BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M20

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795808.1|  PREDICTED: uncharacterized protein LOC104242...    119   5e-29   Nicotiana sylvestris
ref|XP_009782262.1|  PREDICTED: uncharacterized protein LOC104231037    119   6e-29   Nicotiana sylvestris
ref|XP_009795807.1|  PREDICTED: uncharacterized protein LOC104242...    119   7e-29   Nicotiana sylvestris
ref|XP_009587544.1|  PREDICTED: uncharacterized protein LOC104085254    118   8e-29   Nicotiana tomentosiformis
ref|XP_009587546.1|  PREDICTED: uncharacterized protein LOC104085255    117   2e-28   Nicotiana tomentosiformis
ref|XP_004236994.1|  PREDICTED: uncharacterized protein LOC101257950    111   4e-26   Solanum lycopersicum
ref|XP_006344145.1|  PREDICTED: uncharacterized protein LOC102580705    101   3e-22   Solanum tuberosum [potatoes]
ref|XP_011070785.1|  PREDICTED: uncharacterized protein LOC105156369  95.5    4e-20   Sesamum indicum [beniseed]
ref|XP_004239412.1|  PREDICTED: uncharacterized protein LOC101244288  92.0    5e-19   Solanum lycopersicum
ref|XP_006360447.1|  PREDICTED: uncharacterized protein LOC102591290  90.9    1e-18   Solanum tuberosum [potatoes]
ref|XP_004237003.1|  PREDICTED: uncharacterized protein LOC101260633  90.9    1e-18   Solanum lycopersicum
ref|XP_011076562.1|  PREDICTED: uncharacterized protein LOC105160775  88.2    1e-17   Sesamum indicum [beniseed]
ref|XP_010254097.1|  PREDICTED: uncharacterized protein LOC104595181  85.5    9e-17   Nelumbo nucifera [Indian lotus]
emb|CDP00644.1|  unnamed protein product                              84.0    4e-16   Coffea canephora [robusta coffee]
ref|XP_007223127.1|  hypothetical protein PRUPE_ppa010016mg           82.8    9e-16   
ref|XP_002279484.2|  PREDICTED: uncharacterized protein LOC100244117  81.6    2e-15   Vitis vinifera
ref|XP_008243261.1|  PREDICTED: uncharacterized protein LOC103341506  79.7    1e-14   Prunus mume [ume]
ref|XP_010249704.1|  PREDICTED: uncharacterized protein LOC104592180  79.0    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_008445636.1|  PREDICTED: uncharacterized protein LOC103488593  78.6    2e-14   Cucumis melo [Oriental melon]
gb|KDP29438.1|  hypothetical protein JCGZ_18359                       78.2    4e-14   Jatropha curcas
emb|CBI26998.3|  unnamed protein product                              75.5    2e-13   Vitis vinifera
ref|XP_007142930.1|  hypothetical protein PHAVU_007G029200g           73.9    9e-13   Phaseolus vulgaris [French bean]
ref|XP_002314852.2|  hypothetical protein POPTR_0010s13260g           72.8    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_007044281.1|  Uncharacterized protein TCM_009632               72.4    5e-12   
ref|XP_004138348.1|  PREDICTED: uncharacterized protein LOC101205564  70.1    2e-11   Cucumis sativus [cucumbers]
ref|XP_004166843.1|  PREDICTED: uncharacterized protein LOC101226094  69.3    4e-11   
ref|XP_004135397.1|  PREDICTED: uncharacterized protein LOC101211482  69.3    6e-11   
ref|XP_008339652.1|  PREDICTED: uncharacterized protein LOC103402678  69.3    6e-11   Malus domestica [apple tree]
ref|XP_008446612.1|  PREDICTED: uncharacterized protein LOC103489295  69.3    6e-11   Cucumis melo [Oriental melon]
ref|XP_006605904.1|  PREDICTED: uncharacterized protein LOC100782256  68.6    9e-11   Glycine max [soybeans]
gb|KGN52094.1|  hypothetical protein Csa_5G609800                     69.7    1e-10   Cucumis sativus [cucumbers]
gb|EYU40770.1|  hypothetical protein MIMGU_mgv1a010835mg              68.6    1e-10   Erythranthe guttata [common monkey flower]
ref|XP_011007676.1|  PREDICTED: uncharacterized protein LOC105113268  67.8    1e-10   Populus euphratica
gb|EYU29997.1|  hypothetical protein MIMGU_mgv1a010415mg              68.2    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_009356989.1|  PREDICTED: uncharacterized protein LOC103947762  67.4    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_002312408.2|  hypothetical protein POPTR_0008s12160g           66.2    6e-10   Populus trichocarpa [western balsam poplar]
ref|XP_007160389.1|  hypothetical protein PHAVU_002G317700g           63.5    2e-09   Phaseolus vulgaris [French bean]
ref|XP_003535721.2|  PREDICTED: uncharacterized protein LOC100779683  63.5    4e-09   Glycine max [soybeans]
ref|XP_011003255.1|  PREDICTED: uncharacterized protein LOC105110053  62.0    2e-08   Populus euphratica
ref|XP_011022313.1|  PREDICTED: uncharacterized protein LOC105124132  62.0    2e-08   Populus euphratica
ref|XP_008389276.1|  PREDICTED: uncharacterized protein LOC103451638  62.0    2e-08   
ref|XP_008453422.1|  PREDICTED: uncharacterized protein LOC103494136  59.7    6e-08   Cucumis melo [Oriental melon]
ref|XP_004137319.1|  PREDICTED: uncharacterized protein LOC101214785  59.7    7e-08   Cucumis sativus [cucumbers]
gb|AFK44975.1|  unknown                                               58.5    2e-07   Lotus japonicus
ref|XP_004497073.1|  PREDICTED: uncharacterized protein LOC101492865  58.5    2e-07   Cicer arietinum [garbanzo]
ref|XP_010099253.1|  hypothetical protein L484_015442                 58.5    4e-07   
gb|KJB50186.1|  hypothetical protein B456_008G158100                  58.2    4e-07   Gossypium raimondii
ref|NP_001241159.1|  uncharacterized protein LOC100805289             55.8    1e-06   Glycine max [soybeans]
gb|KJB61220.1|  hypothetical protein B456_009G347700                  56.2    2e-06   Gossypium raimondii
gb|KJB61217.1|  hypothetical protein B456_009G347700                  56.2    2e-06   Gossypium raimondii
gb|KJB61218.1|  hypothetical protein B456_009G347700                  56.2    3e-06   Gossypium raimondii
ref|XP_007154144.1|  hypothetical protein PHAVU_003G094100g           54.3    4e-06   Phaseolus vulgaris [French bean]
ref|XP_010549544.1|  PREDICTED: uncharacterized protein LOC104820683  54.3    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_002533698.1|  conserved hypothetical protein                   53.5    1e-05   Ricinus communis
ref|XP_006448443.1|  hypothetical protein CICLE_v10016320mg           53.9    1e-05   Citrus clementina [clementine]
gb|KHG24859.1|  hypothetical protein F383_07684                       53.5    2e-05   Gossypium arboreum [tree cotton]
gb|KCW86313.1|  hypothetical protein EUGRSUZ_B03003                   53.5    2e-05   Eucalyptus grandis [rose gum]
ref|XP_003616744.1|  hypothetical protein MTR_5g083820                53.5    2e-05   
gb|AES99702.2|  DUF1639 family protein                                53.1    3e-05   Medicago truncatula
ref|XP_003592633.1|  hypothetical protein MTR_1g110360                52.4    4e-05   
ref|XP_010551248.1|  PREDICTED: uncharacterized protein LOC104821917  52.8    4e-05   Tarenaya hassleriana [spider flower]
ref|XP_010532317.1|  PREDICTED: uncharacterized protein LOC104808336  52.0    6e-05   Tarenaya hassleriana [spider flower]
ref|XP_010265083.1|  PREDICTED: uncharacterized protein LOC104602914  51.6    8e-05   Nelumbo nucifera [Indian lotus]
emb|CAN68110.1|  hypothetical protein VITISV_000764                   48.9    1e-04   Vitis vinifera
ref|XP_003618367.1|  hypothetical protein MTR_6g008660                50.8    1e-04   
emb|CAN67779.1|  hypothetical protein VITISV_029297                   49.7    1e-04   Vitis vinifera
ref|XP_008799251.1|  PREDICTED: diacylglycerol kinase kappa-like      50.8    2e-04   Phoenix dactylifera
ref|XP_002526996.1|  conserved hypothetical protein                   50.4    2e-04   Ricinus communis
gb|ACU20234.1|  unknown                                               48.5    2e-04   Glycine max [soybeans]
ref|XP_003525235.1|  PREDICTED: uncharacterized protein LOC100801179  48.1    3e-04   Glycine max [soybeans]
ref|XP_010688487.1|  PREDICTED: uncharacterized protein LOC104902410  49.3    4e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002278683.1|  PREDICTED: uncharacterized protein LOC100259406  48.5    4e-04   Vitis vinifera
ref|XP_009127623.1|  PREDICTED: uncharacterized protein LOC103852469  48.5    5e-04   Brassica rapa
ref|XP_004512910.1|  PREDICTED: uncharacterized protein LOC101496171  48.9    5e-04   Cicer arietinum [garbanzo]



>ref|XP_009795808.1| PREDICTED: uncharacterized protein LOC104242454 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009795809.1| PREDICTED: uncharacterized protein LOC104242454 isoform X2 [Nicotiana 
sylvestris]
Length=267

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 75/115 (65%), Gaps = 28/115 (24%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV+S+G+ISA+HRRS+G SE   RRR  
Sbjct  1    MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVESDGQISAIHRRSFG-SELIGRRR--  57

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                       SN+R        + R  E        D   GI AVREKLMFDLQ
Sbjct  58   -----------SNDR--------KFRPPEK------QDAGEGIGAVREKLMFDLQ  87



>ref|XP_009782262.1| PREDICTED: uncharacterized protein LOC104231037 [Nicotiana sylvestris]
 ref|XP_009782263.1| PREDICTED: uncharacterized protein LOC104231037 [Nicotiana sylvestris]
 ref|XP_009782264.1| PREDICTED: uncharacterized protein LOC104231037 [Nicotiana sylvestris]
Length=278

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 75/119 (63%), Gaps = 25/119 (21%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMGPERSKP LHNFTLPCGLKWGNQKFLRCAKVDS+GEIS VHRRSY   E+  RRR  
Sbjct  1    MAMGPERSKP-LHNFTLPCGLKWGNQKFLRCAKVDSDGEISTVHRRSY-EKESIGRRR--  56

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGS----DVXNGIAAVREKLMFDLQ  568
                             E    +R R+ +   RKF S    D   GI A+REKLMFDLQ
Sbjct  57   -----------------EPEAVERHRLNDRFTRKFRSVNAGDSGEGIGAMREKLMFDLQ  98



>ref|XP_009795807.1| PREDICTED: uncharacterized protein LOC104242454 isoform X1 [Nicotiana 
sylvestris]
Length=284

 Score =   119 bits (298),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 75/115 (65%), Gaps = 28/115 (24%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV+S+G+ISA+HRRS+G SE   RRR  
Sbjct  1    MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVESDGQISAIHRRSFG-SELIGRRR--  57

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                       SN+R        + R  E        D   GI AVREKLMFDLQ
Sbjct  58   -----------SNDR--------KFRPPEK------QDAGEGIGAVREKLMFDLQ  87



>ref|XP_009587544.1| PREDICTED: uncharacterized protein LOC104085254 [Nicotiana tomentosiformis]
Length=265

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 70/119 (59%), Gaps = 36/119 (30%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMGPERSK PLHNFTLPCGLKWGNQKFLRCAKV+SNG ISAVHRRSYG SE   RRR  
Sbjct  1    MAMGPERSKLPLHNFTLPCGLKWGNQKFLRCAKVESNGNISAVHRRSYG-SELIGRRR--  57

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKF----GSDVXNGIAAVREKLMFDLQ  568
                                         S  RKF      D   GI AVREKLMFDLQ
Sbjct  58   -----------------------------SNDRKFRPPEKEDAGEGIGAVREKLMFDLQ  87



>ref|XP_009587546.1| PREDICTED: uncharacterized protein LOC104085255 [Nicotiana tomentosiformis]
Length=274

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 75/119 (63%), Gaps = 25/119 (21%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMGPERSKP LHNFTLPCGLKWGNQKFLRCAKVDS+GEIS VHRR Y + E+  RRR  
Sbjct  1    MAMGPERSKP-LHNFTLPCGLKWGNQKFLRCAKVDSDGEISTVHRRPY-NKESIGRRR--  56

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGS----DVXNGIAAVREKLMFDLQ  568
                             E    +R R+ +   RKF S    D   GI A+REKLMFDLQ
Sbjct  57   -----------------EPEAVERHRLNDRFSRKFRSVNAGDSGEGIGAMREKLMFDLQ  98



>ref|XP_004236994.1| PREDICTED: uncharacterized protein LOC101257950 [Solanum lycopersicum]
Length=267

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 73/118 (62%), Gaps = 23/118 (19%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            M MGPERSKP LHNFTLP GLKWGNQ+ LRCAKV+SNGEIS+VHRRS GS     R  ++
Sbjct  1    MTMGPERSKP-LHNFTLPYGLKWGNQRHLRCAKVESNGEISSVHRRSNGSESIGRRMEME  59

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGS----DVXNGIAAVREKLMFDL  565
                    RRGSN+R                 RKF S    D  +GI AVREKLMFDL
Sbjct  60   ---IEMVNRRGSNDRFT---------------RKFRSPGKEDDGDGIGAVREKLMFDL  99



>ref|XP_006344145.1| PREDICTED: uncharacterized protein LOC102580705 [Solanum tuberosum]
Length=291

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 77/124 (62%), Gaps = 17/124 (14%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMG ERSKP LHNF LPCGLKWGNQKFLRCAKVDSNGEI   HRRS GS   S  RR++
Sbjct  1    MAMGHERSKP-LHNFDLPCGLKWGNQKFLRCAKVDSNGEIPHFHRRSNGSD--SIGRRMR  57

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGS---------DVXNGIAAVREKLM  556
                    RR S   V +  + K   VG +  RKF S            +GIAAVREKLM
Sbjct  58   EIDGMVNNRRSS---VVKDELLKETEVGFT--RKFRSAGYNGAAGGGGGDGIAAVREKLM  112

Query  557  FDLQ  568
            FDLQ
Sbjct  113  FDLQ  116



>ref|XP_011070785.1| PREDICTED: uncharacterized protein LOC105156369 [Sesamum indicum]
Length=311

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 76/128 (59%), Gaps = 14/128 (11%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHR---RSYGSSEASARR  394
            MAMG ERSK  LHNFT+PCGL+WGNQ+FLRC KV+SNG+IS + R    + GSS+   + 
Sbjct  1    MAMGTERSKA-LHNFTMPCGLRWGNQRFLRCMKVNSNGQISPLQRFTTNNSGSSDHHHQH  59

Query  395  RVQPPAAATAQRRGSNERVQETC----VAKRARVGES------GGRKFGSDVXNGIAAVR  544
              Q P       R  +    +      V    +VG +      GGR+F  D  +GIAA+R
Sbjct  60   HHQHPIQQRRTTRDRDRERDKDSSPEFVHGSPKVGPTPPPATDGGRRFSDDDDDGIAAMR  119

Query  545  EKLMFDLQ  568
            EK+MFDLQ
Sbjct  120  EKVMFDLQ  127



>ref|XP_004239412.1| PREDICTED: uncharacterized protein LOC101244288 [Solanum lycopersicum]
Length=290

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 70/118 (59%), Gaps = 8/118 (7%)
 Frame = +2

Query  230  MGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQPP  409
            MG ERSK  LHNF L CG KWGN KFLRCAKVDSNGEI   HRRS  S+     RR++  
Sbjct  1    MGHERSKH-LHNFDLSCGFKWGNHKFLRCAKVDSNGEIPHFHRRSNRSNAIG--RRMREI  57

Query  410  AAATAQRRGS---NERVQETCV--AKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                  RR +   +E ++ET V   ++ R+        G    + IAAVREKLMFDLQ
Sbjct  58   DVMVNNRRSNEVRDELLKETDVGFTRKFRLTGYNSAAGGGGGGDEIAAVREKLMFDLQ  115



>ref|XP_006360447.1| PREDICTED: uncharacterized protein LOC102591290 [Solanum tuberosum]
Length=257

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 63/115 (55%), Gaps = 31/115 (27%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMGPERSKP LHNF+LPCGLKWGNQKFLRC K DS+ E+S         SE   RRR  
Sbjct  1    MAMGPERSKP-LHNFSLPCGLKWGNQKFLRCVKEDSDEEMS--------RSELIGRRR--  49

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                             ET V +R R   +  R    D   GI AVREKLM DLQ
Sbjct  50   -----------------ETGVVERHR---TKFRSVNGDSGEGIEAVREKLMIDLQ  84



>ref|XP_004237003.1| PREDICTED: uncharacterized protein LOC101260633 [Solanum lycopersicum]
Length=259

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 63/115 (55%), Gaps = 31/115 (27%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMGPERSKP LHNF+LPCGLKWGNQKFLRC K DS+ E+S         SE   RRR  
Sbjct  1    MAMGPERSKP-LHNFSLPCGLKWGNQKFLRCVKEDSDEEMS--------RSELIGRRR--  49

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                             ET V +R R   +  R    D   GI AVREKLM DLQ
Sbjct  50   -----------------ETGVVERHR---TKFRSVNGDSGEGIEAVREKLMIDLQ  84



>ref|XP_011076562.1| PREDICTED: uncharacterized protein LOC105160775 [Sesamum indicum]
Length=312

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 72/125 (58%), Gaps = 12/125 (10%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHR----RSYGSSEASAR  391
            MAMG ER K  LHNFTLP  L+WGN++FLRC K++SNG+IS + R     SY S +    
Sbjct  1    MAMGIERLKA-LHNFTLPSELRWGNRQFLRCMKINSNGQISPLRRFTTTNSYSSDQHQQN  59

Query  392  RRVQPPAAATAQRRGSNERVQETCVAKRARVGES------GGRKFGSDVXNGIAAVREKL  553
              VQ P     + R   +      +    +VG S      G R+FG D  +GIAA+REK+
Sbjct  60   NYVQQPRTTRDRERRREKESSAEFLHGSHKVGPSPPPASDGCRRFGDD-DDGIAAMREKV  118

Query  554  MFDLQ  568
            MFDLQ
Sbjct  119  MFDLQ  123



>ref|XP_010254097.1| PREDICTED: uncharacterized protein LOC104595181 [Nelumbo nucifera]
Length=271

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 76/121 (63%), Gaps = 14/121 (12%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRR---SYGSSEASARR  394
            MAMGPERSKP LHNF++P  LKWGNQ+ LRC KVDSNGEI++  RR   S G SE S  R
Sbjct  1    MAMGPERSKP-LHNFSMPR-LKWGNQRLLRCMKVDSNGEITSFQRRFSASGGQSEGSVTR  58

Query  395  RVQPPAAATAQRRGSN--ERVQETCVAKRARVGESGGR-KFGSDVXNGIAAVREKLMFDL  565
            R +    A+ +RR  N  E ++++ +     +G S G+ K   DV +G+  +R KL   L
Sbjct  59   RRE---FASLKRRYPNGLESLKKSQLPP---IGASAGKSKTDKDVDDGLEEIRAKLELHL  112

Query  566  Q  568
            +
Sbjct  113  R  113



>emb|CDP00644.1| unnamed protein product [Coffea canephora]
Length=326

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 68/138 (49%), Gaps = 36/138 (26%)
 Frame = +2

Query  224  MAMGPERSKP----------PLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRR----  361
            MAMG ER +           PLHNF LP GL+WGNQKFLRC KV+SNGEISAV RR    
Sbjct  1    MAMGLEREREQSLSSSSSSKPLHNFNLPFGLRWGNQKFLRCMKVNSNGEISAVQRRPSSS  60

Query  362  ---------SYGSSEASARRRVQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGS  514
                     S G+   +          +   +R   E+  +  +  R R G+        
Sbjct  61   SSLAAAFNASNGNRNGNLNSSSSADVLSIIGKRKEREKCDDPSI-NRDRSGD--------  111

Query  515  DVXNGIAAVREKLMFDLQ  568
                GIAAVREKLMFDLQ
Sbjct  112  ----GIAAVREKLMFDLQ  125



>ref|XP_007223127.1| hypothetical protein PRUPE_ppa010016mg [Prunus persica]
 gb|EMJ24326.1| hypothetical protein PRUPE_ppa010016mg [Prunus persica]
Length=267

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 64/128 (50%), Gaps = 38/128 (30%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSN-----GEISAVHRRSYGSSEASA  388
            MAMG ER+KP LHNF LP  LKWGNQK LRC KV S+     GE SAV RRS        
Sbjct  18   MAMGSERTKP-LHNFNLPWDLKWGNQKHLRCMKVSSDAGGSTGEASAVDRRS--------  68

Query  389  RRRVQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKF--------GSDVXNGIAAVR  544
                            S +R++ + +  R R  E   R+F          D   GI AVR
Sbjct  69   ----------------SAQRLESSVMMTRRRESEFEKRRFRAPRPRIENDDAEEGIEAVR  112

Query  545  EKLMFDLQ  568
            EKLMFDL+
Sbjct  113  EKLMFDLK  120



>ref|XP_002279484.2| PREDICTED: uncharacterized protein LOC100244117 [Vitis vinifera]
Length=259

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 68/118 (58%), Gaps = 13/118 (11%)
 Frame = +2

Query  221  VMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRV  400
            +  MGPERSKP LHNF +P  LKWGNQ+FLRC KV+SNGE++A   RS  S     RR  
Sbjct  14   LKTMGPERSKP-LHNFAMPS-LKWGNQRFLRCMKVNSNGEVAADDGRS--SDLVRGRRES  69

Query  401  QPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDV--XNGIAAVREKLMFDLQ  568
            +     + +RR       E+      R    GG+  G ++   +GI AVR KLMFDLQ
Sbjct  70   E-----SEKRRSLT--CSESLEESPTRSSPIGGKGKGDEIDGDDGIEAVRAKLMFDLQ  120



>ref|XP_008243261.1| PREDICTED: uncharacterized protein LOC103341506 [Prunus mume]
Length=306

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 64/128 (50%), Gaps = 38/128 (30%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSN-----GEISAVHRRSYGSSEASA  388
            MAMG ER+KP LHNF LP  LKWGNQK LRC KV S+     GE SAV RRS        
Sbjct  18   MAMGSERTKP-LHNFNLPWDLKWGNQKHLRCMKVSSDAGGSTGEASAVDRRS--------  68

Query  389  RRRVQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKF--------GSDVXNGIAAVR  544
                            S +R++ + +  R R  E   R+F          +   GI AVR
Sbjct  69   ----------------SAQRLESSVMMTRRRESEFEKRRFRAPRPRIENDNAEEGIEAVR  112

Query  545  EKLMFDLQ  568
            EKLMFDL+
Sbjct  113  EKLMFDLK  120



>ref|XP_010249704.1| PREDICTED: uncharacterized protein LOC104592180 [Nelumbo nucifera]
 ref|XP_010249706.1| PREDICTED: uncharacterized protein LOC104592181 [Nelumbo nucifera]
Length=274

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 67/116 (58%), Gaps = 3/116 (3%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            M MGPE+SKP LHNF++P  LKWGNQK LRC KVDS GEIS+V RR   ++  S    ++
Sbjct  1    MEMGPEKSKP-LHNFSMPR-LKWGNQKLLRCMKVDSKGEISSVERRFSAAAGQSGASIIR  58

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGR-KFGSDVXNGIAAVREKLMFDLQ  568
               + + +RR SN             +G S  + K   D  +GI A+REKL   L+
Sbjct  59   GRESRSLKRRFSNGFENSRKSPLPPPIGNSVEKSKIDKDGDDGIEAIREKLELHLR  114



>ref|XP_008445636.1| PREDICTED: uncharacterized protein LOC103488593 [Cucumis melo]
Length=279

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 71/117 (61%), Gaps = 15/117 (13%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNG-EISAVHRRSYGS-SEASARRR  397
            M M  +RSKP LHNF LPC LKWG+QK LRC KV+SNG ++S V+R+S+ S SE S   R
Sbjct  1    MRMRSKRSKP-LHNFMLPC-LKWGSQKHLRCMKVNSNGVQVSGVNRQSHSSRSEESTETR  58

Query  398  VQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                    ++  G   R+    +  R +V +S  +K   D   GI AVREKLMFDL+
Sbjct  59   --------SRESGLEMRMFLKDLEMRPKVSKSRIKKTDDD---GIEAVREKLMFDLK  104



>gb|KDP29438.1| hypothetical protein JCGZ_18359 [Jatropha curcas]
Length=299

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 61/117 (52%), Gaps = 12/117 (10%)
 Frame = +2

Query  218  LVMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRR  397
            LVMAMG ERSKPPLHNF LPC LKWG+QK+LRC K DS+         + G S    R  
Sbjct  14   LVMAMGTERSKPPLHNFNLPC-LKWGSQKYLRCMK-DSDSSNGKNKNINNGVSGDRLRSN  71

Query  398  VQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
              PP+   A       R       KR +         G  V  GIAAVREKLMFD +
Sbjct  72   RSPPSKFVASPDYEIRRF------KRPKSRHDS----GDGVEEGIAAVREKLMFDFK  118



>emb|CBI26998.3| unnamed protein product [Vitis vinifera]
Length=209

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 61/116 (53%), Gaps = 32/116 (28%)
 Frame = +2

Query  221  VMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRV  400
            +  MGPERSKP LHNF +P  LKWGNQ+FLRC KV+SNGE++A   RS  S     RR  
Sbjct  15   LKTMGPERSKP-LHNFAMPS-LKWGNQRFLRCMKVNSNGEVAADDGRS--SDLVRGRR--  68

Query  401  QPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                + + +R+G                          D  +GI AVR KLMFDLQ
Sbjct  69   ---ESESEKRKGDE-----------------------IDGDDGIEAVRAKLMFDLQ  98



>ref|XP_007142930.1| hypothetical protein PHAVU_007G029200g [Phaseolus vulgaris]
 gb|ESW14924.1| hypothetical protein PHAVU_007G029200g [Phaseolus vulgaris]
Length=263

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 58/115 (50%), Gaps = 27/115 (23%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMGPERSKP LHNF LPC LKWG+Q+ LRC K+ S+    A  RRS       A R   
Sbjct  12   MAMGPERSKP-LHNFMLPC-LKWGSQRHLRCTKLGSDSSTDAGDRRS------PAPREFD  63

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
            PP    A  R            KR R        F  D   GI AVREKLM DL+
Sbjct  64   PPPPGNADAR---------LRLKRPR--------FLGD--EGIDAVREKLMLDLK  99



>ref|XP_002314852.2| hypothetical protein POPTR_0010s13260g [Populus trichocarpa]
 gb|EEF01023.2| hypothetical protein POPTR_0010s13260g [Populus trichocarpa]
Length=290

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 61/119 (51%), Gaps = 10/119 (8%)
 Frame = +2

Query  212  EVLVMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASAR  391
            E  VMAMG ERSKPPLHNF LP  LKWGNQ+ LRC K+  +   +AV R +   +     
Sbjct  8    EERVMAMGQERSKPPLHNFDLPF-LKWGNQRHLRCMKLPDSSTAAAVVRDNKNETRGG--  64

Query  392  RRVQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                       + R SN           AR  ++   +FG  V  GI AVREK+M DL+
Sbjct  65   ------RFPVERHRSSNRSPPTNFGNYDARRSKAPRERFGG-VEEGIDAVREKIMLDLK  116



>ref|XP_007044281.1| Uncharacterized protein TCM_009632 [Theobroma cacao]
 gb|EOY00113.1| Uncharacterized protein TCM_009632 [Theobroma cacao]
Length=312

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 68/131 (52%), Gaps = 25/131 (19%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVD-----SNGEISAVHRRSYGSSEASA  388
            MAMGPERSKP LHNF LPC LKWGNQ++LRC K+D     ++   +AV            
Sbjct  12   MAMGPERSKP-LHNFKLPC-LKWGNQRYLRCVKLDDASTATDSSSAAVDHHRRHRHRHVF  69

Query  389  RRRVQPPA-------AATAQRRG----SNERVQETCVAKRARVGESGGRKFGSDVXNGIA  535
            +RR  PP+        AT  R      SN++  +    +R R+ E        +   GI 
Sbjct  70   QRRRSPPSKFESMIVGATRLRESESSPSNDKNNDYGRERRLRISE-------GEAAEGIK  122

Query  536  AVREKLMFDLQ  568
            AVREK+M DL+
Sbjct  123  AVREKIMKDLK  133



>ref|XP_004138348.1| PREDICTED: uncharacterized protein LOC101205564 [Cucumis sativus]
 ref|XP_004160212.1| PREDICTED: uncharacterized protein LOC101227806 [Cucumis sativus]
 gb|KGN45937.1| hypothetical protein Csa_6G024940 [Cucumis sativus]
Length=279

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 69/116 (59%), Gaps = 13/116 (11%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNG-EISAVHRRSYGSSEASARRRV  400
            M M  +RSKP LHNF LPC LKWG+QK LRC KV+SNG ++S V+R+S+ S    +    
Sbjct  1    MRMRSKRSKP-LHNFMLPC-LKWGSQKHLRCMKVNSNGVQVSGVYRQSHSSRSEES----  54

Query  401  QPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                 + ++  G   R+    +  R +V +S  +K   D   GI AVREKLMFDL+
Sbjct  55   ---TESRSRESGLEMRMFLKDLEMRPKVSKSRIKKTDDD---GIEAVREKLMFDLK  104



>ref|XP_004166843.1| PREDICTED: uncharacterized protein LOC101226094 [Cucumis sativus]
Length=269

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 60/115 (52%), Gaps = 7/115 (6%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMG ERSKP LHNFTLP  LKWGNQ++LRC K+DS+    A H            RR  
Sbjct  1    MAMGLERSKP-LHNFTLPF-LKWGNQRYLRCMKLDSD----APHTDDDDDLPPPVDRRPS  54

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                   ++  +++       AKR R  +S       D    IAAVREKLM DL+
Sbjct  55   SAHRFNCRKFHTDKPTLFKDSAKRPRASKSKIHD-NYDGDEDIAAVREKLMIDLK  108



>ref|XP_004135397.1| PREDICTED: uncharacterized protein LOC101211482 [Cucumis sativus]
Length=302

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 60/115 (52%), Gaps = 7/115 (6%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMG ERSKP LHNFTLP  LKWGNQ++LRC K+DS+    A H            RR  
Sbjct  1    MAMGLERSKP-LHNFTLPF-LKWGNQRYLRCMKLDSD----APHTDDDDDLPPPVDRRPS  54

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                   ++  +++       AKR R  +S       D    IAAVREKLM DL+
Sbjct  55   SAHRFNCRKFHTDKPTLFKDSAKRPRASKSKIHD-NYDGDEDIAAVREKLMIDLK  108



>ref|XP_008339652.1| PREDICTED: uncharacterized protein LOC103402678 [Malus domestica]
Length=312

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 65/124 (52%), Gaps = 21/124 (17%)
 Frame = +2

Query  212  EVLVMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAK-----VDSNGEISAVHRRSYGSS  376
            E   MAMG ER+KP LHNF LP  LKWGNQK+LRC K       S GE S V+RRS    
Sbjct  14   EAKSMAMGSERTKP-LHNFNLPWDLKWGNQKYLRCQKESSDAGGSGGEGSGVNRRS----  68

Query  377  EASARRRVQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLM  556
              SA+R    PA  +  RR   E  + T    R R+          D   GI A R+KLM
Sbjct  69   --SAQRIESSPAVMS--RRRDLEFEKRTFRPSRPRIE-------NDDAEEGIDAFRQKLM  117

Query  557  FDLQ  568
            FDL+
Sbjct  118  FDLK  121



>ref|XP_008446612.1| PREDICTED: uncharacterized protein LOC103489295 [Cucumis melo]
Length=310

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 60/116 (52%), Gaps = 7/116 (6%)
 Frame = +2

Query  221  VMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRV  400
             MAMG ERSKP LHNFTLP  LKWGNQ++LRC K+DS+    A H            RR 
Sbjct  13   TMAMGLERSKP-LHNFTLPF-LKWGNQRYLRCMKLDSD----APHTDDDDDLPPPVDRRP  66

Query  401  QPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                    ++  +++       AKR R  +S       D    IAAVREKLM DL+
Sbjct  67   SSAHRFNCRKFHTDKPTLFKDSAKRPRASKSKIHD-NYDGDEDIAAVREKLMIDLK  121



>ref|XP_006605904.1| PREDICTED: uncharacterized protein LOC100782256 [Glycine max]
Length=290

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 58/117 (50%), Gaps = 26/117 (22%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAK--VDSNGEISAVHRRSYGSSEASARRR  397
            MAMGPERSKP LHNF LPC LKWG Q+ LRC K   DS+   +A  RRS    E  +   
Sbjct  12   MAMGPERSKP-LHNFMLPC-LKWGGQRHLRCTKHPSDSSSADAAGDRRSPAPREFDS---  66

Query  398  VQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
              PP    A  R    R        R  VG+            GI AVREKLM DL+
Sbjct  67   -PPPPLTNADTRTRLTR-------PRFLVGDE-----------GIDAVREKLMLDLK  104



>gb|KGN52094.1| hypothetical protein Csa_5G609800 [Cucumis sativus]
Length=489

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 60/115 (52%), Gaps = 7/115 (6%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMG ERSKP LHNFTLP  LKWGNQ++LRC K+DS+    A H            RR  
Sbjct  14   MAMGLERSKP-LHNFTLPF-LKWGNQRYLRCMKLDSD----APHTDDDDDLPPPVDRRPS  67

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                   ++  +++       AKR R  +S       D    IAAVREKLM DL+
Sbjct  68   SAHRFNCRKFHTDKPTLFKDSAKRPRASKSKIHD-NYDGDEDIAAVREKLMIDLK  121



>gb|EYU40770.1| hypothetical protein MIMGU_mgv1a010835mg [Erythranthe guttata]
Length=300

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 15/122 (12%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV--DSNGEISAVHRRSYGSSEASARRR  397
            MA G ERSK  LHNFT+P  L+W NQ+FLRC KV  D++G IS + R +   S +S +RR
Sbjct  1    MATGTERSKT-LHNFTMPGELRWRNQRFLRCMKVNSDADGRISPLRRFAADKSFSSDQRR  59

Query  398  -----VQPPAAA--TAQRRGSNERVQETCVAKRARVGE----SGGRKFGSDVXNGIAAVR  544
                 VQ P  +      RG +        +  A  G+     GGR+F SD  NGIAA+R
Sbjct  60   RGNNPVQQPRTSRDGGIGRGKDSDSDSLHGSLGAGAGQPPASDGGRRFSSD-DNGIAAIR  118

Query  545  EK  550
            EK
Sbjct  119  EK  120



>ref|XP_011007676.1| PREDICTED: uncharacterized protein LOC105113268 [Populus euphratica]
Length=280

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 59/115 (51%), Gaps = 10/115 (9%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMG ERSK PLHNF LP  LKWGNQ+ LRC K+  +   +AV R +   ++        
Sbjct  1    MAMGQERSKLPLHNFDLPF-LKWGNQRHLRCMKLPDSSTAAAVVRDNKNETKGG------  53

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                   + R SN           AR  ++   +FG  V  GI AVREK+M DL+
Sbjct  54   --RFPVERHRSSNRSPPTNFGNYDARRSKASRERFGG-VEEGIDAVREKIMLDLK  105



>gb|EYU29997.1| hypothetical protein MIMGU_mgv1a010415mg [Erythranthe guttata]
Length=313

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 64/128 (50%), Gaps = 15/128 (12%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MA G ERS   LHNFT+P  L+WG Q+FLRC KV+S  +IS  HR    SS +S      
Sbjct  1    MATGTERST--LHNFTMPGDLRWGRQRFLRCMKVNSGDQISPPHRIEPNSSGSSDHHNHL  58

Query  404  PPAAATAQRRGSNERVQETCVAKRARV----------GESGGRKF---GSDVXNGIAAVR  544
            P       R    ER ++   +   +V             GGR+F     D   GIAA R
Sbjct  59   PIQQRRTARDRERERAKDEFASGSPKVGPTHPPPPPPPHGGGRRFGDEDDDDDGGIAATR  118

Query  545  EKLMFDLQ  568
            EK+MFDLQ
Sbjct  119  EKVMFDLQ  126



>ref|XP_009356989.1| PREDICTED: uncharacterized protein LOC103947762 [Pyrus x bretschneideri]
Length=310

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 59/128 (46%), Gaps = 29/128 (23%)
 Frame = +2

Query  212  EVLVMAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASAR  391
            E   MAMG ER+KP LHNF LP  LKWGNQ+ LRC K  S+   S               
Sbjct  14   EAKSMAMGSERTKP-LHNFNLPWDLKWGNQRHLRCQKETSDAGGSGG-------------  59

Query  392  RRVQPPAAATAQRRGSNERVQET-CVAKRARVGESGGRKF--------GSDVXNGIAAVR  544
                    +   RR S +R++ +  V  R R  E   RKF          D   GI A R
Sbjct  60   ------EGSGVNRRSSVQRIESSPAVMTRRRDLEFEKRKFRPSRPRIENDDAEEGIDAFR  113

Query  545  EKLMFDLQ  568
            +KLMFDL+
Sbjct  114  QKLMFDLK  121



>ref|XP_002312408.2| hypothetical protein POPTR_0008s12160g [Populus trichocarpa]
 gb|EEE89775.2| hypothetical protein POPTR_0008s12160g [Populus trichocarpa]
Length=280

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 59/122 (48%), Gaps = 23/122 (19%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV-DSNGEISAVHRRSYGSSEASARRRV  400
            MAMG ERSKPPLHNF LP  LKWGNQ+ LRC K+ DSN    A  R +   +        
Sbjct  1    MAMGQERSKPPLHNFDLPF-LKWGNQRHLRCMKLPDSNTAADAAVRDNKNENNGG-----  54

Query  401  QPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSD------VXNGIAAVREKLMFD  562
                      R S ER + +  +   + G    R+F         V  GI  VREK+M D
Sbjct  55   ----------RISVERNRSSSRSPPRKFGNYDIRRFKPPRERFGGVEEGIDEVREKIMLD  104

Query  563  LQ  568
            L+
Sbjct  105  LK  106



>ref|XP_007160389.1| hypothetical protein PHAVU_002G317700g [Phaseolus vulgaris]
 gb|ESW32383.1| hypothetical protein PHAVU_002G317700g [Phaseolus vulgaris]
Length=170

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 3/47 (6%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSN-GEISAVHRR  361
            MAMGPERSKP LHNF +PC LKWGNQKFLRC KV ++  +I+ V R+
Sbjct  1    MAMGPERSKP-LHNFPMPC-LKWGNQKFLRCVKVANDPNDIADVRRK  45



>ref|XP_003535721.2| PREDICTED: uncharacterized protein LOC100779683 [Glycine max]
Length=257

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 57/115 (50%), Gaps = 28/115 (24%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMGPERSKP LHNF LPC LKWG+Q+ LRC K  S+   S   RRS    E  +     
Sbjct  12   MAMGPERSKP-LHNFMLPC-LKWGSQRHLRCTKHPSDS--STEDRRSPAPREFDS----P  63

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
            P   A  + R +  R                   FG +   GI AVREKLM DL+
Sbjct  64   PLTNADTRTRLTRPRFL-----------------FGDE---GIDAVREKLMLDLK  98



>ref|XP_011003255.1| PREDICTED: uncharacterized protein LOC105110053 [Populus euphratica]
Length=278

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 58/122 (48%), Gaps = 23/122 (19%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV-DSNGEISAVHRRSYGSSEASARRRV  400
            MAMG ERSK PLHNF LP  LKWGNQ+ LRC K+ DSN    A  R +   +        
Sbjct  1    MAMGQERSKLPLHNFDLPF-LKWGNQRHLRCMKLPDSNTAADAAVRDNKNENNGG-----  54

Query  401  QPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSD------VXNGIAAVREKLMFD  562
                      R S ER + +  +   + G    R+F         V  GI  VREK+M D
Sbjct  55   ----------RISVERNRSSSRSPPRKFGNYDIRRFKPPRERFGGVEEGIDEVREKIMLD  104

Query  563  LQ  568
            L+
Sbjct  105  LK  106



>ref|XP_011022313.1| PREDICTED: uncharacterized protein LOC105124132 [Populus euphratica]
Length=278

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 58/122 (48%), Gaps = 23/122 (19%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV-DSNGEISAVHRRSYGSSEASARRRV  400
            MAMG ERSK PLHNF LP  LKWGNQ+ LRC K+ DSN    A  R +   +        
Sbjct  1    MAMGQERSKLPLHNFDLPF-LKWGNQRHLRCMKLPDSNTAADAAVRDNKNENNGG-----  54

Query  401  QPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSD------VXNGIAAVREKLMFD  562
                      R S ER + +  +   + G    R+F         V  GI  VREK+M D
Sbjct  55   ----------RISVERNRSSSRSPPRKFGNYDIRRFKPPREKFGGVEEGIDEVREKIMLD  104

Query  563  LQ  568
            L+
Sbjct  105  LK  106



>ref|XP_008389276.1| PREDICTED: uncharacterized protein LOC103451638 [Malus domestica]
Length=308

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 56/123 (46%), Gaps = 28/123 (23%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MAMG ER+K  LHNF LP  LKWGNQ+ LRC K  S    S                   
Sbjct  18   MAMGSERTKA-LHNFNLPWDLKWGNQRHLRCQKESSEAGGSGG-----------------  59

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKF--------GSDVXNGIAAVREKLMF  559
                + A RR S +R++ +    R R  E   RKF          D   GI A R+KLMF
Sbjct  60   --EGSEANRRSSAQRMESSPAVTRRRDLEFEKRKFRAPRPRIENDDAEEGIDAFRQKLMF  117

Query  560  DLQ  568
            DL+
Sbjct  118  DLK  120



>ref|XP_008453422.1| PREDICTED: uncharacterized protein LOC103494136 [Cucumis melo]
Length=227

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 59/115 (51%), Gaps = 12/115 (10%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            M++ P+RS P LHNF+LPC LKWG+Q+FL+C KV SN   S +   S      S + R +
Sbjct  1    MSIPPDRSNP-LHNFSLPC-LKWGSQRFLKCMKVSSNSNPSTLDHPSVHRQSKSYQFRAR  58

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
            P          +++ +  T V        S  +    D  + I  +REK+M D++
Sbjct  59   P---------INSKAMNFTKVTSPMNTNHSKQKPIH-DRSSSIEIMREKIMLDIR  103



>ref|XP_004137319.1| PREDICTED: uncharacterized protein LOC101214785 [Cucumis sativus]
 ref|XP_004160439.1| PREDICTED: uncharacterized protein LOC101224469 [Cucumis sativus]
 gb|KGN63834.1| hypothetical protein Csa_1G024200 [Cucumis sativus]
Length=227

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 12/115 (10%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            M++ P+RS P LHNF+LPC LKWG+Q+FL+C KV SN   S +   S      S + R +
Sbjct  1    MSIPPDRSNP-LHNFSLPC-LKWGSQRFLKCMKVSSNSNPSTLDHPSVHRQSKSYQFRAR  58

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
            P           ++ +  T V        S  +K   D  + I  +REK+M D++
Sbjct  59   P---------IDSKAMNFTKVTSPMNTNHS-KQKPTHDRSSSIEIMREKIMLDIR  103



>gb|AFK44975.1| unknown [Lotus japonicus]
Length=223

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 1/32 (3%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCA  319
            MAM PERSKPPLHNF+LPC LKWG Q+ LRC 
Sbjct  1    MAMIPERSKPPLHNFSLPC-LKWGTQRLLRCV  31



>ref|XP_004497073.1| PREDICTED: uncharacterized protein LOC101492865 [Cicer arietinum]
Length=243

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 54/115 (47%), Gaps = 30/115 (26%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQ  403
            MA   ER KP LHNF LPC LKWGNQ+ LRC K+ S+                    R  
Sbjct  13   MATNSERVKP-LHNFMLPC-LKWGNQRHLRCMKIPSDDG-----------------DRQS  53

Query  404  PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
            P  A T +       ++ +    R R+  S  R  G D   GI AVREKLM DL+
Sbjct  54   PSNAPTRE-------IESSLNNARMRI-TSKQRIIGDD---GIDAVREKLMLDLK  97



>ref|XP_010099253.1| hypothetical protein L484_015442 [Morus notabilis]
 gb|EXB77517.1| hypothetical protein L484_015442 [Morus notabilis]
Length=296

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 62/116 (53%), Gaps = 14/116 (12%)
 Frame = +2

Query  224  MAMGPERSKP-PLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRV  400
            MA+ PER+   PLHNF LPC LKWG+Q++LRC KV+S+G      RRS       A+R  
Sbjct  1    MAVAPERTAAKPLHNFDLPC-LKWGSQRYLRCVKVNSDGG-GRTDRRSI------AQRFD  52

Query  401  QPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
              P     +      + Q    +K  ++ E      G +   GIAAVREKLM DL+
Sbjct  53   SSPIDRRRELEWERRKRQR-FFSKPGKI-EDEKDDAGEE---GIAAVREKLMCDLK  103



>gb|KJB50186.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
 gb|KJB50187.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
 gb|KJB50188.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
 gb|KJB50189.1| hypothetical protein B456_008G158100 [Gossypium raimondii]
Length=309

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 2/36 (6%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDS  331
            MAM PERSKP LHNF LPC LKWGN+++LRC K+D 
Sbjct  12   MAMAPERSKP-LHNFNLPC-LKWGNRRYLRCMKLDD  45



>ref|NP_001241159.1| uncharacterized protein LOC100805289 [Glycine max]
 ref|XP_006582933.1| PREDICTED: uncharacterized protein LOC100805289 isoform X1 [Glycine 
max]
 gb|ACU19791.1| unknown [Glycine max]
 gb|KHN20745.1| hypothetical protein glysoja_019062 [Glycine soja]
Length=198

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 32/47 (68%), Gaps = 8/47 (17%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRS  364
            MA GPERSKP LHNF+LPC LKWG Q+ LRC   D +      HRRS
Sbjct  1    MATGPERSKP-LHNFSLPC-LKWGTQRLLRCVNADLD------HRRS  39



>gb|KJB61220.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
Length=324

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 59/124 (48%), Gaps = 12/124 (10%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASA-----  388
            MAMG +RS P LHNF LPC LKWGNQ++LRC K+      +        SS + A     
Sbjct  12   MAMGSDRSYP-LHNFNLPC-LKWGNQRYLRCMKLGDASAAATATVTDESSSASVADRHRR  69

Query  389  ---RRRVQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKF-GSDVXNGIAAVREKLM  556
               +RR  PP+       G   R QE+  +     G          +   GI AVREK+M
Sbjct  70   RRFQRRRSPPSKFEGLMVGGMRR-QESASSPTKDYGREQRLMIPKGETAEGIEAVREKIM  128

Query  557  FDLQ  568
             DL+
Sbjct  129  KDLK  132



>gb|KJB61217.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
 gb|KJB61219.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
Length=317

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 59/124 (48%), Gaps = 12/124 (10%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASA-----  388
            MAMG +RS P LHNF LPC LKWGNQ++LRC K+      +        SS + A     
Sbjct  12   MAMGSDRSYP-LHNFNLPC-LKWGNQRYLRCMKLGDASAAATATVTDESSSASVADRHRR  69

Query  389  ---RRRVQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKF-GSDVXNGIAAVREKLM  556
               +RR  PP+       G   R QE+  +     G          +   GI AVREK+M
Sbjct  70   RRFQRRRSPPSKFEGLMVGGMRR-QESASSPTKDYGREQRLMIPKGETAEGIEAVREKIM  128

Query  557  FDLQ  568
             DL+
Sbjct  129  KDLK  132



>gb|KJB61218.1| hypothetical protein B456_009G347700 [Gossypium raimondii]
Length=316

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 59/124 (48%), Gaps = 12/124 (10%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASA-----  388
            MAMG +RS P LHNF LPC LKWGNQ++LRC K+      +        SS + A     
Sbjct  12   MAMGSDRSYP-LHNFNLPC-LKWGNQRYLRCMKLGDASAAATATVTDESSSASVADRHRR  69

Query  389  ---RRRVQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKF-GSDVXNGIAAVREKLM  556
               +RR  PP+       G   R QE+  +     G          +   GI AVREK+M
Sbjct  70   RRFQRRRSPPSKFEGLMVGGMRR-QESASSPTKDYGREQRLMIPKGETAEGIEAVREKIM  128

Query  557  FDLQ  568
             DL+
Sbjct  129  KDLK  132



>ref|XP_007154144.1| hypothetical protein PHAVU_003G094100g [Phaseolus vulgaris]
 gb|ESW26138.1| hypothetical protein PHAVU_003G094100g [Phaseolus vulgaris]
Length=190

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 2/35 (6%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVD  328
            MA GPERSKP LHNF+LPC LKWG Q+ LRC   D
Sbjct  1    MATGPERSKP-LHNFSLPC-LKWGTQRLLRCVNAD  33



>ref|XP_010549544.1| PREDICTED: uncharacterized protein LOC104820683 [Tarenaya hassleriana]
Length=267

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +2

Query  239  ERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASA  388
            ER KPPLHNF L   LKWGNQ+FLRC K DS+        R   SS A +
Sbjct  18   ERVKPPLHNFPL-SSLKWGNQRFLRCVKADSSSSDDEHRLRRQASSPAKS  66



>ref|XP_002533698.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28681.1| conserved hypothetical protein [Ricinus communis]
Length=213

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGE  340
            M    +R KPPLHNF+LP  LKWGNQ+ LRC K+  NG+
Sbjct  1    MTTPQDRPKPPLHNFSLPY-LKWGNQRLLRCVKLTDNGQ  38



>ref|XP_006448443.1| hypothetical protein CICLE_v10016320mg [Citrus clementina]
 ref|XP_006468717.1| PREDICTED: uncharacterized protein LOC102623112 [Citrus sinensis]
 gb|ESR61683.1| hypothetical protein CICLE_v10016320mg [Citrus clementina]
 gb|KDO76960.1| hypothetical protein CISIN_1g025032mg [Citrus sinensis]
Length=259

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 58/118 (49%), Gaps = 23/118 (19%)
 Frame = +2

Query  221  VMAMGPERSK-PPLHNFTLPCGLKWGNQKFLRCAKV-DSNGEISAVHRRSYGSSEASARR  394
            +MAMG  RS   PLHNFTLP  LKWG+Q+ LRC KV DS+    +V  R           
Sbjct  7    LMAMGTARSSSKPLHNFTLPY-LKWGHQRHLRCMKVEDSSPSSPSVDHR-----------  54

Query  395  RVQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                      +RR       ++   K   + +S G   G++   GI AVREK+M DL+
Sbjct  55   ---------PRRRSREFEFDDSGRHKGKVLLKSNGVDGGAEEEEGIDAVREKIMNDLK  103



>gb|KHG24859.1| hypothetical protein F383_07684 [Gossypium arboreum]
Length=315

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 2/34 (6%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  325
            MAMG +RS P LHNF LPC LKWGNQ++LRC K+
Sbjct  12   MAMGTDRSYP-LHNFNLPC-LKWGNQRYLRCMKL  43



>gb|KCW86313.1| hypothetical protein EUGRSUZ_B03003 [Eucalyptus grandis]
Length=318

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 2/34 (6%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  325
            MAMGPERSKP LHNFTLP  L+WG+Q+++RC KV
Sbjct  19   MAMGPERSKP-LHNFTLP-RLRWGSQRYMRCMKV  50



>ref|XP_003616744.1| hypothetical protein MTR_5g083820 [Medicago truncatula]
Length=297

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 51/109 (47%), Gaps = 33/109 (30%)
 Frame = +2

Query  242  RSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQPPAAAT  421
            R K PLHNF LP  LKWG+Q+ LRC KV  NG+         GSS+   R  V  P   +
Sbjct  27   RVKVPLHNFRLPSSLKWGSQRQLRCQKVPDNGD---------GSSQ---REMVSSP--ES  72

Query  422  AQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
            A  R S  R+                  +G D   G+ A+RE+L  DL+
Sbjct  73   AMERMSMLRID-----------------YGDD--EGVNAMRERLTLDLK  102



>gb|AES99702.2| DUF1639 family protein [Medicago truncatula]
Length=284

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 51/109 (47%), Gaps = 33/109 (30%)
 Frame = +2

Query  242  RSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQPPAAAT  421
            R K PLHNF LP  LKWG+Q+ LRC KV  NG+         GSS+   R  V  P   +
Sbjct  27   RVKVPLHNFRLPSSLKWGSQRQLRCQKVPDNGD---------GSSQ---REMVSSP--ES  72

Query  422  AQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
            A  R S  R+                  +G D   G+ A+RE+L  DL+
Sbjct  73   AMERMSMLRID-----------------YGDD--EGVNAMRERLTLDLK  102



>ref|XP_003592633.1| hypothetical protein MTR_1g110360 [Medicago truncatula]
 gb|AES62884.1| DUF1639 family protein [Medicago truncatula]
Length=240

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +2

Query  248  KPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRV  400
            K PLHNF LP  LKWG+Q+ LRC KV  NG+ S+  +R   S+  SA  R+
Sbjct  31   KAPLHNFDLPSSLKWGSQRQLRCQKVTDNGDGSS--QREMVSTLESAMERI  79



>ref|XP_010551248.1| PREDICTED: uncharacterized protein LOC104821917 [Tarenaya hassleriana]
Length=320

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 57/118 (48%), Gaps = 14/118 (12%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSN---GEISAVHRRSYGSSEASARR  394
            M  G ERSK  LHNFTLP  LKWG+Q+ LRC + DS    G +    RR     +     
Sbjct  10   METGHERSKT-LHNFTLP-NLKWGSQRHLRCMRDDSESGGGSVDHRLRRRSSPLKLETSS  67

Query  395  RVQPPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
             V P       RR +++        +R R+  S   + GS+   GI   REK+M DL+
Sbjct  68   EVIPVRFRDGDRRSNDQ-------NRRLRLVSSRSAENGSE--EGIEEFREKIMSDLR  116



>ref|XP_010532317.1| PREDICTED: uncharacterized protein LOC104808336 [Tarenaya hassleriana]
Length=328

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 56/123 (46%), Gaps = 19/123 (15%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVD------SNGEISAVHRRSYGSSEAS  385
            M  GPERSK  LHNFTLP  LKWG+Q+ LRC KVD           +  HR    SS   
Sbjct  10   METGPERSKN-LHNFTLP-NLKWGSQRHLRCMKVDLARGGGGGVSGAGDHRLRRRSSHLK  67

Query  386  ARRRVQ--PPAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMF  559
                 +  P     A  R +N+        +R R   S  R  G+    GI   REK+M 
Sbjct  68   FETLTEAIPVQFGYADERSNNQH-------RRLRTAPS--RSAGNGSEEGIEEFREKIMS  118

Query  560  DLQ  568
            DL+
Sbjct  119  DLR  121



>ref|XP_010265083.1| PREDICTED: uncharacterized protein LOC104602914 [Nelumbo nucifera]
Length=280

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 1/37 (3%)
 Frame = +2

Query  254  PLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRS  364
            PLHNF LPC LKWG Q+ LRC KV SN EI ++ R S
Sbjct  23   PLHNFLLPC-LKWGRQRRLRCIKVRSNAEIPSLERGS  58



>emb|CAN68110.1| hypothetical protein VITISV_000764 [Vitis vinifera]
Length=114

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  325
            MA   +RS  PLHNF+LP  LKWGNQ+FLRC K+
Sbjct  1    MAKARDRSSKPLHNFSLP-RLKWGNQRFLRCMKL  33



>ref|XP_003618367.1| hypothetical protein MTR_6g008660 [Medicago truncatula]
 gb|AES74585.1| DUF1639 family protein [Medicago truncatula]
Length=273

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 2/54 (4%)
 Frame = +2

Query  239  ERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRV  400
            ER K PLH+F  P  LKWG Q+ LRC KV  NG+ S+  +R   SS+ SA  R+
Sbjct  26   ERVKAPLHSFNFPSSLKWGYQRQLRCQKVPENGDGSS--QREMVSSQESAMERM  77



>emb|CAN67779.1| hypothetical protein VITISV_029297 [Vitis vinifera]
Length=160

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  325
            MA   +RS  PLHNF+LP  LKWGNQ+FLRC K+
Sbjct  1    MAKARDRSSKPLHNFSLP-RLKWGNQRFLRCMKL  33



>ref|XP_008799251.1| PREDICTED: diacylglycerol kinase kappa-like [Phoenix dactylifera]
Length=279

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 4/56 (7%)
 Frame = +2

Query  239  ERSKP----PLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARR  394
            ER KP    PL NF+ P   +WGNQ+ LRCA V+  GEI    RR    + AS RR
Sbjct  7    EREKPQSSNPLDNFSFPILKRWGNQRMLRCANVNRKGEIIEGDRRPSLPAAASERR  62



>ref|XP_002526996.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35368.1| conserved hypothetical protein [Ricinus communis]
Length=266

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 27/42 (64%), Gaps = 7/42 (17%)
 Frame = +2

Query  218  LVMAMGP------ERSKPPLHNFTLPCGLKWGNQKFLRCAKV  325
            LVM MG         SKPPLHNF LP  LKWGNQK LRC K+
Sbjct  15   LVMGMGAAAGQRWNNSKPPLHNFDLPF-LKWGNQKHLRCMKI  55



>gb|ACU20234.1| unknown [Glycine max]
Length=129

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = +2

Query  239  ERSKPPLHNFTLPCGLKWGNQKFLRCAK  322
            ERSKP LHNF++PC LKWGNQ+FLRC K
Sbjct  12   ERSKP-LHNFSMPC-LKWGNQRFLRCVK  37



>ref|XP_003525235.1| PREDICTED: uncharacterized protein LOC100801179 [Glycine max]
Length=129

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 2/28 (7%)
 Frame = +2

Query  239  ERSKPPLHNFTLPCGLKWGNQKFLRCAK  322
            ERSKP LHNF++PC LKWGNQ+FLRC K
Sbjct  12   ERSKP-LHNFSMPC-LKWGNQRFLRCVK  37



>ref|XP_010688487.1| PREDICTED: uncharacterized protein LOC104902410 [Beta vulgaris 
subsp. vulgaris]
Length=222

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 54/114 (47%), Gaps = 12/114 (11%)
 Frame = +2

Query  227  AMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSSEASARRRVQP  406
            AM PERS+  LHNF+LP  L WG QK LRCAK+++N   +     S   + +  RR    
Sbjct  3    AMAPERSRT-LHNFSLPPRLNWGTQKLLRCAKLNNNENNNNNPTSSSNDTVSIKRR----  57

Query  407  PAAATAQRRGSNERVQETCVAKRARVGESGGRKFGSDVXNGIAAVREKLMFDLQ  568
                T+  + ++ R  +           S   +   D  N I  + EKLMFD +
Sbjct  58   ----TSTHQNASFRSPQPPQQPPPPPPSSSSIR---DENNEIEVITEKLMFDFR  104



>ref|XP_002278683.1| PREDICTED: uncharacterized protein LOC100259406 [Vitis vinifera]
Length=187

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 1/34 (3%)
 Frame = +2

Query  224  MAMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKV  325
            MA   +RS  PLHNF+LP  LKWGNQ+FLRC K+
Sbjct  1    MAKARDRSSKPLHNFSLP-RLKWGNQRFLRCMKL  33



>ref|XP_009127623.1| PREDICTED: uncharacterized protein LOC103852469 [Brassica rapa]
Length=190

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +2

Query  227  AMGPERSKPPLHNFTLPCGLKWGNQKFLRCAKVDSNGEISAVHRRSYGSS  376
             MG ER K  LHNFTLP  LKWG Q+ LRC K+ SNG +   +RR + S+
Sbjct  13   TMGRERPKT-LHNFTLP-DLKWGVQRSLRCMKLQSNGGVDDRNRRLWRSA  60



>ref|XP_004512910.1| PREDICTED: uncharacterized protein LOC101496171 [Cicer arietinum]
Length=205

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 67/137 (49%), Gaps = 27/137 (20%)
 Frame = +2

Query  227  AMGPERSKPPLHNFTLPCGLKWGNQKFLRC--------AKVDS-----------NGEISA  349
            +M PERSK  LHNF+LPC LKWG Q+ LRC        +K++S           +  ++A
Sbjct  6    SMEPERSKS-LHNFSLPC-LKWGTQRLLRCVNNHNQQSSKLNSPQNNNNPIPQTDETVNA  63

Query  350  VHRRSYGSSEASARR-RVQPPAAATAQRRGSNER---VQETCVAKRARVGESGGRKF--G  511
            V  R  G  + +A++ +V           GSN R   ++    A +A +G+ G R F  G
Sbjct  64   VRERIIGDLKVAAKKLKVSIFEENNGDDDGSNIRPWNLRTRRAACKAPIGDEGRRFFDVG  123

Query  512  SDVXNGIAAVREKLMFD  562
            S   + +   ++ +M D
Sbjct  124  SSSPSSLVKNKKMVMLD  140



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960