ERN14378.1| hypothetical protein AMTR_s00033p00227850 [Amborella trichopoda]
Length=383

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  333  STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S+ + +QA+CS+T+Y+D C+SS+S  +G    DP+ L + S+Q A DS+
Sbjct  90   SSLQKIQALCSLTDYRDLCISSISSYSGLHMEDPRDLIMYSIQAASDSV  138



>ref|XP_010067063.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Eucalyptus grandis]
Length=582

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 78/129 (60%), Gaps = 14/129 (11%)
 Frame = +3

Query  135  SFKGYGKVDPAAEQAF--RRKTRKRiiilavsavllvglvigivagtviHkknknegsgs  308
            S K YGK++ A + A   RR+ RKR I++ +S+V+LV +V+  V GT +H  NK+ G   
Sbjct  3    SIKAYGKINEAEQAALDSRRRHRKRTIVIGLSSVVLVAIVVAAVVGTSVHASNKSNGE--  60

Query  309  geggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKT-TDPKKLFVLSLQLAVDSLKK  485
                   +  S SV+A+C VT YKDSC+SSL+ +A       P+ LF LS+++A++ L K
Sbjct  61   ------PQPLSTSVKAVCDVTLYKDSCLSSLAPMANSSGQVRPEDLFKLSIRVALEELAK  114

Query  486  LA---SQPA  503
             A   S+P 
Sbjct  115  AAGYFSEPG  123



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 37/49 (76%), Gaps = 3/49 (6%)
 Frame = +3

Query  333  STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            +++K+VQAICS T+YK++C SSL   AG  TTDPK+L  L+   AV+++
Sbjct  53   TSTKAVQAICSPTDYKETCESSL---AGANTTDPKELIRLAFNAAVNNI  98



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 3/54 (6%)
 Frame = +3

Query  333  STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLAS  494
            ++SK+VQAIC+ T+YKD+CV SL+ V   KT DPK+L   +   A+  LK++AS
Sbjct  39   ASSKAVQAICNPTDYKDACVKSLATV---KTDDPKELVRAAFASAMAELKEIAS  89



>ref|XP_002311918.1| pectinesterase family protein [Populus trichocarpa]
 gb|EEE89285.1| pectinesterase family protein [Populus trichocarpa]
Length=568

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +3

Query  324  ATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLASQ  497
            A +S S SV+A+C VT YKDSC ++L+ VA      P++LF L++Q+A + L K ASQ
Sbjct  61   ADKSISTSVKAVCDVTLYKDSCYNNLAPVAKPDQLQPEELFKLAIQVAKNELSK-ASQ  117



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 37/49 (76%), Gaps = 3/49 (6%)
 Frame = +3

Query  333  STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            +++K+VQAICS T+YK++C SSLS   G  TTDPK+L  L+   AV+++
Sbjct  53   TSTKAVQAICSPTDYKETCESSLS---GANTTDPKELIRLAFNAAVNNI  98



>ref|XP_008239809.1| PREDICTED: pectinesterase 1 [Prunus mume]
Length=235

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 66/129 (51%), Gaps = 5/129 (4%)
 Frame = +3

Query  120  MDTINSFKGYGKVDP----AAEQAFRRKTRKRiiilavsavllvglvigivagtviHkkn  287
            M++IN FKGYGKV+P       Q    K+ K    +  +  +   + + +V G ++    
Sbjct  1    MESINIFKGYGKVNPDQLENQTQTSNPKSPKPQKPIFSTLTISALICLTLVIGLLLAALI  60

Query  288  knegsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLA  467
                S S    ++  S   +++ IC+VT Y +SC +S+S +      DP+ +F LSL+++
Sbjct  61   HASNSESPSLSNS-NSAESAIKTICNVTRYPNSCFTSISSLNASPKPDPEAIFKLSLEIS  119

Query  468  VDSLKKLAS  494
            V  L  ++S
Sbjct  120  VSELSNVSS  128



>ref|XP_006407095.1| hypothetical protein EUTSA_v10022003mg [Eutrema salsugineum]
 gb|ESQ48548.1| hypothetical protein EUTSA_v10022003mg [Eutrema salsugineum]
Length=587

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 74/127 (58%), Gaps = 5/127 (4%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkknkneg  299
            MDT+   KGY KVD A +   +RKT ++ +++ +S V L+ + IG+V  +  +  + +  
Sbjct  1    MDTLKVIKGYFKVDEAQDVELKRKTWRQWLLVGISVVALLAITIGVVVHSRKNNSHGSTL  60

Query  300  sgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSL  479
            S +     A      S++ +CSVT +  SC+SS+S +    TTDP+ LF LSL++ VD L
Sbjct  61   SSTPNLTPAA-----SLKTVCSVTHFPASCMSSISNIPSSNTTDPEVLFRLSLKVVVDEL  115

Query  480  KKLASQP  500
              +++ P
Sbjct  116  ASISTLP  122



>gb|KDP34079.1| hypothetical protein JCGZ_07650 [Jatropha curcas]
Length=566

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 74/122 (61%), Gaps = 11/122 (9%)
 Frame = +3

Query  138  FKGYGKVDPAAEQAF--RRKTRKRiiilavsavllvglvigivagtviHkknknegsgsg  311
             K YGKV+ A +     RRKTRKR+ I+++S++LL  +V+  V GT          S S 
Sbjct  4    LKAYGKVEEAQQAMLEARRKTRKRLTIISLSSILLAAIVVAAVLGTRA--------SSSN  55

Query  312  eggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLA  491
             G  +  + S S++A+C VT YKDSC +SL+ +A      P++LF LS+Q+A++ L + A
Sbjct  56   NGDQSKGAISTSIKAVCDVTLYKDSCYNSLAPLAKSDHLQPEELFKLSMQVAMNELSE-A  114

Query  492  SQ  497
            SQ
Sbjct  115  SQ  116



>ref|XP_009135375.1| PREDICTED: pectinesterase 1-like [Brassica rapa]
Length=589

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 49/128 (38%), Positives = 76/128 (59%), Gaps = 3/128 (2%)
 Frame = +3

Query  120  MDTINSFKGYGKVDPAAEQ-AFRRKTRKRiiilavsavllvglvigivagtviHkknkne  296
            MDT NS KGY KVD  A++ A ++K  KR+ I+  S V+ +G++IG        +KN   
Sbjct  1    MDTPNSAKGYFKVDDEAQEVALKKKAYKRLFIVVASVVVFLGIIIGAAVAVARSQKNDPH  60

Query  297  gsgsgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDS  476
            GS        T   + S++++CSVT + D+C+SS+S++    TTDP  +F LSL++ VD 
Sbjct  61   GSSPSSTPKLT--PAASLKSVCSVTRFPDACISSISKIPSSNTTDPVVIFRLSLKVVVDE  118

Query  477  LKKLASQP  500
            L  ++  P
Sbjct  119  LASISDLP  126



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 11/63 (17%)
 Frame = +3

Query  342  KSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAV----------DSLKKLA  491
            K+++AIC  T YK++C SSL +VAG+ TTDPK+L     Q+A           D+LK LA
Sbjct  47   KAIEAICQPTSYKETCQSSLEKVAGD-TTDPKELVKAGFQVAADKVNEVIQNSDTLKDLA  105

Query  492  SQP  500
              P
Sbjct  106  KDP  108



>ref|XP_009773321.1| PREDICTED: pectinesterase 1-like [Nicotiana sylvestris]
Length=243

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 72/136 (53%), Gaps = 18/136 (13%)
 Frame = +3

Query  120  MDTINSFKGYGKV----DPAAEQAFRRKTRKRiiilavsavllvglvigivagtviHkkn  287
            M+++N  KGYGK+    DPA+  + RR   KR + +A+S  L + L+I  + G  IH  N
Sbjct  1    MESMNLVKGYGKINLSEDPASSLSTRRAAHKRRLAIALSLTLFLTLLICALVGAFIHASN  60

Query  288  knegsgsgeggDATRSTSKS----VQAICSVTEYKDSCVSSLSQV-AGEKTTDPKKLFVL  452
                       D T S S +    ++A+C+VT+Y +SC  S+S + +  +  DP+    L
Sbjct  61   SK---------DRTPSVSSNSADLLKAVCAVTQYPESCFDSISSLHSSPQKPDPEPFLNL  111

Query  453  SLQLAVDSLKKLASQP  500
            SLQ  +  L  ++S P
Sbjct  112  SLQATIRELTNVSSLP  127



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +3

Query  333  STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKK  485
            ++SKSVQAIC  T+Y++ C  SLS+ AG  TTDP KL     Q+ +D+L++
Sbjct  54   TSSKSVQAICQPTDYREICGKSLSKAAG-NTTDPLKLVQAGFQVTIDALQQ  103



>ref|XP_008800480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Phoenix dactylifera]
Length=570

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  330  RSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLASQ  497
            RST+KSV+ +C+ T+YK++C +SL+++    T++PK +   S+   +D + K  SQ
Sbjct  51   RSTTKSVKMLCATTDYKETCETSLTKIVNGSTSNPKDVLKASVVAVIDEISKSFSQ  106



>ref|XP_009398948.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 46 
[Musa acuminata subsp. malaccensis]
Length=543

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  321  DATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKLAS  494
            D   + S S++A C  T Y++ CV SL  +A   T DP K+F L++Q+ +D L K+++
Sbjct  34   DTGNTFSSSIKAACGATLYQEQCVRSLGPLANGSTLDPVKIFQLAVQITLDELSKVSA  91



>ref|XP_007011069.1| Root hair specific 12 [Theobroma cacao]
 gb|EOY19879.1| Root hair specific 12 [Theobroma cacao]
Length=603

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 68/124 (55%), Gaps = 8/124 (6%)
 Frame = +3

Query  132  NSFKGYGKVDPA--AEQAFRRKTRKRiiilavsavllvglvigivagtviHkknknegsg  305
            N F+ YGKV+ A  A    RRKTR+RI I+ +S ++L  +V+  V          + G  
Sbjct  32   NMFRAYGKVNEADQARLLARRKTRRRIAIIGLSFIVLAAIVVAAV-----FGSRGSGGDS  86

Query  306  sgeggDATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKK  485
               G    +  S S++A+C VT YKD+C  SL+ +A      P+ +F LS+++A+  L K
Sbjct  87   KNGGNGGVQPISSSIKAVCDVTLYKDTCYDSLAPMANSSQLQPEDIFKLSMKVAIAELSK  146

Query  486  LASQ  497
             ASQ
Sbjct  147  -ASQ  149



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = +3

Query  321  DATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLK  482
            D  ++T+K+VQA+CS T++KD+CV+SL + A   +T+P  L  LS  + + S+K
Sbjct  41   DKIKTTTKAVQAVCSPTDFKDTCVNSLME-ASPNSTEPLDLIKLSFDVTIRSIK  93



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +3

Query  321  DATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKL  488
            + T +++K++Q+IC  T+YK +C  +LS+VA    TDPK+L     Q+A+D L+++
Sbjct  46   EQTSTSTKAIQSICQPTDYKKTCEDNLSKVA-SNVTDPKELVKAGFQVAIDQLREV  100



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  324  ATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKL  488
             T S+ K+++ IC  T YK++C SSL + AG+ T+DPK+L     Q+A D L ++
Sbjct  43   GTSSSKKAIETICQTTSYKETCQSSLEKAAGD-TSDPKELIKTGFQVAADKLDEV  96



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 11/69 (16%)
 Frame = +3

Query  327  TRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVD----------S  476
            T +++K++QAIC  T+YK +C  SLS  AG   TDPK+L  +  Q+ +D          +
Sbjct  48   TSTSTKAIQAICQPTDYKKTCEESLSGAAG-NVTDPKELIKVGFQVTMDMLRGVIEKSTT  106

Query  477  LKKLASQPA  503
            LK LA  P+
Sbjct  107  LKDLAKDPS  115



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +3

Query  321  DATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKL  488
            + T +++K++Q+IC  T+YK +C  +LS+VA    TDPK+L     Q+A+D L+++
Sbjct  45   EQTSTSTKAIQSICQPTDYKKTCEDNLSKVA-SNVTDPKELVKAGFQVAIDQLREV  99



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  333  STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLK  482
            ++ KS+Q+IC  T+Y+++CV SLS  AG  +TDPK L     Q+A++ +K
Sbjct  60   TSMKSIQSICEPTDYRETCVKSLS-AAGGNSTDPKDLIRTGFQVAINQVK  108



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +3

Query  333  STSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKK  485
            +TSK+++AIC  T+Y + C SSL+  AG   TDPKKL  LS   A+DSL++
Sbjct  60   TTSKAIRAICRPTDYAEECQSSLAARAG-NVTDPKKLVELSFTSAMDSLRE  109



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  324  ATRSTSKSVQAICSVTEYKDSCVSSLSQVAGEKTTDPKKLFVLSLQLAVDSLKKL  488
             T S+ K+++ IC  T YK++C SSL + AG+ T+DPK+L     Q+A D L ++
Sbjct  43   GTASSKKAIETICQTTSYKETCQSSLEKAAGD-TSDPKELIKAGFQVAADKLDEV  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720