BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M18

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592200.1|  PREDICTED: ras-related protein RABH1b              247   2e-79   Nicotiana tomentosiformis
ref|XP_009790571.1|  PREDICTED: ras-related protein RABH1b              247   2e-79   Nicotiana sylvestris
ref|XP_008232300.1|  PREDICTED: ras-related protein RABH1b              246   2e-79   Prunus mume [ume]
ref|XP_004229706.1|  PREDICTED: ras-related protein RABH1b              246   2e-79   Solanum lycopersicum
ref|XP_002281823.1|  PREDICTED: ras-related protein RABH1b              246   2e-79   Vitis vinifera
ref|XP_006354635.1|  PREDICTED: ras-related protein RABH1b-like         246   2e-79   Solanum tuberosum [potatoes]
ref|XP_007218411.1|  hypothetical protein PRUPE_ppa011501mg             246   3e-79   Prunus persica
ref|XP_010559077.1|  PREDICTED: ras-related protein RABH1b              246   3e-79   Tarenaya hassleriana [spider flower]
ref|XP_008369810.1|  PREDICTED: ras-related protein RABH1b              246   3e-79   Malus domestica [apple tree]
ref|XP_006657723.1|  PREDICTED: ras-related protein RABH1b-like         246   3e-79   Oryza brachyantha
ref|XP_010919837.1|  PREDICTED: ras-related protein RABH1b              246   3e-79   Elaeis guineensis
ref|XP_007052416.1|  Ras-related small GTP-binding family protein       246   3e-79   Theobroma cacao [chocolate]
ref|XP_008364780.1|  PREDICTED: ras-related protein RABH1b              246   3e-79   
ref|XP_011093480.1|  PREDICTED: ras-related protein RABH1b              246   4e-79   Sesamum indicum [beniseed]
ref|XP_011469541.1|  PREDICTED: ras-related protein RABH1b              246   4e-79   Fragaria vesca subsp. vesca
ref|XP_002526504.1|  protein with unknown function                      246   4e-79   
ref|XP_009385937.1|  PREDICTED: ras-related protein RABH1b-like         246   4e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390643.1|  PREDICTED: ras-related protein RABH1b-like         246   4e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784703.1|  PREDICTED: ras-related protein RABH1b isofor...    246   4e-79   
ref|XP_008784700.1|  PREDICTED: ras-related protein RABH1b isofor...    245   6e-79   Phoenix dactylifera
ref|XP_010269896.1|  PREDICTED: ras-related protein RABH1b              245   6e-79   
ref|XP_006445482.1|  hypothetical protein CICLE_v10022269mg             245   6e-79   Citrus clementina [clementine]
ref|XP_010661434.1|  PREDICTED: ras-related protein RABH1b              245   9e-79   Vitis vinifera
emb|CDP09376.1|  unnamed protein product                                245   1e-78   Coffea canephora [robusta coffee]
ref|XP_010677218.1|  PREDICTED: ras-related protein RABH1b              244   1e-78   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU40319.1|  hypothetical protein MIMGU_mgv1a013860mg                244   1e-78   Erythranthe guttata [common monkey flower]
ref|NP_001059699.1|  Os07g0496000                                       244   1e-78   
gb|AAA74117.1|  putative                                                244   1e-78   Nicotiana tabacum [American tobacco]
ref|XP_003611426.1|  Ras-related protein Rab-6                          245   1e-78   
ref|XP_010238113.1|  PREDICTED: ras-related protein RABH1b              244   1e-78   Brachypodium distachyon [annual false brome]
ref|XP_009400213.1|  PREDICTED: ras-related protein RABH1b              244   1e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009766624.1|  PREDICTED: ras-related protein RABH1b              244   2e-78   Nicotiana sylvestris
ref|XP_010933532.1|  PREDICTED: ras-related protein RABH1b-like         244   2e-78   Elaeis guineensis
gb|KDO41082.1|  hypothetical protein CISIN_1g028507mg                   243   2e-78   Citrus sinensis [apfelsine]
ref|XP_009604156.1|  PREDICTED: ras-related protein RABH1b-like         244   2e-78   Nicotiana tomentosiformis
ref|XP_011032019.1|  PREDICTED: ras-related protein RABH1b-like         244   2e-78   Populus euphratica
ref|NP_001150271.1|  ras-related protein Rab-6A                         244   2e-78   
gb|KHG03959.1|  Ras-related RABH1b -like protein                        244   2e-78   Gossypium arboreum [tree cotton]
gb|KJB22826.1|  hypothetical protein B456_004G067600                    244   2e-78   Gossypium raimondii
ref|XP_007156617.1|  hypothetical protein PHAVU_002G003500g             244   2e-78   Phaseolus vulgaris [French bean]
ref|XP_002302484.1|  Ras-related GTP-binding family protein             244   2e-78   Populus trichocarpa [western balsam poplar]
gb|AES94384.2|  RAB GTPase-like protein B1C                             244   2e-78   Medicago truncatula
ref|XP_010544549.1|  PREDICTED: ras-related protein RABH1b              244   2e-78   Tarenaya hassleriana [spider flower]
ref|XP_006436829.1|  hypothetical protein CICLE_v10032757mg             244   3e-78   Citrus clementina [clementine]
ref|XP_003517383.1|  PREDICTED: ras-related protein RABH1b-like         244   3e-78   Glycine max [soybeans]
ref|XP_011085344.1|  PREDICTED: ras-related protein RABH1b-like         244   3e-78   Sesamum indicum [beniseed]
ref|XP_002528787.1|  protein with unknown function                      244   3e-78   Ricinus communis
ref|XP_011018653.1|  PREDICTED: ras-related protein RABH1b-like i...    244   3e-78   Populus euphratica
gb|EEC82085.1|  hypothetical protein OsI_26083                          245   3e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_009142275.1|  PREDICTED: ras-related protein RABH1b-like         243   3e-78   Brassica rapa
ref|XP_006294994.1|  hypothetical protein CARUB_v10024066mg             243   4e-78   Capsella rubella
gb|KDP28909.1|  hypothetical protein JCGZ_14680                         243   4e-78   Jatropha curcas
ref|XP_010506389.1|  PREDICTED: ras-related protein RABH1b              243   4e-78   Camelina sativa [gold-of-pleasure]
gb|KFK37266.1|  hypothetical protein AALP_AA4G235100                    243   4e-78   Arabis alpina [alpine rockcress]
gb|EYU42316.1|  hypothetical protein MIMGU_mgv1a013870mg                243   4e-78   Erythranthe guttata [common monkey flower]
ref|XP_006436830.1|  hypothetical protein CICLE_v10032757mg             242   4e-78   
ref|XP_006397642.1|  hypothetical protein EUTSA_v10001633mg             243   4e-78   Eutrema salsugineum [saltwater cress]
gb|KDP45957.1|  hypothetical protein JCGZ_11860                         243   4e-78   Jatropha curcas
gb|EEE67212.1|  hypothetical protein OsJ_24329                          244   4e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004148503.1|  PREDICTED: ras-related protein RABH1b-like         243   4e-78   Cucumis sativus [cucumbers]
ref|XP_008784702.1|  PREDICTED: ras-related protein RABH1b isofor...    243   4e-78   
ref|XP_009133677.1|  PREDICTED: ras-related protein RABH1b-like         243   4e-78   Brassica rapa
ref|NP_181989.1|  Ras-related protein RABH1B                            243   5e-78   Arabidopsis thaliana [mouse-ear cress]
gb|KHG27267.1|  Ras-related RABH1b -like protein                        243   5e-78   Gossypium arboreum [tree cotton]
ref|XP_010941190.1|  PREDICTED: ras-related protein RABH1b-like i...    243   5e-78   Elaeis guineensis
emb|CDX74672.1|  BnaA05g04180D                                          243   5e-78   
ref|XP_007155742.1|  hypothetical protein PHAVU_003G227800g             243   6e-78   Phaseolus vulgaris [French bean]
ref|XP_006485364.1|  PREDICTED: ras-related protein RABH1b-like i...    241   6e-78   Citrus sinensis [apfelsine]
ref|XP_004511760.1|  PREDICTED: ras-related protein RABH1b-like         243   6e-78   Cicer arietinum [garbanzo]
gb|KEH31569.1|  RAB GTPase-like protein B1C                             243   7e-78   Medicago truncatula
ref|XP_010524453.1|  PREDICTED: ras-related protein RABH1b-like         243   7e-78   Tarenaya hassleriana [spider flower]
gb|KJB21703.1|  hypothetical protein B456_004G037900                    241   7e-78   Gossypium raimondii
gb|AFK37167.1|  unknown                                                 243   8e-78   Medicago truncatula
ref|XP_004508989.1|  PREDICTED: ras-related protein RABH1b-like         243   8e-78   Cicer arietinum [garbanzo]
ref|NP_001142363.1|  hypothetical protein                               243   9e-78   Zea mays [maize]
ref|XP_007209608.1|  hypothetical protein PRUPE_ppa011535mg             242   1e-77   Prunus persica
ref|XP_003549965.2|  PREDICTED: ras-related protein RABH1b-like         242   1e-77   Glycine max [soybeans]
gb|EPS71048.1|  hypothetical protein M569_03713                         242   1e-77   Genlisea aurea
ref|XP_011018655.1|  PREDICTED: ras-related protein RABH1b-like i...    241   1e-77   Populus euphratica
ref|NP_001235476.1|  uncharacterized protein LOC100527651               242   2e-77   
ref|XP_009143050.1|  PREDICTED: ras-related protein RABH1b              242   2e-77   Brassica rapa
ref|XP_007156620.1|  hypothetical protein PHAVU_002G003800g             241   2e-77   Phaseolus vulgaris [French bean]
ref|XP_010926288.1|  PREDICTED: ras-related protein RABH1e              241   3e-77   Elaeis guineensis
gb|AFK45067.1|  unknown                                                 241   4e-77   Lotus japonicus
tpg|DAA62790.1|  TPA: hypothetical protein ZEAMMB73_332722              242   5e-77   
ref|XP_003539133.2|  PREDICTED: ras-related protein RABH1b              240   6e-77   Glycine max [soybeans]
gb|KJB44180.1|  hypothetical protein B456_007G238500                    240   6e-77   Gossypium raimondii
gb|KJB21702.1|  hypothetical protein B456_004G037900                    240   6e-77   Gossypium raimondii
ref|XP_009764281.1|  PREDICTED: ras-related protein RABH1e              240   7e-77   Nicotiana sylvestris
gb|KJB44181.1|  hypothetical protein B456_007G238500                    240   7e-77   Gossypium raimondii
gb|ACU20573.1|  unknown                                                 240   7e-77   Glycine max [soybeans]
ref|XP_009593307.1|  PREDICTED: ras-related protein RABH1e              240   8e-77   Nicotiana tomentosiformis
ref|XP_008782142.1|  PREDICTED: ras-related protein RABH1e              240   9e-77   Phoenix dactylifera
ref|XP_006838450.1|  hypothetical protein AMTR_s00002p00134180          240   9e-77   Amborella trichopoda
ref|XP_010916878.1|  PREDICTED: ras-related protein RABH1e-like         239   1e-76   Elaeis guineensis
ref|XP_007047951.1|  RAB GTPase H1E isoform 1                           239   2e-76   
ref|XP_002531261.1|  protein with unknown function                      239   2e-76   Ricinus communis
ref|XP_010025451.1|  PREDICTED: ras-related protein RABH1e              239   2e-76   Eucalyptus grandis [rose gum]
gb|KJB48804.1|  hypothetical protein B456_008G090100                    236   2e-76   Gossypium raimondii
ref|XP_011097570.1|  PREDICTED: ras-related protein RABH1e              239   2e-76   Sesamum indicum [beniseed]
ref|XP_003531349.1|  PREDICTED: ras-related protein RABH1e-like         239   2e-76   Glycine max [soybeans]
gb|KHG04027.1|  Ras-related RABH1e -like protein                        239   2e-76   Gossypium arboreum [tree cotton]
ref|XP_007047952.1|  RAB GTPase H1E isoform 2                           237   3e-76   
ref|XP_009802532.1|  PREDICTED: ras-related protein RABH1e              238   3e-76   Nicotiana sylvestris
ref|XP_003525055.1|  PREDICTED: ras-related protein RABH1e-like         238   3e-76   Glycine max [soybeans]
ref|XP_004235062.1|  PREDICTED: ras-related protein RABH1e-like         238   3e-76   Solanum lycopersicum
gb|KJB48801.1|  hypothetical protein B456_008G090100                    238   4e-76   Gossypium raimondii
ref|XP_011090551.1|  PREDICTED: ras-related protein RABH1e-like         238   5e-76   Sesamum indicum [beniseed]
ref|XP_006355553.1|  PREDICTED: ras-related protein RABH1e-like         238   5e-76   Solanum tuberosum [potatoes]
gb|EPS72171.1|  hypothetical protein M569_02585                         238   5e-76   Genlisea aurea
ref|XP_004240017.1|  PREDICTED: ras-related protein RABH1e              238   5e-76   Solanum lycopersicum
ref|XP_003517384.1|  PREDICTED: ras-related protein RABH1b-like         238   5e-76   
ref|XP_010547607.1|  PREDICTED: ras-related protein RABH1e              238   6e-76   Tarenaya hassleriana [spider flower]
ref|XP_010269260.1|  PREDICTED: ras-related protein RABH1e-like i...    238   6e-76   Nelumbo nucifera [Indian lotus]
gb|KDP46827.1|  hypothetical protein JCGZ_24036                         238   7e-76   Jatropha curcas
ref|XP_004502420.1|  PREDICTED: ras-related protein RABH1e-like         238   7e-76   Cicer arietinum [garbanzo]
ref|XP_002871412.1|  hypothetical protein ARALYDRAFT_487852             238   7e-76   Arabidopsis lyrata subsp. lyrata
gb|KHG28240.1|  Ras-related RABH1b -like protein                        238   7e-76   Gossypium arboreum [tree cotton]
ref|XP_006288665.1|  hypothetical protein CARUB_v10001971mg             238   7e-76   Capsella rubella
ref|NP_196588.3|  ras-related protein RABH1e                            238   7e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006366321.1|  PREDICTED: ras-related protein RABH1e-like         238   7e-76   Solanum tuberosum [potatoes]
ref|XP_010519539.1|  PREDICTED: ras-related protein RABH1e-like         238   7e-76   Tarenaya hassleriana [spider flower]
ref|XP_010267966.1|  PREDICTED: ras-related protein RABH1e              238   8e-76   Nelumbo nucifera [Indian lotus]
gb|AFK47940.1|  unknown                                                 237   8e-76   Lotus japonicus
gb|KHG21500.1|  Ras-related RABH1e -like protein                        237   9e-76   Gossypium arboreum [tree cotton]
gb|EPS66071.1|  hypothetical protein M569_08708                         237   9e-76   Genlisea aurea
ref|XP_007205911.1|  hypothetical protein PRUPE_ppa011539mg             237   1e-75   Prunus persica
gb|KHN44343.1|  Ras-related protein RABH1e                              237   1e-75   Glycine soja [wild soybean]
ref|XP_008234005.1|  PREDICTED: ras-related protein RABH1e              237   1e-75   Prunus mume [ume]
gb|KEH20835.1|  RAB GTPase-like protein B1C                             237   1e-75   Medicago truncatula
gb|KJB40310.1|  hypothetical protein B456_007G060700                    235   1e-75   Gossypium raimondii
ref|XP_009342518.1|  PREDICTED: ras-related protein RABH1e-like         237   1e-75   Pyrus x bretschneideri [bai li]
ref|XP_009340511.1|  PREDICTED: ras-related protein RABH1e              237   1e-75   Pyrus x bretschneideri [bai li]
ref|XP_009404050.1|  PREDICTED: ras-related protein RABH1e              237   1e-75   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP01457.1|  unnamed protein product                                237   1e-75   Coffea canephora [robusta coffee]
ref|XP_010453053.1|  PREDICTED: ras-related protein RABH1e-like         237   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_004288200.1|  PREDICTED: ras-related protein RABH1e              237   1e-75   Fragaria vesca subsp. vesca
ref|XP_008343311.1|  PREDICTED: ras-related protein RABH1e              237   2e-75   
ref|XP_004504075.1|  PREDICTED: ras-related protein RABH1e-like         236   2e-75   Cicer arietinum [garbanzo]
ref|XP_002307084.1|  Ras-related GTP-binding family protein             236   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_006428196.1|  hypothetical protein CICLE_v10026499mg             236   2e-75   Citrus clementina [clementine]
ref|XP_006399521.1|  hypothetical protein EUTSA_v10014689mg             236   2e-75   Eutrema salsugineum [saltwater cress]
gb|KJB48803.1|  hypothetical protein B456_008G090100                    234   2e-75   Gossypium raimondii
ref|XP_010087594.1|  Ras-related protein                                236   2e-75   Morus notabilis
ref|XP_010531376.1|  PREDICTED: ras-related protein RABH1d              236   3e-75   Tarenaya hassleriana [spider flower]
gb|KJB40307.1|  hypothetical protein B456_007G060700                    236   3e-75   Gossypium raimondii
gb|KHG08795.1|  Ras-related RABH1e -like protein                        236   3e-75   Gossypium arboreum [tree cotton]
gb|EYU23989.1|  hypothetical protein MIMGU_mgv1a013931mg                236   3e-75   Erythranthe guttata [common monkey flower]
gb|KFK25343.1|  hypothetical protein AALP_AA8G100400                    236   4e-75   Arabis alpina [alpine rockcress]
ref|XP_004143465.1|  PREDICTED: ras-related protein RABH1e-like         236   4e-75   Cucumis sativus [cucumbers]
gb|EYU23990.1|  hypothetical protein MIMGU_mgv1a013931mg                234   4e-75   Erythranthe guttata [common monkey flower]
ref|XP_002461043.1|  hypothetical protein SORBIDRAFT_02g039720          235   6e-75   Sorghum bicolor [broomcorn]
ref|XP_008670587.1|  PREDICTED: ras-related protein RABH1b-like         235   6e-75   Zea mays [maize]
gb|AES72198.2|  RAB GTPase-like protein B1C                             235   8e-75   Medicago truncatula
ref|XP_010680547.1|  PREDICTED: ras-related protein RABH1e              234   9e-75   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX96987.1|  BnaC09g46380D                                          234   1e-74   
gb|ABK23720.1|  unknown                                                 234   1e-74   Picea sitchensis
ref|XP_003552057.1|  PREDICTED: ras-related protein RABH1e-like         234   1e-74   Glycine max [soybeans]
ref|XP_009122071.1|  PREDICTED: ras-related protein RABH1e              234   2e-74   Brassica rapa
ref|XP_009131149.1|  PREDICTED: ras-related protein RABH1e              234   2e-74   Brassica rapa
ref|XP_009390286.1|  PREDICTED: ras-related protein RABH1e-like         234   2e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002271220.2|  PREDICTED: ras-related protein RABH1e              233   3e-74   Vitis vinifera
gb|KHN31372.1|  Ras-related protein RABH1e                              234   4e-74   Glycine soja [wild soybean]
ref|XP_008795552.1|  PREDICTED: ras-related protein RABH1e              233   5e-74   Phoenix dactylifera
ref|XP_010532473.1|  PREDICTED: ras-related protein RABH1e-like         233   6e-74   Tarenaya hassleriana [spider flower]
gb|AFK44388.1|  unknown                                                 233   7e-74   Medicago truncatula
ref|XP_002968288.1|  rab family GTPase                                  233   7e-74   Selaginella moellendorffii
ref|XP_010941189.1|  PREDICTED: ras-related protein RABH1b-like i...    232   2e-73   Elaeis guineensis
gb|AFK36124.1|  unknown                                                 230   2e-73   Medicago truncatula
ref|XP_006404685.1|  hypothetical protein EUTSA_v10000663mg             231   3e-73   Eutrema salsugineum [saltwater cress]
ref|XP_002878607.1|  predicted protein                                  231   3e-73   Arabidopsis lyrata subsp. lyrata
gb|KFK32828.1|  hypothetical protein AALP_AA6G292500                    231   3e-73   Arabis alpina [alpine rockcress]
emb|CDY23446.1|  BnaC04g49740D                                          242   3e-73   Brassica napus [oilseed rape]
ref|XP_010941191.1|  PREDICTED: ras-related protein RABH1b-like i...    229   5e-73   Elaeis guineensis
ref|XP_001759775.1|  Rab6/RabH-family small GTPase                      230   7e-73   
ref|XP_005645434.1|  ras-domain-containing protein                      230   8e-73   Coccomyxa subellipsoidea C-169
ref|NP_179816.1|  RAB GTPase-like protein H1D                           230   8e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001785261.1|  Rab6/RabH-family small GTPase                      230   9e-73   
ref|XP_009112539.1|  PREDICTED: ras-related protein RABH1d              229   1e-72   Brassica rapa
ref|XP_006853127.1|  hypothetical protein AMTR_s00038p00155900          234   1e-72   
ref|XP_001783133.1|  predicted protein                                  229   1e-72   
ref|XP_010472219.1|  PREDICTED: ras-related protein RABH1d              229   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010429146.1|  PREDICTED: ras-related protein RABH1d-like         229   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010269259.1|  PREDICTED: ras-related protein RABH1e-like i...    229   1e-72   Nelumbo nucifera [Indian lotus]
emb|CDX76936.1|  BnaC08g35220D                                          231   2e-72   
ref|XP_010269261.1|  PREDICTED: ras-related protein RABH1e-like i...    228   3e-72   Nelumbo nucifera [Indian lotus]
gb|EYU31009.1|  hypothetical protein MIMGU_mgv1a022220mg                226   4e-72   Erythranthe guttata [common monkey flower]
ref|XP_009338093.1|  PREDICTED: ras-related protein RABH1e-like         228   4e-72   
ref|XP_001782940.1|  Rab6/RabH-family small GTPase                      228   5e-72   
ref|XP_001754098.1|  Rab6/RabH-family small GTPase                      228   6e-72   
ref|XP_005844627.1|  GTP binding protein                                227   1e-71   Chlorella variabilis
ref|XP_004985388.1|  PREDICTED: ras-related protein RABH1e-like         226   4e-71   Setaria italica
ref|XP_002948506.1|  RabH/Rab6                                          226   4e-71   Volvox carteri f. nagariensis
ref|XP_010052745.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    225   5e-71   Eucalyptus grandis [rose gum]
ref|XP_001690213.1|  small rab-related GTPase                           225   6e-71   Chlamydomonas reinhardtii
ref|XP_008674341.1|  PREDICTED: LOC100281229 isoform X1                 224   6e-71   
gb|ABF94403.1|  Ras-related protein Rab-6A, putative, expressed         225   7e-71   Oryza sativa Japonica Group [Japonica rice]
gb|ABF94402.1|  Ras-related protein Rab-6A, putative, expressed         224   1e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006649538.1|  PREDICTED: ras-related protein RABH1e-like         224   1e-70   Oryza brachyantha
ref|XP_002500129.1|  ras-related gtp-binding protein, alternative...    224   2e-70   Micromonas commoda
ref|NP_001147620.1|  LOC100281229                                       224   2e-70   Zea mays [maize]
ref|XP_005538068.1|  small GTP-binding protein of Rab family, Rab6      223   3e-70   Cyanidioschyzon merolae strain 10D
gb|AAZ66935.1|  117M18_16                                               223   8e-70   Brassica rapa
ref|XP_006411786.1|  hypothetical protein EUTSA_v10026225mg             222   8e-70   Eutrema salsugineum [saltwater cress]
gb|AGN12807.1|  Ras-related protein RABH1C                              222   1e-69   Leavenworthia alabamica
ref|XP_003057806.1|  predicted protein                                  222   1e-69   Micromonas pusilla CCMP1545
ref|XP_011400864.1|  Ras-related protein RABH1e                         221   2e-69   Auxenochlorella protothecoides
ref|XP_001780867.1|  Rab6/RabH-family small GTPase                      221   2e-69   
gb|KFK30558.1|  hypothetical protein AALP_AA7G277600                    221   3e-69   Arabis alpina [alpine rockcress]
ref|NP_195699.1|  Ras-related protein RABH1c                            221   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866892.1|  hypothetical protein ARALYDRAFT_912477             220   5e-69   Arabidopsis lyrata subsp. lyrata
gb|KDD77143.1|  Ras family protein                                      220   5e-69   Helicosporidium sp. ATCC 50920
dbj|BAJ99126.1|  predicted protein                                      223   6e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003558615.2|  PREDICTED: ras-related protein RABH1e-like i...    220   9e-69   Brachypodium distachyon [annual false brome]
dbj|BAJ92647.1|  predicted protein                                      221   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010437115.1|  PREDICTED: ras-related protein RABH1c              219   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010431970.1|  PREDICTED: ras-related protein RABH1c-like         219   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006284510.1|  hypothetical protein CARUB_v10005710mg             219   2e-68   
emb|CBJ25951.1|  Rab6, RAB family GTPase                                219   2e-68   Ectocarpus siliculosus
gb|EYU40320.1|  hypothetical protein MIMGU_mgv1a013860mg                218   4e-68   Erythranthe guttata [common monkey flower]
ref|XP_002181536.1|  predicted protein                                  219   4e-68   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_010446557.1|  PREDICTED: ras-related protein RABH1c-like         217   7e-68   Camelina sativa [gold-of-pleasure]
ref|XP_002288400.1|  rab-like rab-type small G protein                  217   8e-68   Thalassiosira pseudonana CCMP1335
ref|XP_001751907.1|  predicted protein                                  216   1e-67   
emb|CDY63926.1|  BnaC07g51320D                                          216   2e-67   Brassica napus [oilseed rape]
gb|EPB88187.1|  Ras-like protein Rab-6B                                 216   2e-67   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001418939.1|  predicted protein                                  216   2e-67   Ostreococcus lucimarinus CCE9901
ref|XP_008607023.1|  Ras-like protein Rab-6A                            216   2e-67   Saprolegnia diclina VS20
ref|XP_008902762.1|  hypothetical protein PPTG_09511                    217   3e-67   Phytophthora parasitica INRA-310
ref|XP_009534275.1|  hypothetical protein PHYSODRAFT_254677             215   3e-67   Phytophthora sojae
ref|XP_010229052.1|  PREDICTED: ras-related protein RABH1e-like i...    220   4e-67   Brachypodium distachyon [annual false brome]
gb|EJK61478.1|  hypothetical protein THAOC_18027                        218   4e-67   Thalassiosira oceanica
ref|XP_009138550.1|  PREDICTED: ras-related protein RABH1c isofor...    217   5e-67   Brassica rapa
gb|EMS25094.1|  RAS small monomeric GTPase Rab6                         218   6e-67   Rhodotorula toruloides NP11
emb|CDY31610.1|  BnaA03g54420D                                          216   6e-67   Brassica napus [oilseed rape]
emb|CEP15631.1|  hypothetical protein                                   214   7e-67   Parasitella parasitica
ref|XP_009824670.1|  hypothetical protein H257_02639                    215   7e-67   Aphanomyces astaci
ref|XP_009824671.1|  hypothetical protein, variant                      214   8e-67   Aphanomyces astaci
emb|CEI87138.1|  Putative Ras-like protein Rab-6B                       214   9e-67   Rhizopus microsporus
gb|EMS65503.1|  Ras-related protein RABH1b                              214   1e-66   Triticum urartu
ref|XP_007417607.1|  hypothetical protein MELLADRAFT_40435              213   1e-66   Melampsora larici-populina 98AG31
gb|ETL97732.1|  hypothetical protein L917_05031                         216   1e-66   Phytophthora parasitica
ref|XP_008863771.1|  hypothetical protein H310_02136                    214   2e-66   Aphanomyces invadans
emb|CEG66857.1|  Putative Ras-like protein Rab-6B                       214   2e-66   Rhizopus microsporus
ref|XP_011110515.1|  hypothetical protein H072_4618                     213   4e-66   
emb|CEF98741.1|  Small GTPase superfamily, Rho type                     213   4e-66   Ostreococcus tauri
ref|XP_002679587.1|  rab small GTPase                                   213   4e-66   Naegleria gruberi strain NEG-M
ref|XP_011117303.1|  hypothetical protein AOL_s00004g351                213   4e-66   Arthrobotrys oligospora ATCC 24927
ref|XP_004336232.1|  GTPbinding protein                                 212   5e-66   Acanthamoeba castellanii str. Neff
ref|XP_007008671.1|  hypothetical protein TREMEDRAFT_70574              213   5e-66   Tremella mesenterica DSM 1558
gb|ESA21530.1|  hypothetical protein GLOINDRAFT_343112                  212   8e-66   
ref|XP_005835889.1|  hypothetical protein GUITHDRAFT_151724             211   1e-65   Guillardia theta CCMP2712
emb|CDI56698.1|  probable YPT6-GTP-binding protein of the rab family    211   1e-65   Melanopsichium pennsylvanicum 4
emb|CEG84615.1|  Putative GTP-binding protein ryh1                      211   1e-65   Rhizopus microsporus
ref|XP_005717265.1|  small GTP-binding protein of Rab family, Rab6      211   1e-65   Chondrus crispus [carageen]
ref|XP_003284380.1|  Rab GTPase                                         211   1e-65   Dictyostelium purpureum
emb|CEG63573.1|  Putative GTP-binding protein ryh1                      211   1e-65   Rhizopus microsporus
gb|EPY50854.1|  GTPase Ryh1                                             211   2e-65   Schizosaccharomyces cryophilus OY26
emb|CEP17941.1|  hypothetical protein                                   211   2e-65   Parasitella parasitica
gb|KFH69191.1|  Ras-like protein Rab-6A                                 211   2e-65   Mortierella verticillata NRRL 6337
gb|EPX74734.1|  GTPase Ryh1                                             211   2e-65   Schizosaccharomyces octosporus yFS286
gb|EWM29714.1|  small gtp-binding protein                               214   2e-65   Nannochloropsis gaditana
gb|EPB85844.1|  Ras-like protein Rab-6A                                 211   2e-65   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAM18139.1|  hypothetical protein SAMD00019534_013140               211   2e-65   Acytostelium subglobosum LB1
ref|XP_002364292.1|  RAB6 protein                                       211   2e-65   Toxoplasma gondii ME49
emb|CCX05769.1|  Similar to GTP-binding protein ryh1; acc. no. P1...    211   2e-65   Pyronema omphalodes CBS 100304
emb|CCA23418.1|  Rab6 family GTPase putative                            212   2e-65   Albugo laibachii Nc14
gb|EPB82493.1|  GTP-binding protein ryh1                                211   2e-65   Mucor circinelloides f. circinelloides 1006PhL
ref|NP_593249.1|  GTPase Ryh1                                           211   2e-65   Schizosaccharomyces pombe
ref|XP_772218.1|  hypothetical protein CNBM0510                         211   3e-65   Cryptococcus neoformans var. neoformans B-3501A
gb|KDE07987.1|  hypothetical protein MVLG_01692                         213   3e-65   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_003885057.1|  RAB5C, member RAS oncogene family, related         210   3e-65   Neospora caninum Liverpool
emb|CDS08228.1|  Putative Ras-like protein Rab-6B                       210   3e-65   Lichtheimia ramosa
emb|CDH59636.1|  ras-related protein rab-6a                             210   3e-65   Lichtheimia corymbifera JMRC:FSU:9682
dbj|GAN05970.1|  conserved hypothetical protein                         210   3e-65   Mucor ambiguus
emb|CEG84616.1|  Putative GTP-binding protein ryh1                      210   3e-65   Rhizopus microsporus
emb|CEI96700.1|  Putative GTP-binding protein ryh1                      210   4e-65   Rhizopus microsporus
emb|CEG63574.1|  Putative GTP-binding protein ryh1                      210   4e-65   Rhizopus microsporus
ref|XP_002787019.1|  RAB6 protein, putative                             210   4e-65   Perkinsus marinus ATCC 50983
emb|CCF49052.1|  probable YPT6-GTP-binding protein of the rab family    210   5e-65   
ref|XP_002769264.1|  RAB6 protein, putative                             209   6e-65   
ref|XP_006681351.1|  hypothetical protein BATDEDRAFT_20546              209   7e-65   
ref|XP_003334220.2|  rab family protein                                 213   7e-65   
emb|CBQ71379.1|  probable YPT6-GTP-binding protein of the rab family    210   7e-65   
ref|XP_007588945.1|  putative ras small monomeric gtpase protein        209   7e-65   
ref|XP_011392486.1|  putative Rab family GTPase YPT6                    209   8e-65   
ref|XP_007877798.1|  hypothetical protein PFL1_02096                    209   9e-65   
gb|ETS60345.1|  hypothetical protein PaG_05544                          209   1e-64   
emb|CDS11621.1|  Putative Ras-like protein Rab-6B                       209   1e-64   
emb|CEI95003.1|  Putative Ras-like protein Rab-6A                       208   1e-64   
emb|CDH50617.1|  ras-related protein rab-6a                             209   1e-64   
gb|EPB81813.1|  Ras-like protein Rab-6A                                 209   1e-64   
dbj|GAN04296.1|  RAS-related protein Rab-6A-like isoform 1              209   2e-64   
dbj|GAK67467.1|  rab6                                                   211   2e-64   
ref|XP_007267677.1|  GTP binding protein                                209   2e-64   
emb|CEG79425.1|  Putative Ras-like protein Rab-6A                       208   2e-64   
emb|CEI95219.1|  Putative Ras-like protein Rab-6B                       208   2e-64   
emb|CEG63493.1|  Putative Ras-like protein Rab-6A                       208   2e-64   
dbj|GAN10334.1|  RAS-related protein Rab-6A-like                        217   2e-64   
ref|XP_007740437.1|  Ras-like protein Rab-6B                            208   2e-64   
emb|CDH59446.1|  ras small monomeric gtpase                             208   2e-64   
emb|CDS10552.1|  Putative Ras-like protein Rab-6A                       208   3e-64   
ref|XP_011501611.1|  PREDICTED: ras-related protein Rab6 isoform X2     208   3e-64   
emb|CDS08933.1|  Putative Ras-like protein Rab-6A                       208   3e-64   
emb|CCD52622.1|  similar to ras-related protein Rab-6A                  207   4e-64   
ref|XP_011501610.1|  PREDICTED: ras-related protein Rab6 isoform X1     207   4e-64   
gb|ESZ95880.1|  putative RAS small monomeric GTPase Rab6                207   4e-64   
emb|CCA68465.1|  probable YPT6-GTP-binding protein of the rab family    208   4e-64   
ref|XP_002487149.1|  RAS small monomeric GTPase Rab6, putative          207   4e-64   
gb|KDN53428.1|  putative YPT6-GTP-binding protein of the rab family     207   5e-64   
ref|XP_002766487.1|  RAB6 protein, putative                             207   5e-64   
gb|KIM30990.1|  hypothetical protein M408DRAFT_327897                   207   6e-64   
ref|XP_002145394.1|  RAS small monomeric GTPase Rab6, putative          207   6e-64   
ref|XP_008024910.1|  hypothetical protein SETTUDRAFT_19417              207   6e-64   
ref|XP_009219051.1|  Ras-like protein Rab-6A                            207   7e-64   
gb|EMF09542.1|  ras-domain-containing protein                           207   7e-64   
ref|XP_007338743.1|  GTP binding protein                                207   7e-64   
emb|CCE33826.1|  probable Ras-related protein Rab-6A                    207   7e-64   
ref|NP_498993.1|  Protein RAB-6.1                                       207   8e-64   
ref|XP_002642449.1|  C. briggsae CBR-RAB-6.1 protein                    207   8e-64   
ref|XP_647531.1|  Rab GTPase                                            207   8e-64   
gb|EGT56740.1|  CBN-RAB-6.1 protein                                     207   8e-64   
gb|AFP33148.1|  rab-6.1                                                 207   8e-64   
dbj|GAM88542.1|  hypothetical protein ANO11243_065750                   207   8e-64   
ref|XP_003849428.1|  hypothetical protein MYCGRDRAFT_101238             207   8e-64   
ref|XP_003098195.1|  CRE-RAB-6.1 protein                                207   8e-64   
ref|XP_006956088.1|  GTP-binding protein ryh1                           207   8e-64   
gb|KIO13496.1|  hypothetical protein M404DRAFT_993048                   207   9e-64   
dbj|GAD91770.1|  RAS small monomeric GTPase Rab6, putative              207   9e-64   
ref|XP_007682856.1|  hypothetical protein COCMIDRAFT_32110              206   1e-63   
gb|KIK44548.1|  hypothetical protein CY34DRAFT_10965                    207   1e-63   
ref|XP_008730015.1|  hypothetical protein G647_07478                    206   1e-63   
gb|KIM55039.1|  hypothetical protein SCLCIDRAFT_135466                  207   1e-63   
ref|XP_001804276.1|  hypothetical protein SNOG_14076                    206   1e-63   
ref|XP_001939221.1|  GTP-binding protein ryh1                           206   1e-63   
ref|XP_009267592.1|  Ras-related protein Rab-6A                         212   1e-63   
ref|XP_002837633.1|  hypothetical protein                               206   1e-63   
ref|XP_007863219.1|  GTP binding protein                                206   1e-63   
ref|XP_009253318.1|  hypothetical protein FPSE_01924                    206   1e-63   
emb|CDI75748.1|  RAB6 protein, putative                                 212   1e-63   
ref|XP_007760685.1|  Ras-like protein Rab-6B                            206   1e-63   
gb|KIW33993.1|  hypothetical protein PV07_00798                         206   1e-63   
ref|XP_008716327.1|  hypothetical protein HMPREF1541_03755              206   1e-63   
gb|KIY01219.1|  hypothetical protein Z520_02771                         206   1e-63   
gb|KEQ59785.1|  ras-domain-containing protein                           206   1e-63   
gb|KIL95942.1|  hypothetical protein FAVG1_00680                        206   1e-63   
gb|KIJ69119.1|  hypothetical protein HYDPIDRAFT_172589                  206   1e-63   
gb|EGU75655.1|  hypothetical protein FOXB_13843                         206   1e-63   
gb|EAS34912.3|  GTP-binding protein ryh1                                206   2e-63   
ref|XP_007733649.1|  Ras-like protein Rab-6B                            206   2e-63   
ref|XP_002567356.1|  Pc21g02920                                         206   2e-63   
emb|CDM31074.1|  Small GTPase superfamily                               206   2e-63   
ref|XP_007721857.1|  Ras-like protein Rab-6A                            206   2e-63   
tpe|CBF79720.1|  TPA: hypothetical protein similar to small GTP-b...    205   2e-63   
ref|XP_007776312.1|  Ras-like protein Rab-6A                            206   2e-63   
ref|XP_755892.1|  RAS small monomeric GTPase Rab6                       206   2e-63   
emb|CEJ94861.1|  Putative RAS small monomeric GTPase Rab6               206   2e-63   
gb|EKV05779.1|  hypothetical protein PDIP_81350                         206   2e-63   
gb|KDQ17899.1|  hypothetical protein BOTBODRAFT_29203                   206   2e-63   
gb|KFM81481.1|  Ras-related protein Rab-6A                              206   2e-63   
gb|EPS32703.1|  hypothetical protein PDE_07663                          206   2e-63   
ref|XP_001397103.1|  Ras-related protein Rab-6A                         206   2e-63   
emb|CCU75854.1|  RAS small monomeric GTPase Rab6                        206   2e-63   
ref|XP_001727316.1|  Ras-related protein Rab-6A                         206   2e-63   
gb|KFH42072.1|  Ras-related protein-like protein                        206   2e-63   
gb|EPQ66035.1|  GTPase                                                  206   2e-63   
gb|ABB17267.1|  secretion related GTPase C                              206   2e-63   
gb|EME40844.1|  hypothetical protein DOTSEDRAFT_178065                  206   2e-63   
gb|KIJ17017.1|  hypothetical protein PAXINDRAFT_74227                   206   2e-63   
ref|XP_009044447.1|  hypothetical protein LOTGIDRAFT_230007             206   2e-63   
emb|CCF39041.1|  Ras-like protein Rab-6A                                206   2e-63   
gb|EMT70790.1|  Ras-related protein Rab-6A                              206   2e-63   
gb|EFQ30631.1|  Ras family protein                                      206   2e-63   
gb|KII89187.1|  hypothetical protein PLICRDRAFT_53653                   206   2e-63   
gb|KIY50824.1|  ras-domain-containing protein                           206   2e-63   
gb|KIK82250.1|  hypothetical protein PAXRUDRAFT_723342                  206   3e-63   
ref|XP_010738107.1|  PREDICTED: ras-related protein Rab-6B              206   3e-63   
ref|XP_007930701.1|  hypothetical protein MYCFIDRAFT_190637             205   3e-63   
gb|ELR09187.1|  Ras-like protein Rab-6B                                 206   3e-63   
ref|XP_005097179.1|  PREDICTED: ras-related protein Rab-6A-like i...    205   3e-63   
gb|KFX93782.1|  hypothetical protein V490_04671                         206   3e-63   
ref|XP_007764555.1|  GTP binding protein                                206   3e-63   
emb|CCV00458.1|  unnamed protein product                                206   3e-63   
ref|XP_004987538.1|  small GTP binding protein RAB6A                    205   3e-63   
gb|ABC68472.1|  Rab6A                                                   206   3e-63   
gb|KFX91822.1|  hypothetical protein O988_07563                         206   3e-63   
gb|KFY28999.1|  hypothetical protein V493_02595                         205   3e-63   
emb|CDH58022.1|  ras-related protein rab-6a                             205   3e-63   
gb|KFY17581.1|  hypothetical protein V492_00562                         205   3e-63   
gb|KIK58247.1|  hypothetical protein GYMLUDRAFT_45466                   205   4e-63   
ref|XP_007288632.1|  Ras family protein                                 205   4e-63   
ref|XP_007874773.1|  hypothetical protein PNEG_02743                    205   4e-63   
gb|ETS05170.1|  ras-domain-containing protein                           205   4e-63   
ref|XP_003665769.1|  hypothetical protein MYCTH_2309779                 205   4e-63   
gb|KIV93846.1|  hypothetical protein PV10_05030                         205   4e-63   
ref|XP_003657273.1|  hypothetical protein THITE_2152148                 205   4e-63   
gb|EHK46275.1|  secretion-related small GTPase RAB6/RYH1/SRG3           205   4e-63   
ref|XP_002176098.2|  GTPase Ryh1                                        205   4e-63   
ref|XP_003035736.1|  hypothetical protein SCHCODRAFT_81164              205   4e-63   
ref|XP_011443601.1|  PREDICTED: ras-related protein Rab6 isoform X3     205   4e-63   
ref|XP_001604718.2|  PREDICTED: ras-related protein Rab6 isoform X2     205   4e-63   
ref|NP_001155439.1|  rab6-like                                          205   4e-63   
ref|XP_011443600.1|  PREDICTED: ras-related protein Rab6 isoform X2     205   4e-63   
ref|XP_007911381.1|  putative ras-like protein rab-6a protein           205   4e-63   
gb|KIW12865.1|  hypothetical protein PV08_08052                         205   4e-63   
gb|EFX82462.1|  hypothetical protein DAPPUDRAFT_128059                  205   4e-63   
ref|XP_011053230.1|  PREDICTED: ras-related protein Rab6 isoform X2     205   4e-63   
ref|XP_003700004.1|  PREDICTED: ras-related protein Rab-6A-like i...    205   4e-63   
gb|KIV87224.1|  hypothetical protein PV11_02784                         205   5e-63   
ref|XP_005178934.1|  PREDICTED: ras-related protein Rab6                205   5e-63   
ref|XP_001728930.1|  hypothetical protein MGL_3924                      205   5e-63   
ref|XP_011165040.1|  PREDICTED: ras-related protein Rab6                205   5e-63   
ref|XP_006457952.1|  GTP binding protein                                205   5e-63   
gb|EUC59407.1|  small GTPase family Rab protein                         205   5e-63   
gb|KDR73531.1|  hypothetical protein GALMADRAFT_212404                  205   5e-63   
ref|NP_001040270.1|  ras small monomeric GTPase Rab6                    205   5e-63   
ref|XP_003700005.1|  PREDICTED: ras-related protein Rab-6A-like i...    205   5e-63   
ref|XP_008180667.1|  PREDICTED: rab6-like isoform X1                    205   5e-63   
gb|KFY05440.1|  hypothetical protein V491_09127                         205   5e-63   
ref|XP_011443599.1|  PREDICTED: ras-related protein Rab6 isoform X1     205   5e-63   
gb|KIW60748.1|  hypothetical protein PV05_00942                         205   5e-63   
gb|AAT46563.1|  Rab                                                     205   5e-63   
gb|KFY84979.1|  hypothetical protein V500_08842                         205   5e-63   
ref|XP_011310698.1|  PREDICTED: ras-related protein Rab6 isoform X2     205   5e-63   
gb|KFZ09627.1|  hypothetical protein V502_08600                         205   5e-63   
ref|XP_001238010.2|  AGAP011363-PA                                      205   5e-63   
ref|XP_011053229.1|  PREDICTED: ras-related protein Rab6 isoform X1     205   5e-63   
dbj|BAH70915.1|  ACYPI001698                                            205   5e-63   
ref|XP_008543108.1|  PREDICTED: ras-related protein Rab6                205   5e-63   
gb|KFB47225.1|  rab6                                                    205   5e-63   
ref|XP_007322078.1|  hypothetical protein SERLADRAFT_475872             205   6e-63   
ref|XP_002737729.1|  PREDICTED: ras-related protein Rab-6A-like i...    205   6e-63   
ref|XP_392533.1|  PREDICTED: ras-related protein Rab-6A isoform X2      204   6e-63   
ref|XP_007847721.1|  gtp-binding protein ryh1                           205   6e-63   
emb|CCL99998.1|  predicted protein                                      205   6e-63   
ref|XP_003397812.1|  PREDICTED: ras-related protein Rab-6A-like i...    204   6e-63   
ref|XP_001657424.1|  AAEL006091-PA                                      204   6e-63   
gb|KFY60631.1|  hypothetical protein V497_03517                         204   6e-63   
ref|XP_008336818.1|  PREDICTED: ras-related protein Rab-6B isofor...    204   6e-63   
ref|XP_001874941.1|  GTP binding protein                                205   6e-63   
gb|KIL69923.1|  hypothetical protein M378DRAFT_157164                   205   6e-63   
ref|XP_002423803.1|  GTP-binding nuclear protein RAN1, putative         204   6e-63   
ref|NP_001187853.1|  ras-related protein Rab-6B                         204   6e-63   
ref|XP_006820134.1|  PREDICTED: ras-related protein Rab-6A-like i...    204   6e-63   
gb|KIK08183.1|  hypothetical protein K443DRAFT_586569                   204   6e-63   
ref|XP_791590.3|  PREDICTED: ras-related protein Rab-6A-like            204   6e-63   
ref|XP_003397813.1|  PREDICTED: ras-related protein Rab-6A-like i...    204   6e-63   
gb|KDR24391.1|  Ras-related protein Rab-6A                              204   6e-63   
ref|XP_001833137.2|  ryh1                                               205   6e-63   
ref|XP_011149551.1|  PREDICTED: ras-related protein Rab6 isoform X1     204   6e-63   
ref|XP_006820135.1|  PREDICTED: ras-related protein Rab-6A-like i...    204   6e-63   
ref|XP_004531259.1|  PREDICTED: ras-related protein Rab-6A-like         204   7e-63   
ref|XP_002540832.1|  GTP-binding protein ryh1                           204   7e-63   
ref|XP_008200264.1|  PREDICTED: ras-related protein Rab6 isoform X1     204   7e-63   
ref|XP_003719687.1|  Ras-like protein Rab-6A                            204   7e-63   
ref|XP_002866645.1|  hypothetical protein ARALYDRAFT_496719             204   7e-63   
ref|XP_005190543.1|  PREDICTED: ras-related protein Rab6-like           205   7e-63   
ref|XP_011310697.1|  PREDICTED: ras-related protein Rab6 isoform X1     204   7e-63   
ref|NP_477172.1|  Rab6, isoform A                                       204   7e-63   
ref|XP_008210586.1|  PREDICTED: ras-related protein Rab6 isoform X1     204   7e-63   
ref|XP_002623054.1|  rab6                                               204   8e-63   
ref|XP_008200265.1|  PREDICTED: ras-related protein Rab6 isoform X2     204   8e-63   
gb|KJA27436.1|  hypothetical protein HYPSUDRAFT_35325                   204   8e-63   
gb|KIM48935.1|  hypothetical protein M413DRAFT_438111                   204   8e-63   
gb|EEH06834.1|  conserved hypothetical protein                          204   8e-63   
gb|KHN70890.1|  Ras-related protein Rab-6A                              204   8e-63   
ref|XP_001657425.1|  AAEL006091-PB                                      204   8e-63   
ref|XP_002069232.1|  GK21078                                            204   8e-63   
pdb|2Y8E|A  Chain A, Crystal Structure Of D. Melanogaster Rab6 Gt...    203   8e-63   
ref|XP_002002015.1|  GI14260                                            204   8e-63   
gb|AJC97114.1|  Rab6A                                                   204   9e-63   
ref|XP_007254481.1|  PREDICTED: ras-related protein Rab-6B-like i...    204   9e-63   
gb|KIW42927.1|  hypothetical protein PV06_06426                         204   9e-63   
gb|KFZ20298.1|  hypothetical protein V501_00207                         204   9e-63   
gb|EGC47645.1|  conserved hypothetical protein                          204   9e-63   
ref|XP_003837377.1|  similar to ras-related protein Rab-6A              204   9e-63   
gb|KIM79706.1|  hypothetical protein PILCRDRAFT_553431                  204   9e-63   
gb|EHJ72138.1|  ras small monomeric GTPase Rab6                         204   1e-62   
gb|ERG85416.1|  ras-related protein rab                                 204   1e-62   
gb|AGM32469.1|  Rab GTpase family 6 (Rab6)                              204   1e-62   
ref|XP_011229130.1|  PREDICTED: ras-related protein Rab-6B isofor...    203   1e-62   
gb|KDQ61167.1|  hypothetical protein JAAARDRAFT_173747                  204   1e-62   
ref|XP_005467520.1|  PREDICTED: ras-related protein Rab-6B-like i...    204   1e-62   
ref|XP_008324973.1|  PREDICTED: ras-related protein Rab-41 isofor...    204   1e-62   
ref|XP_001906753.1|  hypothetical protein                               204   1e-62   
ref|XP_007254479.1|  PREDICTED: ras-related protein Rab-6B-like i...    204   1e-62   
gb|KIY73153.1|  ras-domain-containing protein                           204   1e-62   
ref|XP_003445270.1|  PREDICTED: ras-related protein Rab-6B-like i...    204   1e-62   
gb|EJD75978.1|  Ras-like protein                                        204   1e-62   
ref|XP_004073166.1|  PREDICTED: ras-related protein Rab-41 isofor...    204   1e-62   
ref|XP_008468297.1|  PREDICTED: ras-related protein Rab6-like           203   1e-62   
ref|XP_006907294.1|  PREDICTED: ras-related protein Rab-6B isofor...    204   1e-62   
emb|CEL51485.1|  RAB6B, member RAS oncogene family                      204   1e-62   
ref|XP_002121682.1|  PREDICTED: ras-related protein Rab-6A-like i...    204   1e-62   
ref|XP_961894.3|  GTP-binding protein ryh1                              204   1e-62   
gb|AET50598.1|  hypothetical protein                                    204   1e-62   
ref|XP_008324974.1|  PREDICTED: ras-related protein Rab-41 isofor...    204   1e-62   
gb|KHJ35809.1|  putative ras family protein                             204   1e-62   
dbj|GAA93714.1|  hypothetical protein E5Q_00360                         205   1e-62   
ref|XP_005173304.1|  PREDICTED: ras-related protein Rab-41 isofor...    204   1e-62   



>ref|XP_009592200.1| PREDICTED: ras-related protein RABH1b [Nicotiana tomentosiformis]
Length=208

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009790571.1| PREDICTED: ras-related protein RABH1b [Nicotiana sylvestris]
Length=208

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_008232300.1| PREDICTED: ras-related protein RABH1b [Prunus mume]
Length=208

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_004229706.1| PREDICTED: ras-related protein RABH1b [Solanum lycopersicum]
Length=208

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_002281823.1| PREDICTED: ras-related protein RABH1b [Vitis vinifera]
 emb|CAN75036.1| hypothetical protein VITISV_014840 [Vitis vinifera]
Length=208

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006354635.1| PREDICTED: ras-related protein RABH1b-like [Solanum tuberosum]
Length=208

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_007218411.1| hypothetical protein PRUPE_ppa011501mg [Prunus persica]
 gb|EMJ19610.1| hypothetical protein PRUPE_ppa011501mg [Prunus persica]
Length=208

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010559077.1| PREDICTED: ras-related protein RABH1b [Tarenaya hassleriana]
Length=208

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_008369810.1| PREDICTED: ras-related protein RABH1b [Malus domestica]
 ref|XP_009339633.1| PREDICTED: ras-related protein RABH1b [Pyrus x bretschneideri]
Length=208

 Score =   246 bits (628),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006657723.1| PREDICTED: ras-related protein RABH1b-like [Oryza brachyantha]
Length=208

 Score =   246 bits (628),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010919837.1| PREDICTED: ras-related protein RABH1b [Elaeis guineensis]
Length=208

 Score =   246 bits (628),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_007052416.1| Ras-related small GTP-binding family protein [Theobroma cacao]
 gb|EOX96573.1| Ras-related small GTP-binding family protein [Theobroma cacao]
Length=208

 Score =   246 bits (628),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_008364780.1| PREDICTED: ras-related protein RABH1b [Malus domestica]
Length=208

 Score =   246 bits (628),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_011093480.1| PREDICTED: ras-related protein RABH1b [Sesamum indicum]
Length=208

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_011469541.1| PREDICTED: ras-related protein RABH1b [Fragaria vesca subsp. 
vesca]
Length=208

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_002526504.1| protein with unknown function [Ricinus communis]
 gb|EEF35895.1| protein with unknown function [Ricinus communis]
Length=208

 Score =   246 bits (627),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009385937.1| PREDICTED: ras-related protein RABH1b-like [Musa acuminata subsp. 
malaccensis]
Length=208

 Score =   246 bits (627),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009390643.1| PREDICTED: ras-related protein RABH1b-like [Musa acuminata subsp. 
malaccensis]
Length=208

 Score =   246 bits (627),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_008784703.1| PREDICTED: ras-related protein RABH1b isoform X3 [Phoenix dactylifera]
Length=208

 Score =   246 bits (627),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_008784700.1| PREDICTED: ras-related protein RABH1b isoform X1 [Phoenix dactylifera]
Length=208

 Score =   245 bits (626),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010269896.1| PREDICTED: ras-related protein RABH1b [Nelumbo nucifera]
 ref|XP_010269897.1| PREDICTED: ras-related protein RABH1b [Nelumbo nucifera]
 ref|XP_010269898.1| PREDICTED: ras-related protein RABH1b [Nelumbo nucifera]
Length=208

 Score =   245 bits (626),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006445482.1| hypothetical protein CICLE_v10022269mg [Citrus clementina]
 ref|XP_006464378.1| PREDICTED: ras-related protein RABH1b-like [Citrus sinensis]
 gb|ESR58722.1| hypothetical protein CICLE_v10022269mg [Citrus clementina]
 gb|KDO85413.1| hypothetical protein CISIN_1g028466mg [Citrus sinensis]
Length=208

 Score =   245 bits (626),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KWVEEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTTKWVEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010661434.1| PREDICTED: ras-related protein RABH1b [Vitis vinifera]
Length=208

 Score =   245 bits (625),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTAKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>emb|CDP09376.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010677218.1| PREDICTED: ras-related protein RABH1b [Beta vulgaris subsp. vulgaris]
Length=207

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTAKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|EYU40319.1| hypothetical protein MIMGU_mgv1a013860mg [Erythranthe guttata]
Length=208

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|NP_001059699.1| Os07g0496000 [Oryza sativa Japonica Group]
 dbj|BAC21376.1| GTP-binding protein Rab6 [Oryza sativa Japonica Group]
 dbj|BAF21613.1| Os07g0496000 [Oryza sativa Japonica Group]
Length=208

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|AAA74117.1| putative [Nicotiana tabacum]
Length=208

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTV L
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVAL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_003611426.1| Ras-related protein Rab-6 [Medicago truncatula]
Length=226

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTTKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010238113.1| PREDICTED: ras-related protein RABH1b [Brachypodium distachyon]
Length=208

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009400213.1| PREDICTED: ras-related protein RABH1b [Musa acuminata subsp. 
malaccensis]
Length=208

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIV+V
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVVV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009766624.1| PREDICTED: ras-related protein RABH1b [Nicotiana sylvestris]
 ref|XP_009766625.1| PREDICTED: ras-related protein RABH1b [Nicotiana sylvestris]
Length=208

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010933532.1| PREDICTED: ras-related protein RABH1b-like [Elaeis guineensis]
Length=208

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDV+SRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVSSRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KDO41082.1| hypothetical protein CISIN_1g028507mg [Citrus sinensis]
Length=175

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVASRQSFLNTSKW++EVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVASRQSFLNTSKWIDEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009604156.1| PREDICTED: ras-related protein RABH1b-like [Nicotiana tomentosiformis]
Length=208

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_011032019.1| PREDICTED: ras-related protein RABH1b-like [Populus euphratica]
Length=208

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTIRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|NP_001150271.1| ras-related protein Rab-6A [Zea mays]
 ref|XP_002460730.1| hypothetical protein SORBIDRAFT_02g033930 [Sorghum bicolor]
 ref|XP_004957769.1| PREDICTED: ras-related protein RABH1b-like [Setaria italica]
 gb|ACF84814.1| unknown [Zea mays]
 gb|ACG38463.1| ras-related protein Rab-6A [Zea mays]
 gb|EER97251.1| hypothetical protein SORBIDRAFT_02g033930 [Sorghum bicolor]
 tpg|DAA40903.1| TPA: Ras protein Rab-6A [Zea mays]
Length=208

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KHG03959.1| Ras-related RABH1b -like protein [Gossypium arboreum]
Length=208

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSF NTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFQNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KJB22826.1| hypothetical protein B456_004G067600 [Gossypium raimondii]
Length=208

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSF NTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFQNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_007156617.1| hypothetical protein PHAVU_002G003500g [Phaseolus vulgaris]
 gb|ESW28611.1| hypothetical protein PHAVU_002G003500g [Phaseolus vulgaris]
Length=207

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTAKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_002302484.1| Ras-related GTP-binding family protein [Populus trichocarpa]
 ref|XP_011017314.1| PREDICTED: ras-related protein RABH1b [Populus euphratica]
 gb|EEE81757.1| Ras-related GTP-binding family protein [Populus trichocarpa]
Length=208

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVR+ERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRSERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|AES94384.2| RAB GTPase-like protein B1C [Medicago truncatula]
Length=207

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTTKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010544549.1| PREDICTED: ras-related protein RABH1b [Tarenaya hassleriana]
Length=213

 Score =   244 bits (623),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006436829.1| hypothetical protein CICLE_v10032757mg [Citrus clementina]
 ref|XP_006485362.1| PREDICTED: ras-related protein RABH1b-like isoform X1 [Citrus 
sinensis]
 gb|ESR50069.1| hypothetical protein CICLE_v10032757mg [Citrus clementina]
 gb|KDO41079.1| hypothetical protein CISIN_1g028507mg [Citrus sinensis]
Length=208

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVASRQSFLNTSKW++EVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVASRQSFLNTSKWIDEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_003517383.1| PREDICTED: ras-related protein RABH1b-like [Glycine max]
 gb|KHN42638.1| Ras-related protein RABH1b [Glycine soja]
Length=207

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTAKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_011085344.1| PREDICTED: ras-related protein RABH1b-like [Sesamum indicum]
Length=208

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTAKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_002528787.1| protein with unknown function [Ricinus communis]
 gb|EEF33609.1| protein with unknown function [Ricinus communis]
Length=208

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQ+FLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQTFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_011018653.1| PREDICTED: ras-related protein RABH1b-like isoform X1 [Populus 
euphratica]
Length=208

 Score =   244 bits (622),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTIRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|EEC82085.1| hypothetical protein OsI_26083 [Oryza sativa Indica Group]
Length=244

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009142275.1| PREDICTED: ras-related protein RABH1b-like [Brassica rapa]
 emb|CDY30479.1| BnaA04g25800D [Brassica napus]
Length=208

 Score =   243 bits (621),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW++EVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTAKWIDEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006294994.1| hypothetical protein CARUB_v10024066mg [Capsella rubella]
 gb|EOA27892.1| hypothetical protein CARUB_v10024066mg [Capsella rubella]
Length=208

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW++EVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTTKWIDEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KDP28909.1| hypothetical protein JCGZ_14680 [Jatropha curcas]
Length=208

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVAS QSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASMQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010506389.1| PREDICTED: ras-related protein RABH1b [Camelina sativa]
 ref|XP_010508276.1| PREDICTED: ras-related protein RABH1b [Camelina sativa]
 ref|XP_010518063.1| PREDICTED: ras-related protein RABH1b [Camelina sativa]
Length=208

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW++EVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTTKWIDEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KFK37266.1| hypothetical protein AALP_AA4G235100 [Arabis alpina]
Length=208

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW++EVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTTKWIDEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|EYU42316.1| hypothetical protein MIMGU_mgv1a013870mg [Erythranthe guttata]
 gb|EYU45202.1| hypothetical protein MIMGU_mgv1a013879mg [Erythranthe guttata]
Length=208

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQ+FLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQTFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006436830.1| hypothetical protein CICLE_v10032757mg [Citrus clementina]
 ref|XP_006485363.1| PREDICTED: ras-related protein RABH1b-like isoform X2 [Citrus 
sinensis]
 gb|ESR50070.1| hypothetical protein CICLE_v10032757mg [Citrus clementina]
 gb|KDO41081.1| hypothetical protein CISIN_1g028507mg [Citrus sinensis]
Length=170

 Score =   242 bits (617),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVASRQSFLNTSKW++EVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVASRQSFLNTSKWIDEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006397642.1| hypothetical protein EUTSA_v10001633mg [Eutrema salsugineum]
 gb|ESQ39095.1| hypothetical protein EUTSA_v10001633mg [Eutrema salsugineum]
Length=208

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW++EVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTTKWIDEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KDP45957.1| hypothetical protein JCGZ_11860 [Jatropha curcas]
Length=208

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQ+FLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQTFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|EEE67212.1| hypothetical protein OsJ_24329 [Oryza sativa Japonica Group]
Length=244

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_004148503.1| PREDICTED: ras-related protein RABH1b-like [Cucumis sativus]
 ref|XP_004171228.1| PREDICTED: ras-related protein RABH1b-like [Cucumis sativus]
 ref|XP_008465921.1| PREDICTED: ras-related protein RABH1b [Cucumis melo]
 gb|KGN60432.1| hypothetical protein Csa_3G910690 [Cucumis sativus]
Length=208

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAP SALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPTSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_008784702.1| PREDICTED: ras-related protein RABH1b isoform X2 [Phoenix dactylifera]
Length=208

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQ TIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQVTIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009133677.1| PREDICTED: ras-related protein RABH1b-like [Brassica rapa]
Length=208

 Score =   243 bits (621),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW++EVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTTKWIDEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|NP_181989.1| Ras-related protein RABH1B [Arabidopsis thaliana]
 ref|XP_002881970.1| hypothetical protein ARALYDRAFT_903887 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O80501.1|RAH1B_ARATH RecName: Full=Ras-related protein RABH1b; Short=AtRABH1b; AltName: 
Full=Ras-related protein Rab6A; Short=AtRab6A [Arabidopsis 
thaliana]
 gb|AAC27463.1| putative small GTP-binding protein [Arabidopsis thaliana]
 gb|AAM65455.1| putative small GTP-binding protein [Arabidopsis thaliana]
 gb|ABF83670.1| At2g44610 [Arabidopsis thaliana]
 dbj|BAE99055.1| putative small GTP-binding protein [Arabidopsis thaliana]
 gb|EFH58229.1| hypothetical protein ARALYDRAFT_903887 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC10447.1| Ras-related protein RABH1B [Arabidopsis thaliana]
 emb|CDY48241.1| BnaC04g05000D [Brassica napus]
 emb|CDX95606.1| BnaC03g24870D [Brassica napus]
 emb|CDX83425.1| BnaA03g20810D [Brassica napus]
 prf||2008312A GTP-binding protein
Length=208

 Score =   243 bits (620),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW++EVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTTKWIDEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KHG27267.1| Ras-related RABH1b -like protein [Gossypium arboreum]
 gb|KJB21701.1| hypothetical protein B456_004G037900 [Gossypium raimondii]
Length=208

 Score =   243 bits (620),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSF NT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFQNTTKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010941190.1| PREDICTED: ras-related protein RABH1b-like isoform X2 [Elaeis 
guineensis]
Length=208

 Score =   243 bits (620),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNTSKW+EEVRTERG DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTSKWIEEVRTERGGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>emb|CDX74672.1| BnaA05g04180D [Brassica napus]
Length=208

 Score =   243 bits (620),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW++EVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTTKWIDEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_007155742.1| hypothetical protein PHAVU_003G227800g [Phaseolus vulgaris]
 gb|ESW27736.1| hypothetical protein PHAVU_003G227800g [Phaseolus vulgaris]
Length=206

 Score =   243 bits (619),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNTSKW+EEVR+ERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTSKWIEEVRSERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006485364.1| PREDICTED: ras-related protein RABH1b-like isoform X3 [Citrus 
sinensis]
 gb|KDO41080.1| hypothetical protein CISIN_1g028507mg [Citrus sinensis]
Length=170

 Score =   241 bits (616),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVASRQSFLNTSKW++EVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVASRQSFLNTSKWIDEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_004511760.1| PREDICTED: ras-related protein RABH1b-like [Cicer arietinum]
Length=206

 Score =   243 bits (619),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNTSKW+EEVR+ERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTSKWIEEVRSERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KEH31569.1| RAB GTPase-like protein B1C [Medicago truncatula]
Length=206

 Score =   243 bits (619),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNTSKW+EEVR+ERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTSKWIEEVRSERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010524453.1| PREDICTED: ras-related protein RABH1b-like [Tarenaya hassleriana]
Length=208

 Score =   243 bits (619),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVR+ERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRSERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KJB21703.1| hypothetical protein B456_004G037900 [Gossypium raimondii]
Length=164

 Score =   241 bits (615),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSF NT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFQNTTKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|AFK37167.1| unknown [Medicago truncatula]
Length=206

 Score =   243 bits (619),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNTSKW+EEVR+ERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTSKWIEEVRSERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_004508989.1| PREDICTED: ras-related protein RABH1b-like [Cicer arietinum]
Length=206

 Score =   243 bits (619),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNTSKW+EEVR+ERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTSKWIEEVRSERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|NP_001142363.1| hypothetical protein [Zea mays]
 gb|ACF88306.1| unknown [Zea mays]
 tpg|DAA62791.1| TPA: hypothetical protein ZEAMMB73_332722 [Zea mays]
Length=208

 Score =   243 bits (619),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW++EVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIDEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_007209608.1| hypothetical protein PRUPE_ppa011535mg [Prunus persica]
 ref|XP_008229518.1| PREDICTED: ras-related protein RABH1b-like [Prunus mume]
 gb|EMJ10807.1| hypothetical protein PRUPE_ppa011535mg [Prunus persica]
Length=207

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTIRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNTSKW++EVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTSKWIDEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_003549965.2| PREDICTED: ras-related protein RABH1b-like [Glycine max]
 gb|KHN01660.1| Ras-related protein RABH1b [Glycine soja]
 gb|KHN21041.1| Ras-related protein RABH1b [Glycine soja]
Length=206

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNTSKW+EEVR+ERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTSKWIEEVRSERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|EPS71048.1| hypothetical protein M569_03713 [Genlisea aurea]
Length=209

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW++EVR ERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTAKWIQEVRAERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_011018655.1| PREDICTED: ras-related protein RABH1b-like isoform X2 [Populus 
euphratica]
Length=187

 Score =   241 bits (616),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTIRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|NP_001235476.1| uncharacterized protein LOC100527651 [Glycine max]
 gb|ACU16782.1| unknown [Glycine max]
Length=213

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNTSKW+EEVR+ERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTSKWIEEVRSERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009143050.1| PREDICTED: ras-related protein RABH1b [Brassica rapa]
Length=208

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKL+FLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLLFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW++EVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTTKWIDEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_007156620.1| hypothetical protein PHAVU_002G003800g [Phaseolus vulgaris]
 gb|ESW28614.1| hypothetical protein PHAVU_002G003800g [Phaseolus vulgaris]
Length=206

 Score =   241 bits (616),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVI YDVASRQ+FLNTSKW+EEVR+ERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIAYDVASRQTFLNTSKWIEEVRSERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010926288.1| PREDICTED: ras-related protein RABH1e [Elaeis guineensis]
Length=207

 Score =   241 bits (615),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|AFK45067.1| unknown [Lotus japonicus]
Length=210

 Score =   241 bits (614),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYD+ASRQ+FLNTSKW+EEV +ERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDIASRQTFLNTSKWIEEVHSERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>tpg|DAA62790.1| TPA: hypothetical protein ZEAMMB73_332722, partial [Zea mays]
Length=249

 Score =   242 bits (617),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW++EVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIDEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_003539133.2| PREDICTED: ras-related protein RABH1b [Glycine max]
 gb|KHN34874.1| Ras-related protein RABH1b [Glycine soja]
Length=207

 Score =   240 bits (613),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTAKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KJB44180.1| hypothetical protein B456_007G238500 [Gossypium raimondii]
Length=208

 Score =   240 bits (613),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKWVEEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWVEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KJB21702.1| hypothetical protein B456_004G037900 [Gossypium raimondii]
Length=208

 Score =   240 bits (613),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVAS QSF NT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASMQSFQNTTKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009764281.1| PREDICTED: ras-related protein RABH1e [Nicotiana sylvestris]
Length=207

 Score =   240 bits (613),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAAVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KJB44181.1| hypothetical protein B456_007G238500 [Gossypium raimondii]
Length=208

 Score =   240 bits (612),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKWVEEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWVEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|ACU20573.1| unknown [Glycine max]
Length=213

 Score =   240 bits (613),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQ+FLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQTFLNTAKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009593307.1| PREDICTED: ras-related protein RABH1e [Nicotiana tomentosiformis]
Length=207

 Score =   240 bits (612),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAAVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_008782142.1| PREDICTED: ras-related protein RABH1e [Phoenix dactylifera]
Length=207

 Score =   240 bits (612),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVLVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006838450.1| hypothetical protein AMTR_s00002p00134180 [Amborella trichopoda]
 gb|ERN01019.1| hypothetical protein AMTR_s00002p00134180 [Amborella trichopoda]
Length=208

 Score =   240 bits (612),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010916878.1| PREDICTED: ras-related protein RABH1e-like [Elaeis guineensis]
Length=207

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEV TERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVHTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_007047951.1| RAB GTPase H1E isoform 1 [Theobroma cacao]
 gb|EOX92108.1| RAB GTPase H1E isoform 1 [Theobroma cacao]
Length=208

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_002531261.1| protein with unknown function [Ricinus communis]
 gb|EEF31125.1| protein with unknown function [Ricinus communis]
Length=207

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010025451.1| PREDICTED: ras-related protein RABH1e [Eucalyptus grandis]
 gb|KCW62115.1| hypothetical protein EUGRSUZ_H04781 [Eucalyptus grandis]
Length=207

 Score =   239 bits (610),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MANVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KJB48804.1| hypothetical protein B456_008G090100 [Gossypium raimondii]
Length=138

 Score =   236 bits (603),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQS+GKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSIGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWMEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_011097570.1| PREDICTED: ras-related protein RABH1e [Sesamum indicum]
Length=207

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_003531349.1| PREDICTED: ras-related protein RABH1e-like [Glycine max]
 gb|KHN29057.1| Ras-related protein RABH1e [Glycine soja]
Length=207

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KWVEEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWVEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KHG04027.1| Ras-related RABH1e -like protein [Gossypium arboreum]
Length=207

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWMEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_007047952.1| RAB GTPase H1E isoform 2, partial [Theobroma cacao]
 gb|EOX92109.1| RAB GTPase H1E isoform 2, partial [Theobroma cacao]
Length=170

 Score =   237 bits (605),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009802532.1| PREDICTED: ras-related protein RABH1e [Nicotiana sylvestris]
Length=207

 Score =   238 bits (608),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_003525055.1| PREDICTED: ras-related protein RABH1e-like [Glycine max]
 ref|XP_007159658.1| hypothetical protein PHAVU_002G256300g [Phaseolus vulgaris]
 gb|ESW31652.1| hypothetical protein PHAVU_002G256300g [Phaseolus vulgaris]
Length=207

 Score =   238 bits (608),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KWVEEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWVEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_004235062.1| PREDICTED: ras-related protein RABH1e-like [Solanum lycopersicum]
Length=207

 Score =   238 bits (608),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            M+ VS+LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MSVVSSLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KJB48801.1| hypothetical protein B456_008G090100 [Gossypium raimondii]
 gb|KJB48802.1| hypothetical protein B456_008G090100 [Gossypium raimondii]
Length=207

 Score =   238 bits (607),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQS+GKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSIGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWMEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_011090551.1| PREDICTED: ras-related protein RABH1e-like [Sesamum indicum]
Length=207

 Score =   238 bits (607),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAAVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERG DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006355553.1| PREDICTED: ras-related protein RABH1e-like [Solanum tuberosum]
Length=207

 Score =   238 bits (607),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAAVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVA+RQSFLNTSKW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVANRQSFLNTSKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|EPS72171.1| hypothetical protein M569_02585 [Genlisea aurea]
Length=207

 Score =   238 bits (607),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/121 (94%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD+TYQATIGIDFLSKTMYLEDR +RL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDSTYQATIGIDFLSKTMYLEDRAIRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA RQSF+NTSKW+EEVR ERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVAIRQSFINTSKWIEEVRNERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_004240017.1| PREDICTED: ras-related protein RABH1e [Solanum lycopersicum]
Length=207

 Score =   238 bits (607),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAAVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVA+RQSFLNTSKW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVANRQSFLNTSKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_003517384.1| PREDICTED: ras-related protein RABH1b-like [Glycine max]
 gb|KHN42637.1| Ras-related protein RABH1b [Glycine soja]
Length=206

 Score =   238 bits (607),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVI YDVASRQ+FLNTSKW+EEVR+ERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIAYDVASRQTFLNTSKWIEEVRSERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010547607.1| PREDICTED: ras-related protein RABH1e [Tarenaya hassleriana]
Length=207

 Score =   238 bits (606),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERG DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010269260.1| PREDICTED: ras-related protein RABH1e-like isoform X2 [Nelumbo 
nucifera]
Length=207

 Score =   238 bits (606),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KDP46827.1| hypothetical protein JCGZ_24036 [Jatropha curcas]
Length=207

 Score =   238 bits (606),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSF NTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFFNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_004502420.1| PREDICTED: ras-related protein RABH1e-like [Cicer arietinum]
Length=207

 Score =   238 bits (606),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT++WVEEVRTERGSDV+IVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNRWVEEVRTERGSDVVIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_002871412.1| hypothetical protein ARALYDRAFT_487852 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010422866.1| PREDICTED: ras-related protein RABH1e isoform X1 [Camelina sativa]
 ref|XP_010422867.1| PREDICTED: ras-related protein RABH1e isoform X2 [Camelina sativa]
 ref|XP_010491685.1| PREDICTED: ras-related protein RABH1e [Camelina sativa]
 gb|EFH47671.1| hypothetical protein ARALYDRAFT_487852 [Arabidopsis lyrata subsp. 
lyrata]
Length=207

 Score =   238 bits (606),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+E+VRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEDVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KHG28240.1| Ras-related RABH1b -like protein [Gossypium arboreum]
 gb|KJB49301.1| hypothetical protein B456_008G111500 [Gossypium raimondii]
Length=208

 Score =   238 bits (606),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAP+SALAKYKLVFLGDQSVGKTSII+RFMYDKFD  YQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPISALAKYKLVFLGDQSVGKTSIISRFMYDKFDNNYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTS W+EEVR ERGSDVII+LV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSNWIEEVRAERGSDVIIMLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006288665.1| hypothetical protein CARUB_v10001971mg [Capsella rubella]
 gb|EOA21563.1| hypothetical protein CARUB_v10001971mg [Capsella rubella]
Length=207

 Score =   238 bits (606),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+E+VRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEDVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|NP_196588.3| ras-related protein RABH1e [Arabidopsis thaliana]
 sp|Q9LFT9.1|RAH1E_ARATH RecName: Full=Ras-related protein RABH1e; Short=AtRABH1e [Arabidopsis 
thaliana]
 emb|CAB96682.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AED91514.1| ras-related protein RABH1e [Arabidopsis thaliana]
Length=207

 Score =   238 bits (606),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+E+VRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEDVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006366321.1| PREDICTED: ras-related protein RABH1e-like [Solanum tuberosum]
Length=207

 Score =   238 bits (606),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            M+ VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MSVVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010519539.1| PREDICTED: ras-related protein RABH1e-like [Tarenaya hassleriana]
Length=207

 Score =   238 bits (606),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSF NTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFFNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010267966.1| PREDICTED: ras-related protein RABH1e [Nelumbo nucifera]
Length=207

 Score =   238 bits (606),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAIVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|AFK47940.1| unknown [Lotus japonicus]
Length=191

 Score =   237 bits (604),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KWVEEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWVEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KHG21500.1| Ras-related RABH1e -like protein [Gossypium arboreum]
Length=208

 Score =   237 bits (605),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLED TVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDGTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKWVEEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWVEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|EPS66071.1| hypothetical protein M569_08708, partial [Genlisea aurea]
Length=206

 Score =   237 bits (605),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  347
            A VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ
Sbjct  1    AAVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  60

Query  348  LWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            LWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLVG
Sbjct  61   LWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLVG  120



>ref|XP_007205911.1| hypothetical protein PRUPE_ppa011539mg [Prunus persica]
 gb|EMJ07110.1| hypothetical protein PRUPE_ppa011539mg [Prunus persica]
Length=206

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KHN44343.1| Ras-related protein RABH1e [Glycine soja]
Length=207

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDT YQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTNYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_008234005.1| PREDICTED: ras-related protein RABH1e [Prunus mume]
Length=206

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KEH20835.1| RAB GTPase-like protein B1C [Medicago truncatula]
Length=207

 Score =   237 bits (605),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KWVEEVR ERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWVEEVRQERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KJB40310.1| hypothetical protein B456_007G060700 [Gossypium raimondii]
Length=164

 Score =   235 bits (600),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVI YDVA+RQSFLNTSKW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIAYDVANRQSFLNTSKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009342518.1| PREDICTED: ras-related protein RABH1e-like [Pyrus x bretschneideri]
Length=207

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009340511.1| PREDICTED: ras-related protein RABH1e [Pyrus x bretschneideri]
Length=207

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009404050.1| PREDICTED: ras-related protein RABH1e [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVI YDV++RQSFLNTSKW+EEVRTERG DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIAYDVSNRQSFLNTSKWIEEVRTERGGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>emb|CDP01457.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFLNTSKW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFLNTSKWIEEVRTERGNDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010453053.1| PREDICTED: ras-related protein RABH1e-like [Camelina sativa]
Length=207

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTIRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+E+VRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEDVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_004288200.1| PREDICTED: ras-related protein RABH1e [Fragaria vesca subsp. 
vesca]
Length=207

 Score =   237 bits (604),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_008343311.1| PREDICTED: ras-related protein RABH1e [Malus domestica]
Length=207

 Score =   237 bits (604),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT KWVEEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTXKWVEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_004504075.1| PREDICTED: ras-related protein RABH1e-like [Cicer arietinum]
Length=207

 Score =   236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KWVEEVR ERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWVEEVRQERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_002307084.1| Ras-related GTP-binding family protein [Populus trichocarpa]
 ref|XP_011031015.1| PREDICTED: ras-related protein RABH1e [Populus euphratica]
 gb|EEE94080.1| Ras-related GTP-binding family protein [Populus trichocarpa]
Length=207

 Score =   236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/121 (94%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTIRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERG DVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGGDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006428196.1| hypothetical protein CICLE_v10026499mg [Citrus clementina]
 ref|XP_006464236.1| PREDICTED: ras-related protein RABH1e-like [Citrus sinensis]
 gb|ESR41436.1| hypothetical protein CICLE_v10026499mg [Citrus clementina]
 gb|KDO56562.1| hypothetical protein CISIN_1g028546mg [Citrus sinensis]
Length=207

 Score =   236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTS+W+EEVRTERG DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSRWIEEVRTERGGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006399521.1| hypothetical protein EUTSA_v10014689mg [Eutrema salsugineum]
 gb|ESQ40974.1| hypothetical protein EUTSA_v10014689mg [Eutrema salsugineum]
Length=207

 Score =   236 bits (603),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTLRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+E+VRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEDVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KJB48803.1| hypothetical protein B456_008G090100 [Gossypium raimondii]
Length=156

 Score =   234 bits (598),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQS+GKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSIGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWMEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010087594.1| Ras-related protein [Morus notabilis]
 gb|EXB29449.1| Ras-related protein [Morus notabilis]
Length=207

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEV TERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVHTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010531376.1| PREDICTED: ras-related protein RABH1d [Tarenaya hassleriana]
Length=207

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/121 (94%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+R SFLNTS+W+EEVRTERG DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSRWIEEVRTERGGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KJB40307.1| hypothetical protein B456_007G060700 [Gossypium raimondii]
 gb|KJB40308.1| hypothetical protein B456_007G060700 [Gossypium raimondii]
 gb|KJB40309.1| hypothetical protein B456_007G060700 [Gossypium raimondii]
Length=208

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVI YDVA+RQSFLNTSKW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIAYDVANRQSFLNTSKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KHG08795.1| Ras-related RABH1e -like protein [Gossypium arboreum]
Length=208

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVI YDVA+RQSFLNTSKW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIAYDVANRQSFLNTSKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|EYU23989.1| hypothetical protein MIMGU_mgv1a013931mg [Erythranthe guttata]
Length=206

 Score =   236 bits (601),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/118 (97%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW
Sbjct  3    VSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  62

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLVG
Sbjct  63   DTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLVG  120



>gb|KFK25343.1| hypothetical protein AALP_AA8G100400 [Arabis alpina]
Length=206

 Score =   236 bits (601),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTLRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+E+VRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEDVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_004143465.1| PREDICTED: ras-related protein RABH1e-like [Cucumis sativus]
 ref|XP_004160133.1| PREDICTED: ras-related protein RABH1e-like [Cucumis sativus]
 ref|XP_008440593.1| PREDICTED: ras-related protein RABH1e [Cucumis melo]
 gb|KGN48748.1| hypothetical protein Csa_6G500400 [Cucumis sativus]
Length=207

 Score =   236 bits (601),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTIRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDV++RQSFLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFLNTTKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|EYU23990.1| hypothetical protein MIMGU_mgv1a013931mg [Erythranthe guttata]
Length=174

 Score =   234 bits (598),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +3

Query  171  PVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQL  350
             VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQL
Sbjct  2    AVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQL  61

Query  351  WDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            WDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+EEVRTERGSDVIIVLVG
Sbjct  62   WDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEEVRTERGSDVIIVLVG  120



>ref|XP_002461043.1| hypothetical protein SORBIDRAFT_02g039720 [Sorghum bicolor]
 gb|EER97564.1| hypothetical protein SORBIDRAFT_02g039720 [Sorghum bicolor]
Length=209

 Score =   235 bits (600),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/123 (93%), Positives = 120/123 (98%), Gaps = 2/123 (2%)
 Frame = +3

Query  165  MAP--VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTV  338
            MAP  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTV
Sbjct  1    MAPAVVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTV  60

Query  339  RLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIV  518
            RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV++RQSFLNTSKW++EVRTERG DVIIV
Sbjct  61   RLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFLNTSKWIDEVRTERGGDVIIV  120

Query  519  LVG  527
            LVG
Sbjct  121  LVG  123



>ref|XP_008670587.1| PREDICTED: ras-related protein RABH1b-like [Zea mays]
 tpg|DAA41500.1| TPA: hypothetical protein ZEAMMB73_483526 [Zea mays]
Length=209

 Score =   235 bits (600),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/123 (93%), Positives = 120/123 (98%), Gaps = 2/123 (2%)
 Frame = +3

Query  165  MAP--VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTV  338
            MAP  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTV
Sbjct  1    MAPAVVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTV  60

Query  339  RLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIV  518
            RLQLWDTAGQERFRSLIPSYIRDSSVAV+VYDV++RQSFLNTSKW++EVRTERG DVIIV
Sbjct  61   RLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFLNTSKWIDEVRTERGGDVIIV  120

Query  519  LVG  527
            LVG
Sbjct  121  LVG  123



>gb|AES72198.2| RAB GTPase-like protein B1C [Medicago truncatula]
Length=206

 Score =   235 bits (599),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            M  VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MVTVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KWVEEVR ERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWVEEVRAERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010680547.1| PREDICTED: ras-related protein RABH1e [Beta vulgaris subsp. vulgaris]
Length=207

 Score =   234 bits (598),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDV++RQSFL+TSKW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVSNRQSFLSTSKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>emb|CDX96987.1| BnaC09g46380D [Brassica napus]
Length=206

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA V+ LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMY+EDRT+RL
Sbjct  1    MAAVTPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYMEDRTLRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+E+VRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEDVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|ABK23720.1| unknown [Picea sitchensis]
Length=207

 Score =   234 bits (598),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVA+RQSFLNT++W+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVANRQSFLNTARWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_003552057.1| PREDICTED: ras-related protein RABH1e-like [Glycine max]
Length=207

 Score =   234 bits (597),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD  YQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDINYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFLNTNKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009122071.1| PREDICTED: ras-related protein RABH1e [Brassica rapa]
 gb|AAZ67607.1| 80A08_22 [Brassica rapa subsp. pekinensis]
 emb|CDX69850.1| BnaA10g21990D [Brassica napus]
Length=206

 Score =   234 bits (597),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA V+ LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMY+EDRT+RL
Sbjct  1    MAAVTPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYMEDRTLRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKW+E+VRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWIEDVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009131149.1| PREDICTED: ras-related protein RABH1e [Brassica rapa]
 emb|CDX81166.1| BnaC03g04200D [Brassica napus]
 emb|CDX78373.1| BnaA03g02850D [Brassica napus]
Length=207

 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA V+ LAK+KLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MAAVTPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTLRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKWVE+VRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWVEDVRTERGNDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_009390286.1| PREDICTED: ras-related protein RABH1e-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/121 (94%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDV++RQSFL+TSKW+EEV TERG DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVSNRQSFLSTSKWIEEVHTERGGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_002271220.2| PREDICTED: ras-related protein RABH1e [Vitis vinifera]
Length=207

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MAVVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDATYQATIGIDFLSKTMYLEDRTIRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDV +RQSFLNTSKW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVGNRQSFLNTSKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KHN31372.1| Ras-related protein RABH1e [Glycine soja]
Length=253

 Score =   234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD  YQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDINYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFLNT+KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFLNTNKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_008795552.1| PREDICTED: ras-related protein RABH1e [Phoenix dactylifera]
Length=207

 Score =   233 bits (593),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/121 (94%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDITYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFL+TSKW+EEV TERG DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLSTSKWIEEVHTERGGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010532473.1| PREDICTED: ras-related protein RABH1e-like [Tarenaya hassleriana]
Length=207

 Score =   233 bits (593),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDITYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT++W+EEVRTERG DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTTRWIEEVRTERGGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|AFK44388.1| unknown [Medicago truncatula]
Length=207

 Score =   233 bits (593),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/121 (94%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGD+SVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDRSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            Q WDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KWVEEVR ERGSDVIIVLV
Sbjct  61   QPWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWVEEVRQERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_002968288.1| rab family GTPase [Selaginella moellendorffii]
 ref|XP_002976089.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ22994.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ30542.1| rab family GTPase [Selaginella moellendorffii]
Length=209

 Score =   233 bits (593),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  347
            A VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRLQ
Sbjct  6    ATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQ  65

Query  348  LWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            LWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFLNT++WVEEVRTERGSDVIIVLVG
Sbjct  66   LWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFLNTARWVEEVRTERGSDVIIVLVG  125



>ref|XP_010941189.1| PREDICTED: ras-related protein RABH1b-like isoform X1 [Elaeis 
guineensis]
Length=225

 Score =   232 bits (591),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 119/138 (86%), Gaps = 17/138 (12%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVAS-----------------RQSFLNTSKW  473
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVAS                 RQ+FLNTSKW
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASMFLPHGHILQTSIARTCRQTFLNTSKW  120

Query  474  VEEVRTERGSDVIIVLVG  527
            +EEVRTERG DVIIVLVG
Sbjct  121  IEEVRTERGGDVIIVLVG  138



>gb|AFK36124.1| unknown [Medicago truncatula]
Length=180

 Score =   230 bits (586),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/121 (94%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGD+SVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKYKLVFLGDRSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            Q WDTAGQERFRSLIPSYIRDSSVAVIVYDVA RQSFLNT+KWVEEVR ERGSDVIIVLV
Sbjct  61   QPWDTAGQERFRSLIPSYIRDSSVAVIVYDVAHRQSFLNTNKWVEEVRQERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006404685.1| hypothetical protein EUTSA_v10000663mg [Eutrema salsugineum]
 gb|ESQ46138.1| hypothetical protein EUTSA_v10000663mg [Eutrema salsugineum]
Length=207

 Score =   231 bits (589),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+R SFLNTSKW+EEVRTER  DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRTERAGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_002878607.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54866.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=207

 Score =   231 bits (589),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+R SFLNTSKW+EEVRTER  DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRTERAGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|KFK32828.1| hypothetical protein AALP_AA6G292500 [Arabis alpina]
Length=207

 Score =   231 bits (588),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+R SFLNTSKW+EEVRTER  DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRTERAGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>emb|CDY23446.1| BnaC04g49740D [Brassica napus]
Length=601

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 120/121 (99%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  394  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  453

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNT+KW++EVRTERGSDVI+VLV
Sbjct  454  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTAKWIDEVRTERGSDVIVVLV  513

Query  525  G  527
            G
Sbjct  514  G  514



>ref|XP_010941191.1| PREDICTED: ras-related protein RABH1b-like isoform X3 [Elaeis 
guineensis]
Length=173

 Score =   229 bits (584),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 119/138 (86%), Gaps = 17/138 (12%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVAS-----------------RQSFLNTSKW  473
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVAS                 RQ+FLNTSKW
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASMFLPHGHILQTSIARTCRQTFLNTSKW  120

Query  474  VEEVRTERGSDVIIVLVG  527
            +EEVRTERG DVIIVLVG
Sbjct  121  IEEVRTERGGDVIIVLVG  138



>ref|XP_001759775.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
 gb|EDQ75279.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
Length=211

 Score =   230 bits (586),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  347
            A VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRLQ
Sbjct  8    ATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQ  67

Query  348  LWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            LWDTAGQERFRSLIPSYIRDSSVAV+VYDV++RQSF+NT++WVEEVRTERGSDVII+LVG
Sbjct  68   LWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFMNTARWVEEVRTERGSDVIIMLVG  127



>ref|XP_005645434.1| ras-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20890.1| ras-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=212

 Score =   230 bits (586),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRLQLW
Sbjct  7    VSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLW  66

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAV+VYDV++RQSFLNT++W+EEVRTERGSDVI+VLVG
Sbjct  67   DTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFLNTARWIEEVRTERGSDVIVVLVG  124



>ref|NP_179816.1| RAB GTPase-like protein H1D [Arabidopsis thaliana]
 sp|Q9SID8.1|RAH1D_ARATH RecName: Full=Ras-related protein RABH1d; Short=AtRABH1d [Arabidopsis 
thaliana]
 gb|AAD23614.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AEC07288.1| RAB GTPase-like protein H1D [Arabidopsis thaliana]
Length=207

 Score =   230 bits (586),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+R SFLNTSKW+EEVR ER  DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERAGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_001785261.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
 gb|EDQ49913.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
Length=213

 Score =   230 bits (586),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRLQLW
Sbjct  12   VSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLW  71

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAV+VYDV++RQSFLNT++WVEEVRTERGSDVII+LVG
Sbjct  72   DTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFLNTARWVEEVRTERGSDVIIMLVG  129



>ref|XP_009112539.1| PREDICTED: ras-related protein RABH1d [Brassica rapa]
 emb|CDY13772.1| BnaA09g42740D [Brassica napus]
Length=207

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDV++R SFLNTSKW+EEVRTER  DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRLSFLNTSKWIEEVRTERAGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_006853127.1| hypothetical protein AMTR_s00038p00155900 [Amborella trichopoda]
 gb|ERN14594.1| hypothetical protein AMTR_s00038p00155900 [Amborella trichopoda]
Length=335

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            M  VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MVTVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVI YDVA+RQSFLNT KW+EEVRTERGSDVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIAYDVANRQSFLNTPKWIEEVRTERGSDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_001783133.1| predicted protein [Physcomitrella patens]
 gb|EDQ52070.1| predicted protein [Physcomitrella patens]
Length=209

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            VS LAKYKLVFLGDQSVGKTS+ITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRLQLW
Sbjct  8    VSPLAKYKLVFLGDQSVGKTSVITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLW  67

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAV+VYDV++RQSFLNT++WVEEVRTERGSDVII+LVG
Sbjct  68   DTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFLNTARWVEEVRTERGSDVIIMLVG  125



>ref|XP_010472219.1| PREDICTED: ras-related protein RABH1d [Camelina sativa]
Length=207

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+R SFLNTSKW+EEVR ER  DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERAGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010429146.1| PREDICTED: ras-related protein RABH1d-like [Camelina sativa]
Length=207

 Score =   229 bits (584),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDVA+R SFLNTSKW+EEVR ER  DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERAGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010269259.1| PREDICTED: ras-related protein RABH1e-like isoform X1 [Nelumbo 
nucifera]
Length=214

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 119/128 (93%), Gaps = 7/128 (5%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QL-------WDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGS  503
            QL       WDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFLNTSKW+EEVRTERGS
Sbjct  61   QLWYAFFIFWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFLNTSKWIEEVRTERGS  120

Query  504  DVIIVLVG  527
            DVIIVLVG
Sbjct  121  DVIIVLVG  128



>emb|CDX76936.1| BnaC08g35220D [Brassica napus]
Length=275

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDV++R SFLNTSKW+EEVRTER  DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRLSFLNTSKWIEEVRTERAGDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_010269261.1| PREDICTED: ras-related protein RABH1e-like isoform X3 [Nelumbo 
nucifera]
Length=186

 Score =   228 bits (580),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 119/128 (93%), Gaps = 7/128 (5%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QL-------WDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGS  503
            QL       WDTAGQERFRSLIPSYIRDSSVAV+VYDVA+RQSFLNTSKW+EEVRTERGS
Sbjct  61   QLWYAFFIFWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRQSFLNTSKWIEEVRTERGS  120

Query  504  DVIIVLVG  527
            DVIIVLVG
Sbjct  121  DVIIVLVG  128



>gb|EYU31009.1| hypothetical protein MIMGU_mgv1a022220mg [Erythranthe guttata]
Length=169

 Score =   226 bits (577),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            VS L KYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRT+RLQLW
Sbjct  5    VSPLTKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTIRLQLW  64

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT KW EEVRTERG DVIIVLVG
Sbjct  65   DTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTMKWTEEVRTERGRDVIIVLVG  122



>ref|XP_009338093.1| PREDICTED: ras-related protein RABH1e-like [Pyrus x bretschneideri]
Length=207

 Score =   228 bits (581),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMY   RTVRL
Sbjct  1    MATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYTMYRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNT+KW+EEVRTERG+DVIIVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTNKWIEEVRTERGTDVIIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_001782940.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
 gb|EDQ52238.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
Length=213

 Score =   228 bits (581),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  347
            A VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRLQ
Sbjct  10   ATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQ  69

Query  348  LWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            LWDTAGQERFRSLIPSYIRDSSVAV+VYDV++RQSFLNTS+W+EEV TERGSDVII+LVG
Sbjct  70   LWDTAGQERFRSLIPSYIRDSSVAVVVYDVSNRQSFLNTSRWIEEVLTERGSDVIIMLVG  129



>ref|XP_001754098.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
 gb|EDQ80999.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
Length=211

 Score =   228 bits (580),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD +YQATIGIDFLSKTMYLEDRTVRLQLW
Sbjct  10   VSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNSYQATIGIDFLSKTMYLEDRTVRLQLW  69

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAVIVYDV++RQSFLNT++WVEEVRTERG+DVI++LVG
Sbjct  70   DTAGQERFRSLIPSYIRDSSVAVIVYDVSNRQSFLNTARWVEEVRTERGNDVIVMLVG  127



>ref|XP_005844627.1| GTP binding protein [Chlorella variabilis]
 gb|EFN52525.1| GTP binding protein [Chlorella variabilis]
Length=211

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            V  LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW
Sbjct  6    VQPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  65

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAV+VYDV SRQSFLN  +WVEEVR ERGSDVIIVLVG
Sbjct  66   DTAGQERFRSLIPSYIRDSSVAVVVYDVTSRQSFLNIQRWVEEVRAERGSDVIIVLVG  123



>ref|XP_004985388.1| PREDICTED: ras-related protein RABH1e-like [Setaria italica]
Length=214

 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPV-SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVR  341
            MAPV SALAKYKLVFLGDQ+VGKT+IITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVR
Sbjct  1    MAPVVSALAKYKLVFLGDQAVGKTAIITRFMYDKFDDTYQATIGIDFLSKTMYLEDRTVR  60

Query  342  LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVL  521
            LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDV  RQSFLNTSKW+EEV T+RG DV+I L
Sbjct  61   LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFLNTSKWIEEVNTQRGGDVLIFL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>ref|XP_002948506.1| RabH/Rab6 [Volvox carteri f. nagariensis]
 gb|EFJ50381.1| RabH/Rab6 [Volvox carteri f. nagariensis]
Length=211

 Score =   226 bits (575),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 115/121 (95%), Gaps = 1/121 (1%)
 Frame = +3

Query  168  APV-SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            AP  S LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  3    APAPSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  62

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYD+ +RQSFLNT++W++EVRTERG+DVII LV
Sbjct  63   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNRQSFLNTARWIQEVRTERGNDVIIFLV  122

Query  525  G  527
            G
Sbjct  123  G  123



>ref|XP_010052745.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein RABH1b [Eucalyptus 
grandis]
Length=210

 Score =   225 bits (574),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 113/121 (93%), Gaps = 6/121 (5%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVG       FMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  9    MAPVSALAKYKLVFLGDQSVGX------FMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  62

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  63   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  122

Query  525  G  527
            G
Sbjct  123  G  123



>ref|XP_001690213.1| small rab-related GTPase [Chlamydomonas reinhardtii]
 gb|EDP09951.1| small rab-related GTPase [Chlamydomonas reinhardtii]
Length=211

 Score =   225 bits (573),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  347
            A  S LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRLQ
Sbjct  4    ATTSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQ  63

Query  348  LWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            LWDTAGQERFRSLIPSYIRDSSVAV+VYD+ +RQSFLNT++W++EVRTERG+DVII LVG
Sbjct  64   LWDTAGQERFRSLIPSYIRDSSVAVVVYDITNRQSFLNTARWIQEVRTERGNDVIIFLVG  123



>ref|XP_008674341.1| PREDICTED: LOC100281229 isoform X1 [Zea mays]
Length=188

 Score =   224 bits (571),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLG+Q+VGKT+IITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSALAKYKLVFLGNQAVGKTAIITRFMYDKFDDTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDV  RQSFLNTSKW+EEV T+RG DV+I LV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFLNTSKWIEEVNTQRGGDVLIFLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>gb|ABF94403.1| Ras-related protein Rab-6A, putative, expressed [Oryza sativa 
Japonica Group]
Length=215

 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPV-SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVR  341
            MAPV SALAKYKLVFLGDQ+VGKT+IITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVR
Sbjct  1    MAPVVSALAKYKLVFLGDQAVGKTAIITRFMYDKFDATYQATIGIDFLSKTMYLEDRTVR  60

Query  342  LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVL  521
            LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDV  RQSFL+ SKW+EEV T+RG DVIIVL
Sbjct  61   LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFLSISKWIEEVNTQRGGDVIIVL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>gb|ABF94402.1| Ras-related protein Rab-6A, putative, expressed [Oryza sativa 
Japonica Group]
Length=215

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPV-SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVR  341
            MAPV SALAKYKLVFLGDQ+VGKT+IITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVR
Sbjct  1    MAPVVSALAKYKLVFLGDQAVGKTAIITRFMYDKFDATYQATIGIDFLSKTMYLEDRTVR  60

Query  342  LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVL  521
            LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDV  +QSFL+ SKW+EEV T+RG DVIIVL
Sbjct  61   LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTGKQSFLSISKWIEEVNTQRGGDVIIVL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>ref|XP_006649538.1| PREDICTED: ras-related protein RABH1e-like [Oryza brachyantha]
Length=214

 Score =   224 bits (571),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLGDQ+VGKT+IITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSALAKYKLVFLGDQAVGKTAIITRFMYDKFDATYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDV  RQSF +TSKW+EEV T+RG DV+IVLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFFSTSKWIEEVNTQRGGDVLIVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_002500129.1| ras-related gtp-binding protein, alternative splice [Micromonas 
sp. RCC299]
 gb|ACO61387.1| ras-related gtp-binding protein, alternative splice [Micromonas 
sp. RCC299]
Length=204

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            M+ V+ +AKYKLVFLGDQSVGKTSII+RFMYDKFD +YQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MSTVTPMAKYKLVFLGDQSVGKTSIISRFMYDKFDNSYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDV+SR SF NTS+W++EVRTERGSDVI+VLV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVSSRSSFANTSRWIDEVRTERGSDVIVVLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|NP_001147620.1| LOC100281229 [Zea mays]
 gb|ACG28130.1| ras-related protein Rab-6A [Zea mays]
 tpg|DAA43832.1| TPA: hypothetical protein ZEAMMB73_661349 [Zea mays]
Length=213

 Score =   224 bits (570),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAKYKLVFLG+Q+VGKT+IITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAVVSALAKYKLVFLGNQAVGKTAIITRFMYDKFDDTYQATIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIVYDV  RQSFLNTSKW+EEV T+RG DV+I LV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFLNTSKWIEEVNTQRGGDVLIFLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_005538068.1| small GTP-binding protein of Rab family, Rab6 [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82032.1| small GTP-binding protein of Rab family, Rab6 [Cyanidioschyzon 
merolae strain 10D]
Length=211

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  347
            A  +AL+KYKLVFLGDQ+VGKTSIITRFMYDKFD  YQATIGIDFLSKTMYLEDRTVRLQ
Sbjct  7    ATAAALSKYKLVFLGDQAVGKTSIITRFMYDKFDNNYQATIGIDFLSKTMYLEDRTVRLQ  66

Query  348  LWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            LWDTAGQERFRSLIPSYIRDSSVAV+VYDV SR+SFLNT+KW+EEVR ERG++VIIVLVG
Sbjct  67   LWDTAGQERFRSLIPSYIRDSSVAVVVYDVTSRRSFLNTAKWIEEVRNERGNEVIIVLVG  126



>gb|AAZ66935.1| 117M18_16 [Brassica rapa]
Length=216

 Score =   223 bits (567),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 119/130 (92%), Gaps = 9/130 (7%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA V+ LAK+KLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MAAVTPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTLRL  60

Query  345  Q--LW-------DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTER  497
            Q  LW       DTAGQERFRSLIPSYIRDSSVAVIVYDVA+RQSFLNTSKWVE+VRTER
Sbjct  61   QLCLWCLICAFQDTAGQERFRSLIPSYIRDSSVAVIVYDVANRQSFLNTSKWVEDVRTER  120

Query  498  GSDVIIVLVG  527
            G+DVIIVLVG
Sbjct  121  GNDVIIVLVG  130



>ref|XP_006411786.1| hypothetical protein EUTSA_v10026225mg [Eutrema salsugineum]
 dbj|BAJ34631.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53239.1| hypothetical protein EUTSA_v10026225mg [Eutrema salsugineum]
Length=213

 Score =   222 bits (566),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAK+KLVFLGDQSVGKTSIITRFMYDKFDTTYQ TIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAAVSALAKFKLVFLGDQSVGKTSIITRFMYDKFDTTYQPTIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGS-DVIIVL  521
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDVA+RQ+FLN SKW+++V  ERGS DVIIVL
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRQTFLNISKWIDDVHRERGSGDVIIVL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>gb|AGN12807.1| Ras-related protein RABH1C [Leavenworthia alabamica]
Length=214

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 115/122 (94%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAK+KLVFLGDQSVGKTSIITRFMYDKFDTTYQ TIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAGVSPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTTYQPTIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERG-SDVIIVL  521
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDV+ RQSFLNTSKW+E+VR ERG  DVIIVL
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVSKRQSFLNTSKWIEDVRRERGQGDVIIVL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>ref|XP_003057806.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57757.1| predicted protein [Micromonas pusilla CCMP1545]
Length=215

 Score =   222 bits (565),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  347
            A V+ +AKYKLVFLGDQSVGKTS+I+RFMYDKFD +YQATIGIDFLSKTMYLEDRTVRLQ
Sbjct  4    AGVTPMAKYKLVFLGDQSVGKTSVISRFMYDKFDNSYQATIGIDFLSKTMYLEDRTVRLQ  63

Query  348  LWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            LWDTAGQERFRSLIPSYIRDSSVAV+VYDV+SR SFLN ++W++EVRTERGSDVIIVLVG
Sbjct  64   LWDTAGQERFRSLIPSYIRDSSVAVVVYDVSSRASFLNCARWIDEVRTERGSDVIIVLVG  123



>ref|XP_011400864.1| Ras-related protein RABH1e [Auxenochlorella protothecoides]
 gb|KFM27875.1| Ras-related protein RABH1e [Auxenochlorella protothecoides]
Length=211

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            V+ LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW
Sbjct  7    VTPLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  66

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAV+VYDV +RQSF+N  +WVEEVR ERGSDVIIV VG
Sbjct  67   DTAGQERFRSLIPSYIRDSSVAVVVYDVTNRQSFVNIQRWVEEVRGERGSDVIIVAVG  124



>ref|XP_001780867.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
 gb|EDQ54346.1| Rab6/RabH-family small GTPase [Physcomitrella patens]
Length=210

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            +S L+KYKLVFLGDQSVGKTSIITRFMYDKFD TYQ TIGIDFLSKTMYLEDRTVRLQLW
Sbjct  6    ISPLSKYKLVFLGDQSVGKTSIITRFMYDKFDQTYQPTIGIDFLSKTMYLEDRTVRLQLW  65

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAVIVYDV++RQSF+NT++WVEEVR ERG DV++VLVG
Sbjct  66   DTAGQERFRSLIPSYIRDSSVAVIVYDVSNRQSFVNTARWVEEVRAERGKDVVLVLVG  123



>gb|KFK30558.1| hypothetical protein AALP_AA7G277600 [Arabis alpina]
Length=214

 Score =   221 bits (563),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 116/122 (95%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAK+KLVFLGDQSVGKTSIITRFMYDKFDTTYQ TIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTTYQPTIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGS-DVIIVL  521
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDV++RQ+FLNTSKW+++V  ERGS DVIIVL
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVSNRQTFLNTSKWIDDVHRERGSNDVIIVL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>ref|NP_195699.1| Ras-related protein RABH1c [Arabidopsis thaliana]
 sp|Q9SMR4.1|RAH1C_ARATH RecName: Full=Ras-related protein RABH1c; Short=AtRABH1c [Arabidopsis 
thaliana]
 gb|AAK17177.1|AF325109_1 small GTP-binding protein-like [Arabidopsis thaliana]
 gb|AAK62397.1|AF386952_1 small GTP-binding protein-like [Arabidopsis thaliana]
 emb|CAB38902.1| small GTP-binding protein-like [Arabidopsis thaliana]
 emb|CAB80652.1| small GTP-binding protein-like [Arabidopsis thaliana]
 gb|AAN15362.1| small GTP-binding protein-like [Arabidopsis thaliana]
 gb|AEE87134.1| Ras-related protein RABH1c [Arabidopsis thaliana]
Length=214

 Score =   221 bits (562),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 116/122 (95%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAK+KLVFLGDQSVGKTSIITRFMYDKFDTTYQ TIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTTYQPTIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERG-SDVIIVL  521
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDV++RQ+FLNTSKW+E+V  ERG S+VIIVL
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVSNRQTFLNTSKWIEDVHRERGQSNVIIVL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>ref|XP_002866892.1| hypothetical protein ARALYDRAFT_912477 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43151.1| hypothetical protein ARALYDRAFT_912477 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score =   220 bits (561),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 116/122 (95%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAK+KLVFLGDQSVGKTSIITRFMYDKFDTTYQ TIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAAVSPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTTYQPTIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERG-SDVIIVL  521
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDV++RQ+FLNTSKW+++V  ERG SDVIIVL
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVSNRQTFLNTSKWIDDVHRERGQSDVIIVL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>gb|KDD77143.1| Ras family protein [Helicosporidium sp. ATCC 50920]
Length=204

 Score =   220 bits (560),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +3

Query  183  LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTA  362
            LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTA
Sbjct  3    LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTA  62

Query  363  GQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            GQERFRSLIPSYIRDSSVAV+V+DV +RQSFL+ S+W EEVR ERGSDVI+VLVG
Sbjct  63   GQERFRSLIPSYIRDSSVAVVVFDVTNRQSFLSVSRWTEEVRAERGSDVILVLVG  117



>dbj|BAJ99126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=298

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPV-SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVR  341
            MAPV SALAKYKLVFLGDQ+VGKT+IITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVR
Sbjct  85   MAPVVSALAKYKLVFLGDQAVGKTAIITRFMYDKFDATYQATIGIDFLSKTMYLEDRTVR  144

Query  342  LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVL  521
            LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDV   QSFL+TSKW++EV T RG DV+IVL
Sbjct  145  LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDTQSFLHTSKWIDEVNTARGKDVLIVL  204

Query  522  VG  527
            VG
Sbjct  205  VG  206



>ref|XP_003558615.2| PREDICTED: ras-related protein RABH1e-like isoform X2 [Brachypodium 
distachyon]
Length=224

 Score =   220 bits (560),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 2/123 (2%)
 Frame = +3

Query  165  MAPV-SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVR  341
            MAPV SALAKYKLVFLGDQ+VGKT+IITRFMYDKFD TYQATIGIDFLSKTMYLEDRT+R
Sbjct  10   MAPVVSALAKYKLVFLGDQAVGKTAIITRFMYDKFDATYQATIGIDFLSKTMYLEDRTIR  69

Query  342  LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTER-GSDVIIV  518
            LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDV  RQSFL+TS W++EV+TER G+DV+IV
Sbjct  70   LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFLHTSTWIDEVKTERAGTDVLIV  129

Query  519  LVG  527
            LVG
Sbjct  130  LVG  132



>dbj|BAJ92647.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPV-SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVR  341
            MAPV SALAKYKLVFLGDQ+VGKT+IITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVR
Sbjct  61   MAPVVSALAKYKLVFLGDQAVGKTAIITRFMYDKFDATYQATIGIDFLSKTMYLEDRTVR  120

Query  342  LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVL  521
            LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDV   QSFL+TSKW++EV T RG DV+IVL
Sbjct  121  LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDTQSFLHTSKWIDEVNTARGKDVLIVL  180

Query  522  VG  527
            VG
Sbjct  181  VG  182



>ref|XP_010437115.1| PREDICTED: ras-related protein RABH1c [Camelina sativa]
Length=212

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAK+KLVFLGDQSVGKTSIITRFMYDKFDT YQ TIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAAVSPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTIYQPTIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERG-SDVIIVL  521
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDVA+RQ+FLNTSKW+E+V  ERG  DVIIVL
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRQTFLNTSKWIEDVHRERGQGDVIIVL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>ref|XP_010431970.1| PREDICTED: ras-related protein RABH1c-like [Camelina sativa]
Length=210

 Score =   219 bits (558),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAK+KLVFLGDQSVGKTSIITRFMYDKFDT YQ TIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAAVSPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTIYQPTIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERG-SDVIIVL  521
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDVA+RQ+FLNTSKW+E+V  ERG  DVIIVL
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRQTFLNTSKWIEDVHRERGQGDVIIVL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>ref|XP_006284510.1| hypothetical protein CARUB_v10005710mg [Capsella rubella]
 gb|EOA17408.1| hypothetical protein CARUB_v10005710mg [Capsella rubella]
Length=216

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAK+KLVFLGDQSVGKTSIITRFMYDKFDT YQ TIGIDFLSKTMYLEDRTVRL
Sbjct  1    MATVSPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTIYQPTIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERG-SDVIIVL  521
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDVA+RQ+FLNTSKW+E+V  ERG  DVIIVL
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRQTFLNTSKWIEDVHRERGQGDVIIVL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>emb|CBJ25951.1| Rab6, RAB family GTPase [Ectocarpus siliculosus]
Length=217

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            ++ LAKYKLVFLGDQSVGKTSIITRFMYD FD  YQATIGIDFLSKTMYLEDRTVRLQLW
Sbjct  16   IAPLAKYKLVFLGDQSVGKTSIITRFMYDNFDKNYQATIGIDFLSKTMYLEDRTVRLQLW  75

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAVIVYD+ +R SFLNTSKW+E+VR ERG+DV+++LVG
Sbjct  76   DTAGQERFRSLIPSYIRDSSVAVIVYDITNRASFLNTSKWIEDVRNERGNDVVMMLVG  133



>gb|EYU40320.1| hypothetical protein MIMGU_mgv1a013860mg [Erythranthe guttata]
Length=198

 Score =   218 bits (554),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 110/121 (91%), Gaps = 10/121 (8%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQ          TMYLEDRTVRL
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQ----------TMYLEDRTVRL  50

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSKW+EEVRTERGSDVIIVLV
Sbjct  51   QLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSKWIEEVRTERGSDVIIVLV  110

Query  525  G  527
            G
Sbjct  111  G  111



>ref|XP_002181536.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46750.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=236

 Score =   219 bits (557),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            ++ LAKYKLVFLGDQSVGKTSIITRFMYD FD  YQATIGIDFLSKTMYLEDRTVRLQLW
Sbjct  28   LAPLAKYKLVFLGDQSVGKTSIITRFMYDNFDRHYQATIGIDFLSKTMYLEDRTVRLQLW  87

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAV+VYDV++R SFLNT+KWVE+VR ERG+DV+I LVG
Sbjct  88   DTAGQERFRSLIPSYIRDSSVAVVVYDVSNRSSFLNTAKWVEDVRAERGNDVVICLVG  145



>ref|XP_010446557.1| PREDICTED: ras-related protein RABH1c-like [Camelina sativa]
Length=211

 Score =   217 bits (553),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VS LAK+KLVFLGDQSVGKTSIITRFMYDKFDT YQ TIGIDFLSKTMYLEDRTVRL
Sbjct  1    MAAVSPLAKFKLVFLGDQSVGKTSIITRFMYDKFDTIYQPTIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERG-SDVIIVL  521
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDVA+R++FLNTSKW+E+V  ERG  DVIIVL
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRKTFLNTSKWIEDVHRERGQGDVIIVL  120

Query  522  VG  527
            VG
Sbjct  121  VG  122



>ref|XP_002288400.1| rab-like rab-type small G protein [Thalassiosira pseudonana CCMP1335]
 gb|EED93836.1| rab-like rab-type small G protein [Thalassiosira pseudonana CCMP1335]
Length=202

 Score =   217 bits (552),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 111/121 (92%), Gaps = 3/121 (2%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            +AP   LAKYKLVFLGDQSVGKTSIITRFMYD FD  YQATIGIDFLSKTMYLEDRTVRL
Sbjct  24   LAP---LAKYKLVFLGDQSVGKTSIITRFMYDNFDRHYQATIGIDFLSKTMYLEDRTVRL  80

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYDV +R SFLNTSKWVE+VR ERG+DV+I LV
Sbjct  81   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDVTNRASFLNTSKWVEDVRAERGNDVVICLV  140

Query  525  G  527
            G
Sbjct  141  G  141



>ref|XP_001751907.1| predicted protein [Physcomitrella patens]
 gb|EDQ83342.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 112/121 (93%), Gaps = 5/121 (4%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            +A VS LAKYKLVFLGDQSVGKTSIITRFMYDKFD TYQATIGIDFLSKTMYLEDRTVRL
Sbjct  5    IATVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRL  64

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYD     SFLNT +WVEEVRTERGSDVII+LV
Sbjct  65   QLWDTAGQERFRSLIPSYIRDSSVAVVVYD-----SFLNTVRWVEEVRTERGSDVIIMLV  119

Query  525  G  527
            G
Sbjct  120  G  120



>emb|CDY63926.1| BnaC07g51320D [Brassica napus]
Length=214

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 2/123 (2%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAK+KLVFLGDQSVGKTSIITRFMYDKFDT+YQ TIGIDFLSKTMYLEDRTVRL
Sbjct  1    MASVSALAKFKLVFLGDQSVGKTSIITRFMYDKFDTSYQPTIGIDFLSKTMYLEDRTVRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERG--SDVIIV  518
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDVA+RQ+FLN  KW+++V  ERG   DVIIV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRQTFLNIPKWIDDVHRERGGSGDVIIV  120

Query  519  LVG  527
            LVG
Sbjct  121  LVG  123



>gb|EPB88187.1| Ras-like protein Rab-6B [Mucor circinelloides f. circinelloides 
1006PhL]
Length=205

 Score =   216 bits (549),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  177  SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWD  356
            S L KYKLVFLG+QSVGKTS+ITRFMYD FD TYQATIGIDFLSKTMYLED+TVRLQLWD
Sbjct  8    SPLRKYKLVFLGEQSVGKTSLITRFMYDTFDNTYQATIGIDFLSKTMYLEDKTVRLQLWD  67

Query  357  TAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            TAGQERFRSLIPSYIRDSSVAVIVYD+++RQSF+NTSKW+++VR ERG DVIIVLVG
Sbjct  68   TAGQERFRSLIPSYIRDSSVAVIVYDISNRQSFMNTSKWIDDVRAERGDDVIIVLVG  124



>ref|XP_001418939.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97232.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=205

 Score =   216 bits (549),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  347
            A V+ L KYKLVFLGDQSVGKTSII+RFMYDKFD +YQATIGIDFLSKTMYLEDRTVRLQ
Sbjct  6    AGVTPLPKYKLVFLGDQSVGKTSIISRFMYDKFDNSYQATIGIDFLSKTMYLEDRTVRLQ  65

Query  348  LWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            LWDTAGQERFRSLIPSYIRDSSVAVIVYDV+SR SF+N++KW+ EV+ ERG DVII LVG
Sbjct  66   LWDTAGQERFRSLIPSYIRDSSVAVIVYDVSSRASFVNSAKWISEVKAERGGDVIIALVG  125



>ref|XP_008607023.1| Ras-like protein Rab-6A [Saprolegnia diclina VS20]
 gb|EQC39751.1| Ras-like protein Rab-6A [Saprolegnia diclina VS20]
Length=214

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            ++ LAKYKLVFLGDQ VGKTS+ITRFMYD FD  YQATIGIDFLSKTMYLEDRTVRLQLW
Sbjct  12   IAPLAKYKLVFLGDQGVGKTSMITRFMYDTFDNAYQATIGIDFLSKTMYLEDRTVRLQLW  71

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAV+VYD+ +R SFLNTSKW+E+VR ERG DV+I+LVG
Sbjct  72   DTAGQERFRSLIPSYIRDSSVAVVVYDITNRASFLNTSKWIEDVRAERGQDVVIMLVG  129



>ref|XP_008902762.1| hypothetical protein PPTG_09511 [Phytophthora parasitica INRA-310]
 gb|ETI51264.1| hypothetical protein F443_05331 [Phytophthora parasitica P1569]
 gb|ETK91160.1| hypothetical protein L915_05192 [Phytophthora parasitica]
 gb|ETL44560.1| hypothetical protein L916_05148 [Phytophthora parasitica]
 gb|ETM50890.1| hypothetical protein L914_05147 [Phytophthora parasitica]
 gb|ETN11830.1| hypothetical protein PPTG_09511 [Phytophthora parasitica INRA-310]
 gb|ETO80018.1| hypothetical protein F444_05377 [Phytophthora parasitica P1976]
 gb|ETP21029.1| hypothetical protein F441_05338 [Phytophthora parasitica CJ01A1]
 gb|ETP48978.1| hypothetical protein F442_05382 [Phytophthora parasitica P10297]
Length=242

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            ++ LAKYKLVFLGDQ VGKTS+ITRFMYD FD  YQATIGIDFLSKTMY+EDRTVRLQLW
Sbjct  41   IAPLAKYKLVFLGDQGVGKTSMITRFMYDTFDNAYQATIGIDFLSKTMYMEDRTVRLQLW  100

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAV+VYD+ +R SFLNTSKW+E+VRTERG DV+I+LVG
Sbjct  101  DTAGQERFRSLIPSYIRDSSVAVVVYDITNRASFLNTSKWIEDVRTERGQDVVIMLVG  158



>ref|XP_009534275.1| hypothetical protein PHYSODRAFT_254677, partial [Phytophthora 
sojae]
 gb|EGZ09414.1| hypothetical protein PHYSODRAFT_254677 [Phytophthora sojae]
Length=202

 Score =   215 bits (548),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            ++ LAKYKLVFLGDQ VGKTS+ITRFMYD FD  YQATIGIDFLSKTMY+EDRTVRLQLW
Sbjct  1    IAPLAKYKLVFLGDQGVGKTSMITRFMYDTFDNAYQATIGIDFLSKTMYMEDRTVRLQLW  60

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAV+VYD+ +R SFLNTSKW+E+VRTERG DV+I+LVG
Sbjct  61   DTAGQERFRSLIPSYIRDSSVAVVVYDITNRASFLNTSKWIEDVRTERGQDVVIMLVG  118



>ref|XP_010229052.1| PREDICTED: ras-related protein RABH1e-like isoform X1 [Brachypodium 
distachyon]
Length=343

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 2/123 (2%)
 Frame = +3

Query  165  MAPV-SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVR  341
            MAPV SALAKYKLVFLGDQ+VGKT+IITRFMYDKFD TYQATIGIDFLSKTMYLEDRT+R
Sbjct  129  MAPVVSALAKYKLVFLGDQAVGKTAIITRFMYDKFDATYQATIGIDFLSKTMYLEDRTIR  188

Query  342  LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTER-GSDVIIV  518
            LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDV  RQSFL+TS W++EV+TER G+DV+IV
Sbjct  189  LQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVTDRQSFLHTSTWIDEVKTERAGTDVLIV  248

Query  519  LVG  527
            LVG
Sbjct  249  LVG  251



>gb|EJK61478.1| hypothetical protein THAOC_18027, partial [Thalassiosira oceanica]
Length=307

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  347
            A V+ LAKYKLVFLGDQSVGKTSIITRFMYD FD  YQATIGIDFLSKTMYLEDRTVRLQ
Sbjct  96   ASVAPLAKYKLVFLGDQSVGKTSIITRFMYDNFDRHYQATIGIDFLSKTMYLEDRTVRLQ  155

Query  348  LWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            LWDTAGQERFRSLIPSYIRDSSVAV+VYDV +R SFLNTSKWVE+VR ERG+DV+I LVG
Sbjct  156  LWDTAGQERFRSLIPSYIRDSSVAVVVYDVTNRASFLNTSKWVEDVRAERGNDVVICLVG  215



>ref|XP_009138550.1| PREDICTED: ras-related protein RABH1c isoform X1 [Brassica rapa]
 ref|XP_009138551.1| PREDICTED: ras-related protein RABH1c isoform X2 [Brassica rapa]
Length=258

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 2/123 (2%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAK+KLVFLGDQSVGKTSIITRFMYDKFDT+YQ TIGIDFLSKTMYLEDRTVRL
Sbjct  45   MASVSALAKFKLVFLGDQSVGKTSIITRFMYDKFDTSYQPTIGIDFLSKTMYLEDRTVRL  104

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERG--SDVIIV  518
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDVA+RQ+FLN  KW+++V  ERG   DVIIV
Sbjct  105  QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRQTFLNIPKWIDDVHRERGGSGDVIIV  164

Query  519  LVG  527
            LVG
Sbjct  165  LVG  167



>gb|EMS25094.1| RAS small monomeric GTPase Rab6 [Rhodosporidium toruloides NP11]
 emb|CDR42746.1| RHTO0S07e03576g1_1 [Rhodosporidium toruloides]
Length=296

 Score =   218 bits (554),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +3

Query  177  SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWD  356
            +AL K+KLVFLG+QSVGKTS+ITRFMYD FD TYQATIGIDFLSKTMYLEDRTVRLQLWD
Sbjct  96   AALKKFKLVFLGEQSVGKTSLITRFMYDTFDNTYQATIGIDFLSKTMYLEDRTVRLQLWD  155

Query  357  TAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            TAGQERFRSLIPSYIRDSSVAV+VYD+ +R SF+NTSKWV++VR+ERG+DVIIVLVG
Sbjct  156  TAGQERFRSLIPSYIRDSSVAVVVYDITNRTSFMNTSKWVDDVRSERGNDVIIVLVG  212



>emb|CDY31610.1| BnaA03g54420D [Brassica napus]
Length=258

 Score =   216 bits (551),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 2/123 (2%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA VSALAK+KLVFLGDQSVGKTSIITRFMYDKFDT+YQ TIGIDFLSKTMYLEDRTVRL
Sbjct  45   MASVSALAKFKLVFLGDQSVGKTSIITRFMYDKFDTSYQPTIGIDFLSKTMYLEDRTVRL  104

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERG--SDVIIV  518
            QLWDTAGQERFRSLIPSYIRDSSVA++VYDVA+RQ+FLN  KW+++V  ERG   DVIIV
Sbjct  105  QLWDTAGQERFRSLIPSYIRDSSVAIVVYDVANRQTFLNIPKWIDDVHRERGGSGDVIIV  164

Query  519  LVG  527
            LVG
Sbjct  165  LVG  167



>emb|CEP15631.1| hypothetical protein [Parasitella parasitica]
Length=205

 Score =   214 bits (546),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +3

Query  177  SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWD  356
            S L KYKLVFLG+QSVGKTS+ITRFMYD FD TYQATIGIDFLSKTMYLED+TVRLQLWD
Sbjct  8    SPLRKYKLVFLGEQSVGKTSLITRFMYDTFDNTYQATIGIDFLSKTMYLEDKTVRLQLWD  67

Query  357  TAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            TAGQERFRSLIPSYIRDSSVAVIVYD++ RQSF+NTSKW+++VR ERG DVIIVLVG
Sbjct  68   TAGQERFRSLIPSYIRDSSVAVIVYDISDRQSFINTSKWIDDVRAERGDDVIIVLVG  124



>ref|XP_009824670.1| hypothetical protein H257_02639 [Aphanomyces astaci]
 gb|ETV86198.1| hypothetical protein H257_02639 [Aphanomyces astaci]
Length=216

 Score =   215 bits (547),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  347
            A ++ LAKYKLVFLGDQ VGKTS+ITRFMYD FD  YQATIGIDFLSKTMYLE+RTVRLQ
Sbjct  12   AAITPLAKYKLVFLGDQGVGKTSMITRFMYDTFDNAYQATIGIDFLSKTMYLENRTVRLQ  71

Query  348  LWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            LWDTAGQERFRSLIPSYIRDSSVAV+VYD+++R SFLNTSKW+E+VR ERG DV+I+LVG
Sbjct  72   LWDTAGQERFRSLIPSYIRDSSVAVVVYDISNRASFLNTSKWIEDVRAERGQDVVIMLVG  131



>ref|XP_009824671.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV86199.1| hypothetical protein, variant [Aphanomyces astaci]
Length=211

 Score =   214 bits (546),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +3

Query  168  APVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQ  347
            A ++ LAKYKLVFLGDQ VGKTS+ITRFMYD FD  YQATIGIDFLSKTMYLE+RTVRLQ
Sbjct  12   AAITPLAKYKLVFLGDQGVGKTSMITRFMYDTFDNAYQATIGIDFLSKTMYLENRTVRLQ  71

Query  348  LWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            LWDTAGQERFRSLIPSYIRDSSVAV+VYD+++R SFLNTSKW+E+VR ERG DV+I+LVG
Sbjct  72   LWDTAGQERFRSLIPSYIRDSSVAVVVYDISNRASFLNTSKWIEDVRAERGQDVVIMLVG  131



>emb|CEI87138.1| Putative Ras-like protein Rab-6B [Rhizopus microsporus]
Length=207

 Score =   214 bits (545),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  177  SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWD  356
            S L KYKLVFLG+QSVGKTS+ITRFMYD FD TYQATIGIDFLSKTMYLED+TVRLQLWD
Sbjct  9    SPLRKYKLVFLGEQSVGKTSLITRFMYDTFDNTYQATIGIDFLSKTMYLEDKTVRLQLWD  68

Query  357  TAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            TAGQERFRSLIPSYIRDSSVAVIVYD+++RQSF+NTSKW+++VR ERG +VIIVLVG
Sbjct  69   TAGQERFRSLIPSYIRDSSVAVIVYDISNRQSFINTSKWIDDVRAERGEEVIIVLVG  125



>gb|EMS65503.1| Ras-related protein RABH1b [Triticum urartu]
Length=226

 Score =   214 bits (546),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 116/139 (83%), Gaps = 18/139 (13%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFM----------------YDKFDTT--YQATI  290
            MAPVSALAKYKLVFLGDQSVGKTSIITRFM                +D  + +    ATI
Sbjct  1    MAPVSALAKYKLVFLGDQSVGKTSIITRFMITALFGDKCAQAARPSFDLLENSGGCNATI  60

Query  291  GIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSK  470
            GIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIV+DVASRQSFLNTSK
Sbjct  61   GIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVFDVASRQSFLNTSK  120

Query  471  WVEEVRTERGSDVIIVLVG  527
            W+EEVRTERGSDVIIVLVG
Sbjct  121  WIEEVRTERGSDVIIVLVG  139



>ref|XP_007417607.1| hypothetical protein MELLADRAFT_40435 [Melampsora larici-populina 
98AG31]
 gb|EGF99105.1| hypothetical protein MELLADRAFT_40435 [Melampsora larici-populina 
98AG31]
Length=185

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +3

Query  183  LAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTA  362
            L K+KLVFLG+QSVGKTS+ITRFMYD FD TYQATIGIDFLSKTMYLEDRTVRLQLWDTA
Sbjct  1    LKKFKLVFLGEQSVGKTSLITRFMYDTFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTA  60

Query  363  GQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            GQERFRSLIPSYIRDSSVAV+VYDVA+R SF+NTSKWV++VR ERG+DVIIVLVG
Sbjct  61   GQERFRSLIPSYIRDSSVAVVVYDVANRTSFMNTSKWVDDVRAERGNDVIIVLVG  115



>gb|ETL97732.1| hypothetical protein L917_05031 [Phytophthora parasitica]
Length=264

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            ++ LAKYKLVFLGDQ VGKTS+ITRFMYD FD  YQATIGIDFLSKTMY+EDRTVRLQLW
Sbjct  63   IAPLAKYKLVFLGDQGVGKTSMITRFMYDTFDNAYQATIGIDFLSKTMYMEDRTVRLQLW  122

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAV+VYD+ +R SFLNTSKW+E+VRTERG DV+I+LVG
Sbjct  123  DTAGQERFRSLIPSYIRDSSVAVVVYDITNRASFLNTSKWIEDVRTERGQDVVIMLVG  180



>ref|XP_008863771.1| hypothetical protein H310_02136 [Aphanomyces invadans]
 gb|ETW07678.1| hypothetical protein H310_02136 [Aphanomyces invadans]
Length=215

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 111/121 (92%), Gaps = 2/121 (2%)
 Frame = +3

Query  171  PVS--ALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            PVS   LAKYKLVFLGDQ VGKTS+ITRFMYD FD  YQATIGIDFLSKTMYLE+RTVRL
Sbjct  10   PVSITPLAKYKLVFLGDQGVGKTSMITRFMYDTFDNAYQATIGIDFLSKTMYLENRTVRL  69

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVAV+VYD+++R SFLNTSKW+E+VR ERG DV+I+LV
Sbjct  70   QLWDTAGQERFRSLIPSYIRDSSVAVVVYDISNRASFLNTSKWIEDVRAERGQDVVIMLV  129

Query  525  G  527
            G
Sbjct  130  G  130



>emb|CEG66857.1| Putative Ras-like protein Rab-6B [Rhizopus microsporus]
Length=223

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +3

Query  177  SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWD  356
            S L KYKLVFLG+QSVGKTS+ITRFMYD FD TYQATIGIDFLSKTMYLED+TVRLQLWD
Sbjct  9    SPLRKYKLVFLGEQSVGKTSLITRFMYDTFDNTYQATIGIDFLSKTMYLEDKTVRLQLWD  68

Query  357  TAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            TAGQERFRSLIPSYIRDSSVAVIVYD+++RQSF+NTSKW+++VR ERG +VIIVLVG
Sbjct  69   TAGQERFRSLIPSYIRDSSVAVIVYDISNRQSFINTSKWIDDVRAERGEEVIIVLVG  125



>ref|XP_011110515.1| hypothetical protein H072_4618 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41482.1| hypothetical protein H072_4618 [Dactylellina haptotyla CBS 200.50]
Length=210

 Score =   213 bits (542),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +3

Query  177  SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWD  356
            + L K+KLVFLG+QSVGKTS+ITRFMYD FD  YQATIGIDFLSKTMYLEDRTVRLQLWD
Sbjct  12   NPLKKFKLVFLGEQSVGKTSLITRFMYDSFDNMYQATIGIDFLSKTMYLEDRTVRLQLWD  71

Query  357  TAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            TAGQERFRSLIPSYIRDSSVAV+VYD+ +RQSFLNTSKWV++VR ERG+DVIIVLVG
Sbjct  72   TAGQERFRSLIPSYIRDSSVAVVVYDITNRQSFLNTSKWVDDVRGERGNDVIIVLVG  128



>emb|CEF98741.1| Small GTPase superfamily, Rho type [Ostreococcus tauri]
Length=205

 Score =   213 bits (541),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +3

Query  174  VSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLW  353
            V+ L KYKLVFLGDQSVGKTSII+RFMYDKFD +YQATIGIDFLSKTMYLEDRTVRLQLW
Sbjct  9    VTPLPKYKLVFLGDQSVGKTSIISRFMYDKFDNSYQATIGIDFLSKTMYLEDRTVRLQLW  68

Query  354  DTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            DTAGQERFRSLIPSYIRDSSVAVIVYDV+SR SF N++KWV +V+ ERG DVII LVG
Sbjct  69   DTAGQERFRSLIPSYIRDSSVAVIVYDVSSRASFENSAKWVAQVKAERGGDVIIALVG  126



>ref|XP_002679587.1| rab small GTPase [Naegleria gruberi]
 gb|EFC46843.1| rab small GTPase [Naegleria gruberi]
Length=230

 Score =   213 bits (543),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +3

Query  189  KYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQ  368
            KYK+VFLGDQ+VGKTSIITRFMYD FDTTY  TIGIDFLSKTMYLEDRTVRLQLWDTAGQ
Sbjct  14   KYKIVFLGDQAVGKTSIITRFMYDSFDTTYHNTIGIDFLSKTMYLEDRTVRLQLWDTAGQ  73

Query  369  ERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            ERFRSLIPSYIRDSSVA+IVYD+ S+QSF+NT+KW+E+VRTERG DVI+VLVG
Sbjct  74   ERFRSLIPSYIRDSSVAIIVYDITSKQSFMNTNKWIEDVRTERGDDVIVVLVG  126



>ref|XP_011117303.1| hypothetical protein AOL_s00004g351 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX54318.1| hypothetical protein AOL_s00004g351 [Arthrobotrys oligospora 
ATCC 24927]
Length=211

 Score =   213 bits (542),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +3

Query  177  SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWD  356
            + L K+KLVFLG+QSVGKTS+ITRFMYD FD  YQATIGIDFLSKTMYLEDRTVRLQLWD
Sbjct  12   NPLKKFKLVFLGEQSVGKTSLITRFMYDSFDNMYQATIGIDFLSKTMYLEDRTVRLQLWD  71

Query  357  TAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            TAGQERFRSLIPSYIRDSSVAV+VYD+ +RQSFLNTSKWV++VR ERG+DVIIVLVG
Sbjct  72   TAGQERFRSLIPSYIRDSSVAVVVYDITNRQSFLNTSKWVDDVRGERGNDVIIVLVG  128



>ref|XP_004336232.1| GTPbinding protein [Acanthamoeba castellanii str. Neff]
 gb|ELR14219.1| GTPbinding protein [Acanthamoeba castellanii str. Neff]
Length=195

 Score =   212 bits (539),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +3

Query  165  MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRL  344
            MA  + LAKYKLVFLGDQSVGKTSIITRFMYD FD TYQATIGIDFLSKTMYLEDRT+RL
Sbjct  1    MAGSNPLAKYKLVFLGDQSVGKTSIITRFMYDTFDNTYQATIGIDFLSKTMYLEDRTIRL  60

Query  345  QLWDTAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLV  524
            QLWDTAGQERFRSLIPSYIRDSSVA++VYD+ +R +FL+T++WVE++R ERG+DVI++LV
Sbjct  61   QLWDTAGQERFRSLIPSYIRDSSVAIVVYDITNRTTFLDTARWVEDIRAERGNDVILMLV  120

Query  525  G  527
            G
Sbjct  121  G  121



>ref|XP_007008671.1| hypothetical protein TREMEDRAFT_70574 [Tremella mesenterica DSM 
1558]
 gb|EIW65444.1| hypothetical protein TREMEDRAFT_70574 [Tremella mesenterica DSM 
1558]
Length=216

 Score =   213 bits (541),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +3

Query  177  SALAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWD  356
            + L K+KLVFLG+QSVGKTS+ITRFMYD FD TYQATIGIDFLSKTMYLEDRTVRLQLWD
Sbjct  18   NPLRKFKLVFLGEQSVGKTSLITRFMYDTFDNTYQATIGIDFLSKTMYLEDRTVRLQLWD  77

Query  357  TAGQERFRSLIPSYIRDSSVAVIVYDVASRQSFLNTSKWVEEVRTERGSDVIIVLVG  527
            TAGQERFRSLIPSYIRDSSVAVIVYD+ +R SFLNTSKWV++VR ERG DVIIVLVG
Sbjct  78   TAGQERFRSLIPSYIRDSSVAVIVYDITNRTSFLNTSKWVDDVRNERGQDVIIVLVG  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400