BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M19

Length=538
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007221770.1|  hypothetical protein PRUPE_ppb024585mg           80.1    3e-16   
gb|AAN03493.1|AF291761_1  uORF                                        78.2    8e-16   Ipomoea batatas [batate]
gb|ABR13282.1|  putative S-adenosylmethionine decarboxylase           78.2    1e-15   Prunus dulcis [sweet almond]
ref|XP_010100906.1|  hypothetical protein L484_009676                 77.4    3e-15   
gb|AAR84407.1|  S-adenosylmethionine decarboxylase uORF               76.6    4e-15   Daucus carota [carrots]
gb|EPS62260.1|  hypothetical protein M569_12533                       76.6    4e-15   Genlisea aurea
gb|AAC48988.1|  putative                                              76.6    4e-15   Catharanthus roseus [chatas]
ref|XP_006573200.1|  PREDICTED: uncharacterized protein LOC102664135  76.6    4e-15   
ref|XP_011077607.1|  PREDICTED: uncharacterized protein LOC105161571  76.3    5e-15   
ref|XP_011008987.1|  PREDICTED: uncharacterized protein LOC105114...  76.3    5e-15   Populus euphratica
ref|XP_011462958.1|  PREDICTED: uncharacterized protein LOC101290852  75.9    6e-15   Fragaria vesca subsp. vesca
ref|XP_006484362.1|  PREDICTED: uncharacterized protein LOC102608541  75.9    6e-15   
ref|XP_008389351.1|  PREDICTED: uncharacterized protein LOC103451712  75.9    6e-15   
ref|XP_007153541.1|  hypothetical protein PHAVU_003G044300g           75.9    6e-15   Phaseolus vulgaris [French bean]
ref|XP_006348616.1|  PREDICTED: uncharacterized protein LOC102601388  75.9    6e-15   Solanum tuberosum [potatoes]
ref|XP_009356497.1|  PREDICTED: uncharacterized protein LOC103947321  75.9    6e-15   
ref|XP_008339773.1|  PREDICTED: uncharacterized protein LOC103402794  75.9    6e-15   
gb|AAB03864.1|  putative ORF; conserved in 5' leaders of plant SAMdC  75.9    6e-15   Pisum sativum [garden pea]
ref|XP_010549938.1|  PREDICTED: uncharacterized protein LOC104820958  75.5    8e-15   
gb|EYU44270.1|  hypothetical protein MIMGU_mgv11b021951mg             75.5    1e-14   Erythranthe guttata [common monkey flower]
gb|KGN57742.1|  hypothetical protein Csa_3G271350                     75.9    1e-14   Cucumis sativus [cucumbers]
gb|AAR84409.1|  S-adenosylmethionine decarboxylase uORF               74.7    2e-14   Daucus carota [carrots]
ref|XP_006338298.1|  PREDICTED: uncharacterized protein LOC102589...  74.3    3e-14   Solanum tuberosum [potatoes]
emb|CDP02380.1|  unnamed protein product                              73.9    4e-14   Coffea canephora [robusta coffee]
ref|XP_010032593.1|  PREDICTED: uncharacterized protein LOC104422069  73.6    4e-14   
gb|AAO43185.1|  S-adenosylmethionine decarboxylase leader             73.2    6e-14   Narcissus pseudonarcissus
ref|XP_009764780.1|  PREDICTED: uncharacterized protein LOC104216442  73.2    6e-14   Nicotiana sylvestris
gb|KDO58886.1|  hypothetical protein CISIN_1g043845mg                 73.2    7e-14   Citrus sinensis [apfelsine]
ref|XP_011467840.1|  PREDICTED: uncharacterized protein LOC101300...  73.2    7e-14   Fragaria vesca subsp. vesca
ref|XP_006367531.1|  PREDICTED: uncharacterized protein LOC102595876  73.2    7e-14   Solanum tuberosum [potatoes]
ref|XP_010046605.1|  PREDICTED: uncharacterized protein LOC104435580  74.7    8e-14   
gb|ABD96953.1|  hypothetical protein                                  73.6    9e-14   Tarenaya spinosa
ref|XP_010525151.1|  PREDICTED: uncharacterized protein LOC104802999  72.8    9e-14   
ref|XP_006430870.1|  hypothetical protein CICLE_v10013834mg           73.2    1e-13   
ref|XP_011008996.1|  PREDICTED: S-adenosylmethionine decarboxylas...  77.8    1e-13   Populus euphratica
ref|XP_004490298.1|  PREDICTED: S-adenosylmethionine decarboxylas...  77.8    1e-13   
ref|XP_010523528.1|  PREDICTED: uncharacterized protein LOC104801843  72.0    2e-13   
ref|XP_009625495.1|  PREDICTED: S-adenosylmethionine decarboxylas...  77.0    2e-13   
ref|XP_003631339.1|  PREDICTED: S-adenosylmethionine decarboxylas...  77.4    2e-13   
ref|XP_010320542.1|  PREDICTED: S-adenosylmethionine decarboxylas...  77.0    2e-13   
ref|XP_008811188.1|  PREDICTED: uncharacterized protein LOC103722414  71.2    3e-13   
ref|XP_009622585.1|  PREDICTED: uncharacterized protein LOC104113965  74.7    3e-13   
ref|XP_006400121.1|  hypothetical protein EUTSA_v10015839mg           71.2    3e-13   
ref|XP_011021157.1|  PREDICTED: uncharacterized protein LOC105123318  71.2    4e-13   Populus euphratica
emb|CAG28949.1|  S-adenosylmethionine decarboxylase                   74.7    6e-13   Prunus persica
ref|XP_009134672.1|  PREDICTED: uncharacterized protein LOC103858960  70.5    6e-13   
emb|CDY71277.1|  BnaAnng36820D                                        70.5    6e-13   Brassica napus [oilseed rape]
gb|KHG18234.1|  hypothetical protein F383_07278                       70.1    9e-13   Gossypium arboreum [tree cotton]
ref|XP_009403329.1|  PREDICTED: uncharacterized protein LOC103986907  69.7    1e-12   
ref|NP_001118557.1|  conserved peptide upstream open reading frame 9  69.3    2e-12   
ref|XP_011099087.1|  PREDICTED: S-adenosylmethionine decarboxylas...  74.7    2e-12   
ref|XP_004233654.1|  PREDICTED: S-adenosylmethionine decarboxylas...  74.7    2e-12   
ref|XP_008230354.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...  74.7    2e-12   
ref|XP_008461582.1|  PREDICTED: LOW QUALITY PROTEIN: S-adenosylme...  74.3    2e-12   
ref|XP_006845441.1|  hypothetical protein AMTR_s00019p00109600        69.3    2e-12   
emb|CAA69072.1|  S-adenosylmethionine decarboxylase                   69.3    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010277985.1|  PREDICTED: uncharacterized protein LOC104612303  68.9    2e-12   
ref|XP_009118056.1|  PREDICTED: uncharacterized protein LOC103843101  68.9    3e-12   
gb|ACV52080.1|  small uORF                                            68.6    4e-12   Sorghum bicolor [broomcorn]
ref|XP_010656642.1|  PREDICTED: uncharacterized protein LOC104877289  68.2    4e-12   
gb|AGR89930.1|  small-uORF                                            68.2    4e-12   Dendrobium officinale
ref|XP_009618362.1|  PREDICTED: uncharacterized protein LOC104110545  69.7    5e-12   
ref|XP_002462404.1|  hypothetical protein SORBIDRAFT_02g025120        67.8    6e-12   
emb|CBI36591.3|  unnamed protein product                              69.3    8e-12   Vitis vinifera
ref|XP_009121533.1|  PREDICTED: uncharacterized protein LOC103846371  67.4    8e-12   
emb|CDX69488.1|  BnaA10g18370D                                        67.4    8e-12   
gb|AGT16272.1|  S-adenosylmethionine decarboxylase leader             67.4    8e-12   Saccharum hybrid cultivar R570
ref|XP_010492456.1|  PREDICTED: uncharacterized protein LOC104769843  67.4    9e-12   
ref|XP_010420277.1|  PREDICTED: uncharacterized protein LOC104705883  67.4    9e-12   
ref|XP_010235688.1|  PREDICTED: uncharacterized protein LOC100821031  67.4    9e-12   
ref|XP_009131512.1|  PREDICTED: uncharacterized protein LOC103856173  67.0    1e-11   
ref|XP_010687662.1|  PREDICTED: uncharacterized protein LOC104901756  67.0    1e-11   
gb|EYU37131.1|  hypothetical protein MIMGU_mgv11b021364mg             67.0    1e-11   Erythranthe guttata [common monkey flower]
gb|KGN61071.1|  hypothetical protein Csa_2G036690                     67.0    1e-11   Cucumis sativus [cucumbers]
ref|XP_007216569.1|  hypothetical protein PRUPE_ppb015242mg           67.4    1e-11   
ref|XP_007139350.1|  hypothetical protein PHAVU_008G022200g           66.2    2e-11   Phaseolus vulgaris [French bean]
emb|CDX70665.1|  BnaC03g07490D                                        67.4    2e-11   
emb|CAN76947.1|  hypothetical protein VITISV_017166                   71.6    2e-11   Vitis vinifera
ref|XP_011018088.1|  PREDICTED: uncharacterized protein LOC105121227  66.2    3e-11   Populus euphratica
gb|AAB70462.1|  unknown                                               65.9    3e-11   Dianthus caryophyllus [carnation]
gb|KCW52008.1|  hypothetical protein EUGRSUZ_J01448                   67.4    4e-11   Eucalyptus grandis [rose gum]
gb|KDO62316.1|  hypothetical protein CISIN_1g041001mg                 65.1    7e-11   Citrus sinensis [apfelsine]
ref|XP_010691991.1|  PREDICTED: uncharacterized protein LOC104905226  64.7    8e-11   
ref|XP_008793522.1|  PREDICTED: uncharacterized protein LOC103709801  64.3    9e-11   
gb|ABR87869.1|  S-adenosylmethionine decarboxylase uORF               64.3    1e-10   Saccharum hybrid cultivar FN-1702
ref|XP_002452432.1|  hypothetical protein SORBIDRAFT_04g025710        64.3    1e-10   
ref|NP_001118697.1|  conserved peptide upstream open reading fram...  64.3    1e-10   
gb|KEH16883.1|  S-adenosyl-L-methionine decarboxylase leader pept...  63.9    1e-10   Medicago truncatula
ref|XP_010238180.1|  PREDICTED: S-adenosylmethionine decarboxylas...  68.6    2e-10   
ref|XP_004491769.1|  PREDICTED: uncharacterized protein LOC101491421  64.3    2e-10   
ref|NP_001119232.1|  conserved peptide upstream open reading fram...  63.2    3e-10   
ref|XP_008452459.1|  PREDICTED: S-adenosylmethionine decarboxylas...  68.2    3e-10   Cucumis melo [Oriental melon]
ref|XP_010091688.1|  hypothetical protein L484_026543                 63.9    3e-10   
ref|XP_004144715.1|  PREDICTED: S-adenosylmethionine decarboxylas...  67.8    3e-10   
ref|XP_004163988.1|  PREDICTED: S-adenosylmethionine decarboxylas...  67.8    3e-10   
gb|ADD70011.1|  small uORF                                            62.0    6e-10   Leymus chinensis
gb|ADD70014.1|  small uORF                                            62.0    6e-10   Leymus chinensis
ref|XP_009401296.1|  PREDICTED: S-adenosylmethionine decarboxylas...  67.0    7e-10   
ref|XP_006437789.1|  hypothetical protein CICLE_v10033607mg           67.0    7e-10   
ref|XP_008808772.1|  PREDICTED: S-adenosylmethionine decarboxylas...  66.6    8e-10   
ref|XP_004976106.1|  PREDICTED: S-adenosylmethionine decarboxylas...  66.2    1e-09   Setaria italica
ref|XP_010681339.1|  PREDICTED: uncharacterized protein LOC104896306  60.5    2e-09   
gb|EAY94718.1|  hypothetical protein OsI_16495                        65.1    3e-09   Oryza sativa Indica Group [Indian rice]
emb|CAD41510.3|  OSJNBa0029H02.4                                      65.1    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008652738.1|  PREDICTED: S-adenosylmethionine decarboxylas...  64.7    4e-09   
ref|XP_009410240.1|  PREDICTED: tetraspanin-15-like                   63.5    6e-09   
ref|XP_011467841.1|  PREDICTED: S-adenosylmethionine decarboxylas...  63.9    7e-09   Fragaria vesca subsp. vesca
ref|XP_010047048.1|  PREDICTED: S-adenosylmethionine decarboxylas...  63.9    7e-09   Eucalyptus grandis [rose gum]
ref|XP_010660529.1|  PREDICTED: S-adenosylmethionine decarboxylas...  63.5    8e-09   
ref|XP_009588870.1|  PREDICTED: S-adenosylmethionine decarboxylas...  63.2    1e-08   
ref|XP_007033428.1|  S-adenosylmethionine decarboxylase proenzyme...  62.8    2e-08   
ref|XP_010240071.1|  PREDICTED: S-adenosylmethionine decarboxylas...  62.8    2e-08   
ref|XP_010257836.1|  PREDICTED: S-adenosylmethionine decarboxylas...  62.4    2e-08   
gb|EPS67756.1|  hypothetical protein M569_07018                       62.0    3e-08   Genlisea aurea
gb|EEC84597.1|  hypothetical protein OsI_31420                        58.5    3e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_009801145.1|  PREDICTED: S-adenosylmethionine decarboxylas...  61.6    4e-08   Nicotiana sylvestris
ref|XP_002446739.1|  hypothetical protein SORBIDRAFT_06g021530        57.4    8e-08   
emb|CDY71710.1|  BnaAnng38530D                                        60.5    9e-08   Brassica napus [oilseed rape]
emb|CDY43235.1|  BnaC05g48280D                                        60.8    9e-08   Brassica napus [oilseed rape]
ref|XP_006453538.1|  hypothetical protein CICLE_v10010716mg           55.8    2e-07   
gb|EAY86651.1|  hypothetical protein OsI_08032                        58.9    4e-07   Oryza sativa Indica Group [Indian rice]
gb|EEE57355.1|  hypothetical protein OsJ_07492                        58.5    4e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDY54323.1|  BnaCnng26690D                                        55.5    5e-07   Brassica napus [oilseed rape]
emb|CDX85819.1|  BnaC06g23150D                                        55.5    5e-07   
emb|CDY33352.1|  BnaC05g12310D                                        54.7    1e-06   Brassica napus [oilseed rape]
gb|EMT07332.1|  S-adenosylmethionine decarboxylase proenzyme          55.8    4e-06   
emb|CDX99815.1|  BnaC05g22370D                                        53.9    4e-06   
gb|EMS50405.1|  S-adenosylmethionine decarboxylase proenzyme          55.5    4e-06   Triticum urartu
emb|CDY17081.1|  BnaC06g00140D                                        53.5    5e-06   Brassica napus [oilseed rape]
ref|XP_001776461.1|  predicted protein                                51.2    8e-06   
gb|KEH21806.1|  S-adenosylmethionine decarboxylase proenzyme          54.3    1e-05   Medicago truncatula
emb|CDY63462.1|  BnaCnng42170D                                        52.0    1e-05   Brassica napus [oilseed rape]
ref|XP_002992113.1|  hypothetical protein SELMODRAFT_134748           50.8    1e-05   
ref|XP_002977118.1|  hypothetical protein SELMODRAFT_106275           50.8    1e-05   
gb|KEH17677.1|  S-adenosylmethionine decarboxylase proenzyme          53.5    2e-05   Medicago truncatula
gb|KEH21807.1|  S-adenosylmethionine decarboxylase proenzyme          52.4    4e-05   Medicago truncatula



>ref|XP_007221770.1| hypothetical protein PRUPE_ppb024585mg, partial [Prunus persica]
 gb|EMJ22969.1| hypothetical protein PRUPE_ppb024585mg, partial [Prunus persica]
Length=66

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  243  NELMEskggkkkssssksLFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            N+LMESKGGKK SSSSKSLFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  13   NDLMESKGGKKNSSSSKSLFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  66



>gb|AAN03493.1|AF291761_1 uORF [Ipomoea batatas]
Length=51

 Score = 78.2 bits (191),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS
Sbjct  16   LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  51



>gb|ABR13282.1| putative S-adenosylmethionine decarboxylase [Prunus dulcis]
Length=56

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  243  NELMEskggkkkssssksLFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            NELMESKGGKKKSSSSKSLFYEAPLGY++EDVRP+GGIKKFRSAAYSNC RKPS
Sbjct  3    NELMESKGGKKKSSSSKSLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVRKPS  56



>ref|XP_010100906.1| hypothetical protein L484_009676 [Morus notabilis]
 gb|EXB85830.1| hypothetical protein L484_009676 [Morus notabilis]
Length=75

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  243  NELMEskggkkkssssksLFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            NELMESKGGKKKSSSSKSLFYEAPLGY++EDVRP GGIKKFRSAAYSNC RKPS
Sbjct  22   NELMESKGGKKKSSSSKSLFYEAPLGYSIEDVRPAGGIKKFRSAAYSNCVRKPS  75



>gb|AAR84407.1| S-adenosylmethionine decarboxylase uORF [Daucus carota]
Length=53

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGGIKKFRSAAYSNCARKPS
Sbjct  18   LFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS  53



>gb|EPS62260.1| hypothetical protein M569_12533 [Genlisea aurea]
Length=50

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGGIKKFRSAAYSNCARKPS
Sbjct  15   LFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS  50



>gb|AAC48988.1| putative [Catharanthus roseus]
 gb|KJB30426.1| hypothetical protein B456_005G149200 [Gossypium raimondii]
Length=51

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGGIKKFRSAAYSNCARKPS
Sbjct  16   LFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS  51



>ref|XP_006573200.1| PREDICTED: uncharacterized protein LOC102664135 [Glycine max]
Length=53

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGGIKKFRSAAYSNCARKPS
Sbjct  18   LFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS  53



>ref|XP_011077607.1| PREDICTED: uncharacterized protein LOC105161571 [Sesamum indicum]
Length=51

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  16   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  51



>ref|XP_011008987.1| PREDICTED: uncharacterized protein LOC105114203 isoform X1 [Populus 
euphratica]
Length=51

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  16   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  51



>ref|XP_011462958.1| PREDICTED: uncharacterized protein LOC101290852 [Fragaria vesca 
subsp. vesca]
Length=50

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  15   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  50



>ref|XP_006484362.1| PREDICTED: uncharacterized protein LOC102608541 [Citrus sinensis]
 emb|CDP00522.1| unnamed protein product [Coffea canephora]
Length=51

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  16   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  51



>ref|XP_008389351.1| PREDICTED: uncharacterized protein LOC103451712 [Malus domestica]
 ref|XP_008360071.1| PREDICTED: uncharacterized protein LOC103423770 [Malus domestica]
Length=53

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  18   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  53



>ref|XP_007153541.1| hypothetical protein PHAVU_003G044300g [Phaseolus vulgaris]
 gb|AAW56945.1| putative SAMDC uORF [Phaseolus vulgaris]
 gb|ESW25535.1| hypothetical protein PHAVU_003G044300g [Phaseolus vulgaris]
Length=53

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  18   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  53



>ref|XP_006348616.1| PREDICTED: uncharacterized protein LOC102601388 [Solanum tuberosum]
Length=51

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGG+KKFRSAAYSNCARKPS
Sbjct  16   LFYEAPLGYSIEDVRPNGGVKKFRSAAYSNCARKPS  51



>ref|XP_009356497.1| PREDICTED: uncharacterized protein LOC103947321 [Pyrus x bretschneideri]
Length=54

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  19   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  54



>ref|XP_008339773.1| PREDICTED: uncharacterized protein LOC103402794 [Malus domestica]
 ref|XP_008352944.1| PREDICTED: uncharacterized protein LOC103416480 [Malus domestica]
Length=54

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  19   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  54



>gb|AAB03864.1| putative ORF; conserved in 5' leaders of plant SAMdC [Pisum sativum]
Length=54

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  19   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  54



>ref|XP_010549938.1| PREDICTED: uncharacterized protein LOC104820958 [Tarenaya hassleriana]
Length=52

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGGIKKFRSAAYSNCA+KPS
Sbjct  17   LFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCAKKPS  52



>gb|EYU44270.1| hypothetical protein MIMGU_mgv11b021951mg [Erythranthe guttata]
Length=50

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            +FYEAPLGY++EDVRPNGGIKKFRSAAYSNCARKPS
Sbjct  15   VFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS  50



>gb|KGN57742.1| hypothetical protein Csa_3G271350 [Cucumis sativus]
Length=92

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 3/67 (4%)
 Frame = +3

Query  213  TSFIFHIDLCNELMEskggkkkssssks---LFYEAPLGYTVEDVRPNGGIKKFRSAAYS  383
            T F+  + + N+LMESKGGKKKSSSS S   LFYEAPLGY++EDVRP+GGIKKFRSAAYS
Sbjct  26   TDFLHFVFIANDLMESKGGKKKSSSSSSSKSLFYEAPLGYSIEDVRPHGGIKKFRSAAYS  85

Query  384  NCARKPS  404
            NC RKPS
Sbjct  86   NCVRKPS  92



>gb|AAR84409.1| S-adenosylmethionine decarboxylase uORF [Daucus carota]
Length=53

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
             FYEAPLGY++EDVRPNGGIKKFRSAAYSNCARKPS
Sbjct  18   FFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS  53



>ref|XP_006338298.1| PREDICTED: uncharacterized protein LOC102589377 isoform X1 [Solanum 
tuberosum]
 ref|XP_006338299.1| PREDICTED: uncharacterized protein LOC102589377 isoform X2 [Solanum 
tuberosum]
Length=50

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGYT+EDVRPNGGIKKFRSAAYSNC RKPS
Sbjct  15   LCYEAPLGYTIEDVRPNGGIKKFRSAAYSNCTRKPS  50



>emb|CDP02380.1| unnamed protein product [Coffea canephora]
Length=51

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP GGIKKFRSAAYSNCARKPS
Sbjct  16   LFYEAPLGYSIEDVRPAGGIKKFRSAAYSNCARKPS  51



>ref|XP_010032593.1| PREDICTED: uncharacterized protein LOC104422069 [Eucalyptus grandis]
Length=51

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RP+GGIKKFRSAAYSNCARKPS
Sbjct  16   LFYEAPLGYSIEDLRPHGGIKKFRSAAYSNCARKPS  51



>gb|AAO43185.1| S-adenosylmethionine decarboxylase leader [Narcissus pseudonarcissus]
Length=51

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            + YEAPLGY++EDVRPNGGIKKFRSAAYSNCARKPS
Sbjct  16   MQYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS  51



>ref|XP_009764780.1| PREDICTED: uncharacterized protein LOC104216442 [Nicotiana sylvestris]
Length=50

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGYT+EDVRPNGGIKKFRSAAYSNC RKPS
Sbjct  15   LCYEAPLGYTIEDVRPNGGIKKFRSAAYSNCTRKPS  50



>gb|KDO58886.1| hypothetical protein CISIN_1g043845mg, partial [Citrus sinensis]
Length=56

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP+GGIKKFRSAAYSNC RKPS
Sbjct  21   LFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVRKPS  56



>ref|XP_011467840.1| PREDICTED: uncharacterized protein LOC101300649 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=52

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP+GGIKKFRSAAYSNC RKPS
Sbjct  17   LFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVRKPS  52



>ref|XP_006367531.1| PREDICTED: uncharacterized protein LOC102595876 [Solanum tuberosum]
 ref|XP_010325105.1| PREDICTED: uncharacterized protein LOC104644291 [Solanum lycopersicum]
Length=49

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  300  FYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
             YEAPLGY++EDVRPNGGIKKFRSAAYSNCARKPS
Sbjct  15   LYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS  49



>ref|XP_010046605.1| PREDICTED: uncharacterized protein LOC104435580, partial [Eucalyptus 
grandis]
Length=115

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = +3

Query  231  IDLCNELMEskggkkkssssksLFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            +   N+LMESKGGKK SSS  S FYEAPLGY +EDVRPNGGIKKFRSAAYSNC RKPS
Sbjct  59   LKRLNDLMESKGGKKMSSSKPS-FYEAPLGYRIEDVRPNGGIKKFRSAAYSNCVRKPS  115



>gb|ABD96953.1| hypothetical protein [Cleome spinosa]
Length=78

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP+GGIKKFRSAAYSNCA++PS
Sbjct  43   LFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCAKRPS  78



>ref|XP_010525151.1| PREDICTED: uncharacterized protein LOC104802999 [Tarenaya hassleriana]
Length=52

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 52/52 (100%), Gaps = 0/52 (0%)
 Frame = +3

Query  249  LMEskggkkkssssksLFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            +MESKGGKKKSSSSK+LFYEAPLGY++EDVRP+GGIKKFRSAAYSNCA++PS
Sbjct  1    MMESKGGKKKSSSSKTLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCAKRPS  52



>ref|XP_006430870.1| hypothetical protein CICLE_v10013834mg [Citrus clementina]
 gb|ESR44110.1| hypothetical protein CICLE_v10013834mg [Citrus clementina]
Length=72

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP+GGIKKFRSAAYSNC RKPS
Sbjct  37   LFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVRKPS  72



>ref|XP_011008996.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Populus euphratica]
Length=406

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  16   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  51



>ref|XP_004490298.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X1 [Cicer arietinum]
Length=411

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  21   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  56



>ref|XP_010523528.1| PREDICTED: uncharacterized protein LOC104801843 [Tarenaya hassleriana]
Length=54

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGGIKKFRSAAYSN  RKPS
Sbjct  19   LFYEAPLGYSIEDVRPNGGIKKFRSAAYSNITRKPS  54



>ref|XP_009625495.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Nicotiana 
tomentosiformis]
Length=402

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGG+KKFRSAAYSNCARKPS
Sbjct  15   LFYEAPLGYSIEDVRPNGGVKKFRSAAYSNCARKPS  50



>ref|XP_003631339.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X2 [Vitis vinifera]
Length=410

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSNCARKPS
Sbjct  15   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS  50



>ref|XP_010320542.1| PREDICTED: S-adenosylmethionine decarboxylase isoform X1 [Solanum 
lycopersicum]
Length=409

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGG+KKFRSAAYSNCARKPS
Sbjct  16   LFYEAPLGYSIEDVRPNGGVKKFRSAAYSNCARKPS  51



>ref|XP_008811188.1| PREDICTED: uncharacterized protein LOC103722414 [Phoenix dactylifera]
Length=49

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY++ED+RP+GGIK+FRSAAYSNCARKPS
Sbjct  14   LHYEAPLGYSIEDIRPHGGIKRFRSAAYSNCARKPS  49



>ref|XP_009622585.1| PREDICTED: uncharacterized protein LOC104113965 [Nicotiana tomentosiformis]
Length=217

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGYT+EDVRPNGGIKKFRSAAYSNC RKPS
Sbjct  182  LCYEAPLGYTIEDVRPNGGIKKFRSAAYSNCTRKPS  217



>ref|XP_006400121.1| hypothetical protein EUTSA_v10015839mg [Eutrema salsugineum]
 gb|ESQ41574.1| hypothetical protein EUTSA_v10015839mg [Eutrema salsugineum]
Length=50

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGGIKKF+S+ YSNCA++PS
Sbjct  15   LFYEAPLGYSIEDVRPNGGIKKFKSSVYSNCAKRPS  50



>ref|XP_011021157.1| PREDICTED: uncharacterized protein LOC105123318 [Populus euphratica]
Length=52

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED+RP GGIKKFRSAAYSNC RKPS
Sbjct  17   LFYEAPLGYSIEDLRPAGGIKKFRSAAYSNCVRKPS  52



>emb|CAG28949.1| S-adenosylmethionine decarboxylase [Prunus persica]
Length=309

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP+GGIKKFRSAAYSNC RKPS
Sbjct  16   LFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVRKPS  51



>ref|XP_009134672.1| PREDICTED: uncharacterized protein LOC103858960 [Brassica rapa]
 ref|XP_009147350.1| PREDICTED: uncharacterized protein LOC103870912 [Brassica rapa]
 ref|XP_010463656.1| PREDICTED: uncharacterized protein LOC104744323 [Camelina sativa]
 gb|ADG57790.1| S-adenosyl-l-methionine decarboxylase 3-1 leader peptide [Brassica 
napus]
 gb|ADG57792.1| S-adenosyl-l-methionine decarboxylase 3-2 leader peptide [Brassica 
napus]
 emb|CDY57535.1| BnaA05g33520D [Brassica napus]
 emb|CDX91991.1| BnaC03g32930D [Brassica napus]
 emb|CDX74258.1| BnaA03g27890D [Brassica napus]
Length=52

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGGIKKF+S+ YSNCA++PS
Sbjct  17   LFYEAPLGYSIEDVRPNGGIKKFKSSVYSNCAKRPS  52



>emb|CDY71277.1| BnaAnng36820D [Brassica napus]
 emb|CDY34731.1| BnaA01g32940D [Brassica napus]
Length=53

 Score = 70.5 bits (171),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGGIKKF+S+ YSNCA++PS
Sbjct  18   LFYEAPLGYSIEDVRPNGGIKKFKSSVYSNCAKRPS  53



>gb|KHG18234.1| hypothetical protein F383_07278 [Gossypium arboreum]
Length=52

 Score = 70.1 bits (170),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY++ED+RPNGGI+KFRSAAYSNC RKPS
Sbjct  17   LQYEAPLGYSIEDIRPNGGIEKFRSAAYSNCVRKPS  52



>ref|XP_009403329.1| PREDICTED: uncharacterized protein LOC103986907 [Musa acuminata 
subsp. malaccensis]
Length=52

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY++EDVRP+GGIKKF+SAAYSNC RKPS
Sbjct  17   LHYEAPLGYSIEDVRPHGGIKKFQSAAYSNCVRKPS  52



>ref|NP_001118557.1| conserved peptide upstream open reading frame 9  [Arabidopsis 
thaliana]
 gb|AEE73815.1| uncharacterized protein AT3G02468 [Arabidopsis thaliana]
Length=52

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGGIKKF+S+ YSNC+++PS
Sbjct  17   LFYEAPLGYSIEDVRPNGGIKKFKSSVYSNCSKRPS  52



>ref|XP_011099087.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Sesamum indicum]
Length=410

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP+GGIKKFRSAAYSNC RKPS
Sbjct  16   LFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVRKPS  51



>ref|XP_004233654.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Solanum 
lycopersicum]
Length=417

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGYT+EDVRPNGGIKKFRSAAYSNC RKPS
Sbjct  15   LCYEAPLGYTIEDVRPNGGIKKFRSAAYSNCTRKPS  50



>ref|XP_008230354.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme-like [Prunus mume]
Length=426

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP+GGIKKFRSAAYSNC RKPS
Sbjct  16   LFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVRKPS  51



>ref|XP_008461582.1| PREDICTED: LOW QUALITY PROTEIN: S-adenosylmethionine decarboxylase 
proenzyme-like [Cucumis melo]
Length=418

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP+GGIKKFRSAAYSNC RKPS
Sbjct  18   LFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVRKPS  53



>ref|XP_006845441.1| hypothetical protein AMTR_s00019p00109600 [Amborella trichopoda]
 gb|ERN07116.1| hypothetical protein AMTR_s00019p00109600 [Amborella trichopoda]
Length=51

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +3

Query  252  MEskggkkkssssksLFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            MESKGG KK SSS S FYEAPLGY++EDVRP+GGI+KFR+AAYSNC RKPS
Sbjct  1    MESKGGLKKKSSSNSRFYEAPLGYSIEDVRPHGGIEKFRTAAYSNCVRKPS  51



>emb|CAA69072.1| S-adenosylmethionine decarboxylase [Arabidopsis thaliana]
Length=51

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRPNGGIKKF+S+ YSNC+++PS
Sbjct  16   LFYEAPLGYSIEDVRPNGGIKKFKSSVYSNCSKRPS  51



>ref|XP_010277985.1| PREDICTED: uncharacterized protein LOC104612303 [Nelumbo nucifera]
Length=50

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YE PLGY++EDVRPNGGI+KFRSAAYSNC RKPS
Sbjct  15   LQYEVPLGYSIEDVRPNGGIEKFRSAAYSNCVRKPS  50



>ref|XP_009118056.1| PREDICTED: uncharacterized protein LOC103843101 [Brassica rapa]
Length=53

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++ED RPNGGIKKF+S+ YSNCA++PS
Sbjct  18   LFYEAPLGYSIEDARPNGGIKKFKSSVYSNCAKRPS  53



>gb|ACV52080.1| small uORF [Sorghum bicolor]
 gb|ACV52084.1| small uORF [Sorghum bicolor]
Length=50

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            + YEAPLGY++EDVRP GG+KKF+SAAYSNCA+KPS
Sbjct  15   MMYEAPLGYSIEDVRPAGGVKKFQSAAYSNCAKKPS  50



>ref|XP_010656642.1| PREDICTED: uncharacterized protein LOC104877289 [Vitis vinifera]
Length=51

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YE PLGY +EDVRPNGGI+KFRSAAYSNC RKPS
Sbjct  16   LQYEVPLGYIIEDVRPNGGIEKFRSAAYSNCVRKPS  51



>gb|AGR89930.1| small-uORF [Dendrobium catenatum]
Length=50

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YE PLGY++EDVRP+GG+KKF+SAAYSNCARKPS
Sbjct  15   LQYEVPLGYSIEDVRPHGGVKKFQSAAYSNCARKPS  50



>ref|XP_009618362.1| PREDICTED: uncharacterized protein LOC104110545, partial [Nicotiana 
tomentosiformis]
Length=123

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            YEAPLGY +EDVRPNGGI+KFRSAAYSNC RKPS
Sbjct  90   YEAPLGYIIEDVRPNGGIEKFRSAAYSNCVRKPS  123



>ref|XP_002462404.1| hypothetical protein SORBIDRAFT_02g025120 [Sorghum bicolor]
 gb|EER98925.1| hypothetical protein SORBIDRAFT_02g025120 [Sorghum bicolor]
 gb|ACV52077.1| small uORF [Sorghum bicolor]
 gb|ACV52087.1| small uORF [Sorghum bicolor]
Length=49

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
              YEAPLGY +EDVRP GGIKKF+SAAYSNCARKPS
Sbjct  14   FMYEAPLGYKIEDVRPAGGIKKFQSAAYSNCARKPS  49



>emb|CBI36591.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            YE PLGY +EDVRPNGGI+KFRSAAYSNC RKPS
Sbjct  102  YEVPLGYIIEDVRPNGGIEKFRSAAYSNCVRKPS  135



>ref|XP_009121533.1| PREDICTED: uncharacterized protein LOC103846371 [Brassica rapa]
 emb|CDY26477.1| BnaC09g41910D [Brassica napus]
Length=52

 Score = 67.4 bits (163),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY++EDVRPNGGIKKF+S+ YSNCA++PS
Sbjct  17   LCYEAPLGYSIEDVRPNGGIKKFKSSVYSNCAKRPS  52



>emb|CDX69488.1| BnaA10g18370D [Brassica napus]
Length=53

 Score = 67.4 bits (163),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY++EDVRPNGGIKKF+S+ YSNCA++PS
Sbjct  18   LCYEAPLGYSIEDVRPNGGIKKFKSSVYSNCAKRPS  53



>gb|AGT16272.1| S-adenosylmethionine decarboxylase leader [Saccharum hybrid cultivar 
R570]
Length=50

 Score = 67.4 bits (163),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            + YEAPLGY+ EDVRP GG+KKF+SAAYSNCA+KPS
Sbjct  15   MMYEAPLGYSTEDVRPAGGVKKFQSAAYSNCAKKPS  50



>ref|XP_010492456.1| PREDICTED: uncharacterized protein LOC104769843 [Camelina sativa]
Length=51

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP GGIKKF+S+ YSNCA++PS
Sbjct  16   LFYEAPLGYSIEDVRPFGGIKKFKSSVYSNCAKRPS  51



>ref|XP_010420277.1| PREDICTED: uncharacterized protein LOC104705883 [Camelina sativa]
 ref|XP_010453745.1| PREDICTED: uncharacterized protein LOC104735621 [Camelina sativa]
Length=51

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP GGIKKF+S+ YSNCA++PS
Sbjct  16   LFYEAPLGYSIEDVRPFGGIKKFKSSVYSNCAKRPS  51



>ref|XP_010235688.1| PREDICTED: uncharacterized protein LOC100821031 [Brachypodium 
distachyon]
Length=51

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY +ED+RP GGI+KFRSAAYSNC+RKPS
Sbjct  16   LMYEAPLGYCIEDLRPAGGIEKFRSAAYSNCSRKPS  51



>ref|XP_009131512.1| PREDICTED: uncharacterized protein LOC103856173 [Brassica rapa]
 emb|CDX78665.1| BnaA03g05770D [Brassica napus]
Length=50

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP GGIKKF+S+ YSNCA++PS
Sbjct  15   LFYEAPLGYSIEDVRPFGGIKKFKSSVYSNCAKRPS  50



>ref|XP_010687662.1| PREDICTED: uncharacterized protein LOC104901756 [Beta vulgaris 
subsp. vulgaris]
Length=52

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            + YEAPL Y +EDVRPNGGI+KFRSAAYSNC RKPS
Sbjct  17   IHYEAPLDYIIEDVRPNGGIEKFRSAAYSNCVRKPS  52



>gb|EYU37131.1| hypothetical protein MIMGU_mgv11b021364mg, partial [Erythranthe 
guttata]
Length=59

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  243  NELMEskggkkkssssksLFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            N LME+K GKKKSSSS  + YEAPL YT+EDVRPNGG +KFRS AYSNC RKPS
Sbjct  6    NVLMEAKFGKKKSSSSNRIHYEAPLDYTIEDVRPNGGTEKFRSVAYSNCERKPS  59



>gb|KGN61071.1| hypothetical protein Csa_2G036690 [Cucumis sativus]
Length=57

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            YEAPLGY +EDVRP+GGI+KFRSAAYSNC RKPS
Sbjct  24   YEAPLGYIIEDVRPHGGIEKFRSAAYSNCVRKPS  57



>ref|XP_007216569.1| hypothetical protein PRUPE_ppb015242mg, partial [Prunus persica]
 gb|EMJ17768.1| hypothetical protein PRUPE_ppb015242mg, partial [Prunus persica]
Length=77

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +3

Query  240  CNELMEskggkkkssssksLFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
             NELMESKGGKKKSSSSKSLFYEAPLGY++EDVRP+GGIKKFRSAAYSN
Sbjct  3    LNELMESKGGKKKSSSSKSLFYEAPLGYSIEDVRPHGGIKKFRSAAYSN  51



>ref|XP_007139350.1| hypothetical protein PHAVU_008G022200g [Phaseolus vulgaris]
 gb|ESW11344.1| hypothetical protein PHAVU_008G022200g [Phaseolus vulgaris]
Length=50

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            YE PLGY +EDVRP+GGIKKFRSAAYSNC RKPS
Sbjct  17   YETPLGYIIEDVRPHGGIKKFRSAAYSNCIRKPS  50



>emb|CDX70665.1| BnaC03g07490D [Brassica napus]
Length=105

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LFYEAPLGY++EDVRP GGIKKF+S+ YSNCA++PS
Sbjct  70   LFYEAPLGYSIEDVRPFGGIKKFKSSVYSNCAKRPS  105



>emb|CAN76947.1| hypothetical protein VITISV_017166 [Vitis vinifera]
Length=548

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YE PLGY +EDVRPNGGI+KFRSAAYSNC RKPS
Sbjct  513  LQYEVPLGYIIEDVRPNGGIEKFRSAAYSNCVRKPS  548



>ref|XP_011018088.1| PREDICTED: uncharacterized protein LOC105121227 [Populus euphratica]
Length=53

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            YE PLGY++EDVRPNGGI+KFRSAAYSNC R PS
Sbjct  20   YEVPLGYSIEDVRPNGGIEKFRSAAYSNCVRMPS  53



>gb|AAB70462.1| unknown [Dianthus caryophyllus]
Length=54

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  309  APLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            APLGY++EDVRP GGIKKFRSAAYSNCARKPS
Sbjct  23   APLGYSIEDVRPKGGIKKFRSAAYSNCARKPS  54



>gb|KCW52008.1| hypothetical protein EUGRSUZ_J01448, partial [Eucalyptus grandis]
Length=131

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +3

Query  243  NELMEskggkkkssssksLFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCAR  395
            NELMESKGGKKKSSSSKSLFYEAPLGY++ED+RP+GGIKKFRSAAYSN  R
Sbjct  78   NELMESKGGKKKSSSSKSLFYEAPLGYSIEDLRPHGGIKKFRSAAYSNVCR  128



>gb|KDO62316.1| hypothetical protein CISIN_1g041001mg [Citrus sinensis]
Length=52

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            YE PLGY++EDVRPNGGI+KFRSAAY+NC R PS
Sbjct  19   YEVPLGYSIEDVRPNGGIEKFRSAAYANCVRMPS  52



>ref|XP_010691991.1| PREDICTED: uncharacterized protein LOC104905226 [Beta vulgaris 
subsp. vulgaris]
Length=49

 Score = 64.7 bits (156),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  300  FYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            FYEAPLGY++E VRP+GGIKKFRSAAYSN AR PS
Sbjct  15   FYEAPLGYSIEYVRPHGGIKKFRSAAYSNLARNPS  49



>ref|XP_008793522.1| PREDICTED: uncharacterized protein LOC103709801 [Phoenix dactylifera]
Length=50

 Score = 64.3 bits (155),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YE PLGY++E+VRP GGIKKF SAAYSNC RKPS
Sbjct  15   LQYEVPLGYSIEEVRPKGGIKKFHSAAYSNCTRKPS  50



>gb|ABR87869.1| S-adenosylmethionine decarboxylase uORF [Saccharum hybrid cultivar 
FN-1702]
Length=49

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY++ED+RP GGIKKF SAAYSNCARKPS
Sbjct  15   LMYEAPLGYSIEDLRPAGGIKKF-SAAYSNCARKPS  49



>ref|XP_002452432.1| hypothetical protein SORBIDRAFT_04g025710 [Sorghum bicolor]
 gb|EES05408.1| hypothetical protein SORBIDRAFT_04g025710 [Sorghum bicolor]
Length=51

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY++ED+RP GGIKKF SAAYSNCARKPS
Sbjct  17   LMYEAPLGYSIEDLRPAGGIKKF-SAAYSNCARKPS  51



>ref|NP_001118697.1| conserved peptide upstream open reading frame 11 [Arabidopsis 
thaliana]
 dbj|BAB01328.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77031.1| conserved peptide upstream open reading frame 11 [Arabidopsis 
thaliana]
Length=54

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            LF+EAPL Y++EDVRPNGGIKKFRSAAYSN   KPS
Sbjct  19   LFFEAPLRYSIEDVRPNGGIKKFRSAAYSNITGKPS  54



>gb|KEH16883.1| S-adenosyl-L-methionine decarboxylase leader peptide protein 
[Medicago truncatula]
Length=54

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCA  392
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSN +
Sbjct  19   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNVS  50



>ref|XP_010238180.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Brachypodium distachyon]
Length=432

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  300  FYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
             YEAPLGY +EDVRP GGIKKF+SAAYSNCARKPS
Sbjct  15   MYEAPLGYKIEDVRPAGGIKKFQSAAYSNCARKPS  49



>ref|XP_004491769.1| PREDICTED: uncharacterized protein LOC101491421 [Cicer arietinum]
Length=94

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  243  NELMEskggkkkssssksLFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCA  392
            NELMESKGGKKKSSSSKSL YEAPL YT+EDVRP+GGIKKFRSAAYSN +
Sbjct  34   NELMESKGGKKKSSSSKSLLYEAPLDYTIEDVRPHGGIKKFRSAAYSNVS  83



>ref|NP_001119232.1| conserved peptide upstream open reading frame 10 [Arabidopsis 
thaliana]
 emb|CAB63804.1| Hypothetical protein [Arabidopsis thaliana]
 gb|AED92229.1| conserved peptide upstream open reading frame 10 [Arabidopsis 
thaliana]
Length=51

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY++EDVRP GGIKKF+S+ YSNCA++PS
Sbjct  16   LCYEAPLGYSIEDVRPFGGIKKFKSSVYSNCAKRPS  51



>ref|XP_008452459.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Cucumis melo]
Length=433

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            YEAPLGY +EDVRP+GGI+KFRSAAYSNC RKPS
Sbjct  23   YEAPLGYIIEDVRPHGGIEKFRSAAYSNCVRKPS  56



>ref|XP_010091688.1| hypothetical protein L484_026543 [Morus notabilis]
 gb|EXB44954.1| hypothetical protein L484_026543 [Morus notabilis]
Length=94

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            LFYEAPLGY++ED+RPNGGIKKFRSAAYSN
Sbjct  15   LFYEAPLGYSIEDIRPNGGIKKFRSAAYSN  44



>ref|XP_004144715.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Cucumis sativus]
Length=434

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            YEAPLGY +EDVRP+GGI+KFRSAAYSNC RKPS
Sbjct  24   YEAPLGYIIEDVRPHGGIEKFRSAAYSNCVRKPS  57



>ref|XP_004163988.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Cucumis sativus]
Length=434

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            YEAPLGY +EDVRP+GGI+KFRSAAYSNC RKPS
Sbjct  24   YEAPLGYIIEDVRPHGGIEKFRSAAYSNCVRKPS  57



>gb|ADD70011.1| small uORF [Leymus chinensis]
Length=48

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY++EDVRP GG KKF SAAYSNCA+KPS
Sbjct  14   LMYEAPLGYSIEDVRPAGGAKKF-SAAYSNCAKKPS  48



>gb|ADD70014.1| small uORF [Leymus chinensis]
Length=49

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY++EDVRP GG KKF SAAYSNCA+KPS
Sbjct  15   LMYEAPLGYSIEDVRPAGGAKKF-SAAYSNCAKKPS  49



>ref|XP_009401296.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=439

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS*GP  413
            L YEAPLGY++ED+RP+GGI+KF+SAAYSNC RKPS  P
Sbjct  17   LQYEAPLGYSIEDIRPHGGIEKFQSAAYSNCVRKPSYPP  55



>ref|XP_006437789.1| hypothetical protein CICLE_v10033607mg, partial [Citrus clementina]
 gb|ESR51029.1| hypothetical protein CICLE_v10033607mg, partial [Citrus clementina]
Length=476

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  222  IFHIDLCNELMEskggkkkssssksLFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            IF     N LMESKGGKKKSSSSKSLFYEAPLGY++ED+RPNGGIKKFRSAAYSN
Sbjct  54   IFEQAGLNVLMESKGGKKKSSSSKSLFYEAPLGYSIEDIRPNGGIKKFRSAAYSN  108



>ref|XP_008808772.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Phoenix dactylifera]
Length=435

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS*GP  413
            L YE PLGY++EDVRP+GGIKKF+SAAYSNC RKPS  P
Sbjct  16   LQYEVPLGYSIEDVRPHGGIKKFQSAAYSNCVRKPSYPP  54



>ref|XP_004976106.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Setaria italica]
Length=439

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            + YEAPLGY++EDVRP GG KKF+SAAYSNCA+KPS
Sbjct  15   MMYEAPLGYSIEDVRPAGGEKKFQSAAYSNCAKKPS  50



>ref|XP_010681339.1| PREDICTED: uncharacterized protein LOC104896306 [Beta vulgaris 
subsp. vulgaris]
Length=51

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  312  PLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            PL Y +EDVRP GGIKKFRSAAYSNCARKPS
Sbjct  21   PLDYGIEDVRPKGGIKKFRSAAYSNCARKPS  51



>gb|EAY94718.1| hypothetical protein OsI_16495 [Oryza sativa Indica Group]
Length=450

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 2/43 (5%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS*GPRGFL  425
            L YEAPLGY++EDVRP GG+KKF+SAAYSNC+ +P+  P G L
Sbjct  16   LMYEAPLGYSIEDVRPAGGVKKFQSAAYSNCSDQPA--PMGVL  56



>emb|CAD41510.3| OSJNBa0029H02.4 [Oryza sativa Japonica Group]
 gb|EAZ14251.1| hypothetical protein OsJ_04176 [Oryza sativa Japonica Group]
Length=450

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 2/43 (5%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS*GPRGFL  425
            L YEAPLGY++EDVRP GG+KKF+SAAYSNC+ +P+  P G L
Sbjct  16   LMYEAPLGYSIEDVRPAGGVKKFQSAAYSNCSDQPA--PMGVL  56



>ref|XP_008652738.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Zea mays]
Length=436

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  300  FYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
             YEAPLGY +EDVRP GGIKKF++AAYSNC R+PS
Sbjct  17   MYEAPLGYKIEDVRPAGGIKKFQTAAYSNCVRQPS  51



>ref|XP_009410240.1| PREDICTED: tetraspanin-15-like [Musa acuminata subsp. malaccensis]
Length=347

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YE PLGY++ED+RP+GGIKKF+SAAY NC +KPS
Sbjct  312  LDYEVPLGYSIEDIRPHGGIKKFQSAAYYNCVKKPS  347



>ref|XP_011467841.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=417

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCA  392
            LFYEAPLGY++EDVRP+GGIKKFRSAAYSN A
Sbjct  17   LFYEAPLGYSIEDVRPHGGIKKFRSAAYSNMA  48



>ref|XP_010047048.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Eucalyptus grandis]
Length=470

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKP  401
            L YE PLGY +ED+RPNGG++KFRSAAYS+C RKP
Sbjct  20   LHYEVPLGYCIEDIRPNGGVEKFRSAAYSDCLRKP  54



>ref|XP_010660529.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme isoform 
X2 [Vitis vinifera]
Length=405

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCA  392
            +FYEAPLGY++ED+RPNGGIKKFR+AAYSN A
Sbjct  16   MFYEAPLGYSIEDIRPNGGIKKFRTAAYSNMA  47



>ref|XP_009588870.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana tomentosiformis]
Length=415

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            L YEAPLGY++EDVRPNGGIKKFRSAAYSN
Sbjct  14   LLYEAPLGYSIEDVRPNGGIKKFRSAAYSN  43



>ref|XP_007033428.1| S-adenosylmethionine decarboxylase proenzyme isoform 1 [Theobroma 
cacao]
 gb|EOY04354.1| S-adenosylmethionine decarboxylase proenzyme isoform 1 [Theobroma 
cacao]
Length=417

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            LFYEAPLGY++EDVRP+GGIKKFRSAAYSN
Sbjct  16   LFYEAPLGYSIEDVRPHGGIKKFRSAAYSN  45



>ref|XP_010240071.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Brachypodium 
distachyon]
Length=439

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS  404
            L YEAPLGY++EDVRP GG KKF SAAYSNCA+KPS
Sbjct  15   LMYEAPLGYSIEDVRPAGGAKKF-SAAYSNCAKKPS  49



>ref|XP_010257836.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Nelumbo 
nucifera]
Length=405

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKPS*GPRGF  422
            LFYEAPLGY++EDVRP+GGIKKFRSAAYSN     S    GF
Sbjct  14   LFYEAPLGYSIEDVRPHGGIKKFRSAAYSNAEMALSASAIGF  55



>gb|EPS67756.1| hypothetical protein M569_07018, partial [Genlisea aurea]
Length=411

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            +FYEAPLGY +EDVRPNGGIKKFRSAAYSN
Sbjct  17   IFYEAPLGYCIEDVRPNGGIKKFRSAAYSN  46



>gb|EEC84597.1| hypothetical protein OsI_31420 [Oryza sativa Indica Group]
Length=95

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCARK  398
            YEAPLGY +EDVRP GGIKKF+SAAYSN + K
Sbjct  17   YEAPLGYKIEDVRPAGGIKKFQSAAYSNVSTK  48



>ref|XP_009801145.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like 
[Nicotiana sylvestris]
Length=416

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            L YEAPLGY++EDVRPNGGIKKFRSAAYSN
Sbjct  14   LPYEAPLGYSIEDVRPNGGIKKFRSAAYSN  43



>ref|XP_002446739.1| hypothetical protein SORBIDRAFT_06g021530 [Sorghum bicolor]
 gb|EES11067.1| hypothetical protein SORBIDRAFT_06g021530 [Sorghum bicolor]
Length=92

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            + YEAPLGY++EDVRP GG+KKF+SAAYSN
Sbjct  15   MMYEAPLGYSIEDVRPAGGVKKFQSAAYSN  44



>emb|CDY71710.1| BnaAnng38530D [Brassica napus]
Length=429

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            LFYEAPLGY++EDVRPNGGIKKF+S+ YSN
Sbjct  18   LFYEAPLGYSIEDVRPNGGIKKFKSSVYSN  47



>emb|CDY43235.1| BnaC05g48280D [Brassica napus]
Length=463

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            LFYEAPLGY++EDVRPNGGIKKF+S+ YSN
Sbjct  46   LFYEAPLGYSIEDVRPNGGIKKFKSSVYSN  75



>ref|XP_006453538.1| hypothetical protein CICLE_v10010716mg, partial [Citrus clementina]
 gb|ESR66778.1| hypothetical protein CICLE_v10010716mg, partial [Citrus clementina]
Length=66

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            YE PLGY++EDVRPNGGI+KFRSAAY+N
Sbjct  37   YEVPLGYSIEDVRPNGGIEKFRSAAYAN  64



>gb|EAY86651.1| hypothetical protein OsI_08032 [Oryza sativa Indica Group]
Length=646

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            L YEAPLGY++ED+RP GGIKKFRSAAYSN
Sbjct  17   LMYEAPLGYSIEDLRPAGGIKKFRSAAYSN  46



>gb|EEE57355.1| hypothetical protein OsJ_07492 [Oryza sativa Japonica Group]
Length=466

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            L YEAPLGY++ED+RP GGIKKFRSAAYSN
Sbjct  17   LMYEAPLGYSIEDLRPAGGIKKFRSAAYSN  46



>emb|CDY54323.1| BnaCnng26690D [Brassica napus]
Length=111

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCAR  395
            LFYEAPLGY++EDVRPNGGIKKF+S +     R
Sbjct  17   LFYEAPLGYSIEDVRPNGGIKKFKSLSTPTALR  49



>emb|CDX85819.1| BnaC06g23150D [Brassica napus]
Length=128

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCAR  395
            LFYEAPLGY++EDVRPNGGIKKF+S +     R
Sbjct  34   LFYEAPLGYSIEDVRPNGGIKKFKSLSTPTALR  66



>emb|CDY33352.1| BnaC05g12310D [Brassica napus]
Length=154

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCAR  395
            LFYEAPLGY++EDVRPNGGIKKF+S +     R
Sbjct  17   LFYEAPLGYSIEDVRPNGGIKKFKSLSTPTALR  49



>gb|EMT07332.1| S-adenosylmethionine decarboxylase proenzyme [Aegilops tauschii]
Length=468

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  300  FYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
             YEAPLGY +EDVRP GGIKKF+SAAYSN
Sbjct  48   MYEAPLGYKIEDVRPAGGIKKFQSAAYSN  76



>emb|CDX99815.1| BnaC05g22370D [Brassica napus]
Length=184

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAA  377
            LFYEAPLGY++EDVRPNGGIKKF+S +
Sbjct  47   LFYEAPLGYSIEDVRPNGGIKKFKSLS  73



>gb|EMS50405.1| S-adenosylmethionine decarboxylase proenzyme [Triticum urartu]
Length=451

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  300  FYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
             YEAPLGY +EDVRP GGIKKF+SAAYSN
Sbjct  14   MYEAPLGYKIEDVRPAGGIKKFQSAAYSN  42



>emb|CDY17081.1| BnaC06g00140D [Brassica napus]
Length=187

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAA  377
            LFYEAPLGY++EDVRPNGGIKKF+S +
Sbjct  50   LFYEAPLGYSIEDVRPNGGIKKFKSLS  76



>ref|XP_001776461.1| predicted protein [Physcomitrella patens]
 gb|EDQ58728.1| predicted protein [Physcomitrella patens]
Length=86

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
            YE+PLGY +EDVRP+GG KK+RSA YSN
Sbjct  16   YESPLGYVIEDVRPHGGSKKYRSAVYSN  43



>gb|KEH21806.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=385

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  300  FYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
             YEAPLGY +EDVRPNGG++KF+SA YSN
Sbjct  18   LYEAPLGYIIEDVRPNGGVEKFKSADYSN  46



>emb|CDY63462.1| BnaCnng42170D [Brassica napus]
Length=154

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  297  LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCAR  395
            LFYEAPLGY++EDV PNGGIKKF+S +     R
Sbjct  17   LFYEAPLGYSIEDVLPNGGIKKFKSLSTPTALR  49



>ref|XP_002992113.1| hypothetical protein SELMODRAFT_134748 [Selaginella moellendorffii]
 gb|EFJ06768.1| hypothetical protein SELMODRAFT_134748 [Selaginella moellendorffii]
Length=82

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCA  392
            YE+PLGY +ED+RP+G I+KFR AAYSN +
Sbjct  17   YESPLGYKIEDIRPDGDIEKFRCAAYSNVS  46



>ref|XP_002977118.1| hypothetical protein SELMODRAFT_106275 [Selaginella moellendorffii]
 gb|EFJ21727.1| hypothetical protein SELMODRAFT_106275 [Selaginella moellendorffii]
Length=82

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  303  YEAPLGYTVEDVRPNGGIKKFRSAAYSNCA  392
            YE+PLGY +ED+RP+G I+KFR AAYSN +
Sbjct  17   YESPLGYKIEDIRPDGDIEKFRCAAYSNVS  46



>gb|KEH17677.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=406

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  300  FYEAPLGYTVEDVRPNGGIKKFRSAAYSNCA  392
             YEAPLGY +EDVRPNGG++KF+S  YSN A
Sbjct  18   LYEAPLGYIIEDVRPNGGVEKFKSPDYSNMA  48



>gb|KEH21807.1| S-adenosylmethionine decarboxylase proenzyme [Medicago truncatula]
Length=356

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  300  FYEAPLGYTVEDVRPNGGIKKFRSAAYSN  386
             YEAPLGY +EDVRPNGG++KF+S  YSN
Sbjct  18   LYEAPLGYIIEDVRPNGGVEKFKSPDYSN  46



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800