BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M17

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343041.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    115   1e-26   Solanum tuberosum [potatoes]
ref|XP_010318529.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    112   2e-25   
ref|XP_004235645.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    112   2e-25   Solanum lycopersicum
ref|XP_009771112.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    109   3e-24   Nicotiana sylvestris
ref|XP_011080458.1|  PREDICTED: NADP-dependent malic enzyme-like        106   2e-23   Sesamum indicum [beniseed]
ref|XP_009772764.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    105   5e-23   Nicotiana sylvestris
ref|XP_009626739.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    105   5e-23   Nicotiana tomentosiformis
gb|ABI98682.2|  chloroplast NADP-malic enzyme precursor                 105   5e-23   Nicotiana tabacum [American tobacco]
gb|EYU45830.1|  hypothetical protein MIMGU_mgv1a002611mg                104   1e-22   Erythranthe guttata [common monkey flower]
ref|XP_006359476.1|  PREDICTED: NADP-dependent malic enzyme, chlo...    102   5e-22   Solanum tuberosum [potatoes]
ref|NP_001234458.1|  NADP-dependent malic enzyme, chloroplastic       99.0    1e-20   
ref|XP_009591013.1|  PREDICTED: NADP-dependent malic enzyme, chlo...  98.2    2e-20   Nicotiana tomentosiformis
emb|CDO97978.1|  unnamed protein product                              95.9    1e-19   Coffea canephora [robusta coffee]
ref|XP_011072428.1|  PREDICTED: NADP-dependent malic enzyme, chlo...  82.4    5e-15   Sesamum indicum [beniseed]
ref|XP_010098139.1|  NADP-dependent malic enzyme                      72.0    2e-11   
ref|XP_010267161.1|  PREDICTED: NADP-dependent malic enzyme-like ...  71.6    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_007216984.1|  hypothetical protein PRUPE_ppa002714mg           71.2    4e-11   Prunus persica
ref|XP_008228427.1|  PREDICTED: NADP-dependent malic enzyme           71.2    4e-11   Prunus mume [ume]
ref|XP_009342530.1|  PREDICTED: NADP-dependent malic enzyme-like      70.9    4e-11   Pyrus x bretschneideri [bai li]
gb|ADU20198.1|  NADP-dependent malic enzyme                           70.5    6e-11   Pyrus pyrifolia [sha li]
ref|XP_009353550.1|  PREDICTED: NADP-dependent malic enzyme           69.7    1e-10   Pyrus x bretschneideri [bai li]
gb|AFR54473.1|  cytosolic NADP-malic protein                          69.3    1e-10   Prunus armeniaca
ref|XP_010267160.1|  PREDICTED: NADP-dependent malic enzyme-like ...  69.3    2e-10   Nelumbo nucifera [Indian lotus]
ref|XP_009348545.1|  PREDICTED: NADP-dependent malic enzyme-like      68.9    2e-10   Pyrus x bretschneideri [bai li]
gb|AAB17593.1|  NADP-malic enzyme                                     60.8    5e-09   Flaveria bidentis
gb|AHA11552.1|  NADP-malic enzyme                                     63.9    9e-09   Malus domestica [apple tree]
gb|ABB86962.1|  cytosolic NADP-malic enzyme                           62.8    2e-08   Malus domestica [apple tree]
ref|XP_004302862.1|  PREDICTED: LOW QUALITY PROTEIN: NADP-depende...  62.8    2e-08   Fragaria vesca subsp. vesca
ref|NP_001268030.1|  malate dehydrogenase                             61.6    5e-08   Vitis vinifera
emb|CBI36068.3|  unnamed protein product                              61.6    5e-08   Vitis vinifera
emb|CAN69517.1|  hypothetical protein VITISV_024155                   61.6    5e-08   Vitis vinifera
ref|XP_008353539.1|  PREDICTED: NADP-dependent malic enzyme-like      60.8    9e-08   
gb|KDP40863.1|  hypothetical protein JCGZ_24862                       59.3    3e-07   Jatropha curcas
ref|XP_007150609.1|  hypothetical protein PHAVU_005G166400g           58.2    7e-07   Phaseolus vulgaris [French bean]
gb|KHM98720.1|  NADP-dependent malic enzyme, chloroplastic            58.2    7e-07   Glycine soja [wild soybean]
ref|XP_003546557.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  57.8    8e-07   Glycine max [soybeans]
gb|EPS63115.1|  hypothetical protein M569_11673                       56.2    1e-06   Genlisea aurea
gb|KCW53678.1|  hypothetical protein EUGRSUZ_J02940                   54.3    1e-05   Eucalyptus grandis [rose gum]
ref|XP_010033838.1|  PREDICTED: NADP-dependent malic enzyme           54.3    1e-05   Eucalyptus grandis [rose gum]
gb|KCW53676.1|  hypothetical protein EUGRSUZ_J02940                   54.3    1e-05   Eucalyptus grandis [rose gum]
ref|XP_010267163.1|  PREDICTED: NADP-dependent malic enzyme-like ...  54.3    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010665912.1|  PREDICTED: NADP-dependent malic enzyme           53.9    1e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|AAF73006.1|AF262997_1  NADP-dependent malic protein                53.5    2e-05   Ricinus communis
ref|XP_002515967.1|  malic enzyme, putative                           53.5    2e-05   
ref|XP_008352329.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  52.8    3e-05   
gb|EYU21512.1|  hypothetical protein MIMGU_mgv1a002703mg              52.4    5e-05   Erythranthe guttata [common monkey flower]
ref|XP_008810493.1|  PREDICTED: NADP-dependent malic enzyme           51.6    8e-05   Phoenix dactylifera
ref|XP_004150784.1|  PREDICTED: NADP-dependent malic enzyme, chlo...  51.2    1e-04   Cucumis sativus [cucumbers]
ref|XP_008361292.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  50.8    1e-04   
gb|AAB17591.1|  NADP-malic enzyme                                     48.1    1e-04   Flaveria bidentis
sp|P22178.1|MAOC_FLATR  RecName: Full=NADP-dependent malic enzyme...  50.4    2e-04   Flaveria trinervia
prf||1701292A  NADP dependent malic enzyme                            50.4    2e-04
gb|AFM08812.1|  NADP-dependent malic protein                          50.1    2e-04   Dimocarpus longan [longan]
ref|XP_003543623.1|  PREDICTED: NADP-dependent malic enzyme 4, ch...  50.1    2e-04   Glycine max [soybeans]
ref|XP_008447551.1|  PREDICTED: NADP-dependent malic enzyme           50.1    3e-04   Cucumis melo [Oriental melon]
gb|KFK42380.1|  hypothetical protein AALP_AA2G248700                  48.9    6e-04   Arabis alpina [alpine rockcress]
gb|AAW56450.1|  chloroplast NADP-dependent malic enzyme precursor     48.9    8e-04   Flaveria bidentis
sp|P36444.1|MAOC_FLAPR  RecName: Full=NADP-dependent malic enzyme...  48.5    0.001   Flaveria pringlei



>ref|XP_006343041.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Solanum 
tuberosum]
Length=642

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 72/89 (81%), Gaps = 2/89 (2%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  425
            M SL+GT F N+SLSGVS+CL QS+  ++ S P VVA+VS NGRP DRN S++ME+ LKE
Sbjct  1    MFSLNGTNFPNDSLSGVSRCLIQSR--KKVSFPMVVASVSPNGRPADRNVSVLMENTLKE  58

Query  426  VTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            + E+ PV+EK++KSTV GGVGD YGED+A
Sbjct  59   MKENSPVIEKDSKSTVTGGVGDVYGEDSA  87



>ref|XP_010318529.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic isoform 
X2 [Solanum lycopersicum]
Length=634

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  425
            M SL+GT F NNSLSGVS+CLTQS+  +R S P VV +V+ NGR  DRN S++ME+ LKE
Sbjct  1    MFSLNGTNFPNNSLSGVSRCLTQSR--KRVSFPMVVVSVNPNGRSADRNVSVLMENTLKE  58

Query  426  VTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            + E+ PV++++++STV GGVGD YGEDTA
Sbjct  59   MKENAPVIDEDSESTVTGGVGDVYGEDTA  87



>ref|XP_004235645.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=642

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 71/89 (80%), Gaps = 2/89 (2%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  425
            M SL+GT F NNSLSGVS+CLTQS+  +R S P VV +V+ NGR  DRN S++ME+ LKE
Sbjct  1    MFSLNGTNFPNNSLSGVSRCLTQSR--KRVSFPMVVVSVNPNGRSADRNVSVLMENTLKE  58

Query  426  VTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            + E+ PV++++++STV GGVGD YGEDTA
Sbjct  59   MKENAPVIDEDSESTVTGGVGDVYGEDTA  87



>ref|XP_009771112.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Nicotiana 
sylvestris]
Length=643

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKV-VAAVSSNGRPGDRNASIVMESALK  422
            M SL+G++  NNS+SGVS+CLTQS+  +R S P V VA+VSSN +PG+R+AS++ME+ LK
Sbjct  1    MFSLNGSSCTNNSVSGVSRCLTQSR--KRMSVPMVAVASVSSNVKPGERHASVLMENTLK  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            E+ ES PV+EK++KS V+GGVGD YGED+A
Sbjct  59   EMKESAPVIEKDSKSAVSGGVGDVYGEDSA  88



>ref|XP_011080458.1| PREDICTED: NADP-dependent malic enzyme-like [Sesamum indicum]
Length=650

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 74/96 (77%), Gaps = 8/96 (8%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPK-VVAAVSSNGRPGDRNASIVMESALK  422
            M SL+G++F+NNSLSGVS+ LTQS +QR+ SAP  VVA+V+ NG+PGDRN S++ME+ LK
Sbjct  1    MFSLNGSSFLNNSLSGVSRNLTQS-TQRKISAPPMVVASVTPNGKPGDRNVSVLMENTLK  59

Query  423  EVTESVP------VVEKEAKSTVAGGVGDFYGEDTA  512
            E+ E+ P      + E E+KSTV GGV D YGED+A
Sbjct  60   EMRENAPSSSSPSLTENESKSTVGGGVEDVYGEDSA  95



>ref|XP_009772764.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic [Nicotiana 
sylvestris]
Length=642

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 4/90 (4%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVV-AAVSSNGRPGDRNASIVMESALK  422
            M SL+G++F NNSLSGVS+CLTQS S+R  S P VV AAV+SNG+PGDRN S+++E+++K
Sbjct  1    MFSLNGSSFTNNSLSGVSRCLTQS-SRRGVSGPMVVAAAVNSNGKPGDRNVSVLVENSMK  59

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            E + + P VEKE KSTV GGVGD YGED+A
Sbjct  60   E-SAAAP-VEKEIKSTVTGGVGDVYGEDSA  87



>ref|XP_009626739.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic [Nicotiana 
tomentosiformis]
Length=642

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 4/90 (4%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPK-VVAAVSSNGRPGDRNASIVMESALK  422
            M SL+G++F NNSLSGVS+CLTQS S+R  S P  VVAAV+SNG+PGDRN S+++E+++K
Sbjct  1    MFSLNGSSFTNNSLSGVSRCLTQS-SRRGVSGPMVVVAAVNSNGKPGDRNVSVLVENSMK  59

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            E + + P VEKE KSTV GGVGD YGED+A
Sbjct  60   E-SAAAP-VEKEIKSTVTGGVGDVYGEDSA  87



>gb|ABI98682.2| chloroplast NADP-malic enzyme precursor [Nicotiana tabacum]
Length=642

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 4/90 (4%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPK-VVAAVSSNGRPGDRNASIVMESALK  422
            M SL+G++F NNSLSGVS+CLTQS S+R  S P  VVAAV+SNG+PGDRN S+++E+++K
Sbjct  1    MFSLNGSSFTNNSLSGVSRCLTQS-SRRGVSGPMVVVAAVNSNGKPGDRNVSVLVENSMK  59

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            E + + P VEKE KSTV GGVGD YGED+A
Sbjct  60   E-SAAAP-VEKEIKSTVTGGVGDVYGEDSA  87



>gb|EYU45830.1| hypothetical protein MIMGU_mgv1a002611mg [Erythranthe guttata]
Length=654

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 72/100 (72%), Gaps = 12/100 (12%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPK--VVAAVSSNGRPGDRNASIVMESAL  419
            M SL+G+ F+NNSL GVSK LTQS +QR+ SAP   VVA+VSSNGR GDRN  ++MES L
Sbjct  1    MFSLNGSTFLNNSLCGVSKSLTQS-AQRKISAPPTTVVASVSSNGRSGDRNVGVLMESTL  59

Query  420  KEVTES---------VPVVEKEAKSTVAGGVGDFYGEDTA  512
            KE+ E+         + V+EK+ KSTV GGV D YGED+A
Sbjct  60   KEMNENATSSSSASQITVIEKDTKSTVGGGVEDVYGEDSA  99



>ref|XP_006359476.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Solanum 
tuberosum]
Length=640

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 69/90 (77%), Gaps = 6/90 (7%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPK-VVAAVSSNGRPGDRNASIVMESALK  422
            M SL+GT+F NNSLSGVS+CLT  QS RR SAP  VVAAVSSNG+PGD + S+++E+AL 
Sbjct  1    MFSLNGTSFTNNSLSGVSRCLT--QSSRRVSAPMVVVAAVSSNGKPGDGSVSVLVENAL-  57

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
              TES   VE E KSTV GGV D YGED+A
Sbjct  58   --TESAAPVEMEVKSTVTGGVQDVYGEDSA  85



>ref|NP_001234458.1| NADP-dependent malic enzyme, chloroplastic [Solanum lycopersicum]
 gb|AAB58727.1| NADP-malic enzyme [Solanum lycopersicum]
Length=640

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 6/90 (7%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPK-VVAAVSSNGRPGDRNASIVMESALK  422
            M SL+GT+F NNSLSGVS+CL  +QS RR SAP  VVAAV+SNG+PGD + S+++E+AL 
Sbjct  1    MFSLNGTSFTNNSLSGVSRCL--NQSSRRVSAPMVVVAAVNSNGKPGDGSVSVLVENAL-  57

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
              TES   VE E KSTV GGV D YGED+A
Sbjct  58   --TESPAPVEMEVKSTVTGGVQDVYGEDSA  85



>ref|XP_009591013.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=643

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  425
            M SL+G++F NNS+SGVS+CLTQS  +R      VVA+VSSN +PGDRN SI+ME+ LKE
Sbjct  1    MFSLNGSSFTNNSVSGVSRCLTQS-PKRMLVPMVVVASVSSNVKPGDRNVSILMENTLKE  59

Query  426  VTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            + E  P +EK++KS V+GGVGD YGED+A
Sbjct  60   MKEDAPFIEKDSKSAVSGGVGDVYGEDSA  88



>emb|CDO97978.1| unnamed protein product [Coffea canephora]
Length=651

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 70/92 (76%), Gaps = 5/92 (5%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVV-AAVSSNGRPGDRNASIVMESALK  422
            M+SL+GT+F++NSL GVS+ + Q    RR + P VV A+VSSNGR GDRN S+++E++LK
Sbjct  1    MLSLNGTSFLDNSLYGVSRGVVQQH--RRVAPPMVVVASVSSNGRAGDRNVSVLVETSLK  58

Query  423  EVTES--VPVVEKEAKSTVAGGVGDFYGEDTA  512
            E+ ++   P  +K++KS V GG+GD YGEDTA
Sbjct  59   EIRDASPAPPADKDSKSKVTGGIGDVYGEDTA  90



>ref|XP_011072428.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Sesamum 
indicum]
Length=648

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 6/94 (6%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  425
            M SL+G++  NN L GVSK LTQS  + + + P VVAAVSSN RP D N  + +E+ LKE
Sbjct  1    MFSLNGSSTRNNPLYGVSKSLTQSAQKHKSAPPLVVAAVSSNARPRDGNV-LAVENTLKE  59

Query  426  VTESVPV-----VEKEAKSTVAGGVGDFYGEDTA  512
            +T + P      + K++ S+VAGGV D YGEDTA
Sbjct  60   MTANPPSTSSSGIAKDSSSSVAGGVEDVYGEDTA  93



>ref|XP_010098139.1| NADP-dependent malic enzyme [Morus notabilis]
 gb|EXB74576.1| NADP-dependent malic enzyme [Morus notabilis]
Length=621

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 61/92 (66%), Gaps = 11/92 (12%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQS--QRRFSAP-KVVAAVSSNGRPGDRNASIVMESA  416
            MISLS T F+NN+  GVS+  + + S  QRR++A  KVVA+       G+RN ++VME A
Sbjct  1    MISLSRTCFLNNA--GVSELYSPANSTRQRRYAASLKVVASA------GERNGTVVMEGA  52

Query  417  LKEVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            LKE  +   VVE + KSTV GGV D YGED+A
Sbjct  53   LKESKDVSSVVEVDNKSTVGGGVQDVYGEDSA  84



>ref|XP_010267161.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Nelumbo 
nucifera]
Length=642

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = +3

Query  246  MISLSGTAFMNNS--LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESAL  419
            MISL   +F+NNS   SG+S   + S SQR+ SAP VV A++SNGR G+R    +MES L
Sbjct  1    MISLKAGSFLNNSTSFSGIS---SFSHSQRKVSAP-VVVALNSNGRGGERKFKALMESTL  56

Query  420  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            KE+ E    ++ + K     GV D YGED A
Sbjct  57   KEIREGASALDMDPKPNPGAGVEDVYGEDRA  87



>ref|XP_007216984.1| hypothetical protein PRUPE_ppa002714mg [Prunus persica]
 gb|EMJ18183.1| hypothetical protein PRUPE_ppa002714mg [Prunus persica]
Length=641

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (67%), Gaps = 5/90 (6%)
 Frame = +3

Query  246  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            M+SL+ + F+ N +++G S   + SQ +RR ++ KVVA V    R GDRN S+VMES L+
Sbjct  1    MMSLNRSCFLGNPAIAGSSSPFSHSQ-KRRSASLKVVALVP-KARTGDRNGSVVMESTLQ  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            EV +   VV  E KSTV GGV D YGEDTA
Sbjct  59   EVKDESSVV--ELKSTVHGGVQDVYGEDTA  86



>ref|XP_008228427.1| PREDICTED: NADP-dependent malic enzyme [Prunus mume]
Length=641

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (67%), Gaps = 5/90 (6%)
 Frame = +3

Query  246  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            M+SL+ + F+ N +++G S   + SQ +RR ++ KVVA V    R GDRN S+VMES L+
Sbjct  1    MMSLNRSCFLGNPAIAGSSSPFSHSQ-KRRSASLKVVALVPKT-RTGDRNGSVVMESTLQ  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            EV +   VV  E KSTV GGV D YGEDTA
Sbjct  59   EVKDESSVV--ELKSTVHGGVQDVYGEDTA  86



>ref|XP_009342530.1| PREDICTED: NADP-dependent malic enzyme-like [Pyrus x bretschneideri]
Length=641

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (67%), Gaps = 5/90 (6%)
 Frame = +3

Query  246  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            M+SL+ + F+ N +++G S   +QSQ +RR ++ KVVA +    R GDRN S+VMES L+
Sbjct  1    MMSLNRSCFLGNPAVAGSSSPFSQSQ-KRRPASLKVVALIP-KARTGDRNGSVVMESTLQ  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            EV     VV  E KSTV GGV D YGEDTA
Sbjct  59   EVKTESEVV--ELKSTVHGGVKDVYGEDTA  86



>gb|ADU20198.1| NADP-dependent malic enzyme [Pyrus pyrifolia]
Length=641

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 60/90 (67%), Gaps = 5/90 (6%)
 Frame = +3

Query  246  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            M+SL+ + F+ N  ++G S   +QSQ +RR ++ KVVA V    R GDRN S+VME+AL+
Sbjct  1    MMSLNRSCFLGNPGIAGSSSPFSQSQ-KRRPASLKVVAVVPKV-RTGDRNGSVVMENALQ  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            EV     VV  E KSTV GGV D YGEDTA
Sbjct  59   EVKAESEVV--ELKSTVHGGVQDVYGEDTA  86



>ref|XP_009353550.1| PREDICTED: NADP-dependent malic enzyme [Pyrus x bretschneideri]
Length=641

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (67%), Gaps = 5/90 (6%)
 Frame = +3

Query  246  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            M+SL+ + F+ N +++G S   +QSQ +RR ++ KVVA +   G  GDRN S+VMES L+
Sbjct  1    MMSLNRSFFLGNPAVAGSSSPFSQSQ-KRRPASLKVVALIPKAGT-GDRNGSVVMESTLQ  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            EV     VV  E KSTV GGV D YGEDTA
Sbjct  59   EVKTESEVV--ELKSTVHGGVKDVYGEDTA  86



>gb|AFR54473.1| cytosolic NADP-malic protein [Prunus armeniaca]
Length=640

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +3

Query  249  ISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  425
            +SL+ + F+ N  ++G S   +QSQ +RR ++ KVVA +    R GDRN S+VMES L+E
Sbjct  1    MSLNRSCFLGNPGIAGSSSPFSQSQ-KRRSASLKVVALIP-KARTGDRNGSVVMESTLQE  58

Query  426  VTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            V +   VV  E KSTV GGV D YGEDTA
Sbjct  59   VKDESSVV--ELKSTVHGGVQDVYGEDTA  85



>ref|XP_010267160.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Nelumbo 
nucifera]
Length=643

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 1/89 (1%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  425
            MISL   +F+ N+ +  S   + S SQR+ SAP VV A++SNGR G+R    +MES LKE
Sbjct  1    MISLKAGSFLQNNSTSFSGISSFSHSQRKVSAP-VVVALNSNGRGGERKFKALMESTLKE  59

Query  426  VTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            + E    ++ + K     GV D YGED A
Sbjct  60   IREGASALDMDPKPNPGAGVEDVYGEDRA  88



>ref|XP_009348545.1| PREDICTED: NADP-dependent malic enzyme-like [Pyrus x bretschneideri]
Length=641

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = +3

Query  246  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            M+SL+ + F+ N  ++G S     SQSQ+R  A   V AV    R GDRN S+VME+AL+
Sbjct  1    MMSLNRSCFLGNPGIAGSSSPF--SQSQKRQPASLKVVAVVPKVRTGDRNGSVVMENALQ  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            EV     VV  E KSTV GGV D YGEDTA
Sbjct  59   EVKAESEVV--ELKSTVHGGVQDVYGEDTA  86



>gb|AAB17593.1| NADP-malic enzyme, partial [Flaveria bidentis]
Length=106

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 63/95 (66%), Gaps = 9/95 (9%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQR-RFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            M+SL+ ++ + +S+SGVS+  TQSQS R     P VVA V+SNGRP +R+  + ++ A+K
Sbjct  1    MMSLNTSSVVKSSISGVSR--TQSQSVRLSVRRPMVVAMVNSNGRP-ERSVGVSVDGAVK  57

Query  423  EVTE--SVPVVEKEAKST---VAGGVGDFYGEDTA  512
            +V    +V V + E+K T   V GGV D YGED+A
Sbjct  58   DVNAPVAVEVADSESKETTAVVGGGVEDVYGEDSA  92



>gb|AHA11552.1| NADP-malic enzyme [Malus domestica]
Length=641

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = +3

Query  246  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            M+SL+ + F+    ++G S     SQSQ+R SA   V AV    R  DRN S+VME+ L+
Sbjct  1    MMSLNRSCFLGKPGIAGSSSPF--SQSQKRRSASLKVVAVVPKVRTSDRNGSVVMENPLQ  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            EV     VV  E KSTV GGV D YGEDTA
Sbjct  59   EVKAESEVV--ELKSTVHGGVQDVYGEDTA  86



>gb|ABB86962.1| cytosolic NADP-malic enzyme [Malus domestica]
Length=641

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 3/89 (3%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  425
            M+SL+ + F+ N     S   +    +R+ ++ KVVA +    R GDRN S+VMES L+E
Sbjct  1    MMSLNRSCFLGNPAVAGSSSPSSQSQKRQPASLKVVALIP-KARTGDRNGSVVMESTLQE  59

Query  426  VTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            V     VV  E KSTV GGV D YGEDTA
Sbjct  60   VKTESEVV--ELKSTVHGGVEDVYGEDTA  86



>ref|XP_004302862.1| PREDICTED: LOW QUALITY PROTEIN: NADP-dependent malic enzyme [Fragaria 
vesca subsp. vesca]
Length=637

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 54/91 (59%), Gaps = 14/91 (15%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQ-SQRRFSAPKVVAAVSSNG-RPGDRNASIVMESAL  419
            MISL+ + F+ N   GV  C   S  SQ+R SAP  V AV +N  R G+RN SIVME+A 
Sbjct  4    MISLNRSCFLGNP--GV--CGNGSPFSQKRRSAPLRVVAVGTNAARKGERNGSIVMETAA  59

Query  420  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            KEV         E KSTV GG  D YGEDTA
Sbjct  60   KEVV--------ELKSTVHGGDRDVYGEDTA  82



>ref|NP_001268030.1| malate dehydrogenase [Vitis vinifera]
 gb|AAB08874.1| malate dehydrogenase [Vitis vinifera]
Length=640

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +3

Query  306  LTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGV  485
            +++S SQR+   P VV A+ SNGR G+ N S VMES LKE+ +   V+E ++KS V+GGV
Sbjct  18   ISRSVSQRKV-LPPVVLALGSNGRAGELNVSAVMESTLKELRDGNTVLEVDSKSAVSGGV  76

Query  486  GDFYGEDTA  512
             D  GED A
Sbjct  77   RDVQGEDAA  85



>emb|CBI36068.3| unnamed protein product [Vitis vinifera]
Length=640

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +3

Query  306  LTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGV  485
            +++S SQR+   P VV A+ SNGR G+ N S VMES LKE+ +   V+E ++KS V+GGV
Sbjct  18   ISRSVSQRKV-LPPVVLALGSNGRAGELNVSAVMESTLKELRDGNTVLEVDSKSAVSGGV  76

Query  486  GDFYGEDTA  512
             D  GED A
Sbjct  77   RDVQGEDAA  85



>emb|CAN69517.1| hypothetical protein VITISV_024155 [Vitis vinifera]
Length=657

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +3

Query  306  LTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGV  485
            +++S SQR+   P VV A+ SNGR G+ N S VMES LKE+ +   V+E ++KS V+GGV
Sbjct  18   ISRSVSQRKV-LPPVVLALGSNGRAGELNVSAVMESTLKELRDGNTVLEVDSKSAVSGGV  76

Query  486  GDFYGEDTA  512
             D  GED A
Sbjct  77   RDVQGEDAA  85



>ref|XP_008353539.1| PREDICTED: NADP-dependent malic enzyme-like [Malus domestica]
Length=641

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = +3

Query  246  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            M+SL+ + F+    ++G S   +QSQ +RR ++ KVVA V    R  DRN S+VME+ L+
Sbjct  1    MMSLNRSCFLGKPGIAGSSSPFSQSQ-KRRSTSLKVVAVVPKV-RTSDRNGSVVMENXLQ  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            +V     V   E KSTV GGV D YGEDTA
Sbjct  59   DVKAESEVF--ELKSTVHGGVQDVYGEDTA  86



>gb|KDP40863.1| hypothetical protein JCGZ_24862 [Jatropha curcas]
Length=644

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  425
            MISL+ +   N S+SG     +  Q     +AP  +  V+ N    DRN S+VMES+L+E
Sbjct  1    MISLNSSFLSNTSISGSCSPFSGKQKGLVPTAPSTLKVVALNPN-RDRNGSVVMESSLQE  59

Query  426  VTESVPVVEKEA-KSTVAGGVGDFYGEDTA  512
            + +   V++ ++ K+TV GGV D YGEDTA
Sbjct  60   IRDGASVLDFDSDKATVTGGVRDVYGEDTA  89



>ref|XP_007150609.1| hypothetical protein PHAVU_005G166400g [Phaseolus vulgaris]
 gb|ESW22603.1| hypothetical protein PHAVU_005G166400g [Phaseolus vulgaris]
Length=643

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP-KVVAAVSSNGRPGDRNASIVMESALK  422
            M S +  AF+NN+  G+  C +  +  R+ S+P  VV    S+ R  DRN+S+VME+ LK
Sbjct  1    MFSSTRCAFLNNA--GLGGCGSICEGARKRSSPMTVVCMTPSSSRSVDRNSSVVMETPLK  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            E+ +   V + +  S  AGG  D YGED A
Sbjct  59   ELKKDSAVADVDGDSVSAGGPQDVYGEDRA  88



>gb|KHM98720.1| NADP-dependent malic enzyme, chloroplastic [Glycine soja]
Length=643

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = +3

Query  246  MISLSGTAFMNNS-LSGVSK-CLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESAL  419
            M S +  AF++NS L G S  C  Q +   RF   +VV+   S+ R GDRN S+VME+ L
Sbjct  1    MFSSTRCAFLSNSGLGGCSSLCDAQRKRSTRF---RVVSMTPSSSRSGDRNGSVVMETPL  57

Query  420  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            KE+ +   V + +     AGG  D YGED A
Sbjct  58   KELKKESTVADVDNNPISAGGPQDVYGEDRA  88



>ref|XP_003546557.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Glycine max]
Length=643

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = +3

Query  246  MISLSGTAFMNNS-LSGVSK-CLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESAL  419
            M S +  AF++NS L G S  C  Q +   RF   +VV+   S+ R GDRN S+VME+ L
Sbjct  1    MFSSTRCAFLSNSGLGGCSSLCDAQRKRSTRF---RVVSMTPSSSRSGDRNGSVVMETPL  57

Query  420  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            KE+ +   V + +     AGG  D YGED A
Sbjct  58   KELKKESTVADVDNNPISAGGPQDVYGEDRA  88



>gb|EPS63115.1| hypothetical protein M569_11673, partial [Genlisea aurea]
Length=260

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK-  422
            M +L+G+ F+NNSL G  +  TQ   ++  + P++  + S NG+PGDR ASI++E+ +K 
Sbjct  3    MFALNGSTFLNNSLYGAFRSGTQLMQRKLSNPPEMAVSASKNGKPGDRTASILVENEIKP  62

Query  423  -EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
              ++ S P +E+ +KS VA  V +   ED A
Sbjct  63   PPLSSSAPSIEEVSKSNVASNV-EIVDEDEA  92



>gb|KCW53678.1| hypothetical protein EUGRSUZ_J02940 [Eucalyptus grandis]
Length=548

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 63/99 (64%), Gaps = 15/99 (15%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP---KVVAAVSSNGRPG----DRNASIV  404
            MISL+ ++F++NS  GV+     +Q QRR   P   KV+A+ S+  + G    +R+ S++
Sbjct  1    MISLNRSSFLSNS--GVNGSGVNAQRQRR-QPPAFVKVIASRSNQDQKGRATSERSGSVL  57

Query  405  MESALKEV---TESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            ++S LKE+   T S P+V+ E  S V+GGV D YGED+A
Sbjct  58   VDSTLKEMKDHTSSSPIVDPE--SAVSGGVKDVYGEDSA  94



>ref|XP_010033838.1| PREDICTED: NADP-dependent malic enzyme [Eucalyptus grandis]
 gb|KCW53677.1| hypothetical protein EUGRSUZ_J02940 [Eucalyptus grandis]
Length=649

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 63/99 (64%), Gaps = 15/99 (15%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP---KVVAAVSSNGRPG----DRNASIV  404
            MISL+ ++F++NS  GV+     +Q QRR   P   KV+A+ S+  + G    +R+ S++
Sbjct  1    MISLNRSSFLSNS--GVNGSGVNAQRQRR-QPPAFVKVIASRSNQDQKGRATSERSGSVL  57

Query  405  MESALKEV---TESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            ++S LKE+   T S P+V+ E  S V+GGV D YGED+A
Sbjct  58   VDSTLKEMKDHTSSSPIVDPE--SAVSGGVKDVYGEDSA  94



>gb|KCW53676.1| hypothetical protein EUGRSUZ_J02940 [Eucalyptus grandis]
Length=644

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 63/99 (64%), Gaps = 15/99 (15%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAP---KVVAAVSSNGRPG----DRNASIV  404
            MISL+ ++F++NS  GV+     +Q QRR   P   KV+A+ S+  + G    +R+ S++
Sbjct  1    MISLNRSSFLSNS--GVNGSGVNAQRQRR-QPPAFVKVIASRSNQDQKGRATSERSGSVL  57

Query  405  MESALKEV---TESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            ++S LKE+   T S P+V+ E  S V+GGV D YGED+A
Sbjct  58   VDSTLKEMKDHTSSSPIVDPE--SAVSGGVKDVYGEDSA  94



>ref|XP_010267163.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Nelumbo 
nucifera]
Length=626

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +3

Query  327  RRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGED  506
            R+ SAP VV A++SNGR G+R    +MES LKE+ E    ++ + K     GV D YGED
Sbjct  11   RKVSAP-VVVALNSNGRGGERKFKALMESTLKEIREGASALDMDPKPNPGAGVEDVYGED  69

Query  507  TA  512
             A
Sbjct  70   RA  71



>ref|XP_010665912.1| PREDICTED: NADP-dependent malic enzyme [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 48/89 (54%), Gaps = 3/89 (3%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKE  425
            MISL    F++N  S   +    +Q QRR  +   VA   S GR GD N  IV+   +KE
Sbjct  1    MISLHRANFLSNKPSVSGRSFGSTQLQRRGPSVVRVAVGPSKGRSGDENG-IVLTEEIKE  59

Query  426  VTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            V+  + + EK   ST  GGV D YGEDTA
Sbjct  60   VSSVIDLNEKSTVST--GGVEDVYGEDTA  86



>gb|AAF73006.1|AF262997_1 NADP-dependent malic protein [Ricinus communis]
Length=641

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  336  SAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            +AP  +  V+ N    +RN SI+MES L+E+ +   V++ + KSTVAGGV D YGEDTA
Sbjct  29   TAPSSLKVVALNPN-RERNGSIMMESTLQEMRDGASVLDLDPKSTVAGGVRDVYGEDTA  86



>ref|XP_002515967.1| malic enzyme, putative [Ricinus communis]
 gb|EEF46387.1| malic enzyme, putative [Ricinus communis]
Length=641

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  336  SAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            +AP  +  V+ N    +RN SI+MES L+E+ +   V++ + KSTVAGGV D YGEDTA
Sbjct  29   TAPSSLKVVALNPN-RERNGSIMMESTLQEMRDGASVLDLDPKSTVAGGVRDVYGEDTA  86



>ref|XP_008352329.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Malus domestica]
Length=354

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 5/90 (6%)
 Frame = +3

Query  246  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            M+SL+ + F+    ++G S     SQSQ+R S    V AV    R  DRN S+VME+ L+
Sbjct  1    MMSLNRSCFLGKPGIAGSSSPF--SQSQKRRSTSLKVVAVVXKVRTSDRNGSVVMENXLQ  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            +V     V   E KSTV GGV D YG DTA
Sbjct  59   DVKAESEVF--ELKSTVHGGVQDVYGXDTA  86



>gb|EYU21512.1| hypothetical protein MIMGU_mgv1a002703mg [Erythranthe guttata]
Length=645

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = +3

Query  246  MISLSGT-AFMNNSLSGVSKCLTQSQSQRRFSAPKV-VAAVSSNGRPGDRNASIVMESAL  419
            M SL G+ +++N+S+ GVSK L Q  +  R S P + V ++ SN R  D  A     ++ 
Sbjct  1    MFSLGGSCSYLNSSVYGVSKSLVQC-THSRVSPPSMAVVSLGSNNRQVDETAVSKQNASH  59

Query  420  KEVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
               + S   VEK+ KS+V GGV D YGED+A
Sbjct  60   IPSSSSSTAVEKDLKSSVCGGVEDVYGEDSA  90



>ref|XP_008810493.1| PREDICTED: NADP-dependent malic enzyme [Phoenix dactylifera]
Length=641

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 1/66 (2%)
 Frame = +3

Query  318  QSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTESVP-VVEKEAKSTVAGGVGDF  494
             SQRR SA  VV      GR   +   + MES LKE+    P V++ + +STV GGV D 
Sbjct  20   HSQRRSSAAGVVVRCCGRGRGDGKVRGVAMESTLKEIRGDKPSVLDMDPESTVGGGVEDV  79

Query  495  YGEDTA  512
            YGED A
Sbjct  80   YGEDRA  85



>ref|XP_004150784.1| PREDICTED: NADP-dependent malic enzyme, chloroplastic-like [Cucumis 
sativus]
 gb|KGN58034.1| Malic enzyme [Cucumis sativus]
Length=647

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 7/93 (8%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVS-KCLTQSQS-QRRFSAPKVVAAVSSNGRPGDRNASIVME-SA  416
            MISL+ T+F+     GVS  C T S +  RR  A KVV+ + SNGR GDR+ S+++E + 
Sbjct  1    MISLNRTSFLTQM--GVSGPCSTPSGTGNRRPMALKVVS-MDSNGRAGDRSGSVLVENNT  57

Query  417  LKEVTESV-PVVEKEAKSTVAGGVGDFYGEDTA  512
            +KE+ +   PVVE E KST      D Y ED+A
Sbjct  58   VKEIAKPPSPVVEVEPKSTAGAWPQDAYVEDSA  90



>ref|XP_008361292.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Malus domestica]
Length=354

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 50/90 (56%), Gaps = 5/90 (6%)
 Frame = +3

Query  246  MISLSGTAFMNNS-LSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            M+SL+ + F+    ++G S     SQSQ+R S    V AV    R  DRN S+ ME+ L+
Sbjct  1    MMSLNRSCFLGKPGIAGSSSPF--SQSQKRRSTSLKVVAVVXKVRTSDRNGSVXMENXLQ  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            +V     V   E KSTV GGV D YG DTA
Sbjct  59   DVKAESEVF--ELKSTVHGGVQDVYGXDTA  86



>gb|AAB17591.1| NADP-malic enzyme, partial [Flaveria bidentis]
Length=106

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQR-RFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            MISL+ +    +S++G S+  TQSQS R     P V + ++SN  P +RN ++ ++SA++
Sbjct  1    MISLNSSFLERSSVAGGSR--TQSQSLRLSVRRPVVASMLNSNSLP-ERNVNVSVDSAVR  57

Query  423  EVTESVPV-----VEKEAKSTVAGGVGDFYGEDTA  512
            +V   V V     V ++  + V GGV D YGEDTA
Sbjct  58   DVNAPVAVEVDRSVGEKPFAVVGGGVEDMYGEDTA  92



>sp|P22178.1|MAOC_FLATR RecName: Full=NADP-dependent malic enzyme, chloroplastic; Short=NADP-ME; 
Flags: Precursor [Flaveria trinervia]
 emb|CAA40421.1| NADP-dependent malic enzyme [Flaveria trinervia]
Length=648

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 59/96 (61%), Gaps = 11/96 (11%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSA--PKVVAAVSSNGRPGDRNASIVMESAL  419
            MISL+ +    +S++G S+  TQSQS  R SA  P V + ++SN  P +RN S+ ++SA+
Sbjct  1    MISLNSSFLERSSVTGGSR--TQSQS-LRLSARRPVVTSMLNSNSLP-ERNVSVSVDSAV  56

Query  420  KEVTESVPV-----VEKEAKSTVAGGVGDFYGEDTA  512
            ++V   V V     V ++  + V GGV D YGEDTA
Sbjct  57   RDVNAPVAVEVDRSVGEKPFAAVGGGVEDMYGEDTA  92



>prf||1701292A NADP dependent malic enzyme
Length=648

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 59/96 (61%), Gaps = 11/96 (11%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRRFSA--PKVVAAVSSNGRPGDRNASIVMESAL  419
            MISL+ +    +S++G S+  TQSQS  R SA  P V + ++SN  P +RN S+ ++SA+
Sbjct  1    MISLNSSFLERSSVTGGSR--TQSQS-LRLSARRPVVTSMLNSNSLP-ERNVSVSVDSAV  56

Query  420  KEVTESVPV-----VEKEAKSTVAGGVGDFYGEDTA  512
            ++V   V V     V ++  + V GGV D YGEDTA
Sbjct  57   RDVNAPVAVEVDRSVGEKPFAAVGGGVEDMYGEDTA  92



>gb|AFM08812.1| NADP-dependent malic protein [Dimocarpus longan]
Length=645

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 54/95 (57%), Gaps = 11/95 (12%)
 Frame = +3

Query  246  MISLSGTAFMNN-SLSGVSKCLTQSQSQRRFSAPKVVAAVSSNGRPGDRNASIVME----  410
            M SL+ + F+NN S+SG S     S +QRR    KVVA  +SN      N S++ME    
Sbjct  1    MFSLNRSCFLNNTSISGRSSPF--SHNQRRRLPTKVVALSTSNRV--QSNVSVLMENHSG  56

Query  411  -SALKEVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
             +AL+E+ +    V  + KS V GGV D YGEDTA
Sbjct  57   TTALQEMRDGYAEV-VDPKSAVTGGVQDVYGEDTA  90



>ref|XP_003543623.1| PREDICTED: NADP-dependent malic enzyme 4, chloroplastic-like 
[Glycine max]
Length=647

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +3

Query  246  MISLSGTAFMNNS-LSGVSKCLTQSQSQR--RFSAPKVVAAVSSNGRPGDRNASIVMESA  416
            M S +  AF++NS L G S     +Q +R  R     +  + SS+ R GDRN S+VME+ 
Sbjct  1    MFSSTRCAFLSNSGLGGCSSLCDAAQKKRSTRLRVVSMTPSSSSSSRSGDRNGSVVMETP  60

Query  417  LKEVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
            LKE+ +   V + +  +  AGG  D YGED A
Sbjct  61   LKELKKESTVADVDDNAISAGGPQDVYGEDRA  92



>ref|XP_008447551.1| PREDICTED: NADP-dependent malic enzyme [Cucumis melo]
 ref|XP_008447552.1| PREDICTED: NADP-dependent malic enzyme [Cucumis melo]
Length=647

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 7/93 (8%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVS-KCLTQSQS-QRRFSAPKVVAAVSSNGRPGDRNASIVME-SA  416
            MISL+ T F+     GVS  C T S +  RR  A KVV+ + SNGR G+R+ S+++E S 
Sbjct  1    MISLNRTTFLTQM--GVSGACSTPSGTGNRRPMALKVVS-MDSNGRAGERSGSVLVENST  57

Query  417  LKEVTESV-PVVEKEAKSTVAGGVGDFYGEDTA  512
            +KE+ +   PVVE E KST      D Y ED+A
Sbjct  58   VKEIAKPPSPVVEVEPKSTAGSWAQDAYVEDSA  90



>gb|KFK42380.1| hypothetical protein AALP_AA2G248700 [Arabis alpina]
Length=638

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQ-RRFSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            MISLS ++F+N    G S  L+  Q + R  ++P +    SS G   D N S+++ES+L 
Sbjct  1    MISLSASSFLNKP--GCSTHLSLRQPRIRTRTSPALFRVFSSLGSTRDPNGSVLIESSLD  58

Query  423  EVTESVPVVEKEAKSTVAGGVGDFYGEDTA  512
                    V+   KS+V+GGV D YGED A
Sbjct  59   SSA-----VDILPKSSVSGGVQDVYGEDAA  83



>gb|AAW56450.1| chloroplast NADP-dependent malic enzyme precursor [Flaveria bidentis]
Length=647

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = +3

Query  246  MISLSGTAFMNNSLSGVSKCLTQSQSQRR-FSAPKVVAAVSSNGRPGDRNASIVMESALK  422
            MISL+ +    +S++G S+  TQSQS R     P V + ++SN  P +RN ++ ++SA++
Sbjct  1    MISLNSSFLERSSVAGGSR--TQSQSLRLSVRRPVVASMLNSNSLP-ERNVNVSVDSAVR  57

Query  423  EVTESVPV-----VEKEAKSTVAGGVGDFYGEDTA  512
            +V   V V     V ++  + V GGV D YGEDTA
Sbjct  58   DVNAPVAVEVDRSVGEKPFAVVGGGVEDMYGEDTA  92



>sp|P36444.1|MAOC_FLAPR RecName: Full=NADP-dependent malic enzyme, chloroplastic; Short=NADP-ME; 
Flags: Precursor [Flaveria pringlei]
 emb|CAA54986.1| malate dehydrogenase (oxaloacetate decarboxylating) (NADP+) [Flaveria 
pringlei]
Length=647

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 7/74 (9%)
 Frame = +3

Query  309  TQSQSQR-RFSAPKVVAAVSSNGRPGDRNASIVMESALKEVTE--SVPVVEKEAK---ST  470
            TQSQS R     P VVA V+SNGRP +R+  + ++ A+K+V    +V V + E+K   + 
Sbjct  20   TQSQSVRLSVRRPMVVAMVNSNGRP-ERSVGVSVDGAVKDVNAPVAVEVADSESKKPTAV  78

Query  471  VAGGVGDFYGEDTA  512
            V GGV D YGED+A
Sbjct  79   VGGGVEDVYGEDSA  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720