BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M16

Length=517
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796939.1|  PREDICTED: transcription factor DIVARICATA-like    172   3e-50   Nicotiana sylvestris
ref|XP_009618932.1|  PREDICTED: transcription factor DIVARICATA-like    169   3e-49   Nicotiana tomentosiformis
ref|XP_006367246.1|  PREDICTED: transcription factor DIVARICATA-like    168   7e-49   
ref|XP_004249950.1|  PREDICTED: transcription factor DIVARICATA         165   1e-47   Solanum lycopersicum
emb|CDO99922.1|  unnamed protein product                                145   1e-39   Coffea canephora [robusta coffee]
gb|KDO41465.1|  hypothetical protein CISIN_1g032677mg                   140   5e-39   Citrus sinensis [apfelsine]
ref|XP_006445756.1|  hypothetical protein CICLE_v10016071mg             142   7e-38   
ref|XP_006485458.1|  PREDICTED: transcription factor DIVARICATA-like    140   1e-37   Citrus sinensis [apfelsine]
ref|XP_010088815.1|  Transcription factor                               140   1e-37   Morus notabilis
ref|XP_010245815.1|  PREDICTED: transcription factor DIVARICATA-like    137   2e-36   Nelumbo nucifera [Indian lotus]
gb|AGZ16405.1|  MYB5                                                    135   5e-36   Scutellaria baicalensis [Baikal skullcap]
ref|XP_008231910.1|  PREDICTED: transcription factor DIVARICATA         135   1e-35   Prunus mume [ume]
ref|XP_007211982.1|  hypothetical protein PRUPE_ppa010926mg             135   1e-35   Prunus persica
gb|KJB35518.1|  hypothetical protein B456_006G118200                    134   3e-35   Gossypium raimondii
ref|XP_011084236.1|  PREDICTED: transcription factor DIVARICATA-like    132   1e-34   Sesamum indicum [beniseed]
gb|ABH02832.1|  MYB transcription factor MYB69                          132   2e-34   Glycine max [soybeans]
gb|KHN11452.1|  Transcription factor MYB1R1                             132   2e-34   Glycine soja [wild soybean]
ref|NP_001237360.1|  syringolide-induced protein 1-3-1A                 132   2e-34   Glycine max [soybeans]
ref|NP_001237103.1|  syringolide-induced protein 1-3-1B                 130   7e-34   Glycine max [soybeans]
gb|KHG10604.1|  Transcription factor MYB1R1                             130   1e-33   Gossypium arboreum [tree cotton]
emb|CAB65169.1|  I-box binding factor                                   127   3e-33   Solanum lycopersicum
gb|KDP43682.1|  hypothetical protein JCGZ_24140                         129   3e-33   Jatropha curcas
ref|XP_009792792.1|  PREDICTED: transcription factor DIVARICATA-like    128   3e-33   Nicotiana sylvestris
ref|XP_006345871.1|  PREDICTED: transcription factor DIVARICATA-like    127   3e-33   Solanum tuberosum [potatoes]
ref|XP_004239729.1|  PREDICTED: transcription factor DIVARICATA         127   6e-33   
ref|XP_007142868.1|  hypothetical protein PHAVU_007G023600g             127   1e-32   Phaseolus vulgaris [French bean]
ref|XP_004140910.1|  PREDICTED: transcription factor DIVARICATA-like    126   3e-32   Cucumis sativus [cucumbers]
ref|XP_008456608.1|  PREDICTED: transcription factor DIVARICATA         126   3e-32   Cucumis melo [Oriental melon]
ref|XP_009617435.1|  PREDICTED: transcription factor DIVARICATA-like    124   6e-32   Nicotiana tomentosiformis
ref|XP_009341585.1|  PREDICTED: transcription factor DIVARICATA         124   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_011078235.1|  PREDICTED: protein RADIALIS-like 4                 121   2e-31   
ref|XP_008363219.1|  PREDICTED: transcription factor DIVARICATA-like    123   3e-31   Malus domestica [apple tree]
ref|XP_011070193.1|  PREDICTED: protein RADIALIS-like 4                 119   1e-30   Sesamum indicum [beniseed]
ref|XP_002523835.1|  DNA binding protein, putative                      121   1e-30   Ricinus communis
ref|XP_002873168.1|  hypothetical protein ARALYDRAFT_908364             121   2e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_011092674.1|  PREDICTED: transcription factor DIVARICATA-like    119   3e-30   
emb|CDY11306.1|  BnaA03g01420D                                          120   4e-30   Brassica napus [oilseed rape]
emb|CDX80919.1|  BnaC03g01730D                                          119   6e-30   
ref|XP_006289993.1|  hypothetical protein CARUB_v10003623mg             119   9e-30   Capsella rubella
gb|KDP39847.1|  hypothetical protein JCGZ_04192                         119   1e-29   Jatropha curcas
ref|XP_009795456.1|  PREDICTED: transcription factor DIVARICATA-like    117   1e-29   Nicotiana sylvestris
gb|KFK24916.1|  hypothetical protein AALP_AA8G041600                    119   1e-29   Arabis alpina [alpine rockcress]
ref|XP_007015574.1|  Duplicated homeodomain-like superfamily prot...    119   2e-29   
ref|XP_010695074.1|  PREDICTED: transcription factor DIVARICATA         118   2e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003637230.1|  DnaJ homolog subfamily C member                    119   2e-29   
ref|XP_009130835.1|  PREDICTED: transcription factor DIVARICATA         118   3e-29   Brassica rapa
ref|XP_011469263.1|  PREDICTED: transcription factor DIVARICATA         118   3e-29   Fragaria vesca subsp. vesca
ref|XP_009592760.1|  PREDICTED: transcription factor DIVARICATA-like    116   4e-29   Nicotiana tomentosiformis
ref|XP_010552881.1|  PREDICTED: transcription factor DIVARICATA-like    117   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_002273261.1|  PREDICTED: transcription factor DIVARICATA         117   5e-29   Vitis vinifera
emb|CBI28292.3|  unnamed protein product                                117   8e-29   Vitis vinifera
ref|XP_004497135.1|  PREDICTED: transcription factor DIVARICATA-like    117   1e-28   Cicer arietinum [garbanzo]
ref|XP_010490996.1|  PREDICTED: transcription factor DIVARICATA-like    115   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010423540.1|  PREDICTED: transcription factor DIVARICATA-like    115   2e-28   Camelina sativa [gold-of-pleasure]
gb|KHG07762.1|  Transcription factor MYB1R1                             112   2e-27   Gossypium arboreum [tree cotton]
emb|CDX70204.1|  BnaA10g25530D                                          110   4e-27   
ref|XP_011006061.1|  PREDICTED: transcription factor DIVARICATA-like    108   1e-25   Populus euphratica
ref|XP_002515769.1|  DNA binding protein, putative                      108   2e-25   Ricinus communis
ref|XP_006398929.1|  hypothetical protein EUTSA_v10014613mg             108   2e-25   Eutrema salsugineum [saltwater cress]
ref|XP_008440393.1|  PREDICTED: transcription factor DIVARICATA-like    108   2e-25   Cucumis melo [Oriental melon]
ref|XP_009122571.1|  PREDICTED: transcription factor DIVARICATA-like    107   3e-25   Brassica rapa
ref|XP_002316492.2|  hypothetical protein POPTR_0010s24710g             107   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_004141984.1|  PREDICTED: transcription factor DIVARICATA-like    107   3e-25   Cucumis sativus [cucumbers]
ref|XP_011024174.1|  PREDICTED: transcription factor DIVARICATA-like    107   6e-25   Populus euphratica
ref|XP_007015770.1|  Duplicated homeodomain-like superfamily prot...    106   8e-25   
ref|NP_196096.1|  duplicated SANT DNA-binding domain-containing p...    106   8e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDY04922.1|  BnaAnng01040D                                          106   8e-25   
emb|CDY14142.1|  BnaC02g02590D                                          105   1e-24   Brassica napus [oilseed rape]
gb|KJB55532.1|  hypothetical protein B456_009G080900                    103   1e-24   Gossypium raimondii
ref|XP_009125576.1|  PREDICTED: transcription factor DIVARICATA-like    105   2e-24   Brassica rapa
ref|XP_010452376.1|  PREDICTED: transcription factor DIVARICATA-like    102   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006836469.1|  hypothetical protein AMTR_s00108p00066140        97.8    1e-22   
ref|XP_008802864.1|  PREDICTED: transcription factor DIVARICATA         101   2e-22   Phoenix dactylifera
ref|XP_010031294.1|  PREDICTED: transcription factor DIVARICATA         100   2e-22   Eucalyptus grandis [rose gum]
gb|KJB35391.1|  hypothetical protein B456_006G113100                  98.2    8e-22   Gossypium raimondii
ref|XP_010935566.1|  PREDICTED: transcription factor DIVARICATA       98.2    2e-21   
ref|XP_002264197.1|  PREDICTED: transcription factor DIVARICATA       98.6    3e-21   Vitis vinifera
ref|XP_007219262.1|  hypothetical protein PRUPE_ppa018139mg           97.8    3e-21   Prunus persica
ref|XP_008233716.1|  PREDICTED: transcription factor DIVARICATA-like  97.8    3e-21   Prunus mume [ume]
emb|CDY08538.1|  BnaA05g27740D                                        96.7    7e-21   Brassica napus [oilseed rape]
ref|XP_008789580.1|  PREDICTED: transcription factor DIVARICATA-like  95.1    7e-21   
emb|CDY01009.1|  BnaC05g41910D                                        96.3    8e-21   
ref|XP_009146740.1|  PREDICTED: transcription factor DIVARICATA       95.9    1e-20   Brassica rapa
ref|XP_009420852.1|  PREDICTED: transcription factor DIVARICATA-like  95.9    2e-20   
gb|EYU37210.1|  hypothetical protein MIMGU_mgv1a014332mg              94.0    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_006407460.1|  hypothetical protein EUTSA_v10021322mg           95.1    2e-20   Eutrema salsugineum [saltwater cress]
gb|ACR09747.1|  DIV2B protein                                         94.7    4e-20   Heptacodium miconioides [seven-sons tree]
ref|XP_006424203.1|  hypothetical protein CICLE_v10029205mg           93.6    6e-20   Citrus clementina [clementine]
ref|XP_010543747.1|  PREDICTED: transcription factor DIVARICATA-like  94.0    7e-20   Tarenaya hassleriana [spider flower]
ref|XP_010543615.1|  PREDICTED: transcription factor DIVARICATA-l...  94.0    8e-20   Tarenaya hassleriana [spider flower]
ref|XP_001754431.1|  predicted protein                                91.7    1e-19   
gb|KFK27418.1|  hypothetical protein AALP_AA8G380200                  93.6    1e-19   Arabis alpina [alpine rockcress]
ref|XP_008775058.1|  PREDICTED: transcription factor DIVARICATA-l...  93.6    1e-19   Phoenix dactylifera
ref|XP_008775057.1|  PREDICTED: transcription factor DIVARICATA-l...  93.6    1e-19   Phoenix dactylifera
ref|XP_009418650.1|  PREDICTED: transcription factor DIVARICATA-l...  91.7    1e-19   
ref|XP_010552868.1|  PREDICTED: transcription factor DIVARICATA-like  92.8    1e-19   
ref|XP_009418647.1|  PREDICTED: transcription factor DIVARICATA-l...  92.0    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009122287.1|  PREDICTED: transcription factor DIVARICATA-like  92.4    2e-19   Brassica rapa
ref|XP_006437648.1|  hypothetical protein CICLE_v10032259mg           92.4    3e-19   Citrus clementina [clementine]
ref|XP_010907625.1|  PREDICTED: transcription factor DIVARICATA-like  92.4    3e-19   Elaeis guineensis
gb|KDO69927.1|  hypothetical protein CISIN_1g022439mg                 92.4    3e-19   Citrus sinensis [apfelsine]
ref|XP_010486776.1|  PREDICTED: transcription factor DIVARICATA-like  91.7    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010543616.1|  PREDICTED: transcription factor DIVARICATA-l...  91.3    5e-19   Tarenaya hassleriana [spider flower]
ref|XP_009418273.1|  PREDICTED: transcription factor DIVARICATA-like  91.7    5e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006435669.1|  hypothetical protein CICLE_v10032309mg           91.3    6e-19   Citrus clementina [clementine]
ref|XP_010923123.1|  PREDICTED: transcription factor DIVARICATA-like  91.3    6e-19   Elaeis guineensis
ref|XP_006298342.1|  hypothetical protein CARUB_v10014411mg           90.9    7e-19   Capsella rubella
ref|XP_002884839.1|  myb family transcription factor                  90.9    8e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_008445896.1|  PREDICTED: transcription factor DIVARICATA       90.9    9e-19   Cucumis melo [Oriental melon]
ref|XP_009380613.1|  PREDICTED: transcription factor DIVARICATA-like  90.9    9e-19   
ref|XP_011039696.1|  PREDICTED: transcription factor DIVARICATA-like  90.9    9e-19   Populus euphratica
ref|XP_002311203.2|  hypothetical protein POPTR_0008s06450g           90.9    1e-18   
emb|CDY36326.1|  BnaA01g30920D                                        90.5    1e-18   Brassica napus [oilseed rape]
ref|XP_004147105.1|  PREDICTED: transcription factor DIVARICATA-like  90.5    1e-18   Cucumis sativus [cucumbers]
ref|XP_007205616.1|  hypothetical protein PRUPE_ppa009103mg           90.5    1e-18   Prunus persica
ref|XP_008239581.1|  PREDICTED: transcription factor DIVARICATA       90.5    1e-18   Prunus mume [ume]
emb|CDP09156.1|  unnamed protein product                              90.5    1e-18   Coffea canephora [robusta coffee]
gb|KHN17851.1|  Transcription factor MYB1R1                           90.5    1e-18   Glycine soja [wild soybean]
gb|KEH34188.1|  MYB transcription factor MYB51                        90.5    1e-18   Medicago truncatula
emb|CDY36310.1|  BnaA01g31080D                                        90.1    1e-18   Brassica napus [oilseed rape]
ref|XP_009776702.1|  PREDICTED: transcription factor DIVARICATA-like  89.7    2e-18   Nicotiana sylvestris
ref|XP_003552519.1|  PREDICTED: transcription factor DIVARICATA-l...  90.1    2e-18   
gb|KHG20644.1|  Transcription factor MYB1R1                           90.1    2e-18   Gossypium arboreum [tree cotton]
ref|XP_010464831.1|  PREDICTED: transcription factor DIVARICATA       89.7    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002866297.1|  myb family transcription factor                  90.1    2e-18   
gb|AFK48294.1|  unknown                                               89.4    2e-18   Medicago truncatula
gb|ACJ84646.1|  unknown                                               89.4    2e-18   
emb|CDP06510.1|  unnamed protein product                              90.1    2e-18   Coffea canephora [robusta coffee]
ref|XP_010535415.1|  PREDICTED: transcription factor DIVARICATA i...  88.2    2e-18   Tarenaya hassleriana [spider flower]
gb|KDP24483.1|  hypothetical protein JCGZ_25047                       89.7    2e-18   Jatropha curcas
emb|CDY14490.1|  BnaC03g21050D                                        89.7    2e-18   Brassica napus [oilseed rape]
gb|KJB76909.1|  hypothetical protein B456_012G112000                  89.7    2e-18   Gossypium raimondii
ref|XP_008785421.1|  PREDICTED: transcription factor DIVARICATA i...  89.4    3e-18   Phoenix dactylifera
ref|XP_008785419.1|  PREDICTED: transcription factor DIVARICATA i...  89.7    3e-18   Phoenix dactylifera
gb|ACR19085.1|  DIV2B protein                                         87.8    3e-18   Diervilla sessilifolia
emb|CDY18405.1|  BnaA04g21820D                                        89.4    3e-18   Brassica napus [oilseed rape]
ref|XP_009141719.1|  PREDICTED: transcription factor DIVARICATA-like  89.4    3e-18   Brassica rapa
gb|KHN07641.1|  Transcription factor MYB1R1                           89.4    4e-18   Glycine soja [wild soybean]
ref|XP_009398308.1|  PREDICTED: transcription factor DIVARICATA-like  89.0    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006280910.1|  hypothetical protein CARUB_v10026903mg           89.0    4e-18   Capsella rubella
ref|XP_010067021.1|  PREDICTED: transcription factor DIVARICATA-like  89.0    4e-18   Eucalyptus grandis [rose gum]
ref|NP_187737.1|  putative VHA-B1-interacting transcription factor    89.0    4e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67284.1|  MYB-family transcription factor, putative             89.0    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003616568.1|  DnaJ homolog subfamily C member                  89.0    4e-18   Medicago truncatula
gb|KDO53234.1|  hypothetical protein CISIN_1g021756mg                 89.0    4e-18   Citrus sinensis [apfelsine]
ref|XP_006480971.1|  PREDICTED: transcription factor DIVARICATA-like  89.0    4e-18   Citrus sinensis [apfelsine]
ref|XP_006429310.1|  hypothetical protein CICLE_v10012285mg           89.0    4e-18   Citrus clementina [clementine]
gb|KJB74214.1|  hypothetical protein B456_011G279800                  89.0    4e-18   Gossypium raimondii
ref|XP_009132024.1|  PREDICTED: transcription factor DIVARICATA-like  89.0    5e-18   Brassica rapa
gb|ABR16097.1|  unknown                                               88.6    5e-18   Picea sitchensis
ref|XP_009419911.1|  PREDICTED: transcription factor DIVARICATA-like  88.6    6e-18   
ref|XP_007153178.1|  hypothetical protein PHAVU_003G013600g           88.6    6e-18   Phaseolus vulgaris [French bean]
ref|XP_002316232.1|  myb family transcription factor family protein   88.6    6e-18   Populus trichocarpa [western balsam poplar]
ref|XP_003538448.1|  PREDICTED: transcription factor DIVARICATA i...  88.6    6e-18   
gb|KDO69097.1|  hypothetical protein CISIN_1g023196mg                 88.6    6e-18   Citrus sinensis [apfelsine]
ref|XP_011019148.1|  PREDICTED: transcription factor DIVARICATA-like  88.6    7e-18   Populus euphratica
emb|CDP18453.1|  unnamed protein product                              88.6    7e-18   Coffea canephora [robusta coffee]
gb|KHN14065.1|  hypothetical protein glysoja_048339                   85.9    7e-18   Glycine soja [wild soybean]
ref|XP_004302668.1|  PREDICTED: transcription factor DIVARICATA       88.6    7e-18   Fragaria vesca subsp. vesca
ref|XP_010535414.1|  PREDICTED: transcription factor DIVARICATA i...  87.8    8e-18   Tarenaya hassleriana [spider flower]
ref|XP_009622771.1|  PREDICTED: transcription factor DIVARICATA-like  87.4    8e-18   
ref|XP_011009177.1|  PREDICTED: transcription factor DIVARICATA-like  88.2    1e-17   Populus euphratica
ref|XP_010541440.1|  PREDICTED: transcription factor DIVARICATA-like  87.4    1e-17   
ref|NP_001055671.1|  Os05g0442400                                     86.7    1e-17   
emb|CDY71881.1|  BnaAnng39140D                                        87.8    1e-17   Brassica napus [oilseed rape]
ref|XP_004513249.1|  PREDICTED: transcription factor DIVARICATA-l...  87.8    1e-17   Cicer arietinum [garbanzo]
ref|XP_006574483.1|  PREDICTED: MYB transcription factor MYB83 is...  87.8    1e-17   Glycine max [soybeans]
gb|EPS60201.1|  hypothetical protein M569_14602                       87.4    1e-17   Genlisea aurea
emb|CBI30422.3|  unnamed protein product                              86.7    1e-17   Vitis vinifera
gb|KEH40705.1|  MYB family transcription factor                       85.1    1e-17   Medicago truncatula
ref|XP_006380485.1|  hypothetical protein POPTR_0007s07150g           87.4    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002513126.1|  DNA binding protein, putative                    87.4    1e-17   Ricinus communis
ref|XP_010936185.1|  PREDICTED: transcription factor DIVARICATA-like  85.9    2e-17   Elaeis guineensis
ref|XP_006401027.1|  hypothetical protein EUTSA_v10014270mg           87.0    2e-17   Eutrema salsugineum [saltwater cress]
ref|XP_004509855.1|  PREDICTED: transcription factor DIVARICATA-like  87.0    2e-17   Cicer arietinum [garbanzo]
gb|ADE22269.1|  MYB transcription factor                              87.4    2e-17   Malus domestica [apple tree]
emb|CDP14063.1|  unnamed protein product                              87.0    2e-17   Coffea canephora [robusta coffee]
ref|NP_200698.1|  homeodomain-like transcriptional regulator          87.0    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008442463.1|  PREDICTED: transcription factor DIVARICATA-like  87.0    2e-17   Cucumis melo [Oriental melon]
ref|XP_011094978.1|  PREDICTED: transcription factor DIVARICATA-like  87.0    2e-17   Sesamum indicum [beniseed]
ref|XP_009120398.1|  PREDICTED: transcription factor DIVARICATA       87.0    2e-17   Brassica rapa
emb|CDX80328.1|  BnaC09g34140D                                        86.7    2e-17   
ref|XP_006487909.1|  PREDICTED: transcription factor DIVARICATA-like  86.3    2e-17   Citrus sinensis [apfelsine]
ref|XP_002308211.1|  myb family transcription factor family protein   87.0    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_007146740.1|  hypothetical protein PHAVU_006G065700g           87.0    3e-17   Phaseolus vulgaris [French bean]
ref|XP_009143425.1|  PREDICTED: transcription factor DIVARICATA-like  86.7    3e-17   Brassica rapa
gb|KHN43075.1|  DnaJ like subfamily C member 2                        84.7    3e-17   Glycine soja [wild soybean]
ref|XP_003555779.1|  PREDICTED: transcription factor DIVARICATA-l...  86.7    3e-17   Glycine max [soybeans]
ref|XP_010483499.1|  PREDICTED: transcription factor DIVARICATA-l...  86.7    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_007141798.1|  hypothetical protein PHAVU_008G226600g           86.7    3e-17   Phaseolus vulgaris [French bean]
ref|XP_009407560.1|  PREDICTED: transcription factor DIVARICATA-like  86.7    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008370064.1|  PREDICTED: transcription factor DIVARICATA-like  86.7    3e-17   
ref|XP_002278729.1|  PREDICTED: transcription factor DIVARICATA-like  86.7    3e-17   Vitis vinifera
ref|XP_009409492.1|  PREDICTED: transcription factor DIVARICATA-like  86.7    3e-17   
ref|XP_003538252.1|  PREDICTED: transcription factor DIVARICATA       86.7    4e-17   Glycine max [soybeans]
ref|XP_004137732.1|  PREDICTED: transcription factor DIVARICATA-like  86.3    4e-17   Cucumis sativus [cucumbers]
ref|XP_004168810.1|  PREDICTED: transcription factor DIVARICATA-l...  86.3    4e-17   
ref|XP_004143146.1|  PREDICTED: transcription factor DIVARICATA-like  86.3    4e-17   Cucumis sativus [cucumbers]
gb|KDP44829.1|  hypothetical protein JCGZ_01329                       86.3    4e-17   Jatropha curcas
emb|CDX70128.1|  BnaA10g24770D                                        85.9    4e-17   
ref|XP_004251428.1|  PREDICTED: uncharacterized protein LOC101258332  88.6    5e-17   Solanum lycopersicum
gb|AHB59616.1|  putative MYB-related protein 30                       86.3    5e-17   Arachis hypogaea [goober]
ref|XP_009344476.1|  PREDICTED: transcription factor DIVARICATA-like  85.9    5e-17   Pyrus x bretschneideri [bai li]
ref|XP_002534707.1|  DNA binding protein, putative                    85.9    5e-17   Ricinus communis
ref|XP_009370204.1|  PREDICTED: transcription factor DIVARICATA       85.9    5e-17   Pyrus x bretschneideri [bai li]
ref|XP_003532025.1|  PREDICTED: transcription factor DIVARICATA-l...  85.9    5e-17   Glycine max [soybeans]
ref|XP_006363051.1|  PREDICTED: transcription factor DIVARICATA-like  85.9    5e-17   Solanum tuberosum [potatoes]
ref|XP_010262772.1|  PREDICTED: transcription factor DIVARICATA-like  85.9    5e-17   Nelumbo nucifera [Indian lotus]
ref|XP_004168809.1|  PREDICTED: transcription factor DIVARICATA-l...  85.9    6e-17   
gb|KJB76153.1|  hypothetical protein B456_012G075600                  85.5    6e-17   Gossypium raimondii
ref|XP_004246338.1|  PREDICTED: transcription factor DIVARICATA-like  85.9    6e-17   Solanum lycopersicum
ref|XP_008349577.1|  PREDICTED: transcription factor DIVARICATA-like  85.9    6e-17   Malus domestica [apple tree]
ref|XP_009133230.1|  PREDICTED: transcription factor DIVARICATA-like  85.5    6e-17   Brassica rapa
ref|NP_001235748.1|  MYB transcription factor MYB75                   85.5    7e-17   Glycine max [soybeans]
gb|KHN13083.1|  Transcription factor MYB1R1                           85.5    7e-17   Glycine soja [wild soybean]
emb|CDX71148.1|  BnaC03g12320D                                        85.5    7e-17   
ref|XP_003589445.1|  Myb-like protein J                               85.5    7e-17   
ref|XP_009770756.1|  PREDICTED: transcription factor DIVARICATA       85.5    8e-17   Nicotiana sylvestris
gb|ACR09741.1|  DIV2A protein                                         85.1    8e-17   Heptacodium miconioides [seven-sons tree]
emb|CDX93328.1|  BnaC04g45680D                                        85.1    8e-17   
ref|XP_009613368.1|  PREDICTED: transcription factor DIVARICATA       85.1    8e-17   Nicotiana tomentosiformis
gb|KHN20871.1|  Transcription factor MYB1R1                           85.1    9e-17   Glycine soja [wild soybean]
ref|XP_007153659.1|  hypothetical protein PHAVU_003G054100g           85.1    9e-17   Phaseolus vulgaris [French bean]
ref|XP_006848111.1|  hypothetical protein AMTR_s00029p00215750        85.1    9e-17   
ref|XP_008464056.1|  PREDICTED: transcription factor DIVARICATA i...  85.1    9e-17   
ref|XP_002322964.2|  hypothetical protein POPTR_0016s11980g           85.1    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_004492415.1|  PREDICTED: transcription factor DIVARICATA-like  85.1    1e-16   Cicer arietinum [garbanzo]
ref|XP_006425017.1|  hypothetical protein CICLE_v10028910mg           85.1    1e-16   Citrus clementina [clementine]
ref|XP_008464057.1|  PREDICTED: transcription factor DIVARICATA i...  85.1    1e-16   Cucumis melo [Oriental melon]
ref|XP_008388135.1|  PREDICTED: transcription factor DIVARICATA-like  85.1    1e-16   
emb|CDY64223.1|  BnaCnng43450D                                        85.1    1e-16   Brassica napus [oilseed rape]
gb|AFH03060.1|  R2R3-MYB transcription factor MYB8                    85.1    1e-16   Epimedium sagittatum
ref|XP_008392914.1|  PREDICTED: transcription factor DIVARICATA-like  84.7    1e-16   Malus domestica [apple tree]
ref|XP_011036008.1|  PREDICTED: transcription factor DIVARICATA-like  84.7    1e-16   Populus euphratica
ref|XP_006593114.1|  PREDICTED: transcription factor DIVARICATA-like  84.0    1e-16   Glycine max [soybeans]
ref|XP_006411010.1|  hypothetical protein EUTSA_v10017008mg           84.7    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_009786719.1|  PREDICTED: transcription factor DIVARICATA-like  84.7    1e-16   Nicotiana sylvestris
gb|KHN30676.1|  Transcription factor MYB1R1                           84.7    1e-16   Glycine soja [wild soybean]
ref|XP_008464055.1|  PREDICTED: transcription factor DIVARICATA i...  84.7    1e-16   Cucumis melo [Oriental melon]
ref|XP_010553252.1|  PREDICTED: transcription factor DIVARICATA-like  84.7    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_011077580.1|  PREDICTED: transcription factor DIVARICATA-like  84.7    1e-16   Sesamum indicum [beniseed]
gb|KHG28080.1|  Transcription factor MYB1R1                           84.7    1e-16   Gossypium arboreum [tree cotton]
gb|KEH23148.1|  MYB transcription factor MYB51                        84.7    1e-16   Medicago truncatula
ref|XP_002311931.2|  syringolide-induced protein 1-3-1B               83.6    2e-16   
ref|XP_010655991.1|  PREDICTED: transcription factor DIVARICATA i...  84.7    2e-16   Vitis vinifera
ref|XP_007163513.1|  hypothetical protein PHAVU_001G240300g           84.7    2e-16   Phaseolus vulgaris [French bean]
ref|XP_009350979.1|  PREDICTED: transcription factor DIVARICATA-like  84.3    2e-16   Pyrus x bretschneideri [bai li]
ref|NP_001240091.1|  uncharacterized protein LOC100819797             84.3    2e-16   Glycine max [soybeans]
gb|ABR28332.1|  MYB transcription factor MYB33                        84.7    2e-16   Medicago truncatula
ref|XP_009122177.1|  PREDICTED: transcription factor DIVARICATA       84.3    2e-16   Brassica rapa
ref|XP_011084945.1|  PREDICTED: transcription factor DIVARICATA-like  84.0    2e-16   Sesamum indicum [beniseed]
ref|XP_006855645.1|  hypothetical protein AMTR_s00044p00109210        82.0    2e-16   
ref|XP_002989732.1|  hypothetical protein SELMODRAFT_47768            82.8    2e-16   
ref|XP_011070471.1|  PREDICTED: transcription factor DIVARICATA       84.3    2e-16   Sesamum indicum [beniseed]
ref|XP_010483500.1|  PREDICTED: transcription factor DIVARICATA-l...  84.0    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009794315.1|  PREDICTED: transcription factor DIVARICATA-like  84.3    2e-16   Nicotiana sylvestris
ref|XP_002267157.2|  PREDICTED: transcription factor DIVARICATA i...  84.3    2e-16   Vitis vinifera
ref|XP_002530418.1|  DNA binding protein, putative                    84.0    2e-16   Ricinus communis
ref|XP_003516340.1|  PREDICTED: transcription factor DIVARICATA-l...  84.3    2e-16   Glycine max [soybeans]
emb|CDY60235.1|  BnaA03g55780D                                        84.0    2e-16   Brassica napus [oilseed rape]
gb|AAC27179.1|  putative MYB family transcription factor              84.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181344.2|  Duplicated homeodomain-like superfamily protein     84.0    3e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009589244.1|  PREDICTED: transcription factor DIVARICATA-like  84.0    3e-16   Nicotiana tomentosiformis
ref|XP_006573343.1|  PREDICTED: transcription factor DIVARICATA-l...  84.3    3e-16   
gb|KHG08970.1|  Transcription factor MYB1R1                           84.0    3e-16   Gossypium arboreum [tree cotton]
gb|KFK25219.1|  hypothetical protein AALP_AA8G082600                  84.0    3e-16   Arabis alpina [alpine rockcress]
ref|XP_006294698.1|  hypothetical protein CARUB_v10023736mg           83.6    3e-16   Capsella rubella
ref|XP_010491116.1|  PREDICTED: transcription factor DIVARICATA-like  83.6    3e-16   Camelina sativa [gold-of-pleasure]
gb|KHN02156.1|  Transcription factor MYB1R1                           84.0    3e-16   Glycine soja [wild soybean]
ref|XP_006573344.1|  PREDICTED: transcription factor DIVARICATA-l...  83.6    3e-16   Glycine max [soybeans]
gb|KDP40478.1|  hypothetical protein JCGZ_24477                       83.6    3e-16   Jatropha curcas
gb|KJB17029.1|  hypothetical protein B456_002G261600                  83.6    3e-16   Gossypium raimondii
gb|KHN45529.1|  Transcription factor MYB1R1                           83.6    3e-16   Glycine soja [wild soybean]
ref|XP_010655989.1|  PREDICTED: transcription factor DIVARICATA i...  83.6    3e-16   Vitis vinifera
gb|EYU19980.1|  hypothetical protein MIMGU_mgv1a013156mg              83.2    3e-16   Erythranthe guttata [common monkey flower]
ref|NP_001240137.1|  MYB transcription factor MYB51                   83.6    3e-16   Glycine max [soybeans]
ref|XP_009402284.1|  PREDICTED: transcription factor DIVARICATA-like  84.3    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004294268.1|  PREDICTED: transcription factor DIVARICATA       83.6    3e-16   Fragaria vesca subsp. vesca
ref|XP_004500230.1|  PREDICTED: transcription factor DIVARICATA-l...  84.0    4e-16   Cicer arietinum [garbanzo]
ref|XP_008355344.1|  PREDICTED: transcription factor DIVARICATA-like  83.6    4e-16   
ref|XP_003551300.1|  PREDICTED: transcription factor DIVARICATA-like  83.6    4e-16   
gb|KJB77404.1|  hypothetical protein B456_012G135600                  83.2    4e-16   
ref|XP_006288437.1|  hypothetical protein CARUB_v10001695mg           83.2    4e-16   
ref|XP_003529238.1|  PREDICTED: transcription factor DIVARICATA-l...  83.6    4e-16   
ref|XP_010095053.1|  Transcription factor                             83.2    4e-16   
gb|EMS49234.1|  Transcription factor MYB1R1                           83.2    4e-16   
ref|XP_008221083.1|  PREDICTED: transcription factor DIVARICATA       83.2    4e-16   
gb|KJB46618.1|  hypothetical protein B456_007G378300                  83.2    4e-16   
ref|XP_010044094.1|  PREDICTED: transcription factor DIVARICATA-like  83.2    4e-16   
ref|XP_011080854.1|  PREDICTED: transcription factor DIVARICATA       83.2    5e-16   
ref|XP_010547700.1|  PREDICTED: transcription factor DIVARICATA-l...  83.2    5e-16   
gb|KHN22724.1|  Transcription factor MYB1R1                           83.2    5e-16   
ref|XP_004490951.1|  PREDICTED: transcription factor DIVARICATA-like  83.2    5e-16   
ref|XP_009374277.1|  PREDICTED: transcription factor DIVARICATA-like  83.2    5e-16   
gb|ABC55648.1|  MYB transcription factor                              83.2    5e-16   
ref|XP_011003665.1|  PREDICTED: transcription factor DIVARICATA-like  83.2    5e-16   
ref|XP_009358854.1|  PREDICTED: transcription factor DIVARICATA-like  83.2    5e-16   
ref|XP_001779346.1|  predicted protein                                82.8    5e-16   
emb|CDY21545.1|  BnaC09g47470D                                        82.8    6e-16   
ref|XP_010547699.1|  PREDICTED: transcription factor DIVARICATA-l...  83.2    6e-16   
ref|XP_011076737.1|  PREDICTED: transcription factor DIVARICATA-like  82.8    6e-16   
ref|XP_002879727.1|  myb family transcription factor                  82.8    6e-16   
gb|KJB55774.1|  hypothetical protein B456_009G093700                  82.8    6e-16   
gb|EMT08115.1|  Myb-like protein J                                    82.8    6e-16   
gb|KHN10618.1|  Transcription factor MYB1R1                           82.8    6e-16   
gb|KHN24300.1|  Transcription factor MYB1R1                           82.8    6e-16   
ref|XP_010249061.1|  PREDICTED: transcription factor DIVARICATA-l...  82.8    7e-16   
ref|XP_009412978.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  85.1    7e-16   
ref|XP_010256655.1|  PREDICTED: transcription factor DIVARICATA-like  82.8    7e-16   
ref|XP_007009093.1|  Duplicated homeodomain-like superfamily protein  82.4    7e-16   
ref|XP_002525595.1|  DNA binding protein, putative                    82.8    7e-16   
gb|AFW78101.1|  putative MYB DNA-binding domain superfamily protein   80.9    7e-16   
dbj|BAJ92648.1|  predicted protein                                    82.8    7e-16   
gb|ABH02903.1|  MYB transcription factor MYB51                        82.4    7e-16   
ref|XP_007016182.1|  DIV1A protein                                    82.8    7e-16   
gb|AAG44394.1|  unknown                                               82.8    7e-16   
ref|XP_007140381.1|  hypothetical protein PHAVU_008G107000g           82.4    8e-16   
gb|EEE63881.1|  hypothetical protein OsJ_18705                        80.5    8e-16   
gb|AHB59615.1|  putative MYB-related protein 29                       82.4    8e-16   
ref|XP_004241178.1|  PREDICTED: transcription factor DIVARICATA       82.4    8e-16   
ref|XP_008220434.1|  PREDICTED: transcription factor DIVARICATA       82.4    8e-16   
ref|XP_009122461.1|  PREDICTED: transcription factor DIVARICATA       82.4    9e-16   
emb|CDM83638.1|  unnamed protein product                              82.4    9e-16   
ref|XP_006350823.1|  PREDICTED: transcription factor DIVARICATA-like  82.4    9e-16   
ref|XP_002991762.1|  hypothetical protein SELMODRAFT_47760            80.9    1e-15   
gb|EYU35558.1|  hypothetical protein MIMGU_mgv1a010822mg              82.0    1e-15   
ref|XP_006362986.1|  PREDICTED: transcription factor DIVARICATA-like  82.0    1e-15   
gb|KJB46617.1|  hypothetical protein B456_007G378300                  82.4    1e-15   
emb|CAN61550.1|  hypothetical protein VITISV_028268                   84.0    1e-15   
ref|XP_003615578.1|  DnaJ homolog subfamily C member                  82.0    1e-15   
ref|XP_007205610.1|  hypothetical protein PRUPE_ppa009072mg           82.0    1e-15   
gb|EYU27466.1|  hypothetical protein MIMGU_mgv1a014945mg              80.5    1e-15   
ref|XP_010423428.1|  PREDICTED: transcription factor DIVARICATA-like  81.6    1e-15   
ref|XP_009382952.1|  PREDICTED: transcription factor DIVARICATA-like  80.9    1e-15   
gb|EAY98214.1|  hypothetical protein OsI_20125                        80.9    1e-15   
ref|XP_009603384.1|  PREDICTED: transcription factor DIVARICATA-like  82.0    1e-15   
ref|XP_004970674.1|  PREDICTED: transcription factor DIVARICATA-like  80.9    1e-15   
ref|XP_010109645.1|  Transcription factor                             82.0    1e-15   
ref|XP_010905362.1|  PREDICTED: transcription factor DIVARICATA-like  81.6    1e-15   
ref|XP_006838124.1|  hypothetical protein AMTR_s00106p00065610        81.6    1e-15   
gb|AAU06309.1|  MYB transcription factor                              81.6    2e-15   
gb|ACG30643.1|  MYB-like transcription factor DIVARICATA              81.6    2e-15   
ref|XP_007026779.1|  Duplicated homeodomain-like superfamily protein  82.4    2e-15   
ref|NP_001146624.1|  MYB transcription factor                         81.6    2e-15   
ref|XP_004239940.1|  PREDICTED: transcription factor DIVARICATA       81.3    2e-15   
emb|CDX98864.1|  BnaC09g49710D                                        81.3    2e-15   
ref|NP_001281288.1|  transcription factor DIVARICATA-like             81.3    2e-15   
gb|ACR19074.1|  DIV1Bb protein                                        79.3    2e-15   
gb|AAK91894.1|AC091627_7  Putative I-box binding factor, identical    84.0    2e-15   
ref|XP_006340287.1|  PREDICTED: uncharacterized protein LOC102595...  84.0    2e-15   
ref|XP_006340288.1|  PREDICTED: uncharacterized protein LOC102595...  84.0    2e-15   
ref|XP_010279472.1|  PREDICTED: transcription factor DIVARICATA       81.3    2e-15   
gb|KHG02459.1|  Transcription factor MYB1R1                           81.3    2e-15   
ref|XP_009627320.1|  PREDICTED: transcription factor DIVARICATA-like  80.9    2e-15   
ref|XP_009337308.1|  PREDICTED: transcription factor DIVARICATA-like  81.3    2e-15   
ref|XP_009766549.1|  PREDICTED: transcription factor DIVARICATA-like  80.9    2e-15   
ref|XP_010543227.1|  PREDICTED: transcription factor DIVARICATA       80.9    3e-15   
ref|XP_002280403.1|  PREDICTED: transcription factor DIVARICATA       80.9    3e-15   
ref|XP_009346883.1|  PREDICTED: transcription factor DIVARICATA-like  80.9    3e-15   
ref|XP_010452485.1|  PREDICTED: transcription factor DIVARICATA-like  80.9    3e-15   
ref|XP_004961933.1|  PREDICTED: transcription factor DIVARICATA-like  79.7    3e-15   
gb|ACR09748.1|  DIV3B protein                                         80.9    3e-15   
ref|XP_006355655.1|  PREDICTED: transcription factor DIVARICATA-like  80.5    3e-15   
ref|XP_010690085.1|  PREDICTED: transcription factor DIVARICATA-like  80.5    4e-15   
gb|AFN53659.1|  hypothetical protein                                  80.5    4e-15   
ref|XP_011097737.1|  PREDICTED: transcription factor DIVARICATA-like  79.3    4e-15   
ref|XP_006288283.1|  hypothetical protein CARUB_v10001525mg           80.5    4e-15   
ref|XP_006349469.1|  PREDICTED: transcription factor DIVARICATA-like  80.5    4e-15   
ref|XP_009802192.1|  PREDICTED: transcription factor DIVARICATA-like  80.1    4e-15   
ref|XP_004490575.1|  PREDICTED: transcription factor DIVARICATA-like  80.5    4e-15   
ref|XP_006288282.1|  hypothetical protein CARUB_v10001525mg           80.5    5e-15   
ref|XP_010249027.1|  PREDICTED: transcription factor DIVARICATA-l...  80.5    5e-15   
ref|XP_006399038.1|  hypothetical protein EUTSA_v10014370mg           80.1    5e-15   
ref|XP_009351753.1|  PREDICTED: transcription factor DIVARICATA       80.1    5e-15   
ref|XP_006399351.1|  hypothetical protein EUTSA_v10014203mg           80.5    5e-15   
ref|XP_002306366.2|  myb family transcription factor family protein   80.1    5e-15   
ref|XP_008449196.1|  PREDICTED: transcription factor DIVARICATA-like  80.1    5e-15   
ref|XP_004147889.1|  PREDICTED: transcription factor DIVARICATA-like  80.1    5e-15   
ref|XP_004297715.1|  PREDICTED: transcription factor DIVARICATA       80.1    6e-15   
gb|KHG11129.1|  Transcription factor MYB1R1                           80.1    6e-15   
ref|XP_010262869.1|  PREDICTED: transcription factor DIVARICATA-like  79.7    6e-15   
ref|XP_010517093.1|  PREDICTED: transcription factor DIVARICATA-like  80.1    6e-15   
ref|XP_006646487.1|  PREDICTED: transcription factor DIVARICATA-like  79.7    6e-15   
ref|XP_003568340.1|  PREDICTED: transcription factor DIVARICATA       79.7    7e-15   
ref|XP_010423067.1|  PREDICTED: transcription factor DIVARICATA-like  79.7    7e-15   
gb|KFK25008.1|  hypothetical protein AALP_AA8G054600                  79.3    7e-15   
ref|XP_006847792.1|  hypothetical protein AMTR_s00029p00021500        78.2    7e-15   
ref|XP_002441197.1|  hypothetical protein SORBIDRAFT_09g022060        80.1    8e-15   
emb|CCA29115.1|  putative MYB transcription factor                    79.7    8e-15   
ref|XP_007043216.1|  DNA binding protein, putative isoform 1          79.7    8e-15   
ref|XP_010509228.1|  PREDICTED: transcription factor DIVARICATA-like  79.7    8e-15   
ref|XP_010529770.1|  PREDICTED: transcription factor DIVARICATA-like  79.7    9e-15   
ref|XP_004235257.1|  PREDICTED: transcription factor DIVARICATA-like  79.3    9e-15   
ref|XP_003567296.1|  PREDICTED: transcription factor DIVARICATA-like  78.6    9e-15   
ref|XP_010505420.1|  PREDICTED: transcription factor DIVARICATA-like  79.3    1e-14   
gb|KJB49963.1|  hypothetical protein B456_008G147400                  79.3    1e-14   
ref|NP_196469.1|  duplicated SANT DNA-binding domain-containing p...  79.3    1e-14   
sp|Q8S9H7.1|DIV_ANTMA  RecName: Full=Transcription factor DIVARICATA  79.3    1e-14   
ref|XP_004173613.1|  PREDICTED: transcription factor DIVARICATA-like  78.6    1e-14   
gb|KJB36877.1|  hypothetical protein B456_006G180900                  79.0    1e-14   
ref|XP_004500231.1|  PREDICTED: transcription factor DIVARICATA-l...  79.3    1e-14   
emb|CDY44778.1|  BnaC02g01090D                                        79.0    1e-14   
ref|XP_008366961.1|  PREDICTED: transcription factor DIVARICATA-like  79.0    1e-14   
ref|XP_008360003.1|  PREDICTED: transcription factor DIVARICATA-like  79.0    1e-14   
gb|KFK24624.1|  hypothetical protein AALP_AA8G003400                  78.6    1e-14   
gb|KHG24928.1|  Transcription factor MYB1R1                           79.0    1e-14   
ref|XP_010671196.1|  PREDICTED: transcription factor DIVARICATA       79.0    1e-14   
ref|XP_010495118.1|  PREDICTED: transcription factor DIVARICATA-like  78.2    1e-14   
gb|EAY98253.1|  hypothetical protein OsI_20162                        79.0    1e-14   
ref|NP_001055702.1|  Os05g0449900                                     79.0    1e-14   
ref|NP_001280907.1|  transcription factor DIVARICATA                  79.0    2e-14   
ref|XP_007223255.1|  hypothetical protein PRUPE_ppa009396mg           78.6    2e-14   
ref|XP_010666611.1|  PREDICTED: transcription factor DIVARICATA-like  78.6    2e-14   
ref|XP_004961904.1|  PREDICTED: transcription factor DIVARICATA-like  78.6    2e-14   
ref|NP_001267652.1|  transcription factor DIVARICATA-like             78.6    2e-14   
gb|KJB79801.1|  hypothetical protein B456_013G067600                  78.6    2e-14   
gb|ACR09746.1|  DIV1A protein                                         78.6    2e-14   
ref|XP_009405310.1|  PREDICTED: transcription factor DIVARICATA-like  77.8    2e-14   
ref|XP_006361820.1|  PREDICTED: transcription factor DIVARICATA-like  79.0    2e-14   
ref|XP_007142227.1|  hypothetical protein PHAVU_008G262900g           78.6    2e-14   
gb|EEE63920.1|  hypothetical protein OsJ_18745                        79.3    2e-14   
ref|XP_009125735.1|  PREDICTED: transcription factor DIVARICATA-like  78.2    2e-14   
ref|XP_004307612.1|  PREDICTED: transcription factor DIVARICATA-like  78.6    2e-14   
gb|KDP46533.1|  hypothetical protein JCGZ_08505                       78.6    2e-14   
ref|XP_004249083.1|  PREDICTED: transcription factor DIVARICATA-like  78.2    2e-14   
gb|ADL36781.1|  MYBR domain class transcription factor                78.2    2e-14   
gb|AEV91164.1|  MYB-related protein                                   78.2    2e-14   
gb|KHN03656.1|  hypothetical protein glysoja_031153                   76.6    2e-14   
gb|EPS69353.1|  hypothetical protein M569_05416                       77.8    2e-14   
ref|XP_010521505.1|  PREDICTED: transcription factor DIVARICATA-like  78.2    2e-14   
gb|ACR09740.1|  DIV1B protein                                         77.4    2e-14   
emb|CDY55904.1|  BnaAnng13960D                                        77.8    2e-14   
gb|EPS62442.1|  hypothetical protein M569_12348                       77.0    3e-14   
ref|XP_010033026.1|  PREDICTED: transcription factor DIVARICATA       78.2    3e-14   
ref|XP_010452859.1|  PREDICTED: transcription factor DIVARICATA-like  78.2    3e-14   
ref|XP_009419728.1|  PREDICTED: transcription factor DIVARICATA-like  78.2    3e-14   
ref|NP_196198.1|  duplicated SANT DNA-binding domain-containing p...  77.8    3e-14   
ref|XP_009412979.1|  PREDICTED: transcription factor DIVARICATA-like  77.8    3e-14   
ref|XP_010546276.1|  PREDICTED: transcription factor DIVARICATA-like  77.8    4e-14   
ref|XP_008463216.1|  PREDICTED: transcription factor DIVARICATA       77.8    4e-14   
dbj|BAJ97156.1|  predicted protein                                    77.8    4e-14   
ref|XP_002873224.1|  myb family transcription factor                  77.4    4e-14   
ref|XP_006655363.1|  PREDICTED: transcription factor DIVARICATA-like  76.6    4e-14   
ref|XP_006289672.1|  hypothetical protein CARUB_v10003231mg           77.8    4e-14   
ref|XP_010943784.1|  PREDICTED: transcription factor DIVARICATA-like  76.6    4e-14   
ref|XP_006376751.1|  hypothetical protein POPTR_0012s05720g           77.4    5e-14   
ref|XP_002872443.1|  hypothetical protein ARALYDRAFT_352012           76.6    5e-14   
ref|XP_002873368.1|  myb family transcription factor                  77.4    5e-14   
ref|XP_011035198.1|  PREDICTED: transcription factor DIVARICATA       77.4    5e-14   
ref|XP_002299827.2|  hypothetical protein POPTR_0001s25590g           77.4    5e-14   
ref|XP_002456680.1|  hypothetical protein SORBIDRAFT_03g040730        76.3    6e-14   
gb|KHN40253.1|  hypothetical protein glysoja_038936                   75.1    6e-14   
ref|XP_006654489.1|  PREDICTED: transcription factor DIVARICATA-like  77.4    7e-14   
ref|XP_009798833.1|  PREDICTED: uncharacterized protein LOC104244997  78.6    7e-14   
gb|EMT13974.1|  Myb-like protein J                                    75.9    7e-14   
ref|XP_008775022.1|  PREDICTED: protein RADIALIS-like 3               74.3    7e-14   
emb|CDX81108.1|  BnaC03g03620D                                        79.7    7e-14   
ref|XP_009132223.1|  PREDICTED: transcription factor DIVARICATA-like  76.6    7e-14   
ref|XP_002268293.2|  PREDICTED: transcription factor DIVARICATA-like  75.9    8e-14   
ref|XP_006361807.1|  PREDICTED: transcription factor DIVARICATA-l...  77.0    8e-14   
ref|XP_010031380.1|  PREDICTED: transcription factor DIVARICATA       76.6    8e-14   
emb|CBI29349.3|  unnamed protein product                              75.9    8e-14   
gb|KHN40049.1|  Transcription factor MYB1R1                           76.6    9e-14   
gb|KJB31832.1|  hypothetical protein B456_005G212900                  76.6    1e-13   
ref|XP_008777770.1|  PREDICTED: transcription factor DIVARICATA       76.3    1e-13   
ref|XP_009602461.1|  PREDICTED: transcription factor DIVARICATA-like  76.3    1e-13   
gb|KHG26471.1|  Transcription factor MYB1R1                           76.3    1e-13   
emb|CDY69130.1|  BnaCnng62030D                                        76.3    1e-13   
ref|XP_002275014.1|  PREDICTED: transcription factor DIVARICATA       76.3    1e-13   
ref|XP_006360841.1|  PREDICTED: transcription factor DIVARICATA-like  75.9    1e-13   
gb|EYU23843.1|  hypothetical protein MIMGU_mgv1a010639mg              76.3    1e-13   
ref|XP_006573980.1|  PREDICTED: transcription factor DIVARICATA-like  74.7    1e-13   
ref|XP_010923684.1|  PREDICTED: transcription factor DIVARICATA-like  75.9    1e-13   
ref|XP_002873022.1|  myb family transcription factor                  75.9    1e-13   
gb|EPS57791.1|  hypothetical protein M569_17026                       75.9    2e-13   
ref|XP_011009785.1|  PREDICTED: transcription factor DIVARICATA       75.9    2e-13   
ref|XP_009793123.1|  PREDICTED: uncharacterized protein LOC104240036  77.8    2e-13   
ref|XP_011095585.1|  PREDICTED: transcription factor DIVARICATA-like  75.1    2e-13   
ref|XP_008657026.1|  PREDICTED: transcription factor DIVARICATA-like  75.1    2e-13   
ref|XP_006281581.1|  hypothetical protein CARUB_v10027693mg           75.9    2e-13   
ref|XP_009767350.1|  PREDICTED: transcription factor DIVARICATA-like  75.5    2e-13   
ref|XP_002268137.2|  PREDICTED: transcription factor DIVARICATA       74.7    2e-13   
ref|XP_002314123.1|  syringolide-induced protein 1-3-1B               75.9    2e-13   
ref|XP_006398645.1|  hypothetical protein EUTSA_v10014410mg           75.5    2e-13   
ref|XP_009609269.1|  PREDICTED: uncharacterized protein LOC104103093  77.0    2e-13   
ref|NP_001235675.1|  MYB transcription factor MYB57                   75.9    2e-13   
emb|CBI15416.3|  unnamed protein product                              75.1    2e-13   
gb|AHL19854.1|  DIVARICATA-like protein                               73.9    2e-13   
gb|ACG38219.1|  DNA binding protein                                   75.5    3e-13   
dbj|BAJ98576.1|  predicted protein                                    74.3    3e-13   
gb|AEV91176.1|  MYB-related protein                                   75.5    3e-13   
emb|CDY48115.1|  BnaC02g03720D                                        74.7    3e-13   
ref|XP_003533231.2|  PREDICTED: transcription factor DIVARICATA-like  73.2    3e-13   
ref|NP_195740.1|  duplicated SANT DNA-binding domain-containing p...  74.7    3e-13   
ref|XP_004506787.1|  PREDICTED: transcription factor DIVARICATA-like  75.1    4e-13   
ref|NP_001146181.1|  uncharacterized protein LOC100279751             74.7    4e-13   
emb|CDY46967.1|  BnaA02g32790D                                        74.7    4e-13   
ref|XP_003519244.1|  PREDICTED: transcription factor DIVARICATA       74.7    4e-13   
emb|CDY44877.1|  BnaC09g50770D                                        76.3    4e-13   
gb|EAY76528.1|  hypothetical protein OsI_04470                        74.7    5e-13   



>ref|XP_009796939.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana sylvestris]
Length=212

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 107/129 (83%), Gaps = 5/129 (4%)
 Frame = +2

Query  83   MMYSANHRWMMGDSVTA--MQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKS  253
            MMY+ N+RWM+G   TA  + S +TWTR+EDK+FEQ+LV++ + D +RWQKIA+R+PGK+
Sbjct  1    MMYTTNNRWMIGSDSTATMIHSNSTWTRFEDKLFEQALVMYSENDVERWQKIANRVPGKT  60

Query  254  ALDVIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQ-GEPSQISFGNSKKQGEAERKKG  430
            A DV+AH++ALVHDV EIDSGRV+ PSYPDD+F W+   + SQISFG++KK  E ERKKG
Sbjct  61   AEDVMAHYDALVHDVFEIDSGRVDPPSYPDDAFDWESDSKTSQISFGSNKKH-EVERKKG  119

Query  431  TPWTEEEHR  457
            TPWTEEEHR
Sbjct  120  TPWTEEEHR  128



>ref|XP_009618932.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana tomentosiformis]
Length=212

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 106/129 (82%), Gaps = 5/129 (4%)
 Frame = +2

Query  83   MMYSANHRWMMGDSVTA--MQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKS  253
            MMY+ N+RWM+G   TA  + S +TWTR+EDK+FEQ+LV++ + D +RW KIA+ +PGK+
Sbjct  1    MMYTTNNRWMIGSDSTATMIHSNSTWTRFEDKLFEQALVMYSENDVERWLKIANHVPGKT  60

Query  254  ALDVIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQ-GEPSQISFGNSKKQGEAERKKG  430
            A DV+AH++ALVHDV EIDSGRV+ PSYPDDSF W+   + SQISFG++KK  EAERKKG
Sbjct  61   AEDVMAHYDALVHDVFEIDSGRVDPPSYPDDSFDWESDSKTSQISFGSNKKH-EAERKKG  119

Query  431  TPWTEEEHR  457
            TPWTEEEHR
Sbjct  120  TPWTEEEHR  128



>ref|XP_006367246.1| PREDICTED: transcription factor DIVARICATA-like [Solanum tuberosum]
Length=192

 Score =   168 bits (425),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 103/127 (81%), Gaps = 3/127 (2%)
 Frame = +2

Query  83   MMYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSAL  259
            MMY AN+RW++G+S   +   +TWTR+EDK+FEQ+LV++ + D +RWQKIA+ +PG++A 
Sbjct  1    MMYPANNRWLIGESPAMIHPNSTWTRFEDKLFEQALVMYSENDIERWQKIANHVPGRTAE  60

Query  260  DVIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQ-GEPSQISFGNSKKQGEAERKKGTP  436
            DV+AH++ALVHDV EIDSGRVE PSYPDD F W+   + SQISFG +KK  E ERKKGTP
Sbjct  61   DVMAHYDALVHDVFEIDSGRVEPPSYPDDLFDWESDCKTSQISFGTNKKH-EVERKKGTP  119

Query  437  WTEEEHR  457
            WTEEEHR
Sbjct  120  WTEEEHR  126



>ref|XP_004249950.1| PREDICTED: transcription factor DIVARICATA [Solanum lycopersicum]
Length=210

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 102/127 (80%), Gaps = 3/127 (2%)
 Frame = +2

Query  83   MMYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSAL  259
            MMY AN+RW++G+S   +   +TWTR+EDK+FEQ+LV++ + D +RWQKIA+ +PG++  
Sbjct  1    MMYPANNRWLIGESPAMIHPNSTWTRFEDKLFEQALVMYSENDIERWQKIANHVPGRTPE  60

Query  260  DVIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQ-GEPSQISFGNSKKQGEAERKKGTP  436
            DV+AH++ALVHDV EIDSGRVE PSYPDD F W+   + +QISFG +KK  E ERKKGTP
Sbjct  61   DVMAHYDALVHDVFEIDSGRVEPPSYPDDLFDWESDCKTNQISFGTNKKH-EVERKKGTP  119

Query  437  WTEEEHR  457
            WTEEEHR
Sbjct  120  WTEEEHR  126



>emb|CDO99922.1| unnamed protein product [Coffea canephora]
Length=231

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 94/135 (70%), Gaps = 13/135 (10%)
 Frame = +2

Query  92   SANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVI  268
            + N  W+M +S        TWT+YEDK+FEQ+LV FP D  +RWQKIA R+PGK+A DV 
Sbjct  11   NTNQSWVMYNSAPPHPPVVTWTKYEDKLFEQALVGFPEDLPNRWQKIADRVPGKTAEDVR  70

Query  269  AHFEALVHDVGEIDSGRVELPSYPDDS--FGWDQGE--------PSQISFGNS--KKQGE  412
             H++ALVHDV EI++GRVELP+Y D+   FGW + E        P+QISFG S   K G+
Sbjct  71   VHYDALVHDVREIEAGRVELPNYADEDEFFGWGEPEQPPPESRTPNQISFGASGKAKHGD  130

Query  413  AERKKGTPWTEEEHR  457
             ERKKGTPWTEEEHR
Sbjct  131  GERKKGTPWTEEEHR  145



>gb|KDO41465.1| hypothetical protein CISIN_1g032677mg [Citrus sinensis]
Length=136

 Score =   140 bits (354),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 86/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  131  AMQSAATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEI  307
            AM  +  W R EDK+FE +LV+FP+   DRWQKIAS++PGKSA++V  H+EALVHDV EI
Sbjct  17   AMTHSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEI  76

Query  308  DSGRVELPSYPDDSFGWDQGEPSQISFG-NSKKQGEAERKKGTPWTEEEHR  457
            DSGRVELPSY DDS  WD   PSQISF   S K G+ ERKKGTPWTEEEH+
Sbjct  77   DSGRVELPSYADDS-DWDS--PSQISFAPKSTKHGDPERKKGTPWTEEEHK  124



>ref|XP_006445756.1| hypothetical protein CICLE_v10016071mg [Citrus clementina]
 gb|ESR58996.1| hypothetical protein CICLE_v10016071mg [Citrus clementina]
Length=303

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 86/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  131  AMQSAATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEI  307
            AM  +  W R EDK+FE +LV+FP+   DRWQKIAS++PGKSA++V  H+EALVHDV EI
Sbjct  84   AMTHSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEI  143

Query  308  DSGRVELPSYPDDSFGWDQGEPSQISFG-NSKKQGEAERKKGTPWTEEEHR  457
            DSGRVELPSY DDS  WD   PSQISF   S K G+ ERKKGTPWTEEEH+
Sbjct  144  DSGRVELPSYADDS-DWD--SPSQISFAPKSTKHGDPERKKGTPWTEEEHK  191



>ref|XP_006485458.1| PREDICTED: transcription factor DIVARICATA-like [Citrus sinensis]
Length=236

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 86/111 (77%), Gaps = 5/111 (5%)
 Frame = +2

Query  131  AMQSAATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEI  307
            AM  +  W R EDK+FE +LV+FP+   DRWQKIAS++PGKSA++V  H+EALVHDV EI
Sbjct  17   AMTHSTHWNRSEDKLFEHALVMFPEESPDRWQKIASQLPGKSAVEVREHYEALVHDVYEI  76

Query  308  DSGRVELPSYPDDSFGWDQGEPSQISFG-NSKKQGEAERKKGTPWTEEEHR  457
            DSGRVELPSY DDS  WD   PSQISF   S K G+ ERKKGTPWTEEEH+
Sbjct  77   DSGRVELPSYADDS-DWD--SPSQISFAPKSTKHGDPERKKGTPWTEEEHK  124



>ref|XP_010088815.1| Transcription factor [Morus notabilis]
 gb|EXB36998.1| Transcription factor [Morus notabilis]
Length=244

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 92/132 (70%), Gaps = 13/132 (10%)
 Frame = +2

Query  86   MYSANHRWMMGDSVTAMQSAAT-WTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSAL  259
            M+  +  W +G S    QSA+T WTR EDK+FEQ+LV  PDG  DRW  IA R+PGKSA 
Sbjct  1    MFQDDPCWALGVST---QSASTGWTREEDKLFEQALVSIPDGAPDRWAMIALRLPGKSAA  57

Query  260  DVIAHFEALVHDVGEIDSGRVELPSYPDDSF------GWDQGEPSQISFGNSKKQGEAER  421
            DV  H+  LVHDVGEID+GRVELPSY DDS       GWD    +QISFG +K + E ER
Sbjct  58   DVAMHYHDLVHDVGEIDAGRVELPSYADDSALSPRRGGWDSA--NQISFGVAKPKQEPER  115

Query  422  KKGTPWTEEEHR  457
            KKGTPWTE+EH+
Sbjct  116  KKGTPWTEQEHK  127



>ref|XP_010245815.1| PREDICTED: transcription factor DIVARICATA-like [Nelumbo nucifera]
Length=236

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 91/124 (73%), Gaps = 7/124 (6%)
 Frame = +2

Query  107  WMMGDSVTAMQSAAT--WTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHF  277
            WMMG + +   S     WTR +DK+FE++LV FP+G  DRWQKIA ++PGK+AL+V  H+
Sbjct  7    WMMGGNFSPSPSPFPSPWTRVQDKLFERALVTFPEGTLDRWQKIAGQVPGKTALEVRDHY  66

Query  278  EALVHDVGEIDSGRVELPSYPDDSF--GW-DQGEPSQISFGNS-KKQGEAERKKGTPWTE  445
            EALVHDV EIDSGRVE+P Y D+SF   W  + + SQISFG+   +Q E ERKKG PWTE
Sbjct  67   EALVHDVQEIDSGRVEVPDYADNSFTPSWASECQASQISFGSKPPRQTETERKKGVPWTE  126

Query  446  EEHR  457
            EEHR
Sbjct  127  EEHR  130



>gb|AGZ16405.1| MYB5 [Scutellaria baicalensis]
Length=216

 Score =   135 bits (341),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 89/120 (74%), Gaps = 10/120 (8%)
 Frame = +2

Query  128  TAMQSAAT-WTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVG  301
            + M +AAT W+R+EDK+FE++LV FP+G  DRW+KIA  +PGKS  +V AH+EAL++D+ 
Sbjct  15   SLMSAAATSWSRWEDKIFEKALVEFPEGIGDRWRKIAEFLPGKSPEEVHAHYEALLYDIS  74

Query  302  EIDSGRVELPSYPDDSFGWDQGE-----PSQISF---GNSKKQGEAERKKGTPWTEEEHR  457
            EIDSGRVELPSY D+S GW+        P QISF   GN  +  E ERKKGTPWTE+EHR
Sbjct  75   EIDSGRVELPSYSDESIGWENERARSRMPGQISFGSPGNRSRHSEVERKKGTPWTEDEHR  134



>ref|XP_008231910.1| PREDICTED: transcription factor DIVARICATA [Prunus mume]
Length=230

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            S  A  ++A WTR+EDK+FEQ+LV F  D  DRW++IA  +PGK+  +V+ H+E LVHDV
Sbjct  10   SSMAQSASAPWTRFEDKLFEQALVRFSEDLPDRWERIAEEVPGKTPEEVLEHYETLVHDV  69

Query  299  GEIDSGRVELPSYPDDS-FGWDQGEPSQISFGNS-KKQGEAERKKGTPWTEEEHR  457
             EIDSGRVELPSY DDS  GWD    SQISFG+   K GE ERKKGTPWTE+EH+
Sbjct  70   LEIDSGRVELPSYADDSVVGWDTA--SQISFGSKLNKHGEPERKKGTPWTEQEHK  122



>ref|XP_007211982.1| hypothetical protein PRUPE_ppa010926mg [Prunus persica]
 gb|EMJ13181.1| hypothetical protein PRUPE_ppa010926mg [Prunus persica]
Length=230

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            S  A  ++A WTR+EDK+FEQ+LV F  D  DRW++IA  +PGK+  +V+ H+E LVHDV
Sbjct  10   SSMAQSASAPWTRFEDKLFEQALVRFSEDLPDRWERIAGEVPGKTPEEVLEHYETLVHDV  69

Query  299  GEIDSGRVELPSYPDDS-FGWDQGEPSQISFGNS-KKQGEAERKKGTPWTEEEHR  457
             EIDSGRVELPSY DDS  GWD    SQISFG+   K GE ERKKGTPWTE+EH+
Sbjct  70   LEIDSGRVELPSYADDSVVGWDTA--SQISFGSKLNKHGEPERKKGTPWTEQEHK  122



>gb|KJB35518.1| hypothetical protein B456_006G118200 [Gossypium raimondii]
Length=233

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 93/133 (70%), Gaps = 12/133 (9%)
 Frame = +2

Query  86   MYSANHRWMMGDS--VTAMQSAAT-WTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKS  253
            MY  N+    GD   + ++ +A+T WTR EDKVFEQ LVLFP+G  DRW+KIA +IPGKS
Sbjct  1    MYQDNNH-CNGDPLFIESVAAASTHWTRLEDKVFEQCLVLFPEGISDRWEKIAEQIPGKS  59

Query  254  ALDVIAHFEALVHDVGEIDSGRVELPSYPDDSF----GWDQGEPSQISF-GNSKKQGEAE  418
            A +V  HF  LV+DV EID+GRV++P Y DDS     GWD    +QISF   SK  GE E
Sbjct  60   AKEVEQHFHMLVYDVYEIDAGRVQVPQYADDSVMLSQGWD--SQNQISFVSKSKHHGEGE  117

Query  419  RKKGTPWTEEEHR  457
            RKKGTPWTEEEH+
Sbjct  118  RKKGTPWTEEEHK  130



>ref|XP_011084236.1| PREDICTED: transcription factor DIVARICATA-like [Sesamum indicum]
Length=219

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 84/115 (73%), Gaps = 9/115 (8%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +AA W+R EDK+FE++LV FP+G D RW++IA  +PGKS  +V  H+E L+HD+ EIDSG
Sbjct  19   AAAVWSRQEDKIFEKALVEFPEGIDHRWRRIAEFLPGKSPDEVRLHYETLLHDIAEIDSG  78

Query  317  RVELPSYPDDS--FGWDQGE----PSQISF--GNSKKQGEAERKKGTPWTEEEHR  457
            RVELPSY D+S   GWDQ      P QISF  GN  +  E ERKKGTPWTE+EHR
Sbjct  79   RVELPSYSDESAPLGWDQHARPRTPGQISFGGGNRSRHSEVERKKGTPWTEDEHR  133



>gb|ABH02832.1| MYB transcription factor MYB69 [Glycine max]
Length=233

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 85/115 (74%), Gaps = 15/115 (13%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTRY DK+FE++L++ P D  DRW+KIA ++PGKSA++V  H+EALVHDV EIDSGRVE+
Sbjct  14   WTRYHDKLFERALLVVPEDLPDRWEKIADQVPGKSAVEVREHYEALVHDVFEIDSGRVEV  73

Query  329  PSYPDDSFG-----------WDQGEPSQISFGNS-KKQGEAERKKGTPWTEEEHR  457
            PSY DDS             WD    +QISFG+  K+QGE ERKKGTPWTEEEHR
Sbjct  74   PSYVDDSVAMPPSGGAGISTWDNA--NQISFGSKLKQQGENERKKGTPWTEEEHR  126



>gb|KHN11452.1| Transcription factor MYB1R1 [Glycine soja]
Length=236

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 85/115 (74%), Gaps = 15/115 (13%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTRY DK+FE++L++ P D  DRW+KIA ++PGKSA++V  H+EALVHDV EIDSGRVE+
Sbjct  17   WTRYHDKLFERALLVVPEDLPDRWEKIADQVPGKSAVEVREHYEALVHDVFEIDSGRVEV  76

Query  329  PSYPDDSFG-----------WDQGEPSQISFGNS-KKQGEAERKKGTPWTEEEHR  457
            PSY DDS             WD    +QISFG+  K+QGE ERKKGTPWTEEEHR
Sbjct  77   PSYVDDSVAMPLSGGAGISTWDNA--NQISFGSKLKQQGENERKKGTPWTEEEHR  129



>ref|NP_001237360.1| syringolide-induced protein 1-3-1A [Glycine max]
 dbj|BAB86892.1| syringolide-induced protein 1-3-1A [Glycine max]
Length=233

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 85/115 (74%), Gaps = 15/115 (13%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTRY DK+FE++L++ P D  DRW+KIA ++PGKSA++V  H+EALVHDV EIDSGRVE+
Sbjct  14   WTRYHDKLFERALLVVPEDLPDRWEKIADQVPGKSAVEVREHYEALVHDVFEIDSGRVEV  73

Query  329  PSYPDDSFG-----------WDQGEPSQISFGNS-KKQGEAERKKGTPWTEEEHR  457
            PSY DDS             WD    +QISFG+  K+QGE ERKKGTPWTEEEHR
Sbjct  74   PSYVDDSVAMPPSGGAGISTWDNA--NQISFGSKLKQQGENERKKGTPWTEEEHR  126



>ref|NP_001237103.1| syringolide-induced protein 1-3-1B [Glycine max]
 dbj|BAB86893.1| syringolide-induced protein 1-3-1B [Glycine max]
Length=236

 Score =   130 bits (327),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 85/115 (74%), Gaps = 15/115 (13%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTRY DK+FE++L++ P D  DRW+KIA ++PGKSA++V  H+EALVHDV EIDSGRVE+
Sbjct  17   WTRYHDKLFERALLVVPEDLPDRWEKIADQVPGKSAVEVREHYEALVHDVFEIDSGRVEV  76

Query  329  PSYPDDSFG-----------WDQGEPSQISFGNS-KKQGEAERKKGTPWTEEEHR  457
            PSY DDS             WD    +QISFG+  K+QG+ ERKKGTPWTEEEHR
Sbjct  77   PSYVDDSVATPPSGGAEISTWDNA--NQISFGSKPKQQGDNERKKGTPWTEEEHR  129



>gb|KHG10604.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=233

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 92/133 (69%), Gaps = 12/133 (9%)
 Frame = +2

Query  86   MYSANHRWMMGDS--VTAMQSAAT-WTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKS  253
            MY  N+ +  GD   + ++ +A T WTR EDKVFEQ LVLFP+G  DRW+KIA +IPGKS
Sbjct  1    MYQDNNHYN-GDPLFIESVAAATTRWTRVEDKVFEQCLVLFPEGISDRWEKIAEQIPGKS  59

Query  254  ALDVIAHFEALVHDVGEIDSGRVELPSYPDDSF----GWDQGEPSQISF-GNSKKQGEAE  418
            A +V  HF  LV+DV EID+GRV++P Y DDS      WD    +QISF   SK  G+ E
Sbjct  60   AKEVEQHFHMLVYDVYEIDAGRVQVPQYADDSVMLSQSWDSH--NQISFVSKSKHHGDGE  117

Query  419  RKKGTPWTEEEHR  457
            RKKGTPWTEEEH+
Sbjct  118  RKKGTPWTEEEHK  130



>emb|CAB65169.1| I-box binding factor [Solanum lycopersicum]
Length=191

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 82/107 (77%), Gaps = 3/107 (3%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            S +TWTR +DK+FE  LVL+P+   DRWQ IA  +PGK+A D++AH++ LVHDV EIDSG
Sbjct  3    SMSTWTRDDDKLFEHGLVLYPENSADRWQLIADHVPGKTADDIMAHYDDLVHDVYEIDSG  62

Query  317  RVELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            R++LPSY DD     +G+  QI+ G++KK  E ERKKGTPWTE+EHR
Sbjct  63   RIDLPSYTDDPVEL-EGD-CQITSGSNKKSNEIERKKGTPWTEDEHR  107



>gb|KDP43682.1| hypothetical protein JCGZ_24140 [Jatropha curcas]
Length=234

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 82/116 (71%), Gaps = 6/116 (5%)
 Frame = +2

Query  125  VTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVG  301
            +T       W RYEDK+FE++LV+FP D  DRWQKIA  + G+S  +V  H+E LVHDV 
Sbjct  11   LTQSSPPTRWNRYEDKLFEKALVMFPEDFPDRWQKIAEHV-GRSVQEVTEHYEILVHDVY  69

Query  302  EIDSGRVELPSYPDDSF--GWDQ--GEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            EIDSGRVELPSY D+ F   W+      +QISFG+  KQG+AERKKG PWTEEEHR
Sbjct  70   EIDSGRVELPSYADEFFESSWESPMAASNQISFGSQTKQGDAERKKGKPWTEEEHR  125



>ref|XP_009792792.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana sylvestris]
Length=199

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (74%), Gaps = 4/110 (4%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTRYEDK+FE++LV++P+G  +RWQKIA  +PGKS  DV+AH++ALVHDV  IDSG
Sbjct  7    TSSIWTRYEDKLFEEALVMYPEGVVNRWQKIAIHVPGKSPEDVMAHYDALVHDVFVIDSG  66

Query  317  RVELPSYPDDSFGW--DQGEPSQISF-GNSKKQGEAERKKGTPWTEEEHR  457
            RVE+PSY D S  W  + G    ISF  N K   E  RKKGTPWT EEHR
Sbjct  67   RVEIPSYHDRSSEWEPESGTSRNISFMSNYKNHTEQIRKKGTPWTPEEHR  116



>ref|XP_006345871.1| PREDICTED: transcription factor DIVARICATA-like [Solanum tuberosum]
Length=188

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = +2

Query  146  ATWTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRV  322
            +TWTR +DK+FE  LVL+P+   DRWQ IA  +PGK+A D++AH++ LVHDV EIDSGR+
Sbjct  2    STWTRDDDKLFEHGLVLYPENVADRWQLIADHVPGKTADDIMAHYDDLVHDVFEIDSGRI  61

Query  323  ELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            +LPSY DD     +G+  QIS G++KK  E ERKKGTPWTE+EHR
Sbjct  62   DLPSYTDDPVEL-EGD-CQISSGSNKKNNEIERKKGTPWTEDEHR  104



>ref|XP_004239729.1| PREDICTED: transcription factor DIVARICATA [Solanum lycopersicum]
Length=188

 Score =   127 bits (318),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = +2

Query  146  ATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRV  322
            +TWTR +DK+FE  LVL+P+   DRWQ IA  +PGK+A D++AH++ LVHDV EIDSGR+
Sbjct  2    STWTRDDDKLFEHGLVLYPENSADRWQLIADHVPGKTADDIMAHYDDLVHDVYEIDSGRI  61

Query  323  ELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            +LPSY DD     +G+  QI+ G++KK  E ERKKGTPWTE+EHR
Sbjct  62   DLPSYTDDPVEL-EGD-CQITSGSNKKSNEIERKKGTPWTEDEHR  104



>ref|XP_007142868.1| hypothetical protein PHAVU_007G023600g [Phaseolus vulgaris]
 gb|ESW14862.1| hypothetical protein PHAVU_007G023600g [Phaseolus vulgaris]
Length=240

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 80/113 (71%), Gaps = 13/113 (12%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTRY DK+FE++L+L P D  DRW +IA  +PG S  +V  H++ALVHDV EIDSGRVE+
Sbjct  20   WTRYHDKLFERALLLVPEDLPDRWNQIAGHVPGMSPAEVREHYDALVHDVFEIDSGRVEV  79

Query  329  PSYPDDSF----------GWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            PSY DDS            WD    +QISFG+  KQG++ERKKGTPWTEEEHR
Sbjct  80   PSYVDDSAPQLSGGAGNSAWDSA--NQISFGSKPKQGDSERKKGTPWTEEEHR  130



>ref|XP_004140910.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus]
 ref|XP_004169172.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus]
 gb|KGN46046.1| Syringolide-induced protein 1-3-1B [Cucumis sativus]
Length=233

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 82/117 (70%), Gaps = 8/117 (7%)
 Frame = +2

Query  125  VTAMQSAATWTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVG  301
             T  QS+  WTR EDK+FE++LV+ P    DRWQ++A  +PGKS  +V  H++ALVHDV 
Sbjct  8    TTMTQSSTHWTRSEDKLFEEALVVVPANLPDRWQRVADHVPGKSPREVKDHYDALVHDVL  67

Query  302  EIDSGRVELPSYPDDSF----GWDQGEPSQISFGNSKKQ-GEAERKKGTPWTEEEHR  457
            EIDSGRVELPSY D+S      WD     QISFG+  K  G+ ERKKGTPWTEEEHR
Sbjct  68   EIDSGRVELPSYADESAVGLPEWDSS--GQISFGSKAKHGGDNERKKGTPWTEEEHR  122



>ref|XP_008456608.1| PREDICTED: transcription factor DIVARICATA [Cucumis melo]
Length=233

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 85/124 (69%), Gaps = 10/124 (8%)
 Frame = +2

Query  110  MMGDS--VTAMQSAATWTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFE  280
            M  DS   T  QS+  WTR EDK+FE++LV+ P    DRWQ++A  +PGKS  +V  H+E
Sbjct  1    MFHDSRWTTMTQSSTHWTRSEDKLFEEALVVVPANLPDRWQRVADHVPGKSPREVKDHYE  60

Query  281  ALVHDVGEIDSGRVELPSYPDDSF----GWDQGEPSQISFGNSKKQ-GEAERKKGTPWTE  445
            ALVHDV EIDSGRVELPSY ++S      WD     QISFG+  K  G+ ERKKGTPWTE
Sbjct  61   ALVHDVLEIDSGRVELPSYAEESAVGLPEWDSS--GQISFGSKAKHGGDNERKKGTPWTE  118

Query  446  EEHR  457
            EEHR
Sbjct  119  EEHR  122



>ref|XP_009617435.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana tomentosiformis]
Length=202

 Score =   124 bits (312),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 82/116 (71%), Gaps = 8/116 (7%)
 Frame = +2

Query  134  MQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEID  310
            + S +TWTRYEDK+FE++LV++P+G  +RWQKIA  +PGKS  DV+AH++ALVHDV  ID
Sbjct  4    IHSTSTWTRYEDKLFEEALVMYPEGVVNRWQKIAIHVPGKSPEDVMAHYDALVHDVFVID  63

Query  311  SGRVELPSYPDDSFGWDQGEPSQ------ISF-GNSKKQGEAERKKGTPWTEEEHR  457
            SGRV++PSY   S  W+    ++      ISF  N K   E  RKKGTPWT EEHR
Sbjct  64   SGRVDIPSYNHRSSEWEPESGTRTRTSHNISFESNYKNHAEQIRKKGTPWTPEEHR  119



>ref|XP_009341585.1| PREDICTED: transcription factor DIVARICATA [Pyrus x bretschneideri]
Length=230

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 8/114 (7%)
 Frame = +2

Query  128  TAMQSAAT--WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            + +QSAA+  WTR EDKVFEQ+LV F  D  DRW++IA  +PGK+  +V+ H+E LVHDV
Sbjct  11   SVVQSAASTPWTRLEDKVFEQALVRFQEDLPDRWERIAGELPGKTPKEVLEHYEDLVHDV  70

Query  299  GEIDSGRVELPSYPDDSF-GWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
             EIDSGRV LPSY D+S  GW+    SQI+FG+++   E ERKKGTPWTEEEH+
Sbjct  71   LEIDSGRVNLPSYADESMVGWEDTA-SQITFGSNR---EPERKKGTPWTEEEHK  120



>ref|XP_011078235.1| PREDICTED: protein RADIALIS-like 4 [Sesamum indicum]
Length=126

 Score =   121 bits (303),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 9/115 (8%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            + A W+R EDK+ EQ+LV F  G D RW++IA  +PGKS  +V  H+EAL+HD+ EIDSG
Sbjct  11   ATAVWSRQEDKILEQALVEFLVGIDHRWRRIAEFLPGKSPDEVRLHYEALLHDIVEIDSG  70

Query  317  RVELPSYPDDS--FGWDQG----EPSQISF--GNSKKQGEAERKKGTPWTEEEHR  457
            RVELP Y D+S   GWD+      P QISF  GN  +  E ERKKGTPWTE+EHR
Sbjct  71   RVELPGYSDESAPLGWDEHARLRAPGQISFGGGNRSRHSEVERKKGTPWTEDEHR  125



>ref|XP_008363219.1| PREDICTED: transcription factor DIVARICATA-like [Malus domestica]
Length=230

 Score =   123 bits (309),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 8/114 (7%)
 Frame = +2

Query  128  TAMQSAAT--WTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            + +QSAA+  WTR EDKVFEQ+LV F  D  +RW++IA  +PGK+  +V+ H+E LVHDV
Sbjct  11   SVVQSAASTPWTRLEDKVFEQALVRFSEDLPNRWERIAEELPGKTPKEVLEHYEDLVHDV  70

Query  299  GEIDSGRVELPSYPDDSF-GWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
             EIDSGRV LPSY D+S  GW+    SQI+FG+++   E ERKKGTPWTEEEH+
Sbjct  71   LEIDSGRVNLPSYADESMVGWEDTA-SQITFGSNR---EPERKKGTPWTEEEHK  120



>ref|XP_011070193.1| PREDICTED: protein RADIALIS-like 4, partial [Sesamum indicum]
Length=131

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 79/114 (69%), Gaps = 8/114 (7%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGDDRW-QKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +AA W+R EDK+ EQ+LV FP+G D W ++IA  +P KS  +V  H+EAL+HD+ EIDSG
Sbjct  8    AAAVWSRQEDKILEQALVEFPEGIDHWWRRIAEFLPSKSPDEVRLHYEALLHDIVEIDSG  67

Query  317  RVELPSYPDDS--FGWDQGE---PSQISF--GNSKKQGEAERKKGTPWTEEEHR  457
            RVELP Y D+S   GWD+     P QIS   GN  +  E ERKKG PWTE+EHR
Sbjct  68   RVELPGYSDESAPLGWDEARPRVPGQISLSGGNHSRHSEVERKKGRPWTEDEHR  121



>ref|XP_002523835.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF38561.1| DNA binding protein, putative [Ricinus communis]
Length=214

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 5/110 (5%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            +++W+R EDK+FE++LV+FP+   DRW+KIAS +PGKS  DV  H+E LV+DV EIDSGR
Sbjct  7    SSSWSRLEDKLFERALVVFPEETPDRWEKIASHVPGKSRFDVKEHYEDLVYDVKEIDSGR  66

Query  320  VELPSYPDD-SFGWDQGEP--SQISFGNSKKQGE-AERKKGTPWTEEEHR  457
            VELPSY D    GW   E   SQ+ FG+  K+ E +ER+KG PWTEEEHR
Sbjct  67   VELPSYGDQFGLGWGAAESGTSQVWFGSKGKEKETSERRKGVPWTEEEHR  116



>ref|XP_002873168.1| hypothetical protein ARALYDRAFT_908364 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49427.1| hypothetical protein ARALYDRAFT_908364 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 84/108 (78%), Gaps = 7/108 (6%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FEQ+LVLFP+G  +RW++IA ++  KSA +V  H+EALVHDV EIDSG
Sbjct  2    ASSQWTRSEDKMFEQALVLFPEGSPNRWERIADQLH-KSAGEVREHYEALVHDVFEIDSG  60

Query  317  RVELPSYPDDS-FGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++P Y DDS  GWD     QISFG+  K GE+ERK+GTPWTE EH+
Sbjct  61   RVDVPDYMDDSAAGWDSA--GQISFGS--KHGESERKRGTPWTENEHK  104



>ref|XP_011092674.1| PREDICTED: transcription factor DIVARICATA-like [Sesamum indicum]
Length=171

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 83/123 (67%), Gaps = 13/123 (11%)
 Frame = +2

Query  128  TAMQS----AATWTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVH  292
            T +QS    AA W R EDK+ EQ+LV F +G D RW++IA  + GKS  +V  H+EAL+H
Sbjct  37   TTLQSVDSAAAVWIRQEDKILEQALVEFLEGIDHRWRRIAEFLLGKSPDEVRLHYEALLH  96

Query  293  DVGEIDSGRVELPSYPDDS--FGWDQG----EPSQISF--GNSKKQGEAERKKGTPWTEE  448
            D+ EIDSG VELP Y D+S   GWD+      P+QISF  GN  +  E ERKKGTPWTE+
Sbjct  97   DIVEIDSGHVELPGYSDESAPLGWDEHARPRAPAQISFGGGNRSRHSEVERKKGTPWTED  156

Query  449  EHR  457
            EHR
Sbjct  157  EHR  159



>emb|CDY11306.1| BnaA03g01420D [Brassica napus]
Length=211

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 83/108 (77%), Gaps = 7/108 (6%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FEQ+LVLFP+G  +RW++IA ++  KSA +V  H+EALVHDV EIDSG
Sbjct  2    ASSQWTRSEDKMFEQALVLFPEGSPNRWERIADQL-NKSAGEVREHYEALVHDVLEIDSG  60

Query  317  RVELPSYPDDS-FGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++P Y DDS  GWD     QISFG+  K GE ERK+GTPW+E EH+
Sbjct  61   RVDVPDYMDDSAAGWDSA--GQISFGS--KHGEGERKRGTPWSENEHK  104



>emb|CDX80919.1| BnaC03g01730D [Brassica napus]
Length=212

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 7/108 (6%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FEQ+LVLFP+G  +RW++IA ++  KSA +V  H+EALVHDV EIDSG
Sbjct  2    ASSQWTRSEDKMFEQALVLFPEGSPNRWERIADQL-NKSAGEVREHYEALVHDVLEIDSG  60

Query  317  RVELPSYPDD-SFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++P Y DD + GWD     QISFG+  K GE ERK+GTPW+E EH+
Sbjct  61   RVDVPDYMDDPAAGWDSA--GQISFGS--KHGEGERKRGTPWSENEHK  104



>ref|XP_006289993.1| hypothetical protein CARUB_v10003623mg [Capsella rubella]
 gb|EOA22891.1| hypothetical protein CARUB_v10003623mg [Capsella rubella]
Length=214

 Score =   119 bits (298),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 84/110 (76%), Gaps = 9/110 (8%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FEQ+LVLFP+G  +RW++IA ++  KSA +V  H+EALVHDV EID+G
Sbjct  2    ASSQWTRSEDKMFEQALVLFPEGSPNRWERIADQLH-KSAGEVREHYEALVHDVFEIDAG  60

Query  317  RVELPSYPDDS---FGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++P Y DDS    GWD     QISFG+  K GE+ERK+GTPWTE EH+
Sbjct  61   RVDVPDYMDDSAAAAGWDSA--GQISFGS--KHGESERKRGTPWTENEHK  106



>gb|KDP39847.1| hypothetical protein JCGZ_04192 [Jatropha curcas]
Length=219

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 89/118 (75%), Gaps = 10/118 (8%)
 Frame = +2

Query  134  MQSAATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEID  310
            + ++++W+R EDK+FE++LV+FP+   +RWQKIA+++PG++ ++V  H+E LVHDVGEID
Sbjct  2    IGNSSSWSRLEDKLFERALVIFPEESPNRWQKIAAQVPGRTWVEVKKHYEDLVHDVGEID  61

Query  311  SGRVELPSYPDD-----SFGWD---QGEPSQISFGNSKKQGE-AERKKGTPWTEEEHR  457
            SGRV+LPSY D+     + GW    +   SQ+ FG+  K+ E +ER+KG PWTEEEHR
Sbjct  62   SGRVQLPSYEDEWGMDSAGGWGSVTESGTSQVWFGSKGKEKETSERRKGVPWTEEEHR  119



>ref|XP_009795456.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana sylvestris]
Length=174

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 13/103 (13%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTR EDK+FE +LVL+P+   DRWQ IA  +PGK+  D+IAH++ LVHD+ EIDSGR+EL
Sbjct  4    WTREEDKLFEHALVLYPENIADRWQLIADHVPGKTTEDIIAHYDDLVHDLLEIDSGRIEL  63

Query  329  PSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            P+Y DD               ++KK  E ERKKGTPWTEEEHR
Sbjct  64   PTYTDD------------PVESNKKNTEIERKKGTPWTEEEHR  94



>gb|KFK24916.1| hypothetical protein AALP_AA8G041600 [Arabis alpina]
Length=214

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 7/108 (6%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FEQ+LVLFP+G  +RW++IA ++  KS+ +V  H+E LVHDV EIDSG
Sbjct  2    ASSQWTRSEDKMFEQALVLFPEGSLNRWERIADQLQ-KSSGEVREHYEVLVHDVFEIDSG  60

Query  317  RVELPSYPDDS-FGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++P Y DDS  GWD     QISFG+  K GE+ERK+GTPWTE EH+
Sbjct  61   RVDVPDYLDDSAAGWDSA--GQISFGS--KHGESERKRGTPWTENEHK  104



>ref|XP_007015574.1| Duplicated homeodomain-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007015575.1| Duplicated homeodomain-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY33193.1| Duplicated homeodomain-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY33194.1| Duplicated homeodomain-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=245

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 84/128 (66%), Gaps = 6/128 (5%)
 Frame = +2

Query  92   SANHRWMMGDSVTAMQSAAT-WTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDV  265
            S NH   +     + Q   + WTR EDK+FEQ+LV+ P+G  DRWQKIA R+PGKSA +V
Sbjct  7    SINHNPFLTQPQPSTQVLTSRWTRLEDKLFEQALVMLPEGIPDRWQKIAERVPGKSAKEV  66

Query  266  IAHFEALVHDVGEIDSGRVELPSYP--DDSFGWDQGEPSQISFGNS--KKQGEAERKKGT  433
              H+E L++DV EID+GR+E+PSY              +QISF  S  K+ GE ERKKGT
Sbjct  67   KEHYEMLLYDVYEIDAGRIEIPSYADDSSLLSSSWDSDTQISFEASKPKQHGENERKKGT  126

Query  434  PWTEEEHR  457
            PWTEEEH+
Sbjct  127  PWTEEEHK  134



>ref|XP_010695074.1| PREDICTED: transcription factor DIVARICATA [Beta vulgaris subsp. 
vulgaris]
Length=230

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 12/114 (11%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPD---GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRV  322
            WTR EDK+FE++LV+F D    ++RW+KIA  +PG+S ++V  H+EAL++DV EIDSGRV
Sbjct  8    WTRAEDKLFEEALVIFADEEAAEERWRKIAGHVPGRSPVEVRDHYEALIYDVDEIDSGRV  67

Query  323  ELPSYPDD-SFGW--DQGEPS---QISF---GNSKKQGEAERKKGTPWTEEEHR  457
            +LP Y D+ +  W   + +P+   QISF   GN  K  E ERKKGTPWTEEEHR
Sbjct  68   QLPCYSDEFAASWWSTESQPTRSNQISFGCDGNKPKHNEVERKKGTPWTEEEHR  121



>ref|XP_003637230.1| DnaJ homolog subfamily C member [Medicago truncatula]
 gb|KEH44287.1| MYB-like transcription factor family protein [Medicago truncatula]
Length=244

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 81/111 (73%), Gaps = 11/111 (10%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTR  DK+FE++L++ P D  DRW+KIA ++PGKSA ++  H+EALVHD+ EIDSGRVE+
Sbjct  24   WTRDHDKLFERALLMVPEDLPDRWEKIAEQVPGKSAAEIRDHYEALVHDILEIDSGRVEV  83

Query  329  PSYPDDS-------FGWDQGEPSQISFGNSKKQ-GEAERKKGTPWTEEEHR  457
            PSY D+S         WD    +QISFG+  +  G+ ERKKGTPWTEEEHR
Sbjct  84   PSYSDESAVSGGGLAEWDSS--NQISFGSKPRHGGDNERKKGTPWTEEEHR  132



>ref|XP_009130835.1| PREDICTED: transcription factor DIVARICATA [Brassica rapa]
Length=212

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 7/108 (6%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FEQ+LVLFP+G  +RW++IA ++  KS  +V  H+EALVHDV EIDSG
Sbjct  2    ASSQWTRSEDKMFEQALVLFPEGSPNRWERIADQL-NKSPGEVREHYEALVHDVLEIDSG  60

Query  317  RVELPSYPDDS-FGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++P Y DDS  GWD     QISFG+  K GE ERK+GTPW+E EH+
Sbjct  61   RVDVPDYMDDSAAGWDSA--GQISFGS--KHGEGERKRGTPWSENEHK  104



>ref|XP_011469263.1| PREDICTED: transcription factor DIVARICATA [Fragaria vesca subsp. 
vesca]
Length=223

 Score =   118 bits (295),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 82/129 (64%), Gaps = 15/129 (12%)
 Frame = +2

Query  110  MMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEAL  286
            M  ++     S+A WTR EDK+FEQ+LV F  D  DRW++IA  +PGK+A +V+ H+E L
Sbjct  1    MFQEAPPCWSSSARWTRAEDKLFEQALVSFSEDLPDRWERIAEMVPGKTAEEVLEHYETL  60

Query  287  VHDVGEIDSGRVELPSYPDDS----FGWDQGEPSQISFGNSK--------KQGEAERKKG  430
            VHDV EIDSGRVELPSY DDS     GWD    SQISF   K            AERKKG
Sbjct  61   VHDVVEIDSGRVELPSYADDSAAAGVGWDSA--SQISFDGCKANNTNNNAASEAAERKKG  118

Query  431  TPWTEEEHR  457
             PWTE EH+
Sbjct  119  KPWTEIEHK  127



>ref|XP_009592760.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana tomentosiformis]
Length=174

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 72/103 (70%), Gaps = 13/103 (13%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTR EDK+FE +LVL+P+   DRWQ IA  +PGK+  D+IAH++ LVHD+ EIDSGR+EL
Sbjct  4    WTRDEDKLFEHALVLYPENIADRWQLIADHVPGKTTEDIIAHYDDLVHDLLEIDSGRIEL  63

Query  329  PSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            P+Y DD               ++KK  E ERKKGTPWTEEEHR
Sbjct  64   PAYTDD------------PVESNKKNIEIERKKGTPWTEEEHR  94



>ref|XP_010552881.1| PREDICTED: transcription factor DIVARICATA-like [Tarenaya hassleriana]
Length=221

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 79/108 (73%), Gaps = 6/108 (6%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +A  WTR EDK+FE+SLV+FP+   DRW++IA ++  KS  +V  H+EALVHDV EIDSG
Sbjct  2    AANQWTRTEDKMFEESLVIFPETLPDRWERIAEKL-RKSPAEVREHYEALVHDVSEIDSG  60

Query  317  RVELPSYPDDSFG-WDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RVE+P Y DDS   WD   P+QISF    K G+ E+KKGTPWTE EH+
Sbjct  61   RVEMPDYVDDSAASWDSA-PAQISF--RAKHGDTEKKKGTPWTENEHK  105



>ref|XP_002273261.1| PREDICTED: transcription factor DIVARICATA [Vitis vinifera]
Length=224

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 88/125 (70%), Gaps = 5/125 (4%)
 Frame = +2

Query  98   NHRWMMG-DSVTAMQSAATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIA  271
            N  WMM  +   +  S+++W+R++DK+FE++LV+ P+   DRW KIA+++PGKS+ +V  
Sbjct  4    NDSWMMMVNQSPSPSSSSSWSRHQDKLFERALVVIPEETPDRWDKIAAQVPGKSSSEVRR  63

Query  272  HFEALVHDVGEIDSGRVELPSYPDDSFG--W-DQGEPSQISFGNSKKQGEAERKKGTPWT  442
            H+E LVHDV EIDSGRVELP Y D+S G  W       Q+SF    +Q E+ERKKG PWT
Sbjct  64   HYEDLVHDVAEIDSGRVELPLYEDESCGSPWASDSRAGQVSFSPRPRQSESERKKGVPWT  123

Query  443  EEEHR  457
            EEEHR
Sbjct  124  EEEHR  128



>emb|CBI28292.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   117 bits (292),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 86/120 (72%), Gaps = 4/120 (3%)
 Frame = +2

Query  110  MMGDSVTAMQSAATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEAL  286
            MM +   +  S+++W+R++DK+FE++LV+ P+   DRW KIA+++PGKS+ +V  H+E L
Sbjct  2    MMVNQSPSPSSSSSWSRHQDKLFERALVVIPEETPDRWDKIAAQVPGKSSSEVRRHYEDL  61

Query  287  VHDVGEIDSGRVELPSYPDDSFG--W-DQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            VHDV EIDSGRVELP Y D+S G  W       Q+SF    +Q E+ERKKG PWTEEEHR
Sbjct  62   VHDVAEIDSGRVELPLYEDESCGSPWASDSRAGQVSFSPRPRQSESERKKGVPWTEEEHR  121



>ref|XP_004497135.1| PREDICTED: transcription factor DIVARICATA-like [Cicer arietinum]
Length=243

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 78/112 (70%), Gaps = 8/112 (7%)
 Frame = +2

Query  146  ATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRV  322
            + WTR  DK+FE++L++ P D  DRW+KIA ++PGKSA +V  H+EALVHDV EIDSGRV
Sbjct  22   SQWTRDHDKLFERALLIVPEDLPDRWEKIAEQVPGKSAAEVRDHYEALVHDVLEIDSGRV  81

Query  323  ELPSY-------PDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            E+PSY              D    +QISFG+  + G+ ERKKGTPWTEEEHR
Sbjct  82   EVPSYSDDSAASGGGGGLSDWDSSNQISFGSKSRHGDNERKKGTPWTEEEHR  133



>ref|XP_010490996.1| PREDICTED: transcription factor DIVARICATA-like [Camelina sativa]
Length=216

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 10/111 (9%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FEQ+LVLFP+G  +RW++IA ++  KSA +V  H+EALVHDV EID+G
Sbjct  2    ASSQWTRSEDKMFEQALVLFPEGSPNRWERIADQLH-KSAGEVKEHYEALVHDVFEIDAG  60

Query  317  RVELPSYPDDSF----GWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++P Y DDS     GWD     QISFG+  K  ++ERK+GTPWTE EH+
Sbjct  61   RVDVPDYMDDSAAASAGWDSA--GQISFGS--KHADSERKRGTPWTENEHK  107



>ref|XP_010423540.1| PREDICTED: transcription factor DIVARICATA-like [Camelina sativa]
Length=216

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 10/111 (9%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FEQ+LVLFP+G  +RW++IA ++  KSA +V  H+EALVHDV EID+G
Sbjct  2    ASSQWTRSEDKMFEQALVLFPEGSPNRWERIADQLH-KSAGEVREHYEALVHDVFEIDAG  60

Query  317  RVELPSYPDDSF----GWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++P Y DDS     GWD     QISFG+  K  ++ERK+GTPWTE EH+
Sbjct  61   RVDVPDYMDDSAAASAGWDSA--GQISFGS--KHADSERKRGTPWTENEHK  107



>gb|KHG07762.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=208

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = +2

Query  128  TAMQSAATWTRYEDKVFEQSLVLFPDGD--DRWQKIASRIPGKSALDVIAHFEALVHDVG  301
            T   +++ W+ ++DK+FE++LV+F + +  DRW+KIA+++PGKSA DV  H+E L HDV 
Sbjct  4    TNDDASSAWSWHQDKLFERALVMFSNDESSDRWEKIAAQVPGKSAADVRRHYEDLEHDVL  63

Query  302  EIDSGRVELPSYPD--DSFGW-DQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            EI+SGRVELPSY    +S  W ++   SQ+  G+  K+ E+ER+KG PWTEEEHR
Sbjct  64   EIESGRVELPSYEGELESASWVNESGRSQVWVGSKGKERESERRKGVPWTEEEHR  118



>emb|CDX70204.1| BnaA10g25530D [Brassica napus]
Length=129

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 11/107 (10%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +A+ WTR EDK+FE +LVLFP+G  +RW+ IA ++  KSA +V  H+EALVHDV EIDSG
Sbjct  2    AASQWTRSEDKMFEHALVLFPEGSPNRWEIIADQLQ-KSAGEVREHYEALVHDVIEIDSG  60

Query  317  RVELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV +P Y DDS G       QISF    K GE ERK+GTPW+E EH+
Sbjct  61   RVHVPRYMDDSAG-------QISF--ESKHGENERKRGTPWSESEHK  98



>ref|XP_011006061.1| PREDICTED: transcription factor DIVARICATA-like [Populus euphratica]
Length=221

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 11/111 (10%)
 Frame = +2

Query  146  ATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRV  322
            ++W+R EDK FEQ+LVLFP+    RW+KI+S +PGKS  +V  H+E LVHDV EIDSGRV
Sbjct  6    SSWSRLEDKQFEQALVLFPEETPKRWEKISSYVPGKSWREVRKHYEDLVHDVLEIDSGRV  65

Query  323  ELPSYPDDSFGWDQGEPSQISFG------NSKKQGEAERKKGTPWTEEEHR  457
            E+P Y  D    D    S  SFG      + K++   ER+KGTPWTEEEHR
Sbjct  66   EVPVYDQDELWGD----STTSFGAAAEPRSGKEREHTERRKGTPWTEEEHR  112



>ref|XP_002515769.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF46608.1| DNA binding protein, putative [Ricinus communis]
Length=240

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = +2

Query  149  TWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVE  325
             W   E+K FE++LV F  D  DRWQ+IA  I GKS  +V  H+E LV DV EIDSGRVE
Sbjct  20   CWNLSEEKQFEKALVQFSEDLPDRWQQIADCI-GKSVQEVTEHYEELVRDVNEIDSGRVE  78

Query  326  LPSYPDDSFGWDQ--GEPSQISFGN-SKKQGEAERKKGTPWTEEEHR  457
            LP Y D +  W+     PS+ISFG  S KQ ++ERKKGTPWTE EHR
Sbjct  79   LPCYRDGNSCWESMGAVPSEISFGGKSNKQADSERKKGTPWTEHEHR  125



>ref|XP_006398929.1| hypothetical protein EUTSA_v10014613mg [Eutrema salsugineum]
 gb|ESQ40382.1| hypothetical protein EUTSA_v10014613mg [Eutrema salsugineum]
Length=222

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 80/109 (73%), Gaps = 6/109 (6%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FEQ+LVLFP+G  +RW++IA ++  ++A++V  H+EALVHDV EIDSG
Sbjct  2    ASSVWTRSEDKMFEQALVLFPEGSPNRWERIADQL-HRTAVEVRDHYEALVHDVIEIDSG  60

Query  317  RVELPSY--PDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++P Y     +         QISFG+  K GE+ERK+GTPWTE EH+
Sbjct  61   RVDVPDYMDDSAAAAAGWDSAGQISFGS--KHGESERKRGTPWTENEHK  107



>ref|XP_008440393.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis melo]
Length=273

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 77/117 (66%), Gaps = 10/117 (9%)
 Frame = +2

Query  125  VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVG  301
            +T+  S   WTR++D +FE++LVL PD   DRW KIA+ +PGKSA DV  H++ LV DV 
Sbjct  13   ITSFSSPTPWTRHQDDLFERALVLVPDNSPDRWIKIAALVPGKSAADVRYHYDVLVSDVL  72

Query  302  EIDSGRVELPSYPDD-----SFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
             IDSGRVELP+Y DD     S   ++  P  I    S+K   +ERKKG PWT++EH+
Sbjct  73   NIDSGRVELPNYADDLTAARSPEREKSPPHPI----SEKASSSERKKGKPWTKKEHQ  125



>ref|XP_009122571.1| PREDICTED: transcription factor DIVARICATA-like [Brassica rapa]
Length=207

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 11/107 (10%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FE +LVLFP+G  +RW+ IA ++  KSA +V  H+EALVHDV EIDSG
Sbjct  2    ASSQWTRSEDKMFEHALVLFPEGSPNRWEIIADQLQ-KSAGEVREHYEALVHDVIEIDSG  60

Query  317  RVELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV +P Y DDS G       QISF      GE ERK+GTPW+E EH+
Sbjct  61   RVHVPRYMDDSAG-------QISF--ESIHGENERKRGTPWSESEHK  98



>ref|XP_002316492.2| hypothetical protein POPTR_0010s24710g [Populus trichocarpa]
 gb|EEF02663.2| hypothetical protein POPTR_0010s24710g [Populus trichocarpa]
Length=235

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 79/121 (65%), Gaps = 17/121 (14%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +A  WTR EDK+FEQ+L +FP+   DRWQ IA+ I  KSA +V  H++ LVHDV  IDSG
Sbjct  20   AATRWTREEDKIFEQALTIFPENLPDRWQSIANHI-RKSAWEVKEHYDILVHDVLAIDSG  78

Query  317  RVELPSYPDD------SFGWDQG-------EPS-QISFGNSKKQGEAERKKGTPWTEEEH  454
            RVELP+Y DD      S G D G        PS QI FG   KQ + ERKKGTPWTE+EH
Sbjct  79   RVELPTYRDDESVSWESSGGDDGGMVAAGAPPSGQICFGGKGKQ-DTERKKGTPWTEDEH  137

Query  455  R  457
            +
Sbjct  138  K  138



>ref|XP_004141984.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus]
 ref|XP_004160951.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus]
 gb|KGN48612.1| hypothetical protein Csa_6G495660 [Cucumis sativus]
Length=239

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 8/117 (7%)
 Frame = +2

Query  125  VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVG  301
            V ++ S   WTR++D +FE +LVL PD   DRW KIA+ +PGKSA DV  H++ LV DV 
Sbjct  13   VASLSSPTPWTRHQDNLFEHALVLVPDNSPDRWIKIAALVPGKSAADVRYHYDVLVSDVL  72

Query  302  EIDSGRVELPSYPDD-----SFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            +IDSGRVELP+Y DD     S   ++  PS      S+K    ERKKG PWT++EH+
Sbjct  73   DIDSGRVELPNYADDLTVAKSSERERSPPSPRPV--SEKTSTTERKKGKPWTKKEHQ  127



>ref|XP_011024174.1| PREDICTED: transcription factor DIVARICATA-like [Populus euphratica]
Length=238

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 79/124 (64%), Gaps = 20/124 (16%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +A  WTR EDK+FEQ+L +FP+   DRWQ IA+ I  KSA +V  H++ LVHDV  IDSG
Sbjct  20   AATRWTREEDKIFEQALTIFPENLPDRWQSIANHI-RKSAWEVKEHYDILVHDVLAIDSG  78

Query  317  RVELPSYPDD-SFGWD---------------QGEPS-QISFGNSKKQGEAERKKGTPWTE  445
            RVELP+Y DD S  W+               +  PS QI FG   KQ + ERKKGTPWTE
Sbjct  79   RVELPTYRDDESVSWESSGGDGDGAGRMVAARAPPSGQICFGGKAKQ-DTERKKGTPWTE  137

Query  446  EEHR  457
            +EH+
Sbjct  138  DEHK  141



>ref|XP_007015770.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY33389.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
Length=212

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 77/109 (71%), Gaps = 3/109 (3%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            S ++W+ ++DK+FE++L++FP D  DRW+KIA+++PGKSA++V  H+  L HDV EI+SG
Sbjct  8    SPSSWSWHQDKLFERALIMFPEDSPDRWEKIAAQLPGKSAMEVRKHYADLEHDVMEIESG  67

Query  317  RVELPSYPD--DSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++PSY    +S  W         +   KK  E+ER+KG PWTEEEHR
Sbjct  68   RVQMPSYEGELESASWVNESGGSQGWVGWKKDRESERRKGVPWTEEEHR  116



>ref|NP_196096.1| duplicated SANT DNA-binding domain-containing protein [Arabidopsis 
thaliana]
 emb|CAB86018.1| I-box binding factor-like protein [Arabidopsis thaliana]
 dbj|BAB08980.1| I-box binding factor-like protein [Arabidopsis thaliana]
 gb|AAK93653.1| putative I-box binding factor [Arabidopsis thaliana]
 gb|AAM14116.1| putative I-box binding factor [Arabidopsis thaliana]
 gb|AAM65901.1| I-box binding factor-like protein [Arabidopsis thaliana]
 dbj|BAH30574.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90781.1| duplicated SANT DNA-binding domain-containing protein [Arabidopsis 
thaliana]
Length=215

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 78/109 (72%), Gaps = 6/109 (6%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FEQ+LVLFP+G  +RW++IA ++  KSA +V  H+E LVHDV EIDSG
Sbjct  2    ASSQWTRSEDKMFEQALVLFPEGSPNRWERIADQL-HKSAGEVREHYEVLVHDVFEIDSG  60

Query  317  RVELPSY--PDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++P Y     +         QISFG+  K GE+ERK+GTPWTE EH+
Sbjct  61   RVDVPDYMDDSAAAAAGWDSAGQISFGS--KHGESERKRGTPWTENEHK  107



>emb|CDY04922.1| BnaAnng01040D [Brassica napus]
Length=213

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 78/110 (71%), Gaps = 9/110 (8%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FE++LV FP+G  +RW++IA ++  K   +V  H+EALVHDV +IDSG
Sbjct  2    ASSQWTRSEDKMFEEALVFFPEGSPNRWERIADQLH-KPVGEVREHYEALVHDVFQIDSG  60

Query  317  RVELPSYPDDS---FGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            +V++P Y DDS    GWD     QISFG   K  E ERK+GTPW+E EH+
Sbjct  61   QVDVPDYIDDSAAAAGWDSA--GQISFGT--KHSEGERKRGTPWSENEHK  106



>emb|CDY14142.1| BnaC02g02590D [Brassica napus]
Length=212

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 79/109 (72%), Gaps = 8/109 (7%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDKVFE++LV FP+G  +RW++IA ++  K   +V  H++ALVHDV +IDSG
Sbjct  2    ASSQWTRSEDKVFEEALVFFPEGSPNRWERIADQLQ-KPVGEVRDHYDALVHDVFQIDSG  60

Query  317  RVELPSYPDD--SFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            +V++P Y D   + GWD    SQISFG +   GE ERK+GTPW+E EH+
Sbjct  61   QVDVPDYIDSAAAAGWDSA--SQISFGTN--HGEGERKRGTPWSENEHK  105



>gb|KJB55532.1| hypothetical protein B456_009G080900 [Gossypium raimondii]
Length=129

 Score =   103 bits (257),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 73/108 (68%), Gaps = 8/108 (7%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPDGDD-RWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            W+  E+K+FE + ++FP+    RWQKIA RI GKSA +V  HF+ L+HDV EI++GR+E+
Sbjct  15   WSTLENKLFEHAFLVFPEETSYRWQKIADRISGKSAKEVEEHFDMLLHDVYEIEAGRIEI  74

Query  329  PSYPDDS----FGWDQGEPSQISF-GNSKKQGEAERKKGTPWTEEEHR  457
            P Y DDS      W+    +QI F   SK Q + ERK+G+PWTEEEH 
Sbjct  75   PRYADDSSMLLSNWNSN--NQIYFTSKSKHQLDNERKEGSPWTEEEHN  120



>ref|XP_009125576.1| PREDICTED: transcription factor DIVARICATA-like [Brassica rapa]
Length=213

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 9/110 (8%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK FE++LV FP+G  +RW++IA ++  K   +V  H+EALVHDV +IDSG
Sbjct  2    ASSQWTRSEDKRFEEALVFFPEGSPNRWERIADQLH-KPVGEVREHYEALVHDVFQIDSG  60

Query  317  RVELPSYPDDS---FGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            +V++P Y DDS    GWD     QISFG   K  E ERK+GTPW+E EH+
Sbjct  61   QVDVPDYIDDSAAAAGWDSA--GQISFGT--KHSEGERKRGTPWSENEHK  106



>ref|XP_010452376.1| PREDICTED: transcription factor DIVARICATA-like [Camelina sativa]
Length=219

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 78/111 (70%), Gaps = 8/111 (7%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +++ WTR EDK+FEQ+LVLFP+G  +RW++IA ++  KSA +V  H+EALVHDV EID+G
Sbjct  2    ASSQWTRSEDKMFEQALVLFPEGSPNRWERIADQL-HKSAGEVREHYEALVHDVFEIDAG  60

Query  317  RVELPSY----PDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV++P Y       +         QISFG+  K  ++ERK+GTPWTE EH+
Sbjct  61   RVDVPDYMDDSAAAAASAGWDSAGQISFGS--KHADSERKRGTPWTENEHK  109



>ref|XP_006836469.1| hypothetical protein AMTR_s00108p00066140 [Amborella trichopoda]
 gb|ERM99322.1| hypothetical protein AMTR_s00108p00066140 [Amborella trichopoda]
Length=112

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 74/108 (69%), Gaps = 7/108 (6%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            W+  ++K+F ++L  FPDG  DRWQ+I  ++ GKSA +V  H+EAL+ D+ EIDSG+VEL
Sbjct  6    WSFQQNKIFGEALAAFPDGLPDRWQEIVGKVAGKSAKEVYMHYEALLKDIKEIDSGKVEL  65

Query  329  PSYPDDSFGWDQGEPSQISFGNSKKQ-----GEAERKKGTPWTEEEHR  457
            PSY D S+ + +  P + S+G+ + +      +  RKKG+PWTE +HR
Sbjct  66   PSYNDVSY-FRENSPEKFSYGSFESRQVPATCKMGRKKGSPWTEVQHR  112



>ref|XP_008802864.1| PREDICTED: transcription factor DIVARICATA [Phoenix dactylifera]
 ref|XP_008802869.1| PREDICTED: transcription factor DIVARICATA [Phoenix dactylifera]
 ref|XP_008802876.1| PREDICTED: transcription factor DIVARICATA [Phoenix dactylifera]
 ref|XP_008802884.1| PREDICTED: transcription factor DIVARICATA [Phoenix dactylifera]
 ref|XP_008802892.1| PREDICTED: transcription factor DIVARICATA [Phoenix dactylifera]
 ref|XP_008802900.1| PREDICTED: transcription factor DIVARICATA [Phoenix dactylifera]
 ref|XP_008802908.1| PREDICTED: transcription factor DIVARICATA [Phoenix dactylifera]
 ref|XP_008802917.1| PREDICTED: transcription factor DIVARICATA [Phoenix dactylifera]
Length=289

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 12/119 (10%)
 Frame = +2

Query  137  QSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDS  313
             S+++W+R ++K FE +LV  P D  DRW+KIA+ +PGK+  D+  H+E LV DV  I+S
Sbjct  7    NSSSSWSREQEKAFENALVTHPEDCSDRWEKIAADVPGKTLEDIKHHYELLVEDVNAIES  66

Query  314  GRVELPSYPDDSFGWDQ------GEPSQISFGNSKKQGEA-----ERKKGTPWTEEEHR  457
            GRV +P YP  S G DQ      G+    S G+S   G+A     ER+KG  WTE+EHR
Sbjct  67   GRVPVPCYPSSSDGGDQANEGSSGKKGGHSHGDSSHSGKASRSDQERRKGIAWTEDEHR  125



>ref|XP_010031294.1| PREDICTED: transcription factor DIVARICATA [Eucalyptus grandis]
 gb|KCW50557.1| hypothetical protein EUGRSUZ_J00271 [Eucalyptus grandis]
Length=232

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 68/106 (64%), Gaps = 6/106 (6%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLV-LFPDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            AA W+RYEDKVFE +LV +  D  DRWQ I +R+  +SA  V  H++ LV D+  I+SGR
Sbjct  5    AAEWSRYEDKVFEHALVAVAEDSPDRWQLIGNRL-NRSASQVFEHYQRLVEDIDAIESGR  63

Query  320  VELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            VE PSY DD          QI+F    +  EAE+KKG PWTEEEHR
Sbjct  64   VEPPSYRDDH----PASCGQIAFETKPRIKEAEKKKGNPWTEEEHR  105



>gb|KJB35391.1| hypothetical protein B456_006G113100 [Gossypium raimondii]
Length=210

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 84/117 (72%), Gaps = 7/117 (6%)
 Frame = +2

Query  128  TAMQSAATWTRYEDKVFEQSLVLFPDGD--DRWQKIASRIPGKSALDVIAHFEALVHDVG  301
            T   +++ W+ ++DK+FE++LV+F + +  DRW+KIA+++PGKSA DV  H+E L HDV 
Sbjct  4    TNDDASSAWSWHQDKLFERALVMFSNDESSDRWEKIAAQVPGKSAADVRRHYEDLEHDVL  63

Query  302  EIDSGRVELPSYPD--DSFGW-DQGEPSQISFGNSKK--QGEAERKKGTPWTEEEHR  457
            EI+SGR+ELPSY    +S  W ++   SQ+  G+  K  + E+ER+KG PWTEEEHR
Sbjct  64   EIESGRIELPSYEGELESASWVNESGRSQVWVGSKGKERERESERRKGVPWTEEEHR  120



>ref|XP_010935566.1| PREDICTED: transcription factor DIVARICATA [Elaeis guineensis]
 ref|XP_010935567.1| PREDICTED: transcription factor DIVARICATA [Elaeis guineensis]
 ref|XP_010935568.1| PREDICTED: transcription factor DIVARICATA [Elaeis guineensis]
 ref|XP_010935570.1| PREDICTED: transcription factor DIVARICATA [Elaeis guineensis]
 ref|XP_010935571.1| PREDICTED: transcription factor DIVARICATA [Elaeis guineensis]
Length=290

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 72/119 (61%), Gaps = 12/119 (10%)
 Frame = +2

Query  137  QSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDS  313
             S++ W+R ++K FE +LV  P D  DRW+KIA+ +PGK+  DV  H+E LV D+  I+S
Sbjct  7    NSSSLWSREQEKAFENALVTHPEDCSDRWEKIAADVPGKTLEDVKHHYELLVEDINAIES  66

Query  314  GRVELPSYPDDSFGWDQ------GEPSQISFGNSKKQGEA-----ERKKGTPWTEEEHR  457
            GRV +P YP  S G D       G+    S G+S   G+A     ER+KG  WTE+EHR
Sbjct  67   GRVPVPCYPSSSDGGDHANEGSSGKKGGHSHGDSTHSGKASRSDQERRKGIAWTEDEHR  125



>ref|XP_002264197.1| PREDICTED: transcription factor DIVARICATA [Vitis vinifera]
Length=333

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 69/104 (66%), Gaps = 4/104 (4%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTR +DK+FEQ+L +FP+   DRW  IA ++PGK+  D+  H+E LV DV  I++G VE+
Sbjct  15   WTRLDDKIFEQALAIFPEEMPDRWLSIAQQLPGKTPEDMKLHYELLVEDVTNIENGNVEM  74

Query  329  PSYPDDSFGW-DQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            PSY +++  W  + EP        KK  E ERKKGTPWTE EHR
Sbjct  75   PSYLEEA--WRRETEPRTSHDSVGKKTKEVERKKGTPWTEVEHR  116



>ref|XP_007219262.1| hypothetical protein PRUPE_ppa018139mg [Prunus persica]
 gb|EMJ20461.1| hypothetical protein PRUPE_ppa018139mg [Prunus persica]
Length=290

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 74/129 (57%), Gaps = 12/129 (9%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDV  265
            Y A+  W + DS      ++ WT+ E+K FE +L +F +   DRW K+AS IPGK+ +DV
Sbjct  9    YMADSNWFIQDS-----QSSEWTKEENKKFESALAMFDEKTPDRWLKVASMIPGKTVIDV  63

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSKKQGEA-----ERKKG  430
            I  ++ L  DV EI+SGR  +P Y   SF  D G+       N K+   A     ERKKG
Sbjct  64   IKQYQELEEDVSEIESGRFPIPGYLTSSFTLDLGDDRNFD-ANRKRPSAARGSDQERKKG  122

Query  431  TPWTEEEHR  457
             PWTEEEHR
Sbjct  123  IPWTEEEHR  131



>ref|XP_008233716.1| PREDICTED: transcription factor DIVARICATA-like [Prunus mume]
Length=290

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 74/129 (57%), Gaps = 12/129 (9%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDV  265
            Y A+  W + DS      ++ WT+ E+K FE +L +F +   DRW K+AS IPGK+ +DV
Sbjct  9    YMADSNWFIQDS-----QSSEWTKEENKKFESALAMFDEKTPDRWLKVASMIPGKTVIDV  63

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSKKQGEA-----ERKKG  430
            I  ++ L  DV EI+SGR  +P Y   SF  D G+       N K+   A     ERKKG
Sbjct  64   IKQYQELEEDVSEIESGRFPIPGYLTSSFTLDLGDDRNFD-ANRKRPSAARGSDQERKKG  122

Query  431  TPWTEEEHR  457
             PWTEEEHR
Sbjct  123  IPWTEEEHR  131



>emb|CDY08538.1| BnaA05g27740D [Brassica napus]
Length=253

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 75/122 (61%), Gaps = 4/122 (3%)
 Frame = +2

Query  95   ANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIA  271
            ++HR++  D ++    ++ WT+ E+K+FE++L ++P D  DRW KIAS IPGK+  DV+ 
Sbjct  13   SDHRFVGQDMMSLQSPSSIWTKEENKMFERALAIYPEDSPDRWFKIASMIPGKTVFDVMK  72

Query  272  HFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEE  451
             +  L  DV +I+ GRV +P YP    G  Q   +     N  +  + +RKKG PWTEEE
Sbjct  73   QYSKLEEDVFDIEEGRVPIPGYP-SPLGLAQD--TYRKRPNGARGSDHDRKKGVPWTEEE  129

Query  452  HR  457
            HR
Sbjct  130  HR  131



>ref|XP_008789580.1| PREDICTED: transcription factor DIVARICATA-like [Phoenix dactylifera]
Length=186

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 81/124 (65%), Gaps = 15/124 (12%)
 Frame = +2

Query  125  VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVG  301
            + ++QS   W+ YE+K+FE +LV +P+G  +RW  I +++PGKS   V+ H++ L+ D+ 
Sbjct  7    IGSLQSPTEWSWYENKIFELALVEYPEGTPNRWPLITAKLPGKSLGQVLHHYQVLIDDLY  66

Query  302  EIDSGRVELPSYPDDSFGWDQGE-----PSQ-------ISFGNSKKQGEAERKKGTPWTE  445
             I+SG+VE+P Y D+  G + G+     P Q       I+ G S++QG+ ERKKG PWTE
Sbjct  67   LIESGKVEIPDYRDEEEGGNSGDGRCMTPKQHPSDGPNIASG-SRQQGQ-ERKKGKPWTE  124

Query  446  EEHR  457
            EEHR
Sbjct  125  EEHR  128



>emb|CDY01009.1| BnaC05g41910D [Brassica napus]
Length=254

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 76/122 (62%), Gaps = 4/122 (3%)
 Frame = +2

Query  95   ANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIA  271
            +++R++  D ++    ++ WT+ E+K+FE++L ++P D  DRW KIAS IPGK+  DV+ 
Sbjct  13   SDYRFVGQDMMSLQSPSSIWTKEENKMFERALAIYPEDSPDRWFKIASMIPGKTVFDVMK  72

Query  272  HFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEE  451
             +  L  DV +I+ GRV +P YP    G+ Q    +    N  +  + +RKKG PWTEEE
Sbjct  73   QYNKLEEDVFDIEEGRVPIPGYP-SPLGFTQDTCRKRP--NGARGSDHDRKKGVPWTEEE  129

Query  452  HR  457
            HR
Sbjct  130  HR  131



>ref|XP_009146740.1| PREDICTED: transcription factor DIVARICATA [Brassica rapa]
Length=254

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 76/122 (62%), Gaps = 4/122 (3%)
 Frame = +2

Query  95   ANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIA  271
            +++R++  D ++    ++ WT+ E+K+FE++L ++P D  DRW KIAS IPGK+  DV+ 
Sbjct  13   SDYRFVGQDMMSLQSPSSIWTKEENKMFERALAIYPEDSPDRWFKIASMIPGKTVFDVMN  72

Query  272  HFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEE  451
             +  L  DV +I+ GRV +P YP    G+ Q    +    N  +  + +RKKG PWTEEE
Sbjct  73   QYSKLEEDVFDIEEGRVPIPGYP-SPLGFTQDTCRKRP--NGARGSDHDRKKGVPWTEEE  129

Query  452  HR  457
            HR
Sbjct  130  HR  131



>ref|XP_009420852.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420853.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420854.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420856.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420857.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420858.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420859.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
Length=276

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 71/120 (59%), Gaps = 12/120 (10%)
 Frame = +2

Query  134  MQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEID  310
            +  +++WTR ++K FE +L   P D  D W+KIA+ +PGKS  DV  H+E L+ D+  I+
Sbjct  6    VSCSSSWTREQEKAFENALATHPEDCSDWWEKIAANVPGKSIEDVKNHYELLLEDINGIE  65

Query  311  SGRVELPSYPDDSFGWDQ------GEPSQISFGNSKKQGEA-----ERKKGTPWTEEEHR  457
            SGRV LP YP  S G D       G+   +S G+    G+A     ERKKG  WTE+EHR
Sbjct  66   SGRVPLPCYPSSSDGDDHANDGVSGKKGGLSHGDPSHSGKASKSDQERKKGIAWTEDEHR  125



>gb|EYU37210.1| hypothetical protein MIMGU_mgv1a014332mg [Erythranthe guttata]
Length=193

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 63/108 (58%), Gaps = 19/108 (18%)
 Frame = +2

Query  149  TWTRYEDKVFEQSLVLFPDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            +WTR EDK+FE++LV  PDG              S  +V  H++ L+ D+  IDSG VEL
Sbjct  15   SWTREEDKIFERALVEIPDG--------------SPEEVKDHYDDLLDDIHRIDSGLVEL  60

Query  329  PSYPDDSFGWDQGEPSQISF-----GNSKKQGEAERKKGTPWTEEEHR  457
            P Y DDS     G P QISF     GN  +  E +RKKGTPWTE+EHR
Sbjct  61   PCYSDDSASLGSGMPGQISFGSPSSGNRSRHSEVDRKKGTPWTEDEHR  108



>ref|XP_006407460.1| hypothetical protein EUTSA_v10021322mg [Eutrema salsugineum]
 gb|ESQ48913.1| hypothetical protein EUTSA_v10021322mg [Eutrema salsugineum]
Length=270

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 76/123 (62%), Gaps = 6/123 (5%)
 Frame = +2

Query  95   ANHRWMMGDSVTAMQ-SAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVI  268
            + HR+++ + ++    S++ WT+ E+K+FE++L ++  D  DRW K+AS IPGK+  DV+
Sbjct  23   SEHRFVVQEMMSLQSTSSSIWTKEENKMFERALAIYAEDSPDRWFKVASMIPGKTVFDVM  82

Query  269  AHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEE  448
              +  L  DV +I++GRV +P YP D F  +          N  +  + +RKKG PWTEE
Sbjct  83   KQYSKLEEDVFDIEAGRVPIPGYPTDGFDPNTCRKRP----NGARGSDQDRKKGVPWTEE  138

Query  449  EHR  457
            EHR
Sbjct  139  EHR  141



>gb|ACR09747.1| DIV2B protein [Heptacodium miconioides]
Length=265

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 77/130 (59%), Gaps = 14/130 (11%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y +N  W M +S     ++  WTR E+K FE +L +F  +  DRW K+A  IPGKS LDV
Sbjct  9    YISNMNWFMEES-----TSKNWTREENKRFESALAIFDKETPDRWTKVAEMIPGKSVLDV  63

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSKKQG------EAERKK  427
            I  ++ LV DV +I++G V +P Y   SF  +  +  +  FG+ +K+       + ERKK
Sbjct  64   IEQYKELVADVTDIEAGLVPIPGYLTSSFTLELVDNRR--FGDFRKRASLGRSSDQERKK  121

Query  428  GTPWTEEEHR  457
            G PWTE+EHR
Sbjct  122  GVPWTEDEHR  131



>ref|XP_006424203.1| hypothetical protein CICLE_v10029205mg [Citrus clementina]
 gb|ESR37443.1| hypothetical protein CICLE_v10029205mg [Citrus clementina]
 gb|KDO58134.1| hypothetical protein CISIN_1g026855mg [Citrus sinensis]
Length=232

 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 70/106 (66%), Gaps = 4/106 (4%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTR EDK+FE++LV FP+    RW++IA ++PGKS++DV   ++ LV D+ +I++G VEL
Sbjct  18   WTREEDKLFERALVTFPEETPGRWERIARQVPGKSSVDVQRRYDDLVLDLRKIEAGLVEL  77

Query  329  PSYPDDSFGWDQGEPSQISFGNSKKQG---EAERKKGTPWTEEEHR  457
            P Y D+     +   S  S GN+  +    E ER+KG PWT EEHR
Sbjct  78   PGYEDEMDSPGRVAESGASLGNNSNRSRDRETERRKGVPWTAEEHR  123



>ref|XP_010543747.1| PREDICTED: transcription factor DIVARICATA-like [Tarenaya hassleriana]
Length=279

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 71/115 (62%), Gaps = 12/115 (10%)
 Frame = +2

Query  134  MQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEID  310
            M  + TWT+ E+K FE++L ++  D  DRW +IA+ IPGK+  DV+  +  L  DV +I+
Sbjct  21   MNRSGTWTKEENKKFERALAIYAEDTPDRWFRIAAMIPGKTVSDVMKQYNKLEEDVFDIE  80

Query  311  SGRVELPSYPDDSFGWDQGEPSQISFGNSKKQ------GEAERKKGTPWTEEEHR  457
            +GRV +P YP  SF +D  +     F  ++K+       E ERKKG PWTEEEHR
Sbjct  81   AGRVPIPGYPPSSFRFDHRD-----FDANRKRPIGGRGTEQERKKGVPWTEEEHR  130



>ref|XP_010543615.1| PREDICTED: transcription factor DIVARICATA-like isoform X1 [Tarenaya 
hassleriana]
Length=276

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 77/129 (60%), Gaps = 10/129 (8%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            A  WTR EDK+FE++LV F +   DRWQ+I S I  +S  +V  H+ ALVHDV EIDSGR
Sbjct  3    ANYWTRTEDKMFEEALVTFSELMPDRWQRI-SEILRRSQSEVYDHYYALVHDVSEIDSGR  61

Query  320  VELPSYPDDSFGWDQGEPSQISFGNS-------KKQGEAERKKGTPWTEEEHRlltl*l*  478
            V +P+Y D S       P+ ++   +       K+ G  ++KKGTPWTE EHR + +   
Sbjct  62   VNVPAYADHSPA-SCDSPATVAATRTTPKSLRVKRDGTEKKKKGTPWTENEHRYVFISSE  120

Query  479  ISMILQYIY  505
             S ++ Y +
Sbjct  121  NSQVVSYRF  129



>ref|XP_001754431.1| predicted protein [Physcomitrella patens]
 gb|EDQ80881.1| predicted protein, partial [Physcomitrella patens]
Length=168

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            S + WTR +DK FE +L  +  D  +RW++IAS++ GK A +V  H+E L  D+  IDSG
Sbjct  1    SGSVWTREQDKEFENALNTYGEDTPNRWEEIASQVTGKDAAEVKRHYEILQEDINLIDSG  60

Query  317  RVELPSYPDDSFGW-DQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            R+ LPSY   S    ++G  S    G S K  + ER+KG PW+EEEHR
Sbjct  61   RIALPSYRFSSLSLSEEGAASDSPGGVSSKTSDQERRKGIPWSEEEHR  108



>gb|KFK27418.1| hypothetical protein AALP_AA8G380200 [Arabis alpina]
Length=288

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 71/136 (52%), Gaps = 14/136 (10%)
 Frame = +2

Query  92   SANHRWMMGDS---VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSAL  259
            ++   W+M D+   V      ATWT  E+K FE +L ++ D   DRWQK+A+ IPGK+  
Sbjct  13   TSGGNWLMEDTKSNVVVTGEGATWTAAENKAFENALAVYDDNTPDRWQKVAAVIPGKTVS  72

Query  260  DVIAHFEALVHDVGEIDSGRVELPSYPDDSF----------GWDQGEPSQISFGNSKKQG  409
            DVI  +  L  DV  I++G + +P Y    F          G+  G P       S +  
Sbjct  73   DVIKQYNELEADVSSIEAGLIPVPGYVTSPFTLDWTGGGCNGFKPGHPVGNKRSPSGRSP  132

Query  410  EAERKKGTPWTEEEHR  457
            E ERKKG PWTEEEH+
Sbjct  133  ELERKKGVPWTEEEHK  148



>ref|XP_008775058.1| PREDICTED: transcription factor DIVARICATA-like isoform X2 [Phoenix 
dactylifera]
Length=274

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 83/143 (58%), Gaps = 17/143 (12%)
 Frame = +2

Query  62   LKIAEQMMMYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD--DRWQKIAS  235
            +++  Q   Y  N  W++G      + +  WT+ E+K+FE +L  F DGD  DRW+ +A+
Sbjct  7    MEVLAQTTPYFPNSSWLLGP-----KRSGNWTQEENKLFEDALAHF-DGDTPDRWEMVAA  60

Query  236  RIPGKSALDVIAHFEALVHDVGEIDSGRVELPSYPDDSFGWD-----QGEPSQIS-FGNS  397
             IPGKS  D+I+H++ L  DV  I++G +  P Y   SF  D     + E S+ S F  +
Sbjct  61   MIPGKSVQDIISHYKDLEEDVSHIEAGLIPFPGYSSSSFTLDWENSHRYEGSKPSYFVGA  120

Query  398  KKQG---EAERKKGTPWTEEEHR  457
            K+ G   + ERKKG PWTEEEH+
Sbjct  121  KRLGGRPDQERKKGVPWTEEEHK  143



>ref|XP_008775057.1| PREDICTED: transcription factor DIVARICATA-like isoform X1 [Phoenix 
dactylifera]
Length=303

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 83/143 (58%), Gaps = 17/143 (12%)
 Frame = +2

Query  62   LKIAEQMMMYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD--DRWQKIAS  235
            +++  Q   Y  N  W++G      + +  WT+ E+K+FE +L  F DGD  DRW+ +A+
Sbjct  7    MEVLAQTTPYFPNSSWLLGP-----KRSGNWTQEENKLFEDALAHF-DGDTPDRWEMVAA  60

Query  236  RIPGKSALDVIAHFEALVHDVGEIDSGRVELPSYPDDSFGWD-----QGEPSQIS-FGNS  397
             IPGKS  D+I+H++ L  DV  I++G +  P Y   SF  D     + E S+ S F  +
Sbjct  61   MIPGKSVQDIISHYKDLEEDVSHIEAGLIPFPGYSSSSFTLDWENSHRYEGSKPSYFVGA  120

Query  398  KKQG---EAERKKGTPWTEEEHR  457
            K+ G   + ERKKG PWTEEEH+
Sbjct  121  KRLGGRPDQERKKGVPWTEEEHK  143



>ref|XP_009418650.1| PREDICTED: transcription factor DIVARICATA-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=180

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 68/110 (62%), Gaps = 4/110 (4%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
              + WTR ++K FE +L   P D  DRW+KIA+ +PGKS  D+  H+E LV D+ +I+SG
Sbjct  8    CCSVWTREQEKAFENALATHPEDCGDRWEKIAAGVPGKSIEDIRHHYELLVEDIDDIESG  67

Query  317  RVELPSY-PDDSFGWDQGEPSQ--ISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV +PSY P +  G  +G  S    S G    + + ER+KG  WTE+EHR
Sbjct  68   RVPVPSYLPVEGGGAKKGGNSHGDPSHGGRTSRSDQERRKGIAWTEDEHR  117



>ref|XP_010552868.1| PREDICTED: transcription factor DIVARICATA-like [Tarenaya hassleriana]
 ref|XP_010552869.1| PREDICTED: transcription factor DIVARICATA-like [Tarenaya hassleriana]
 ref|XP_010552870.1| PREDICTED: transcription factor DIVARICATA-like [Tarenaya hassleriana]
Length=259

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 66/114 (58%), Gaps = 6/114 (5%)
 Frame = +2

Query  134  MQSAATWTRYEDKVFEQSL-VLFPDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEID  310
            M    TWT+ E+K FE++L V   D  DRW KIAS IPGK+  DV+  +  L  DV +I+
Sbjct  2    MNRDTTWTKEENKKFERALAVHVEDTPDRWFKIASVIPGKTVSDVMNQYIRLEEDVSDIE  61

Query  311  SGRVELPSYPDDSFGWDQGEP-----SQISFGNSKKQGEAERKKGTPWTEEEHR  457
            SGR+ +P YP  S  +DQ        S     N  +  E ERKKG PWTEEEHR
Sbjct  62   SGRIPIPGYPLSSCRFDQAVSYRDLESYRKRANGSRGTEQERKKGVPWTEEEHR  115



>ref|XP_009418647.1| PREDICTED: transcription factor DIVARICATA-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418648.1| PREDICTED: transcription factor DIVARICATA-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418649.1| PREDICTED: transcription factor DIVARICATA-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=209

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 68/110 (62%), Gaps = 4/110 (4%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
              + WTR ++K FE +L   P D  DRW+KIA+ +PGKS  D+  H+E LV D+ +I+SG
Sbjct  8    CCSVWTREQEKAFENALATHPEDCGDRWEKIAAGVPGKSIEDIRHHYELLVEDIDDIESG  67

Query  317  RVELPSY-PDDSFGWDQGEPSQ--ISFGNSKKQGEAERKKGTPWTEEEHR  457
            RV +PSY P +  G  +G  S    S G    + + ER+KG  WTE+EHR
Sbjct  68   RVPVPSYLPVEGGGAKKGGNSHGDPSHGGRTSRSDQERRKGIAWTEDEHR  117



>ref|XP_009122287.1| PREDICTED: transcription factor DIVARICATA-like [Brassica rapa]
Length=255

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 72/112 (64%), Gaps = 7/112 (6%)
 Frame = +2

Query  134  MQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEID  310
            M S++ WT+ E+K+FE++L ++  D  DRW  IAS IPGK+  DV+  +  L  DV +I+
Sbjct  23   MSSSSVWTKEENKMFERALAIYAEDSPDRWFSIASMIPGKTVFDVMKQYSKLEEDVSDIE  82

Query  311  SGRVELPSYPDDS--FGWDQGEP-SQISFGNSKKQGEAERKKGTPWTEEEHR  457
            +GR+ +P YP  S   G+DQ     + S+G   +  + +RKKG PWTEEEHR
Sbjct  83   AGRIPIPGYPSASSPLGFDQDTCRKRPSWG---RGSDHDRKKGVPWTEEEHR  131



>ref|XP_006437648.1| hypothetical protein CICLE_v10032259mg [Citrus clementina]
 ref|XP_006437649.1| hypothetical protein CICLE_v10032259mg [Citrus clementina]
 ref|XP_006484484.1| PREDICTED: transcription factor DIVARICATA-like [Citrus sinensis]
 gb|ESR50888.1| hypothetical protein CICLE_v10032259mg [Citrus clementina]
 gb|ESR50889.1| hypothetical protein CICLE_v10032259mg [Citrus clementina]
Length=297

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 74/129 (57%), Gaps = 17/129 (13%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V  + S++ WT+ +DK FE +LV +P D  DRW+KIA+ +PGKS  ++  H+E LV DV
Sbjct  2    TVDEVGSSSVWTKEQDKAFENALVSYPEDASDRWEKIAADVPGKSLEEIKQHYELLVDDV  61

Query  299  GEIDSGRVELPSYPDDSFG-----WDQGEP-----------SQISFGNSKKQGEAERKKG  430
              I+SG V LPSY   S G      D+G             +  S GN   + + ER+KG
Sbjct  62   NRIESGCVPLPSYNSSSDGSMSHAGDEGTSNGKKGGHYGHFNSESNGNKSSRSDQERRKG  121

Query  431  TPWTEEEHR  457
              WTE+EHR
Sbjct  122  IAWTEDEHR  130



>ref|XP_010907625.1| PREDICTED: transcription factor DIVARICATA-like [Elaeis guineensis]
Length=298

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 73/133 (55%), Gaps = 15/133 (11%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDV  265
            Y  N  W++G      + +  WT+ E+K+FE +L  F  D  +RW+ +A+ IPGKS  D+
Sbjct  16   YFPNSSWLLGP-----KRSGNWTQEENKLFEDALAHFDRDTPERWEMVAAMIPGKSVQDI  70

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFGWD-------QGEPSQISFGNSKKQG--EAE  418
            I H++ L  DV +I+SGR+  P Y   SF  D       +G       G  +  G  + E
Sbjct  71   ITHYKDLEDDVSKIESGRIPFPGYSSSSFTLDWENSHGYEGSKPSYCVGAKRSGGRLDQE  130

Query  419  RKKGTPWTEEEHR  457
            RKKG PWTEEEH+
Sbjct  131  RKKGVPWTEEEHK  143



>gb|KDO69927.1| hypothetical protein CISIN_1g022439mg [Citrus sinensis]
Length=297

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 74/129 (57%), Gaps = 17/129 (13%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V  + S++ WT+ +DK FE +LV +P D  DRW+KIA+ +PGKS  ++  H+E LV DV
Sbjct  2    TVDEVGSSSVWTKEQDKAFENALVSYPEDASDRWEKIAADVPGKSLEEIKQHYELLVDDV  61

Query  299  GEIDSGRVELPSYPDDSFG-----WDQGEP-----------SQISFGNSKKQGEAERKKG  430
              I+SG V LPSY   S G      D+G             +  S GN   + + ER+KG
Sbjct  62   NRIESGCVPLPSYNSSSDGSMSHAGDEGTSNGKKGGHYGHFNSESNGNKSSRSDQERRKG  121

Query  431  TPWTEEEHR  457
              WTE+EHR
Sbjct  122  IAWTEDEHR  130



>ref|XP_010486776.1| PREDICTED: transcription factor DIVARICATA-like [Camelina sativa]
Length=267

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 77/127 (61%), Gaps = 6/127 (5%)
 Frame = +2

Query  95   ANHRW----MMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSAL  259
            ++HR+    MM    ++  S++ WT+ E+K+FE++L ++  D  DRW K+AS IPGK+ L
Sbjct  13   SDHRFVVQEMMSLHSSSSSSSSNWTKEENKMFERALAIYAEDSPDRWFKVASMIPGKTVL  72

Query  260  DVIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQI-SFGNSKKQGEAERKKGTP  436
            DV+  +  L  DV +I++GRV +P YP  S      +P       N  +  + +RKKG P
Sbjct  73   DVMNQYSKLEEDVSDIEAGRVPIPGYPAASSSPLAFDPDTCRKRPNGARGSDHDRKKGVP  132

Query  437  WTEEEHR  457
            WTEEEHR
Sbjct  133  WTEEEHR  139



>ref|XP_010543616.1| PREDICTED: transcription factor DIVARICATA-like isoform X2 [Tarenaya 
hassleriana]
Length=245

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 10/113 (9%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            A  WTR EDK+FE++LV F +   DRWQ+I S I  +S  +V  H+ ALVHDV EIDSGR
Sbjct  3    ANYWTRTEDKMFEEALVTFSELMPDRWQRI-SEILRRSQSEVYDHYYALVHDVSEIDSGR  61

Query  320  VELPSYPDDSFGWDQGEPSQISFGNS-------KKQGEAERKKGTPWTEEEHR  457
            V +P+Y D S       P+ ++   +       K+ G  ++KKGTPWTE EHR
Sbjct  62   VNVPAYADHSPA-SCDSPATVAATRTTPKSLRVKRDGTEKKKKGTPWTENEHR  113



>ref|XP_009418273.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
Length=288

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 68/118 (58%), Gaps = 12/118 (10%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
              ++WTR ++K FE +L   P D  DRW+KIA+ +PGK+  +V  H+E LV D+  I+SG
Sbjct  6    CGSSWTREQEKAFENALATHPEDCSDRWEKIAADVPGKTIEEVKDHYELLVEDINGIESG  65

Query  317  RVELPSYPDDSFGWDQ------GEPSQISFGNSKKQGEA-----ERKKGTPWTEEEHR  457
            R+ LP YP  S G D       G+      G+    G+A     ER+KG  WTE+EHR
Sbjct  66   RIPLPCYPSSSEGGDHANDGGSGKKGGNPHGDPGHTGKASRSDQERRKGIAWTEDEHR  123



>ref|XP_006435669.1| hypothetical protein CICLE_v10032309mg [Citrus clementina]
 ref|XP_006486372.1| PREDICTED: transcription factor DIVARICATA-like [Citrus sinensis]
 gb|ESR48909.1| hypothetical protein CICLE_v10032309mg [Citrus clementina]
Length=286

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = +2

Query  92   SANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVI  268
            S +  W + DS      + +WTR E+K FE +L ++ +   DRW K+A+ IPGK+ LDVI
Sbjct  11   SNSSNWFLQDS----SRSTSWTREENKRFESALAIYSESTPDRWIKVAAMIPGKTVLDVI  66

Query  269  AHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKGTP  436
              ++ L  DV +I++GRV +P Y   SF  +    S       +    K  + ERKKG P
Sbjct  67   KQYKELEEDVSDIEAGRVPIPGYLSSSFTLELVSESDYDANRKRTLVAKSSDHERKKGVP  126

Query  437  WTEEEHR  457
            WTEEEH+
Sbjct  127  WTEEEHK  133



>ref|XP_010923123.1| PREDICTED: transcription factor DIVARICATA-like [Elaeis guineensis]
Length=301

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 77/142 (54%), Gaps = 15/142 (11%)
 Frame = +2

Query  62   LKIAEQMMMYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASR  238
            +++      Y  N  W+ G      + +  WT+ E+K FE +L  F  D  DRW+++A+ 
Sbjct  7    MQVLTPRAPYFPNSSWLPGP-----KRSGNWTQEENKRFEDALAQFDRDTPDRWERVAAV  61

Query  239  IPGKSALDVIAHFEALVHDVGEIDSGRVELPSYPDDSF--------GWDQGEPSQISFGN  394
            IPGKS  D+I H+  L  DV +I++GR+  P Y   SF        G++  +PS    G 
Sbjct  62   IPGKSVRDIITHYRDLEDDVNDIEAGRIPCPGYTSSSFTLDWENSHGYEGFKPSYCIAGK  121

Query  395  -SKKQGEAERKKGTPWTEEEHR  457
             S  + + ERKKG PWTEEEH+
Sbjct  122  RSGGRPDQERKKGVPWTEEEHK  143



>ref|XP_006298342.1| hypothetical protein CARUB_v10014411mg [Capsella rubella]
 gb|EOA31240.1| hypothetical protein CARUB_v10014411mg [Capsella rubella]
Length=264

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 78/124 (63%), Gaps = 3/124 (2%)
 Frame = +2

Query  95   ANHRWMMGD--SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDV  265
            ++HR++  +  S+ +  S+++WT+ E+K+FE++L ++  D  DRW K+AS IPGK+ LDV
Sbjct  13   SDHRFVFQEMMSLQSSSSSSSWTKEENKMFERALAIYAEDSPDRWFKVASMIPGKTVLDV  72

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTE  445
            +  +  L  DV +I++GRV +P YP  S        +     N  +  + +RKKG PWTE
Sbjct  73   MNQYSKLEEDVSDIEAGRVPIPGYPAASSPSAFDPETCRKRPNGARGSDHDRKKGVPWTE  132

Query  446  EEHR  457
            EEHR
Sbjct  133  EEHR  136



>ref|XP_002884839.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61098.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=264

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 79/124 (64%), Gaps = 3/124 (2%)
 Frame = +2

Query  95   ANHRWMMGDSVT--AMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDV  265
            ++HR+++ + V+  +  S+++WT+ E+K+FE++L ++  D  DRW K+AS IPGK+ LDV
Sbjct  13   SDHRFVVQEMVSLHSSSSSSSWTKEENKMFERALAIYAEDSPDRWFKVASMIPGKTVLDV  72

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTE  445
            +  +  L  DV +I++GRV +P YP  S        +     N  +  + +RKKG PWTE
Sbjct  73   MKQYSKLEEDVFDIEAGRVPIPGYPAASSPLAFDPDTCRKRPNGARGSDQDRKKGVPWTE  132

Query  446  EEHR  457
            EEHR
Sbjct  133  EEHR  136



>ref|XP_008445896.1| PREDICTED: transcription factor DIVARICATA [Cucumis melo]
 ref|XP_008445897.1| PREDICTED: transcription factor DIVARICATA [Cucumis melo]
 ref|XP_008445898.1| PREDICTED: transcription factor DIVARICATA [Cucumis melo]
Length=287

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 74/132 (56%), Gaps = 24/132 (18%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V   + ++ W+R +DK FE +L  +P D  DRW+KIA  +PGK+  ++  H+E LV DV
Sbjct  2    TVDEERKSSIWSREQDKAFENALATYPEDASDRWEKIAVDVPGKTLKEIKDHYELLVDDV  61

Query  299  GEIDSGRVELPSYPDDSFGWDQGEPSQIS-------------------FGNSKKQGEAER  421
             +I+SG V LPSY   SF  D G PS  S                   FG+   + + ER
Sbjct  62   NQIESGFVPLPSY---SFSSD-GSPSHASEEGSGKKGDYHGLDNSESRFGSKAPRSDQER  117

Query  422  KKGTPWTEEEHR  457
            +KGT WTE+EHR
Sbjct  118  RKGTAWTEDEHR  129



>ref|XP_009380613.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380614.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380615.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
Length=296

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 70/125 (56%), Gaps = 19/125 (15%)
 Frame = +2

Query  137  QSAATWTRYEDKVFEQSLVLFPDGD--DRWQKIASRIPGKSALDVIAHFEALVHDVGEID  310
            ++   WT+ E+K FE +L  F DGD  DRW+K+A+ IPGK+  DV++H+  LV DV EI+
Sbjct  22   ENGGRWTQEENKRFEDALAKF-DGDTPDRWEKVAALIPGKTVPDVLSHYRELVDDVSEIE  80

Query  311  SGRVELPSY------------PDDSFGWDQGEPSQISFGNSKKQG----EAERKKGTPWT  442
            +GRV  P Y              DS GW     +    G  K+ G      ERKKG PWT
Sbjct  81   AGRVPCPVYYGTSSFTLDWENSYDSEGWKNTYCAGGGGGGGKRSGARASHHERKKGIPWT  140

Query  443  EEEHR  457
            EEEHR
Sbjct  141  EEEHR  145



>ref|XP_011039696.1| PREDICTED: transcription factor DIVARICATA-like [Populus euphratica]
Length=292

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 77/129 (60%), Gaps = 9/129 (7%)
 Frame = +2

Query  86   MYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALD  262
            +YS+   W M + +   Q+   WT+ E+K+FE++L +F + + DRW K+A+ IPGK+  D
Sbjct  4    LYSS---WCMSNPICVAQTTE-WTKEENKMFERALAIFDEHEPDRWLKVAAMIPGKTVND  59

Query  263  VIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKG  430
            VI  ++ L  DV +I++GRV +P Y   SF  +  + S       +    K  + +RKKG
Sbjct  60   VIKQYKKLEEDVCDIEAGRVPVPGYLSSSFTPELVDNSTFDAYRKRPLNIKSADQQRKKG  119

Query  431  TPWTEEEHR  457
             PWTEEEHR
Sbjct  120  VPWTEEEHR  128



>ref|XP_002311203.2| hypothetical protein POPTR_0008s06450g [Populus trichocarpa]
 gb|EEE88570.2| hypothetical protein POPTR_0008s06450g [Populus trichocarpa]
Length=292

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 77/129 (60%), Gaps = 9/129 (7%)
 Frame = +2

Query  86   MYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALD  262
            +YS+   W M + +   Q+   WT+ E+K+FE++L +F + + DRW K+A+ IPGK+  D
Sbjct  4    LYSS---WSMSNPICVAQTTE-WTKEENKMFERALAIFDEHEPDRWLKVAAMIPGKTVND  59

Query  263  VIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKG  430
            VI  ++ L  DV +I++GRV +P Y   SF  +  + S       +    K  + +RKKG
Sbjct  60   VIKQYKKLEEDVCDIEAGRVPVPGYLSSSFTSELVDNSTFDAYRKRPLNIKSADQQRKKG  119

Query  431  TPWTEEEHR  457
             PWTEEEHR
Sbjct  120  VPWTEEEHR  128



>emb|CDY36326.1| BnaA01g30920D [Brassica napus]
Length=259

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 71/112 (63%), Gaps = 7/112 (6%)
 Frame = +2

Query  134  MQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEID  310
            + S + WT+ E+K+FE++L ++  D  DRW  IAS IPGK+  DV+  +  L  DV +I+
Sbjct  23   ISSRSVWTKEENKMFERALAIYAEDSPDRWFSIASMIPGKTVFDVMKQYSKLEEDVSDIE  82

Query  311  SGRVELPSYPDDS--FGWDQGEP-SQISFGNSKKQGEAERKKGTPWTEEEHR  457
            +GRV +P YP  S   G+DQ     + S+G   +  + +RKKG PWTEEEHR
Sbjct  83   AGRVPIPGYPSASSPLGFDQDTCRKRPSWG---RGSDHDRKKGVPWTEEEHR  131



>ref|XP_004147105.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus]
 ref|XP_004166357.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus]
 gb|KGN51566.1| hypothetical protein Csa_5G579040 [Cucumis sativus]
Length=286

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 71/125 (57%), Gaps = 24/125 (19%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            ++ W+R +DK FE +L  +P D  DRW+KIA  +PGK+  +V  H+E LV DV +I+SG 
Sbjct  9    SSIWSREQDKAFENALATYPEDASDRWEKIAVDVPGKTLEEVKDHYELLVDDVNQIESGF  68

Query  320  VELPSYPDDSFGWDQGEPSQIS-------------------FGNSKKQGEAERKKGTPWT  442
            + LPSY   SF  D G PS  S                   FG+   + + ER+KGT WT
Sbjct  69   IPLPSY---SFSSD-GSPSHASEEGSGNKGDYHGLDNSESRFGSKAPRSDQERRKGTAWT  124

Query  443  EEEHR  457
            E+EHR
Sbjct  125  EDEHR  129



>ref|XP_007205616.1| hypothetical protein PRUPE_ppa009103mg [Prunus persica]
 gb|EMJ06815.1| hypothetical protein PRUPE_ppa009103mg [Prunus persica]
Length=306

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 74/135 (55%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S     +   WT  E+K FE +L L+  D  DRW K+A+RIPGK+  DV
Sbjct  13   YLENSNWLFQES-----NGTEWTAEENKQFENALALYDKDTPDRWFKVAARIPGKTVGDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--W--DQGEPSQISF-------GNSKKQGE  412
            I  ++ L  DV +I++G + +P Y  +SF   W  +QG      F       G S +  +
Sbjct  68   IKQYKELEEDVSDIEAGLIPIPGYTSNSFTLEWVNNQGFDGLKQFYGVGGKRGTSTRPAD  127

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEHR
Sbjct  128  QERKKGVPWTEEEHR  142



>ref|XP_008239581.1| PREDICTED: transcription factor DIVARICATA [Prunus mume]
Length=307

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 74/135 (55%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S     +   WT  E+K FE +L L+  D  DRW K+A+RIPGK+  DV
Sbjct  13   YLENSNWLFQES-----NGTEWTAEENKQFENALALYDKDTPDRWFKVAARIPGKTVGDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--W--DQGEPSQISF-------GNSKKQGE  412
            I  ++ L  DV +I++G + +P Y  +SF   W  +QG      F       G S +  +
Sbjct  68   IKQYKELEEDVSDIEAGLIPIPGYTSNSFTLEWVNNQGFDGLKQFYGVGGKRGTSTRPAD  127

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEHR
Sbjct  128  QERKKGVPWTEEEHR  142



>emb|CDP09156.1| unnamed protein product [Coffea canephora]
Length=286

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y +N  W++ +S      +  WT  E+K FE +L +F  D  DRWQK+A+ +PGK+ +DV
Sbjct  9    YLSNSGWLVEES-----KSTKWTPAENKAFENALAVFDKDTPDRWQKVAAVVPGKTVMDV  63

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--WDQG------EPSQISFG---NSKKQGE  412
            I  ++ LV DV  I++G + +P Y    F   W  G      + S I+ G   ++ +  E
Sbjct  64   IRQYKELVEDVSNIEAGLIPIPGYGTSPFTLEWGSGHNFDGYKQSFIATGKRSSATRPSE  123

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEH+
Sbjct  124  QERKKGVPWTEEEHK  138



>gb|KHN17851.1| Transcription factor MYB1R1 [Glycine soja]
Length=299

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 63/107 (59%), Gaps = 5/107 (5%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTR E+K FE +L ++  D  DRW ++A+ +PGK+  DVI  +  L  DV EI++GR+ +
Sbjct  27   WTREENKKFESALAIYDKDTPDRWLRVAAMLPGKTVYDVIKQYRELEEDVCEIEAGRIPV  86

Query  329  PSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKGTPWTEEEHR  457
            P YP  SF  +  +         K    +  + ERKKG PWTEEEHR
Sbjct  87   PGYPTSSFTLEMVDNQCYDACRKKPATLRSSDQERKKGVPWTEEEHR  133



>gb|KEH34188.1| MYB transcription factor MYB51 [Medicago truncatula]
Length=322

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 72/130 (55%), Gaps = 11/130 (8%)
 Frame = +2

Query  101  HRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHF  277
            + W + D   ++  +  WT  E+K+FE +L ++  D  DRW K+A+ IPGKS +DV+  +
Sbjct  26   NNWFLEDCSNSINRSTKWTPAENKLFENALAVYDKDTPDRWHKVAAMIPGKSVVDVMNQY  85

Query  278  EALVHDVGEIDSGRVELPSYPD----------DSFGWDQGEPSQISFGNSKKQGEAERKK  427
            + L  DV  I++G V +P Y            +S G+D         G+S +  + ERKK
Sbjct  86   KELEADVCNIEAGLVPIPGYSTTASPFTLDWVNSSGYDGFRGISGKRGSSGRSPDQERKK  145

Query  428  GTPWTEEEHR  457
            G PWTEEEH+
Sbjct  146  GVPWTEEEHK  155



>emb|CDY36310.1| BnaA01g31080D [Brassica napus]
Length=255

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 71/112 (63%), Gaps = 7/112 (6%)
 Frame = +2

Query  134  MQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEID  310
            + S + WT+ E+K+FE++L ++  D  DRW  IAS IPGK+  DV+  +  L  DV +I+
Sbjct  23   ISSCSVWTKEENKMFERALAIYAEDLPDRWFSIASMIPGKTVFDVMKQYSKLEEDVSDIE  82

Query  311  SGRVELPSYPDDS--FGWDQGEP-SQISFGNSKKQGEAERKKGTPWTEEEHR  457
            +GR+ +P YP  S   G+DQ     + S+G   +  + +RKKG PWTEEEHR
Sbjct  83   AGRIPIPGYPSASSPLGFDQDTCRKRPSWG---RGSDHDRKKGVPWTEEEHR  131



>ref|XP_009776702.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana sylvestris]
Length=247

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 73/125 (58%), Gaps = 7/125 (6%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDV  265
            +  N  WMM  S      +  WT+ E+K FE +L ++ +   +RW  +A+ IPGKSALDV
Sbjct  9    FMPNSNWMMQQS-----KSTEWTKEENKKFESALAIYDEKTPNRWSMVAAMIPGKSALDV  63

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQI-SFGNSKKQGEAERKKGTPWT  442
            +  ++ LV DV +I++G V  P +   SF  +  +  +I +F    K  + ERKKG PWT
Sbjct  64   MMQYKELVADVSDIEAGLVPTPRHFASSFTLEFVDHREIHTFRKRGKSCDQERKKGVPWT  123

Query  443  EEEHR  457
            EEEHR
Sbjct  124  EEEHR  128



>ref|XP_003552519.1| PREDICTED: transcription factor DIVARICATA-like isoform X1 [Glycine 
max]
 ref|XP_006601963.1| PREDICTED: transcription factor DIVARICATA-like isoform X2 [Glycine 
max]
 ref|XP_006601964.1| PREDICTED: transcription factor DIVARICATA-like isoform X3 [Glycine 
max]
 ref|XP_006601965.1| PREDICTED: transcription factor DIVARICATA-like isoform X4 [Glycine 
max]
 ref|XP_006601966.1| PREDICTED: transcription factor DIVARICATA-like isoform X5 [Glycine 
max]
Length=299

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTR E+K FE +L ++  D  DRW ++A+ +PGK+  DVI  +  L  DV EI++GR+ +
Sbjct  27   WTREENKKFESALAIYDKDTPDRWLRVAAMLPGKTVYDVIKQYRELEEDVCEIEAGRIPV  86

Query  329  PSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKGTPWTEEEHR  457
            P YP  SF     +         K    +  + ERKKG PWTEEEHR
Sbjct  87   PGYPTSSFTLKMVDNQCYDACRKKPATLRSSDQERKKGVPWTEEEHR  133



>gb|KHG20644.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=308

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 64/114 (56%), Gaps = 12/114 (11%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT  E+K FE +L L+  D  DRW K+AS IPGK+  DVI  +  L  DV +I++G + +
Sbjct  29   WTPEENKCFENALALYDKDTPDRWIKVASMIPGKTVGDVIKQYRELEEDVSDIEAGLIPI  88

Query  329  PSYPDDSFGWDQGEPSQ--ISF---------GNSKKQGEAERKKGTPWTEEEHR  457
            P Y  DSF  + G  SQ    F         G   +  + ERKKG PWTEEEHR
Sbjct  89   PGYSSDSFTLEWGNDSQGFAGFRHYYTPGKRGTGSRSSDQERKKGVPWTEEEHR  142



>ref|XP_010464831.1| PREDICTED: transcription factor DIVARICATA [Camelina sativa]
Length=266

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 65/105 (62%), Gaps = 2/105 (2%)
 Frame = +2

Query  149  TWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVE  325
             WT+ E+K+FE++L ++  D  DRW K+AS IPGK+ LDV+  +  L  DV +I++GRV 
Sbjct  34   NWTKEENKMFERALAIYAEDSPDRWFKVASMIPGKTVLDVMNQYSKLEEDVSDIEAGRVP  93

Query  326  LPSYPDDSFGWDQGEPSQI-SFGNSKKQGEAERKKGTPWTEEEHR  457
            +P YP  S      +P       N  +  + +R+KG PWTEEEHR
Sbjct  94   IPGYPAASSSPLAFDPDTCRKRPNGARGSDHDRRKGVPWTEEEHR  138



>ref|XP_002866297.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42556.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=286

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 78/147 (53%), Gaps = 15/147 (10%)
 Frame = +2

Query  62   LKIAEQMMMYSANHRWMMGDS---VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKI  229
            +++      + +   W+M ++   V A    ATWT  E+K FE +L ++ D   DRWQK+
Sbjct  1    MEVLRPTTSHVSGGNWLMDETKSAVAASGEGATWTAAENKAFENALAVYDDNTPDRWQKV  60

Query  230  ASRIPGKSALDVIAHFEALVHDVGEIDSGRVELPSY---PDDSFGWDQGEPSQISFGN--  394
            A+ IPGK+  DVI  +  L  DV  I++G + +P Y   P  +  W  G  +  + G+  
Sbjct  61   AAVIPGKTVSDVIRQYNDLEADVSSIEAGLIPVPGYITSPPFTLDWAGGGCNGFNPGHQV  120

Query  395  ------SKKQGEAERKKGTPWTEEEHR  457
                  + +  E ERKKG PWTEEEH+
Sbjct  121  CNKRSPAGRSPELERKKGVPWTEEEHK  147



>gb|AFK48294.1| unknown [Medicago truncatula]
Length=232

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 7/108 (6%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            W+R ++K FE +L ++  D  DRW K+A  IPGK+  DVI  +  LV DV EI++G V +
Sbjct  36   WSREDNKKFESALAIYDKDTPDRWLKVAEMIPGKTVFDVIKQYRELVEDVSEIEAGNVPI  95

Query  329  PSYPDDSFGWDQGEPSQISFGNSKKQ-----GEAERKKGTPWTEEEHR  457
            P Y   SF ++  E      GN ++       + ERKKG PWTEEEHR
Sbjct  96   PGYLASSFTFEVVEKQNYD-GNRRRHVTVRGSDHERKKGVPWTEEEHR  142



>gb|ACJ84646.1| unknown [Medicago truncatula]
Length=232

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 7/108 (6%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            W+R ++K FE +L ++  D  DRW K+A  IPGK+  DVI  +  LV DV EI++G V +
Sbjct  36   WSREDNKKFESALAIYDKDTPDRWLKVAEMIPGKTVFDVIKQYRELVEDVSEIEAGNVPI  95

Query  329  PSYPDDSFGWDQGEPSQISFGNSKKQ-----GEAERKKGTPWTEEEHR  457
            P Y   SF ++  E      GN ++       + ERKKG PWTEEEHR
Sbjct  96   PGYLASSFTFEVVEKQNYD-GNRRRHVTVRGSDHERKKGVPWTEEEHR  142



>emb|CDP06510.1| unnamed protein product [Coffea canephora]
Length=296

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 70/135 (52%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S       A WT  E+K FE +L LF  D  DRW  +A+ IPGK+  DV
Sbjct  9    YLGNSSWLFEES-----KGAKWTPEENKRFENALALFDKDTPDRWFNVATMIPGKTVSDV  63

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSF-----------GWDQGEPSQISFGNSKKQGE  412
            I  +  LV DVG+I++G + +P Y  DSF           G  Q         +S +  +
Sbjct  64   IKQYRELVDDVGDIEAGLIPIPGYTGDSFTLEWVNDHDYDGLKQFYGPGGKRNSSNRSSD  123

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEHR
Sbjct  124  HERKKGVPWTEEEHR  138



>ref|XP_010535415.1| PREDICTED: transcription factor DIVARICATA isoform X2 [Tarenaya 
hassleriana]
Length=173

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 69/120 (58%), Gaps = 7/120 (6%)
 Frame = +2

Query  119  DSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHD  295
            ++V    +AATWT  E+K FE +L ++ D   DRWQK+A+ IPGK+  DVI  +  L  D
Sbjct  20   ETVKNSSTAATWTAAENKAFEDALAVYDDDTPDRWQKVAAMIPGKTVGDVIKQYTELEAD  79

Query  296  VGEIDSGRVELPSYPDDSF------GWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            V  I++G V +P Y    F      G++  +P       + +  E ERKKG PWTEEEH+
Sbjct  80   VINIEAGLVPVPGYITSPFTLDWAGGYNGLKPVGSKRSPAARPPEHERKKGVPWTEEEHK  139



>gb|KDP24483.1| hypothetical protein JCGZ_25047 [Jatropha curcas]
Length=301

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 71/139 (51%), Gaps = 22/139 (16%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S      A  WT  E+K FE +L L+  D  DRW K+AS IPGK+  D+
Sbjct  13   YFQNSNWLFPES-----RATKWTPEENKRFENALALYDRDDPDRWHKVASVIPGKTVGDI  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--WDQGEPSQISFGNSK-------------  400
            I H+  L  DV +I++G + +P Y  DSF   W        SFG  K             
Sbjct  68   IKHYRELEEDVSDIEAGLIPIPGYSSDSFTLEWVNNHIDH-SFGEFKHFYTPGGKRTTAT  126

Query  401  KQGEAERKKGTPWTEEEHR  457
            +  E ERKKG PWTEEEHR
Sbjct  127  RPCEQERKKGVPWTEEEHR  145



>emb|CDY14490.1| BnaC03g21050D [Brassica napus]
Length=297

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 17/119 (14%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT  E+K FE +L  +  D  DRW K+A+ +PGK+  DVI  +  L  D+ +I++GR+ +
Sbjct  29   WTHEENKKFENALAFYDKDTPDRWNKVAAMLPGKTVGDVIKQYRELEEDLSDIEAGRIPI  88

Query  329  PSYPDDSF-----GWDQGE-----------PSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            P Y  DSF     G+D G             S    G++ +  E ERKKG PWTEEEHR
Sbjct  89   PGYASDSFTLDWGGYDAGNNGFNMNGYYFPASGGKRGSAARAAEHERKKGVPWTEEEHR  147



>gb|KJB76909.1| hypothetical protein B456_012G112000 [Gossypium raimondii]
Length=308

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 63/114 (55%), Gaps = 12/114 (11%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT  E+K FE +L L+  D  DRW K+AS IPGK+  DVI  +  L  DV +I++G + +
Sbjct  29   WTPEENKCFENALALYDKDTPDRWIKVASMIPGKTVGDVIKQYRELEEDVSDIEAGLIPI  88

Query  329  PSYPDDSFGWDQGEPSQIS-----------FGNSKKQGEAERKKGTPWTEEEHR  457
            P Y  DSF  + G  SQ              G   +  + ERKKG PWTEEEHR
Sbjct  89   PGYSRDSFTLEWGNDSQGCDGFRHYYTPGKRGTGSRSSDQERKKGVPWTEEEHR  142



>ref|XP_008785421.1| PREDICTED: transcription factor DIVARICATA isoform X2 [Phoenix 
dactylifera]
Length=266

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 75/133 (56%), Gaps = 15/133 (11%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDV  265
            Y  N  W+ G      + +  WT+ E+K FE +L  F  D  DRW+++A+ IPGKS  D+
Sbjct  16   YFPNSSWLPGP-----KRSGAWTQEENKRFEDALARFDRDTPDRWERVAAMIPGKSVRDI  70

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSF--------GWDQGEPSQISFGN-SKKQGEAE  418
            I+H++ L  DV  I++G +  P Y   SF        G+++ +PS    G  S  + + E
Sbjct  71   ISHYKDLEDDVSHIEAGLIPFPGYSSSSFTLDWENSHGYERLKPSYCVGGKRSGGRPDQE  130

Query  419  RKKGTPWTEEEHR  457
            RKKG PWTEEEH+
Sbjct  131  RKKGVPWTEEEHK  143



>ref|XP_008785419.1| PREDICTED: transcription factor DIVARICATA isoform X1 [Phoenix 
dactylifera]
 ref|XP_008785420.1| PREDICTED: transcription factor DIVARICATA isoform X1 [Phoenix 
dactylifera]
Length=301

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 75/133 (56%), Gaps = 15/133 (11%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDV  265
            Y  N  W+ G      + +  WT+ E+K FE +L  F  D  DRW+++A+ IPGKS  D+
Sbjct  16   YFPNSSWLPGP-----KRSGAWTQEENKRFEDALARFDRDTPDRWERVAAMIPGKSVRDI  70

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSF--------GWDQGEPSQISFGN-SKKQGEAE  418
            I+H++ L  DV  I++G +  P Y   SF        G+++ +PS    G  S  + + E
Sbjct  71   ISHYKDLEDDVSHIEAGLIPFPGYSSSSFTLDWENSHGYERLKPSYCVGGKRSGGRPDQE  130

Query  419  RKKGTPWTEEEHR  457
            RKKG PWTEEEH+
Sbjct  131  RKKGVPWTEEEHK  143



>gb|ACR19085.1| DIV2B protein, partial [Diervilla sessilifolia]
Length=165

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 66/106 (62%), Gaps = 5/106 (5%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT+ E+K FE +L +F  +  DRW K+A+ IPGKS LDVI  ++ LV DV +I++G + +
Sbjct  1    WTKEENKRFESALAIFDKETPDRWTKVAAMIPGKSVLDVIEQYKELVADVSDIEAGLIPI  60

Query  329  PSYPDDSFGWDQGEPSQIS----FGNSKKQGEAERKKGTPWTEEEH  454
            P Y   SF  +  E  + S     G+  +  + ERKKG PWTE+EH
Sbjct  61   PGYLTSSFTLELVENRRFSDFRKRGSLGRSSDQERKKGVPWTEDEH  106



>emb|CDY18405.1| BnaA04g21820D [Brassica napus]
Length=294

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 66/115 (57%), Gaps = 13/115 (11%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT  E+K FE +L  +  D  DRW K+A+ +PGK+  DVI  +  L  DV +I++G + +
Sbjct  30   WTAEENKKFENALAFYDKDTPDRWFKVAAMLPGKTVGDVIKQYRELEEDVSDIEAGLIPI  89

Query  329  PSYPDDSF-----GWDQGEPSQISF-------GNSKKQGEAERKKGTPWTEEEHR  457
            P Y  DSF     G+D G  +   F       G++ +  E ERKKG PWTEEEHR
Sbjct  90   PGYASDSFTLDWGGYDAGNMNGYYFAAVGGKRGSAARAAEHERKKGVPWTEEEHR  144



>ref|XP_009141719.1| PREDICTED: transcription factor DIVARICATA-like [Brassica rapa]
 ref|XP_009141720.1| PREDICTED: transcription factor DIVARICATA-like [Brassica rapa]
Length=294

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 66/115 (57%), Gaps = 13/115 (11%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT  E+K FE +L  +  D  DRW K+A+ +PGK+  DVI  +  L  DV +I++G + +
Sbjct  30   WTAEENKKFENALAFYDKDTPDRWFKVAAMLPGKTVGDVIKQYRELEEDVSDIEAGLIPI  89

Query  329  PSYPDDSF-----GWDQGEPSQISF-------GNSKKQGEAERKKGTPWTEEEHR  457
            P Y  DSF     G+D G  +   F       G++ +  E ERKKG PWTEEEHR
Sbjct  90   PGYASDSFTLDWGGYDAGNMNGYYFAAVGGKRGSAARAAEHERKKGVPWTEEEHR  144



>gb|KHN07641.1| Transcription factor MYB1R1 [Glycine soja]
Length=299

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTR E+K FE +L ++  D  DRW ++A+ +PGK+  DVI  +  L  DV EI++GR+ +
Sbjct  27   WTREENKKFESALAIYDKDTPDRWLRVAAMLPGKTVYDVIKQYRELEEDVCEIEAGRIPV  86

Query  329  PSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKGTPWTEEEHR  457
            P YP  SF     +         K    +  + ERKKG PWTEEEHR
Sbjct  87   PGYPISSFTLKMVDNQCYDACRKKPATLRSSDQERKKGVPWTEEEHR  133



>ref|XP_009398308.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398316.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009398324.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
Length=282

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 64/118 (54%), Gaps = 12/118 (10%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
             + +WTR +DK FE +L     D D+RW+KIA  +PGK+  D+  H+E LV DV  I+SG
Sbjct  8    CSPSWTREQDKAFEYALATHHEDCDNRWEKIAVDVPGKTIEDIKHHYELLVEDVNGIESG  67

Query  317  RVELPSYPDDSFGWDQGEPSQI-----------SFGNSKKQGEAERKKGTPWTEEEHR  457
            RV LP YP  S G D                  + G    + + ER+KG  WTE+EHR
Sbjct  68   RVPLPCYPSSSEGGDLANEGGGSKKGGHSHGDSAHGGKASRSDQERRKGIAWTEDEHR  125



>ref|XP_006280910.1| hypothetical protein CARUB_v10026903mg [Capsella rubella]
 gb|EOA13808.1| hypothetical protein CARUB_v10026903mg [Capsella rubella]
Length=288

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 69/134 (51%), Gaps = 16/134 (12%)
 Frame = +2

Query  104  RWMMGDS-----VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDV  265
             W+M ++     VTA     TWT  E+K FE +L ++ D   DRWQK+A+ IPGK+  DV
Sbjct  16   NWLMEETKSNAGVTASGEGCTWTAAENKAFENALAVYDDNTPDRWQKVAAVIPGKTVSDV  75

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISF----------GNSKKQGEA  415
            I  +  L  DV  I++G + +P Y    F  D        F           ++ +  E 
Sbjct  76   IRQYNDLEADVSSIEAGLIPVPGYITSPFTLDWAGGGGGGFKPGHSVCNKRSSAGRSPEL  135

Query  416  ERKKGTPWTEEEHR  457
            ERKKG PWTEEEH+
Sbjct  136  ERKKGVPWTEEEHK  149



>ref|XP_010067021.1| PREDICTED: transcription factor DIVARICATA-like [Eucalyptus grandis]
 ref|XP_010067022.1| PREDICTED: transcription factor DIVARICATA-like [Eucalyptus grandis]
 ref|XP_010067023.1| PREDICTED: transcription factor DIVARICATA-like [Eucalyptus grandis]
 ref|XP_010067024.1| PREDICTED: transcription factor DIVARICATA-like [Eucalyptus grandis]
 ref|XP_010067025.1| PREDICTED: transcription factor DIVARICATA-like [Eucalyptus grandis]
 ref|XP_010067026.1| PREDICTED: transcription factor DIVARICATA-like [Eucalyptus grandis]
 gb|KCW65083.1| hypothetical protein EUGRSUZ_G02591 [Eucalyptus grandis]
 gb|KCW65084.1| hypothetical protein EUGRSUZ_G02591 [Eucalyptus grandis]
 gb|KCW65085.1| hypothetical protein EUGRSUZ_G02591 [Eucalyptus grandis]
 gb|KCW65086.1| hypothetical protein EUGRSUZ_G02591 [Eucalyptus grandis]
Length=295

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 74/128 (58%), Gaps = 16/128 (13%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V    S  +W+R +DK FE +L  +P D  DRW+KIA+ +PGK+  ++  H+E LV DV
Sbjct  2    TVDETTSDCSWSREQDKAFENALATYPEDSADRWEKIAADVPGKTVEEIKRHYEILVDDV  61

Query  299  GEIDSGRVELPSY---PDD--SFGWDQGEPSQIS-----FGNSKKQGEA-----ERKKGT  433
              I+SG VELP Y   P+   S G D+    + S      GN   +G+A     ER+KG 
Sbjct  62   NSIESGCVELPPYSCSPEGSTSHGGDEMNSKKGSHVGNLHGNLNHEGKASRSDQERRKGI  121

Query  434  PWTEEEHR  457
             WTEEEHR
Sbjct  122  AWTEEEHR  129



>ref|NP_187737.1| putative VHA-B1-interacting transcription factor [Arabidopsis 
thaliana]
 ref|NP_850558.1| putative VHA-B1-interacting transcription factor [Arabidopsis 
thaliana]
 gb|AAG50963.1|AC073395_5 MYB-family transcription factor, putative; alternative splicing 
isoform 1 of 2;71559-70643 [Arabidopsis thaliana]
 gb|AAG50964.1|AC073395_6 MYB-family transcription factor, putative; alternative splicing 
isoform 2 of 2;71559-70643 [Arabidopsis thaliana]
 gb|AAL07029.1| putative MYB-family transcription factor [Arabidopsis thaliana]
 gb|AAM14204.1| putative MYB-family transcription factor [Arabidopsis thaliana]
 gb|AAS58519.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE75024.1| VHA-B1-interacting transcription factor, putative [Arabidopsis 
thaliana]
 gb|AEE75025.1| VHA-B1-interacting transcription factor, putative [Arabidopsis 
thaliana]
Length=263

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 79/125 (63%), Gaps = 6/125 (5%)
 Frame = +2

Query  95   ANHRWMMGDSVTAMQSAAT-WTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVI  268
            ++HR+++ + V+   S++  WT+ E+K+FE++L ++  D  DRW K+AS IPGK+  DV+
Sbjct  13   SDHRFVVQEMVSLHSSSSGSWTKEENKMFERALAIYAEDSPDRWFKVASMIPGKTVFDVM  72

Query  269  AHFEALVHDVGEIDSGRVELPSYPDDS--FGWDQGEPSQISFGNSKKQGEAERKKGTPWT  442
              +  L  DV +I++GRV +P YP  S   G+D     +   G   +  + +RKKG PWT
Sbjct  73   KQYSKLEEDVFDIEAGRVPIPGYPAASSPLGFDTDMCRKRPSG--ARGSDQDRKKGVPWT  130

Query  443  EEEHR  457
            EEEHR
Sbjct  131  EEEHR  135



>gb|AAM67284.1| MYB-family transcription factor, putative [Arabidopsis thaliana]
Length=263

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 79/125 (63%), Gaps = 6/125 (5%)
 Frame = +2

Query  95   ANHRWMMGDSVTAMQSAAT-WTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVI  268
            ++HR+++ + V+   S++  WT+ E+K+FE++L ++  D  DRW K+AS IPGK+  DV+
Sbjct  13   SDHRFVVQEMVSFHSSSSGSWTKEENKMFERALAIYAEDSPDRWFKVASMIPGKTVFDVM  72

Query  269  AHFEALVHDVGEIDSGRVELPSYPDDS--FGWDQGEPSQISFGNSKKQGEAERKKGTPWT  442
              +  L  DV +I++GRV +P YP  S   G+D     +   G   +  + +RKKG PWT
Sbjct  73   KQYSKLEEDVFDIEAGRVPIPGYPAASSPLGFDTDMCRKRPSG--ARGSDQDRKKGVPWT  130

Query  443  EEEHR  457
            EEEHR
Sbjct  131  EEEHR  135



>ref|XP_003616568.1| DnaJ homolog subfamily C member [Medicago truncatula]
 gb|AES99526.1| MYB transcription factor MYB51 [Medicago truncatula]
Length=271

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 7/108 (6%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            W+R ++K FE +L ++  D  DRW K+A  IPGK+  DVI  +  LV DV EI++G V +
Sbjct  27   WSREDNKKFESALAIYDKDTPDRWLKVAEMIPGKTVFDVIKQYRELVEDVSEIEAGNVPI  86

Query  329  PSYPDDSFGWDQGEPSQISFGNSKKQ-----GEAERKKGTPWTEEEHR  457
            P Y   SF ++  E      GN ++       + ERKKG PWTEEEHR
Sbjct  87   PGYLASSFTFEVVEKQNYD-GNRRRHVTVRGSDHERKKGVPWTEEEHR  133



>gb|KDO53234.1| hypothetical protein CISIN_1g021756mg [Citrus sinensis]
Length=308

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 75/136 (55%), Gaps = 18/136 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S         WT  E+K FE +L ++  D  DRW K+A+ IPGK+  DV
Sbjct  13   YLENSNWLFQES-----KGTKWTPQENKQFENALAVYDKDTPDRWIKVAAMIPGKTVGDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--W---DQGEPSQISF-------GNSKKQG  409
            I  ++ L  DV +I++G + +P Y +DSF   W   +QG     +F       G+S +  
Sbjct  68   IKQYKELEEDVSDIEAGLIPIPGYGNDSFTLEWVDSNQGYDGLKNFYGPGGKRGSSTRPS  127

Query  410  EAERKKGTPWTEEEHR  457
            + ERKKG PWTEEEHR
Sbjct  128  DQERKKGVPWTEEEHR  143



>ref|XP_006480971.1| PREDICTED: transcription factor DIVARICATA-like [Citrus sinensis]
Length=308

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 75/136 (55%), Gaps = 18/136 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S         WT  E+K FE +L ++  D  DRW K+A+ IPGK+  DV
Sbjct  13   YLENSNWLFQES-----KGTKWTPQENKQFENALAVYDKDTPDRWIKVAAMIPGKTVGDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--W---DQGEPSQISF-------GNSKKQG  409
            I  ++ L  DV +I++G + +P Y +DSF   W   +QG     +F       G+S +  
Sbjct  68   IKQYKELEEDVSDIEAGLIPIPGYGNDSFTLEWVDSNQGYDGLKNFYGPGGKRGSSTRPS  127

Query  410  EAERKKGTPWTEEEHR  457
            + ERKKG PWTEEEHR
Sbjct  128  DQERKKGVPWTEEEHR  143



>ref|XP_006429310.1| hypothetical protein CICLE_v10012285mg [Citrus clementina]
 gb|ESR42550.1| hypothetical protein CICLE_v10012285mg [Citrus clementina]
Length=308

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 75/136 (55%), Gaps = 18/136 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S         WT  E+K FE +L ++  D  DRW K+A+ IPGK+  DV
Sbjct  13   YLENSNWLFQES-----KGTKWTPQENKQFENALAVYDKDTPDRWIKVAAMIPGKTVGDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--W---DQGEPSQISF-------GNSKKQG  409
            I  ++ L  DV +I++G + +P Y +DSF   W   +QG     +F       G+S +  
Sbjct  68   IKQYKELEEDVSDIEAGLIPIPGYGNDSFTLEWVDSNQGYDGLKNFYGPGGKRGSSTRPS  127

Query  410  EAERKKGTPWTEEEHR  457
            + ERKKG PWTEEEHR
Sbjct  128  DQERKKGVPWTEEEHR  143



>gb|KJB74214.1| hypothetical protein B456_011G279800 [Gossypium raimondii]
Length=276

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 63/107 (59%), Gaps = 5/107 (5%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT+ E+K FE +L ++ D   DRW K+A  IPGK+ LDVI  +  L  DV +I++GR+ +
Sbjct  30   WTKEENKRFEHALAIYGDDVPDRWIKVAEMIPGKTVLDVIKQYRELEEDVSDIEAGRIPI  89

Query  329  PSYPDDSFGWDQGEPSQISF----GNSKKQGEAERKKGTPWTEEEHR  457
            P YP  SF  +  +           N  K  + ERKKG PWTE+EHR
Sbjct  90   PGYPTSSFTLELVDNHDFDGYRKRPNGAKGHDHERKKGVPWTEDEHR  136



>ref|XP_009132024.1| PREDICTED: transcription factor DIVARICATA-like [Brassica rapa]
Length=289

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 71/135 (53%), Gaps = 17/135 (13%)
 Frame = +2

Query  104  RWMMGDS-----VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDV  265
             W+M ++     + A   AATWT  E+K FE +L ++ D   DRWQK+A+ IPGK+  DV
Sbjct  16   NWLMEETESNVPLAASPDAATWTVAENKAFENALAVYDDNTPDRWQKVAAAIPGKTVSDV  75

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSF-----------GWDQGEPSQISFGNSKKQGE  412
            I  +  L  D+  I++G + +P Y    F           G+  G P       + +  E
Sbjct  76   IKQYNDLEADLSSIEAGLIPVPGYITSPFTLDWAGGGGCNGFKPGHPVGNKRSPAGRSPE  135

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEH+
Sbjct  136  LERKKGVPWTEEEHK  150



>gb|ABR16097.1| unknown [Picea sitchensis]
Length=270

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 69/126 (55%), Gaps = 17/126 (13%)
 Frame = +2

Query  131  AMQSAATWTRYEDKVFEQSLVL-FPDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEI  307
            A  S   W+R ++K FE +L     D DDRW+KIAS +PGKS  +V  H+E LV D+  I
Sbjct  3    ANMSNGDWSREQNKAFEMALAKHLEDTDDRWEKIASAVPGKSPAEVKRHYEILVEDIASI  62

Query  308  DSGRVELPSY-------PDDSFGWDQGE--------PSQIS-FGNSKKQGEAERKKGTPW  439
            ++GRV +PSY        DD      G         PS+ +  G    + + ER+KG PW
Sbjct  63   EAGRVPIPSYLDEVAEQADDGTAKKGGTHSSAYANLPSESNGTGKGTSKSDQERRKGIPW  122

Query  440  TEEEHR  457
            TEEEHR
Sbjct  123  TEEEHR  128



>ref|XP_009419911.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419913.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
Length=268

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 67/116 (58%), Gaps = 15/116 (13%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPDGD--DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVE  325
            WT+ E+K FE +L  F DGD  DRW+K+A+ IPGKS  DV++H+  LV DV EI++GR+ 
Sbjct  31   WTQEENKRFEDALAEF-DGDSPDRWEKVAALIPGKSVGDVVSHYRELVDDVTEIEAGRIP  89

Query  326  LPSYPD------------DSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
             P Y              DS GW           + ++  + ERKKG PWTEEEH+
Sbjct  90   CPVYHGASPFTLDWENNYDSEGWKNSYCLSGGKRSGRRAPDHERKKGVPWTEEEHK  145



>ref|XP_007153178.1| hypothetical protein PHAVU_003G013600g [Phaseolus vulgaris]
 ref|XP_007153179.1| hypothetical protein PHAVU_003G013600g [Phaseolus vulgaris]
 ref|XP_007153180.1| hypothetical protein PHAVU_003G013600g [Phaseolus vulgaris]
 gb|ESW25172.1| hypothetical protein PHAVU_003G013600g [Phaseolus vulgaris]
 gb|ESW25173.1| hypothetical protein PHAVU_003G013600g [Phaseolus vulgaris]
 gb|ESW25174.1| hypothetical protein PHAVU_003G013600g [Phaseolus vulgaris]
Length=296

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 73/128 (57%), Gaps = 16/128 (13%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V  + S++ W+R +DK FE +L   P D  DRW+KIA+ +PGK+  ++  H+E LV DV
Sbjct  2    TVDEVDSSSEWSREQDKAFENALATHPEDASDRWEKIAADVPGKTIEEIKQHYELLVEDV  61

Query  299  GEIDSGRVELPSYPDDSFG-----WDQGEP----------SQISFGNSKKQGEAERKKGT  433
             +I+SG V LPSY   S G      D+G            S+ + G    + + ER+KG 
Sbjct  62   SQIESGCVPLPSYNSSSEGSTSHASDEGAGKKGSGLGNYNSESNHGTKASRSDQERRKGI  121

Query  434  PWTEEEHR  457
             WTE+EHR
Sbjct  122  AWTEDEHR  129



>ref|XP_002316232.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEF02403.1| myb family transcription factor family protein [Populus trichocarpa]
Length=293

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 73/129 (57%), Gaps = 6/129 (5%)
 Frame = +2

Query  86   MYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALD  262
            M + N  W M +S    Q+   WTR E+K FE +L +F + + DRW K+A+ IPGK+  D
Sbjct  1    METLNPSWYMSNSNWFTQTTE-WTREENKEFEIALAIFDEHEPDRWLKVAAMIPGKTVYD  59

Query  263  VIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKG  430
            VI  ++ L  DV +I++GRV +P Y   SF +     S       +    K  + +RKKG
Sbjct  60   VIKQYKELEEDVSDIEAGRVPVPGYLSSSFTFQLVGNSNFDAYRKRSLTAKSADQQRKKG  119

Query  431  TPWTEEEHR  457
             PWTE+EHR
Sbjct  120  VPWTEDEHR  128



>ref|XP_003538448.1| PREDICTED: transcription factor DIVARICATA isoformX1 [Glycine 
max]
 ref|XP_006591374.1| PREDICTED: transcription factor DIVARICATA isoform X3 [Glycine 
max]
 ref|XP_006591375.1| PREDICTED: transcription factor DIVARICATA isoform X4 [Glycine 
max]
 ref|XP_006591376.1| PREDICTED: transcription factor DIVARICATA isoform X5 [Glycine 
max]
 ref|XP_006591377.1| PREDICTED: transcription factor DIVARICATA isoform X6 [Glycine 
max]
Length=299

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTR E+K FE +L ++  D  DRW ++A+ +PGK+  DVI  +  L  DV EI++GR+ +
Sbjct  27   WTREENKKFESALAIYDKDTPDRWLRVAAMLPGKTVYDVIKQYRELEEDVCEIEAGRIPV  86

Query  329  PSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKGTPWTEEEHR  457
            P YP  S   +  +         K    +  + ERKKG PWTEEEHR
Sbjct  87   PGYPTSSLTLEMVDNQCYDACRKKPATLRSSDQERKKGVPWTEEEHR  133



>gb|KDO69097.1| hypothetical protein CISIN_1g023196mg [Citrus sinensis]
Length=286

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 66/110 (60%), Gaps = 5/110 (5%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            + +WT+ E+K FE +L ++ +   DRW K+A+ IPGK+ LDVI  ++ L  DV +I++GR
Sbjct  24   STSWTKEENKRFESALAIYSESTPDRWIKVAAMIPGKTVLDVIKQYKELEEDVSDIEAGR  83

Query  320  VELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKGTPWTEEEHR  457
            V +P Y   SF  +    S       +    K  + ERKKG PWTEEEH+
Sbjct  84   VPIPGYLSSSFTLELVSESDYDANRKRTLVAKSSDHERKKGVPWTEEEHK  133



>ref|XP_011019148.1| PREDICTED: transcription factor DIVARICATA-like [Populus euphratica]
Length=307

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 70/135 (52%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +          WT  E+K FE +L L+  D  DRW K+A+ IPGK+  DV
Sbjct  13   YLQNSNWLFQEG-----EGTKWTPEENKQFENALALYDKDTPDRWLKVAALIPGKTVDDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--W--DQGEPSQISF-------GNSKKQGE  412
            I  +  L  DV +I++G + +P Y  DSF   W  DQG      F       G + +  E
Sbjct  68   IKQYRELEEDVCDIEAGLIPIPGYNSDSFTLEWVSDQGYDGLKQFYSPGGKRGTATRPSE  127

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEHR
Sbjct  128  QERKKGVPWTEEEHR  142



>emb|CDP18453.1| unnamed protein product [Coffea canephora]
Length=295

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 69/122 (57%), Gaps = 16/122 (13%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            ++A W+R +DK FE +L  +P D  DRW+KIA+ +PGKS  ++  H+E LV DV  I+SG
Sbjct  7    TSAVWSREQDKAFENALATYPEDSADRWEKIAADVPGKSLEEIKHHYEILVDDVNRIESG  66

Query  317  RVELPSYP-----------DDSFGWDQGE----PSQISFGNSKKQGEAERKKGTPWTEEE  451
             V LPSY            D+  G   G      S+ + G    + + ER+KG  WTE+E
Sbjct  67   CVPLPSYSSCLDGSTSQAGDEGTGKKSGNLGHFSSESNHGGKASRSDQERRKGIAWTEDE  126

Query  452  HR  457
            HR
Sbjct  127  HR  128



>gb|KHN14065.1| hypothetical protein glysoja_048339 [Glycine soja]
Length=133

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 69/118 (58%), Gaps = 12/118 (10%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            S++ W++ +DK FE +L + P D  DRW+KI   IPGK+  ++  H+E LV DV +I+SG
Sbjct  8    SSSEWSKEQDKAFENALAIHPEDASDRWEKIVVDIPGKTLEEIKHHYELLVEDVNQIESG  67

Query  317  RVELPSY---PDDSFGWDQGEP--------SQISFGNSKKQGEAERKKGTPWTEEEHR  457
             V LPSY   P+ S     G+         ++ + G    + + ER+KG  WTE+EHR
Sbjct  68   CVPLPSYNSSPEGSTSQGAGKKGGHSWNSNNECNHGTKASRSDQERQKGIAWTEDEHR  125



>ref|XP_004302668.1| PREDICTED: transcription factor DIVARICATA [Fragaria vesca subsp. 
vesca]
Length=313

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 75/139 (54%), Gaps = 21/139 (15%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S       A WT  E+K FE +L L+  D  DRWQK+A  IPGK+  DV
Sbjct  13   YIQNSNWLFQES-----KGAEWTAEENKRFENALALYDKDTPDRWQKVAYLIPGKTVGDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDD---SFGW--DQGEPSQISF----GNSKKQG---  409
            I  ++ L  DV +I++G + +P Y ++   +  W  DQG      +    GN  K+G   
Sbjct  68   IKQYKELEEDVSDIEAGLIPIPGYSNNNSFTLEWVDDQGFDGLKQYYSVGGNGGKRGSST  127

Query  410  ---EAERKKGTPWTEEEHR  457
               E ERKKG PWTEEEHR
Sbjct  128  RPSEQERKKGVPWTEEEHR  146



>ref|XP_010535414.1| PREDICTED: transcription factor DIVARICATA isoform X1 [Tarenaya 
hassleriana]
Length=255

 Score = 87.8 bits (216),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 72/126 (57%), Gaps = 8/126 (6%)
 Frame = +2

Query  104  RWMMGD-SVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHF  277
             W++ + +V    +AATWT  E+K FE +L ++ D   DRWQK+A+ IPGK+  DVI  +
Sbjct  14   NWILPEETVKNSSTAATWTAAENKAFEDALAVYDDDTPDRWQKVAAMIPGKTVGDVIKQY  73

Query  278  EALVHDVGEIDSGRVELPSYPDDSF------GWDQGEPSQISFGNSKKQGEAERKKGTPW  439
              L  DV  I++G V +P Y    F      G++  +P       + +  E ERKKG PW
Sbjct  74   TELEADVINIEAGLVPVPGYITSPFTLDWAGGYNGLKPVGSKRSPAARPPEHERKKGVPW  133

Query  440  TEEEHR  457
            TEEEH+
Sbjct  134  TEEEHK  139



>ref|XP_009622771.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana tomentosiformis]
 ref|XP_009622772.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana tomentosiformis]
 ref|XP_009622774.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana tomentosiformis]
Length=231

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 72/122 (59%), Gaps = 7/122 (6%)
 Frame = +2

Query  98   NHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAH  274
            N  W++  S      +  WT+ E+K FE +L ++ +   +RW  +A+ IPGKSALDV+  
Sbjct  12   NSNWILQHS-----KSTEWTKEENKKFESALAIYDEKTPNRWSMVAAMIPGKSALDVMMQ  66

Query  275  FEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQI-SFGNSKKQGEAERKKGTPWTEEE  451
            ++ LV DV +I++G V  P   D +F  +  +  +I +F    K  + ERKKG PWTEEE
Sbjct  67   YKELVADVSDIEAGLVPTPRNFDSAFTLEFVDHREIHTFRKRGKSCDQERKKGVPWTEEE  126

Query  452  HR  457
            HR
Sbjct  127  HR  128



>ref|XP_011009177.1| PREDICTED: transcription factor DIVARICATA-like [Populus euphratica]
 ref|XP_011009178.1| PREDICTED: transcription factor DIVARICATA-like [Populus euphratica]
 ref|XP_011009179.1| PREDICTED: transcription factor DIVARICATA-like [Populus euphratica]
 ref|XP_011009180.1| PREDICTED: transcription factor DIVARICATA-like [Populus euphratica]
Length=296

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 69/128 (54%), Gaps = 16/128 (13%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            SV    S + WTR  DK FE +L  +P D  DRW+KIA  +PGK+  ++  H+E LV D+
Sbjct  2    SVDEGGSGSLWTREHDKAFENALATYPEDASDRWEKIAEDVPGKTLEEIKHHYELLVEDI  61

Query  299  GEIDSGRVELPSYP-----------DDSFGWDQG----EPSQISFGNSKKQGEAERKKGT  433
             +I++G V LP Y            D+  G   G      S+ + GN   + + ER+KG 
Sbjct  62   NQIEAGCVPLPCYSSSSEGSTSHAGDEGTGKKGGHLGHHNSEFNHGNKASRSDQERRKGI  121

Query  434  PWTEEEHR  457
             WTE+EHR
Sbjct  122  AWTEDEHR  129



>ref|XP_010541440.1| PREDICTED: transcription factor DIVARICATA-like [Tarenaya hassleriana]
 ref|XP_010541441.1| PREDICTED: transcription factor DIVARICATA-like [Tarenaya hassleriana]
Length=251

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 69/129 (53%), Gaps = 12/129 (9%)
 Frame = +2

Query  107  WMMGDSVTAMQSA-ATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFE  280
            W+  +      SA ATWT  E+K FE +L ++  D  DRWQK+A+ IPGK+  DVI  + 
Sbjct  15   WLRPEETAKNSSAGATWTAAENKAFENALAVYDEDSPDRWQKVAAMIPGKTVSDVIKQYT  74

Query  281  ALVHDVGEIDSGRVELPSY--PDDSFGWD----QGEPSQISFGNSKKQG----EAERKKG  430
             L  DV  I++G V +P Y  P   F  D     G     + GN +       E ERKKG
Sbjct  75   ELEADVSNIEAGLVPVPGYIMPSPQFTLDWTAAAGYKELKAMGNKRPTAARPPEHERKKG  134

Query  431  TPWTEEEHR  457
             PWTEEEH+
Sbjct  135  VPWTEEEHK  143



>ref|NP_001055671.1| Os05g0442400 [Oryza sativa Japonica Group]
 gb|AAT69605.1| putative myb-like transcription factor [Oryza sativa Japonica 
Group]
 gb|AAU90097.1| putative myb-like transcription factor [Oryza sativa Japonica 
Group]
 dbj|BAF17585.1| Os05g0442400 [Oryza sativa Japonica Group]
 gb|EAY98215.1| hypothetical protein OsI_20126 [Oryza sativa Indica Group]
 dbj|BAG97965.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63882.1| hypothetical protein OsJ_18706 [Oryza sativa Japonica Group]
Length=182

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 67/115 (58%), Gaps = 10/115 (9%)
 Frame = +2

Query  116  GDSVTAMQSAATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVH  292
            G +   + S+  W++ EDKVFE +LV FP+   +RW  +ASR+PG+SA +V  H++ LV 
Sbjct  16   GVAEVPVPSSRPWSKAEDKVFESALVAFPEHTHNRWALVASRLPGRSAHEVWEHYQVLVD  75

Query  293  DVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            DV  I+ G V  P   DD            S G+ +  G  ER++G PWTEEEHR
Sbjct  76   DVDLIERGMVASPGCWDD---------DNNSAGHGRGSGGDERRRGVPWTEEEHR  121



>emb|CDY71881.1| BnaAnng39140D [Brassica napus]
Length=289

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 71/135 (53%), Gaps = 17/135 (13%)
 Frame = +2

Query  104  RWMMGDS-----VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDV  265
             W+M ++     + A   AATWT  E+K FE +L ++ D   DRWQK+A+ IPGK+  DV
Sbjct  16   NWLMEETESNVPLAASPDAATWTVAENKAFENALAVYDDNTPDRWQKVAAAIPGKTVSDV  75

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSF-----------GWDQGEPSQISFGNSKKQGE  412
            I  +  L  D+  I++G + +P Y    F           G+  G P       + +  E
Sbjct  76   IKQYNDLEADLSSIEAGLIPVPGYITSPFTLDWTGDGGCNGFKPGHPVGNKRLPAGRSPE  135

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEH+
Sbjct  136  LERKKGVPWTEEEHK  150



>ref|XP_004513249.1| PREDICTED: transcription factor DIVARICATA-like isoform X1 [Cicer 
arietinum]
 ref|XP_004513250.1| PREDICTED: transcription factor DIVARICATA-like isoform X2 [Cicer 
arietinum]
Length=296

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 74/128 (58%), Gaps = 16/128 (13%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V  ++S + W+R +DK FE +L  +P D  DRW+KIA+ +PGK+  ++  H+E LV DV
Sbjct  2    TVDEVESISEWSREQDKAFENALATYPEDASDRWEKIAADVPGKTMEEIKQHYEFLVDDV  61

Query  299  GEIDSGRVELPSYPDDSFG-----WDQG----------EPSQISFGNSKKQGEAERKKGT  433
             +I++G V +PSY   S G      D+G            S+ + G    + + ER+KG 
Sbjct  62   NQIEAGCVPIPSYNSSSEGSTSHASDEGVGKKGGLNGNNNSESNHGTKASRSDQERRKGI  121

Query  434  PWTEEEHR  457
             WTE+EHR
Sbjct  122  AWTEDEHR  129



>ref|XP_006574483.1| PREDICTED: MYB transcription factor MYB83 isoform X1 [Glycine 
max]
Length=312

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 70/129 (54%), Gaps = 10/129 (8%)
 Frame = +2

Query  86   MYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALD  262
             Y  N  W + +S++       WTR ++K FE +L ++  D  DRW K+A+ IPGK+  D
Sbjct  22   CYMPNSNWFVQESLST-----EWTREDNKKFESALAIYDKDTPDRWFKVAAMIPGKTVFD  76

Query  263  VIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKG  430
            VI  +  L  DV EI++G V +P Y   SF ++  +         +    +  + ERKKG
Sbjct  77   VIKQYRELEEDVSEIEAGHVPIPGYLASSFTFELVDNHNYDGCRRRLAPVRGSDQERKKG  136

Query  431  TPWTEEEHR  457
             PWTEEEHR
Sbjct  137  VPWTEEEHR  145



>gb|EPS60201.1| hypothetical protein M569_14602, partial [Genlisea aurea]
Length=282

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 73/118 (62%), Gaps = 14/118 (12%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            S++ WTR +DK FE+++V + D   DRW+K+AS + GKSA +V  H+E L+ DV  I+SG
Sbjct  8    SSSVWTREQDKQFERAIVTYSDDCPDRWEKVASEVAGKSAGEVRDHYEVLLDDVSRIESG  67

Query  317  RVELPSYPDDSFG-----------WDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
             VELPSY   S G            + GE +Q S  +S+   + ER+KG  WTE+EHR
Sbjct  68   FVELPSYNSSSDGSTSHAAEDGKKSNSGESNQGSGKSSRS--DQERRKGIAWTEDEHR  123



>emb|CBI30422.3| unnamed protein product [Vitis vinifera]
Length=211

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S     +   WT  E+K+FE +L L   D  DRW K+A+ IPGK+  DV
Sbjct  13   YLQNSNWLFSES-----NGTKWTHEENKLFENALALHDKDTPDRWLKVAAMIPGKTVEDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--WDQGEP----SQISF-----GNSKKQGE  412
            I  ++ L  D+ +I++G + +P Y   SF   W+  +      Q  F     G++ +  +
Sbjct  68   IKQYKDLEDDISDIEAGLIPIPGYSTSSFKLEWNNNQGFDGLKQFYFPGGKRGSATRSTD  127

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEHR
Sbjct  128  QERKKGVPWTEEEHR  142



>gb|KEH40705.1| MYB family transcription factor [Medicago truncatula]
Length=140

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 75/129 (58%), Gaps = 17/129 (13%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDV  298
            ++  + +++ W+  +DK FE +LV +P+ D DRW+KIA  +PGK+  ++  H+E LV D+
Sbjct  2    TMDEVDNSSEWSWEQDKAFENALVTYPEDDSDRWEKIAVDVPGKTMEEIKQHYELLVDDI  61

Query  299  GEIDSGRVELPSYPDDSFG-----WDQG-----------EPSQISFGNSKKQGEAERKKG  430
            G+I++G V LPSY   S G      D+G           +  + + G    + + ER+KG
Sbjct  62   GQIEAGCVPLPSYNSSSEGSTSHASDEGVGGKKGGHNGHKNDESNHGTKGSRSDQERRKG  121

Query  431  TPWTEEEHR  457
              WTEEEHR
Sbjct  122  IAWTEEEHR  130



>ref|XP_006380485.1| hypothetical protein POPTR_0007s07150g [Populus trichocarpa]
 ref|XP_002310052.2| hypothetical protein POPTR_0007s07150g [Populus trichocarpa]
 ref|XP_006380486.1| hypothetical protein POPTR_0007s07150g [Populus trichocarpa]
 ref|XP_006380487.1| hypothetical protein POPTR_0007s07150g [Populus trichocarpa]
 gb|ERP58282.1| hypothetical protein POPTR_0007s07150g [Populus trichocarpa]
 gb|EEE90502.2| hypothetical protein POPTR_0007s07150g [Populus trichocarpa]
 gb|ERP58283.1| hypothetical protein POPTR_0007s07150g [Populus trichocarpa]
 gb|ERP58284.1| hypothetical protein POPTR_0007s07150g [Populus trichocarpa]
Length=296

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 69/128 (54%), Gaps = 16/128 (13%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            SV    S + WTR  DK FE +L  +P D  DRW+KIA  +PGK+  ++  H+E LV D+
Sbjct  2    SVDEGGSGSLWTREHDKAFENALATYPEDASDRWEKIAEDVPGKTLEEIKHHYELLVEDI  61

Query  299  GEIDSGRVELPSYP-----------DDSFGWDQG----EPSQISFGNSKKQGEAERKKGT  433
             +I++G V LP Y            D+  G   G      S+ + GN   + + ER+KG 
Sbjct  62   NQIEAGCVPLPCYSSSSEGSTSHAGDEGTGKKGGHLGHHNSESNHGNKASRSDQERRKGI  121

Query  434  PWTEEEHR  457
             WTE+EHR
Sbjct  122  AWTEDEHR  129



>ref|XP_002513126.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF49629.1| DNA binding protein, putative [Ricinus communis]
Length=295

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 71/130 (55%), Gaps = 21/130 (16%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V     ++ WTR +DK FE +L  +P+ D DRW+KIA+ +PGK++ ++  H+E LV DV
Sbjct  2    TVDEADCSSVWTREQDKAFEDALATYPEDDLDRWEKIAADVPGKTSEEIKFHYELLVEDV  61

Query  299  GEIDSGRVELPSYPDDS-----------------FGWDQGEPSQISFGNSKKQGEAERKK  427
             +I++G V LP+Y                      G    EP+    GN   + + ER+K
Sbjct  62   NQIEAGCVPLPNYSSSEGSTGHAGDEGTSKKGSHLGHHNNEPAH---GNKASRSDQERRK  118

Query  428  GTPWTEEEHR  457
            G  WTE+EHR
Sbjct  119  GIAWTEDEHR  128



>ref|XP_010936185.1| PREDICTED: transcription factor DIVARICATA-like [Elaeis guineensis]
Length=173

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = +2

Query  110  MMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEAL  286
            M  +   ++Q+  +W  YE+K FE +L  +P+G  +RW  I +++ GKS   V+ H+ AL
Sbjct  1    MSSNETPSLQTQWSW--YENKTFEVALTEYPEGTPNRWPLITAKLSGKSLCQVLDHYRAL  58

Query  287  VHDVGEIDSGRVELPSYP-DDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            +HD+  IDSG+VE P+Y  DD+       P Q        +GE ER+K  PWTE+EHR
Sbjct  59   IHDLELIDSGKVETPNYRYDDNSDRSNMAPKQHPTTARSGRGE-ERRKSVPWTEKEHR  115



>ref|XP_006401027.1| hypothetical protein EUTSA_v10014270mg [Eutrema salsugineum]
 gb|ESQ42480.1| hypothetical protein EUTSA_v10014270mg [Eutrema salsugineum]
Length=290

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 75/151 (50%), Gaps = 19/151 (13%)
 Frame = +2

Query  62   LKIAEQMMMYSANHRWMMGDS-----VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQ  223
            ++I      + +   W+M ++     V A    ATWT  E+K FE +L ++ D   DRWQ
Sbjct  1    MEILRPTTSHVSGGNWLMEETKSNVAVAASGEVATWTAAENKAFENALAVYDDNTPDRWQ  60

Query  224  KIASRIPGKSALDVIAHFEALVHDVGEIDSGRVELPSYPDDSFGWD---------QGEPS  376
            K+A+ IPGK+  DVI  +  L  DV  I++G + +P Y    F  D          G   
Sbjct  61   KVAAVIPGKTVSDVIKQYNELEADVSSIEAGLIPVPGYITSPFTLDWASGGGGGCNGFKL  120

Query  377  QISFGNSK----KQGEAERKKGTPWTEEEHR  457
                GN +    +  E ERKKG PWTEEEH+
Sbjct  121  GHQVGNKRSPAGRSPELERKKGVPWTEEEHK  151



>ref|XP_004509855.1| PREDICTED: transcription factor DIVARICATA-like [Cicer arietinum]
Length=294

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = +2

Query  113  MGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALV  289
            M + V +   ++ W+R ED  FE +L ++P+ D +RW+KIA+ +PGK+  ++  H+E LV
Sbjct  1    MDEMVCSTSCSSEWSREEDIAFENALAIYPENDVNRWEKIAADVPGKTLQEIKYHYEVLV  60

Query  290  HDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            +D+  I+SG V LP Y    F      P+     +   + + ER+KG PWTEEEH+
Sbjct  61   YDINLIESGFVILPCY--KLFPERSKNPAAGKKESKGSKYDHERRKGIPWTEEEHK  114



>gb|ADE22269.1| MYB transcription factor [Malus domestica]
Length=304

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 77/138 (56%), Gaps = 19/138 (14%)
 Frame = +2

Query  83   MMYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSAL  259
            + Y  N  W+  +S     + A WT  E+K+FE +L L+  D  DRW ++A+ IPGK+  
Sbjct  9    LSYLQNSNWLFEES-----TGAEWTVEENKLFENALALYDKDTPDRWLRVAAMIPGKTVG  63

Query  260  DVIAHFEALVHDVGEIDSGRVELPSYPDDSF--------GWDQGEPSQISFG----NSKK  403
            DVI  ++ L  DV +I++G + +P Y  ++F        G+D G     S G    +S +
Sbjct  64   DVIKQYKELEEDVSDIEAGLIPIPGYTSNNFTMEWVNNQGFD-GLEQFYSVGGKRSSSTR  122

Query  404  QGEAERKKGTPWTEEEHR  457
              + ERKKG PWTEEEHR
Sbjct  123  PADQERKKGVPWTEEEHR  140



>emb|CDP14063.1| unnamed protein product [Coffea canephora]
Length=278

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            +  WT+ E+K FE +L +  +   DRW ++A+ IPGKS  DVI  ++ LV DV +I++G 
Sbjct  22   STKWTKEENKRFESALAMIDEKSPDRWYRVAAMIPGKSVCDVINQYQELVADVNDIEAGL  81

Query  320  VELPSYPDDSFGWDQGEPSQISFGNSKKQGEA---ERKKGTPWTEEEHR  457
            V +P Y   SF  +  + ++  F   +K+G +   ERKKG PWTEEEHR
Sbjct  82   VPVPGYLASSFTLELMD-NRGGFATFRKRGRSIDQERKKGIPWTEEEHR  129



>ref|NP_200698.1| homeodomain-like transcriptional regulator [Arabidopsis thaliana]
 dbj|BAB09635.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC43475.1| putative I-box binding factor [Arabidopsis thaliana]
 gb|AAO63893.1| putative I-box binding factor [Arabidopsis thaliana]
 gb|AAS10003.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AED97115.1| homeodomain-like transcriptional regulator [Arabidopsis thaliana]
Length=288

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 77/148 (52%), Gaps = 21/148 (14%)
 Frame = +2

Query  77   QMMMYSANH----RWMMGDS---VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIA  232
            ++M  S +H     W+M ++   V A    ATWT  E+K FE +L ++ D   DRWQK+A
Sbjct  2    EVMRPSTSHVSGGNWLMEETKSGVAASGEGATWTAAENKAFENALAVYDDNTPDRWQKVA  61

Query  233  SRIPGKSALDVIAHFEALVHDVGEIDSGRVELPSY---PDDSFGWDQGEPSQISF-----  388
            + IPGK+  DVI  +  L  DV  I++G + +P Y   P  +  W  G      F     
Sbjct  62   AVIPGKTVSDVIRQYNDLEADVSSIEAGLIPVPGYITSPPFTLDWAGGGGGCNGFKPGHQ  121

Query  389  -GNSKKQG----EAERKKGTPWTEEEHR  457
              N + Q     E ERKKG PWTEEEH+
Sbjct  122  VCNKRSQAGRSPELERKKGVPWTEEEHK  149



>ref|XP_008442463.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis melo]
Length=265

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 68/116 (59%), Gaps = 11/116 (9%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
             + WT  E+K FE +L LF  D  DRW K+A+ IPGK+  DV+  +  LV DV +I++G 
Sbjct  19   CSKWTPEENKRFENALALFDRDTPDRWVKVAAMIPGKTVGDVVKQYRELVEDVSDIEAGL  78

Query  320  VELPSYP-DDSF----GWDQGEPSQISFGNSKKQG-----EAERKKGTPWTEEEHR  457
            V +P Y   +SF      D GE + +  G  K+ G     + ERKKG PWTEEEHR
Sbjct  79   VPVPGYGVGNSFVLEWSNDGGEFAPMYIGAGKRGGSVRASDQERKKGVPWTEEEHR  134



>ref|XP_011094978.1| PREDICTED: transcription factor DIVARICATA-like [Sesamum indicum]
Length=308

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 64/118 (54%), Gaps = 12/118 (10%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            +   WT  E+K FE +L LF  D  DRW  +AS IPGK+  DVI  +  LV DV +I++G
Sbjct  25   TVTKWTPEENKRFENALALFDKDTPDRWHNVASMIPGKTVSDVIKQYRELVEDVSDIEAG  84

Query  317  RVELPSYPDDSF-----------GWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
             + +P Y ++SF           G  Q         +S +  + ERKKG PWTEEEHR
Sbjct  85   LIPIPGYTNNSFTLEWVSNHGYEGLKQLYGPGGKRNSSTRCSDHERKKGVPWTEEEHR  142



>ref|XP_009120398.1| PREDICTED: transcription factor DIVARICATA [Brassica rapa]
Length=291

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 76/151 (50%), Gaps = 19/151 (13%)
 Frame = +2

Query  62   LKIAEQMMMYSANHRWMMGDS---VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKI  229
            ++I      + +   W+M ++   V   + +ATWT  E+K FE +L ++ D   DRWQK+
Sbjct  1    MEILRPTTSHVSGGSWLMEETKSNVATARESATWTAAENKAFENALAVYDDNTPDRWQKV  60

Query  230  ASRIPGKSALDVIAHFEALVHDVGEIDSGRVELPSY---PDDSFGWDQ------------  364
            A+ IPGK+  DVI  +  L  DV  I++G + +P Y   P  +  W              
Sbjct  61   AAVIPGKTVSDVIRQYNELEADVSNIEAGLIPVPGYITSPPFTLDWTAGGGGGGCNGFKP  120

Query  365  GEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            G P       + +  E ERKKG PWTEEEH+
Sbjct  121  GHPVGNKRSPAVRSPELERKKGVPWTEEEHK  151



>emb|CDX80328.1| BnaC09g34140D [Brassica napus]
Length=265

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 74/140 (53%), Gaps = 23/140 (16%)
 Frame = +2

Query  62   LKIAEQMMMYSANHRWMMGDS---VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKI  229
            ++I      + +   W+M ++   V   + +ATWT  E+K FE +L ++ D   DRWQK+
Sbjct  1    MEILRPTTSHVSGGNWLMEETKSNVATARESATWTAAENKAFENALAIYDDNTPDRWQKV  60

Query  230  ASRIPGKSALDVIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSK---  400
            A+ IPGK+  DVI  +  L  DV  I++G + +P +P                GN +   
Sbjct  61   AAVIPGKTVSDVIRQYNELEADVSNIEAGLIPVPGHP---------------VGNKRSPA  105

Query  401  -KQGEAERKKGTPWTEEEHR  457
             +  E +RKKG PWTEEEH+
Sbjct  106  GRSPELDRKKGVPWTEEEHK  125



>ref|XP_006487909.1| PREDICTED: transcription factor DIVARICATA-like [Citrus sinensis]
Length=231

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 77/117 (66%), Gaps = 4/117 (3%)
 Frame = +2

Query  119  DSVTAMQSAATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHD  295
            D + +  ++++WTR EDK+FE++LV FP+    RW++IA ++PGKS++DV   ++ LV D
Sbjct  7    DYLYSASTSSSWTREEDKLFERALVTFPEETPGRWERIARQVPGKSSVDVQRRYDDLVLD  66

Query  296  VGEIDSGRVELPSYPDDSFGWDQGEPSQISFG---NSKKQGEAERKKGTPWTEEEHR  457
            + +I++G VELP Y D+     +   S  S G   N  ++ E ER+KG PWT EEHR
Sbjct  67   LRKIEAGLVELPGYEDEMDSPGRVAESGASLGSNSNRSRERETERRKGVPWTAEEHR  123



>ref|XP_002308211.1| myb family transcription factor family protein [Populus trichocarpa]
 gb|EEE91734.1| myb family transcription factor family protein [Populus trichocarpa]
Length=307

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 70/135 (52%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +          WT  E+K FE +L L+  D  DRW K+A+ IPGK+  DV
Sbjct  13   YLQNSNWLFQEG-----EGTKWTPEENKQFENALALYDKDTPDRWLKVAALIPGKTVDDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--W--DQGEPSQISF-------GNSKKQGE  412
            I  +  L  DV +I++G + +P Y  DSF   W  +QG      F       G + +  E
Sbjct  68   IKQYRELEEDVCDIEAGLIPIPGYNSDSFTLEWVSNQGYDGLKQFYSPGGKRGTATRPSE  127

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEHR
Sbjct  128  QERKKGVPWTEEEHR  142



>ref|XP_007146740.1| hypothetical protein PHAVU_006G065700g [Phaseolus vulgaris]
 gb|ESW18734.1| hypothetical protein PHAVU_006G065700g [Phaseolus vulgaris]
Length=314

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 74/134 (55%), Gaps = 15/134 (11%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+M D+    ++   WT  E+K+FE +L ++  D  DRW K+A  IPGK+ +DV
Sbjct  14   YMYNSNWLMDDN----RNNTKWTPAENKLFENALAVYDKDTPDRWHKVAEMIPGKTVMDV  69

Query  266  IAHFEALVHDVGEIDSGRVELPSYPD----------DSFGWDQGEPSQISFGNSKKQGEA  415
            +  ++ L  DV +I++G + +P Y            ++ G+D  +       +S +  E 
Sbjct  70   VKQYKELEADVSDIEAGLIPIPGYSTTTSPFTLDWVNTPGYDGFKGITAKRSSSGRPPEQ  129

Query  416  ERKKGTPWTEEEHR  457
            ERKKG PWTEEEH+
Sbjct  130  ERKKGVPWTEEEHK  143



>ref|XP_009143425.1| PREDICTED: transcription factor DIVARICATA-like [Brassica rapa]
 ref|XP_009143426.1| PREDICTED: transcription factor DIVARICATA-like [Brassica rapa]
 emb|CDX74914.1| BnaA05g06600D [Brassica napus]
Length=295

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 67/124 (54%), Gaps = 17/124 (14%)
 Frame = +2

Query  137  QSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDS  313
             +A  WT  E+K FE +L  +  D  DRW K+A+ +PGK+  DVI  +  L  DV +I++
Sbjct  24   NTATKWTAEENKKFENALAFYDKDTPDRWFKVAAMLPGKTVGDVIKQYRELEEDVSDIEA  83

Query  314  GRVELPSYPDDSF-----GWDQGE-----------PSQISFGNSKKQGEAERKKGTPWTE  445
            G + +P Y  DSF     G+D G             +    G++ +  E ERKKG PWTE
Sbjct  84   GLIPIPGYASDSFTLDWGGYDAGSNGFNMNGYYFAAAGGKRGSAARAAEHERKKGVPWTE  143

Query  446  EEHR  457
            EEHR
Sbjct  144  EEHR  147



>gb|KHN43075.1| DnaJ like subfamily C member 2 [Glycine soja]
Length=149

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 67/118 (57%), Gaps = 16/118 (14%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            W+R +DK FE +L   P+ D DRW+KIA+ +PGK+  ++  H+E LV D+ +I+SG V L
Sbjct  12   WSREQDKAFENALATHPEDDSDRWEKIAADVPGKTIEEIKQHYELLVEDINQIESGCVPL  71

Query  329  PSYPDDSFG-----WDQGE------PSQIS----FGNSKKQGEAERKKGTPWTEEEHR  457
            PSY   S G      D+G       P   S     G    + + ER+KG  WTE+EHR
Sbjct  72   PSYNSSSEGSTSHASDEGAGKKGSGPGHYSGESNHGTKASRSDQERRKGIAWTEDEHR  129



>ref|XP_003555779.1| PREDICTED: transcription factor DIVARICATA-like isoform X1 [Glycine 
max]
 ref|XP_006605472.1| PREDICTED: transcription factor DIVARICATA-like isoform X2 [Glycine 
max]
 ref|XP_006605473.1| PREDICTED: transcription factor DIVARICATA-like isoform X3 [Glycine 
max]
Length=296

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 73/128 (57%), Gaps = 16/128 (13%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V  + S++ W+R +DK FE +L   P+ D DRW+KIA+ +PGK+  ++  H+E LV D+
Sbjct  2    TVDEVDSSSEWSREQDKAFENALATHPEDDSDRWEKIAADVPGKTIEEIKQHYELLVEDI  61

Query  299  GEIDSGRVELPSYPDDSFG-----WDQGE------PSQIS----FGNSKKQGEAERKKGT  433
             +I+SG V LPSY   S G      D+G       P   S     G    + + ER+KG 
Sbjct  62   NQIESGCVPLPSYNSSSEGSTSHASDEGAGKKGSGPGHYSGESNHGTKASRSDQERRKGI  121

Query  434  PWTEEEHR  457
             WTE+EHR
Sbjct  122  AWTEDEHR  129



>ref|XP_010483499.1| PREDICTED: transcription factor DIVARICATA-like isoform X1 [Camelina 
sativa]
Length=291

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 68/138 (49%), Gaps = 20/138 (14%)
 Frame = +2

Query  104  RWMMGDS-----VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDV  265
             W+M D+     V A     TWT  E+K FE +L ++ D   DRWQK+A+ IPGK+  DV
Sbjct  15   NWLMEDTKSNAGVAASGEGCTWTAAENKAFENALAVYDDNTPDRWQKVAAVIPGKTVSDV  74

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFGWD--------------QGEPSQISFGNSKK  403
            I  +  L  DV  I++G + +P Y    F  D               G        ++ +
Sbjct  75   IRQYNDLEADVSSIEAGLIPVPGYVTSPFTLDWAGGGGSGGCNGFKPGHSVCYKRSSAGR  134

Query  404  QGEAERKKGTPWTEEEHR  457
              E ERKKG PWTEEEH+
Sbjct  135  SPELERKKGVPWTEEEHK  152



>ref|XP_007141798.1| hypothetical protein PHAVU_008G226600g [Phaseolus vulgaris]
 gb|ESW13792.1| hypothetical protein PHAVU_008G226600g [Phaseolus vulgaris]
Length=305

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 63/107 (59%), Gaps = 5/107 (5%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WTR ++K FE +L ++  D  DRW K+A+ IPGK+  DVI  +  L  DV EI++GRV +
Sbjct  27   WTREDNKKFESALAIYDKDTPDRWFKVAAMIPGKTVFDVIKQYRELEEDVSEIEAGRVPI  86

Query  329  PSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKGTPWTEEEHR  457
            P Y   SF ++  +         +    +  + ERKKG PWTEEEHR
Sbjct  87   PGYLASSFTFELVDNHNYDGCRRRPAPIRGSDQERKKGVPWTEEEHR  133



>ref|XP_009407560.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 84/165 (51%), Gaps = 19/165 (12%)
 Frame = +2

Query  8    KTPLNPSQTLHKFFRKEKLKIAEQMMMYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQS  187
            K P++  + +    R E    A       ++  W++G          +WT+ E+K FE +
Sbjct  18   KIPVSNCEPMMTGSRMEATATATATATSYSSSDWVLGQKRCG---NGSWTQEENKHFEDA  74

Query  188  LVLFPDGD--DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVELP--SYPDDSFG  355
            L  F DGD  DRW+K+A+ IPGK+  DV  H+  L+ DV EI++GR+  P  +Y   SF 
Sbjct  75   LAKF-DGDTPDRWEKVAACIPGKTVADVKRHYRHLLDDVREIEAGRIPCPGYAYSSSSFT  133

Query  356  WD-------QGEPSQISFGNSKKQG----EAERKKGTPWTEEEHR  457
             D        G   Q    + K+ G    + ERKKG PWTEEEHR
Sbjct  134  LDWEHSHGLDGSRQQPYCISGKRCGLRAPDHERKKGVPWTEEEHR  178



>ref|XP_008370064.1| PREDICTED: transcription factor DIVARICATA-like [Malus domestica]
Length=307

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 76/136 (56%), Gaps = 19/136 (14%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S     + A WT  E+K+FE +L L+  D  DRW ++A+ IPGK+  DV
Sbjct  13   YLQNSXWLFEES-----TGAEWTVEENKLFENALALYDKDTPDRWLRVAAMIPGKTVGDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSF--------GWDQGEPSQISFG----NSKKQG  409
            I  ++ L  DV +I++G + +P Y  ++F        G+D G     S G    +S +  
Sbjct  68   IKQYKELEEDVSDIEAGLIPIPGYTSNNFTMEWVNNQGFD-GLEQFYSVGGKRSSSTRPA  126

Query  410  EAERKKGTPWTEEEHR  457
            + ERKKG PWTEEEHR
Sbjct  127  DQERKKGVPWTEEEHR  142



>ref|XP_002278729.1| PREDICTED: transcription factor DIVARICATA-like [Vitis vinifera]
 ref|XP_010654186.1| PREDICTED: transcription factor DIVARICATA-like [Vitis vinifera]
Length=312

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S     +   WT  E+K+FE +L L   D  DRW K+A+ IPGK+  DV
Sbjct  13   YLQNSNWLFSES-----NGTKWTHEENKLFENALALHDKDTPDRWLKVAAMIPGKTVEDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--WDQGEP----SQISF-----GNSKKQGE  412
            I  ++ L  D+ +I++G + +P Y   SF   W+  +      Q  F     G++ +  +
Sbjct  68   IKQYKDLEDDISDIEAGLIPIPGYSTSSFKLEWNNNQGFDGLKQFYFPGGKRGSATRSTD  127

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEHR
Sbjct  128  QERKKGVPWTEEEHR  142



>ref|XP_009409492.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409493.1| PREDICTED: transcription factor DIVARICATA-like [Musa acuminata 
subsp. malaccensis]
Length=308

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 78/142 (55%), Gaps = 22/142 (15%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAA-TWTRYEDKVFEQSLVLFPDGD--DRWQKIASRIPGKSAL  259
            Y  N  W +G   +  +SA+ +W++ E+K FE +L  F DGD  DRW K+A+ IPGK+  
Sbjct  21   YCTN--WFVGQQSSEGRSASGSWSQEENKWFEDALAKF-DGDTPDRWAKVAALIPGKTVG  77

Query  260  DVIAHFEALVHDVGEIDSGRVELPSY------------PDDSFGWDQGEPSQISFGNSKK  403
            DV++H+  LV DV EI++GR+  P Y              DS  W          G +K+
Sbjct  78   DVVSHYRELVDDVTEIEAGRIPCPVYYGTSSFTLDWENSRDSEAWKNSYCVGGGGGGAKR  137

Query  404  QG----EAERKKGTPWTEEEHR  457
             G    + ERKKG PWTE+EH+
Sbjct  138  SGARSSDHERKKGVPWTEDEHK  159



>ref|XP_003538252.1| PREDICTED: transcription factor DIVARICATA [Glycine max]
Length=323

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 79/148 (53%), Gaps = 15/148 (10%)
 Frame = +2

Query  53   KEKLKIAEQMMMYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKI  229
            K +++I      Y+ N  W++ D+ T   +   WT  E+K+FE +L ++  D  DRW K+
Sbjct  2    KWEMEILPPASPYTYNSNWLLDDNRT--NNNTKWTPAENKLFENALAVYDKDTPDRWHKV  59

Query  230  ASRIPGKSALDVIAHFEALVHDVGEIDSGRVELPSYPDDS----FGWDQGEPS-------  376
            A  IPGK+ +DV+  ++ L  DV +I++G + +P Y   +    F  D   P+       
Sbjct  60   AEMIPGKTVMDVVKQYKELEADVCDIEAGLISIPGYRSTTTTSPFTLDWVNPAYGDGFKG  119

Query  377  -QISFGNSKKQGEAERKKGTPWTEEEHR  457
                  +S +  E ERKKG PWTEEEH+
Sbjct  120  LTAKRSSSGRPPEQERKKGVPWTEEEHK  147



>ref|XP_004137732.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus]
 ref|XP_004163854.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus]
 gb|KGN58790.1| hypothetical protein Csa_3G732480 [Cucumis sativus]
Length=268

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 67/117 (57%), Gaps = 11/117 (9%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
              + WT  E+K FE +L LF  D  DRW K+A+ IPGK+  DV+  +  LV DV +I++G
Sbjct  18   GCSKWTPEENKRFENALALFDIDTPDRWVKVAAMIPGKTVCDVVKQYRELVEDVSDIEAG  77

Query  317  RVELPSYP-DDSF----GWDQGEPSQISFGNSKKQG-----EAERKKGTPWTEEEHR  457
             V +P Y   +SF      D G  + +  G  K+ G     + ERKKG PWTEEEHR
Sbjct  78   LVPVPGYGVGNSFVLEWSSDGGGFAPMYIGAGKRGGCGRPSDQERKKGVPWTEEEHR  134



>ref|XP_004168810.1| PREDICTED: transcription factor DIVARICATA-like isoform 2 [Cucumis 
sativus]
Length=305

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 71/128 (55%), Gaps = 16/128 (13%)
 Frame = +2

Query  107  WMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEA  283
            W  GD       A+ WT  E+K+FE +L +F  D  DRWQK+AS IPGK+  DVI  ++ 
Sbjct  20   WSSGDG-----KASRWTVAENKMFENALAIFDTDTPDRWQKVASMIPGKTVGDVIRQYKE  74

Query  284  LVHDVGEIDSGRVELPSYPDDSFGWD-----QGEPSQISFG-----NSKKQGEAERKKGT  433
            L  DV  I++G + +P Y    F  D       +  + S+G     +S +  + ERKKG 
Sbjct  75   LEADVSSIEAGLIPIPGYDTSQFTLDWVNSHSYDGFKQSYGLIGKRSSGRSADQERKKGV  134

Query  434  PWTEEEHR  457
            PWTEEEH+
Sbjct  135  PWTEEEHK  142



>ref|XP_004143146.1| PREDICTED: transcription factor DIVARICATA-like [Cucumis sativus]
Length=298

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 71/128 (55%), Gaps = 16/128 (13%)
 Frame = +2

Query  107  WMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEA  283
            W  GD       A+ WT  E+K+FE +L +F  D  DRWQK+AS IPGK+  DVI  ++ 
Sbjct  20   WSSGDG-----KASRWTVAENKMFENALAIFDTDTPDRWQKVASMIPGKTVGDVIRQYKE  74

Query  284  LVHDVGEIDSGRVELPSYPDDSFGWD-----QGEPSQISFG-----NSKKQGEAERKKGT  433
            L  DV  I++G + +P Y    F  D       +  + S+G     +S +  + ERKKG 
Sbjct  75   LEADVSSIEAGLIPIPGYDTSQFTLDWVNSHSYDGFKQSYGLIGKRSSGRSADQERKKGV  134

Query  434  PWTEEEHR  457
            PWTEEEH+
Sbjct  135  PWTEEEHK  142



>gb|KDP44829.1| hypothetical protein JCGZ_01329 [Jatropha curcas]
Length=288

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 66/110 (60%), Gaps = 5/110 (5%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            +  WT+ E+K FE++L ++ + + DRW K+A+RIPGK+  DVI  +  L  DV +I++G+
Sbjct  19   STEWTKEENKEFERALAMYDEHEPDRWTKVAARIPGKTVYDVIKQYRELEMDVSDIEAGK  78

Query  320  VELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKGTPWTEEEHR  457
            V +P Y    F  +  +         +    K G+ ERKKG PWTE+EHR
Sbjct  79   VPIPGYLSSPFTLEWVDDRDFDAYRKRPLPTKNGDQERKKGVPWTEDEHR  128



>emb|CDX70128.1| BnaA10g24770D [Brassica napus]
Length=270

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 78/129 (60%), Gaps = 11/129 (9%)
 Frame = +2

Query  92   SANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVI  268
            +++HR+++ + +    S  TWT+ E+K FE++L ++ D   DRW K+A+ IPGK+  DV+
Sbjct  13   TSDHRFVVQEMMCLQTS--TWTKEENKKFERALAIYADDTPDRWFKVAAMIPGKTISDVM  70

Query  269  AHFEALVHDVGEIDSGRVELPSYPDDSFGWDQ-GEPSQISFGNSKKQGEA-----ERKKG  430
              +  L  D+ +I++G V +P YP  S G+DQ   P        + QG A     +R+KG
Sbjct  71   TQYSKLEEDLFDIEAGLVPIPGYP--SAGFDQLVSPYDHDLYRKRPQGGARGFDQDRRKG  128

Query  431  TPWTEEEHR  457
             PWTEEEHR
Sbjct  129  VPWTEEEHR  137



>ref|XP_004251428.1| PREDICTED: uncharacterized protein LOC101258332 [Solanum lycopersicum]
Length=619

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 8/106 (8%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFPDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            +++ WT+ EDK FE +L LF    D++ KIA+ +PGKS  ++I H+  LV DV +I+SG+
Sbjct  8    NSSFWTKEEDKAFENALALFSGDSDKFLKIAAAVPGKSLQEIIDHYNVLVEDVNDIESGK  67

Query  320  VELPSYPDDSFGWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            V LP Y        +   S  S          ER+KG PWTEEEHR
Sbjct  68   VPLPKY--------ERMRSSSSRRRRSSGAGVERRKGVPWTEEEHR  105



>gb|AHB59616.1| putative MYB-related protein 30 [Arachis hypogaea]
Length=336

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 78/155 (50%), Gaps = 21/155 (14%)
 Frame = +2

Query  56   EKLKIAEQMMMYSANHRWMMGDSVTAM----QSAATWTRYEDKVFEQSLVLF-PDGDDRW  220
            E L  +   + ++    W +GD+        +S+  WT  E+K+FE +L L   D  DRW
Sbjct  6    EVLSPSSPYVHHNNTTHWFLGDNNIINNNNNRSSTKWTHEENKLFENALALHDKDTPDRW  65

Query  221  QKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVELPSYP----------------DDSF  352
             ++A  IPGK+ LDV+  +  L+ DV +I++G V +P Y                 ++  
Sbjct  66   HRVAEMIPGKTVLDVMKQYHELLADVSDIENGLVPIPGYSTSTTTTTSPFTLDWVNNNCS  125

Query  353  GWDQGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            G+D  +    +   S K  E ERKKG PWTEEEH+
Sbjct  126  GYDGFKGIGAAAKRSSKTPEQERKKGVPWTEEEHK  160



>ref|XP_009344476.1| PREDICTED: transcription factor DIVARICATA-like [Pyrus x bretschneideri]
Length=282

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
             + WT+ E+K+FE +L +F +   DR+Q++A  IPGK+ +DV+  ++ L  DV EI+SGR
Sbjct  12   GSEWTKEENKMFESALAMFDEKSPDRFQRVAEMIPGKTVIDVMKQYQELEEDVCEIESGR  71

Query  320  VEL-PSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKGTPWTEEEHR  457
            V + P YP   F  + G+         +    +  E ER+KG PWT+EEHR
Sbjct  72   VPIPPGYPQSYFRLELGDDRDFDANRKRPLATRGSEQERRKGIPWTQEEHR  122



>ref|XP_002534707.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF27676.1| DNA binding protein, putative [Ricinus communis]
Length=307

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 69/138 (50%), Gaps = 20/138 (14%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S         WT  E+K FE +L LF  D  DRWQK+A+ IPGK+  DV
Sbjct  13   YLENSNWLFQES-----RGTKWTPEENKRFENALALFDKDEPDRWQKVAALIPGKTVGDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSY--PDDSFG--WDQGEPSQISF----------GNSKK  403
            I  +  L  DV +I++G + +P Y    DSF   W  G      F            + +
Sbjct  68   IKQYRELEEDVSDIEAGLIPIPGYSSSSDSFTLEWVNGNQGYDGFKQYYTPGGKRTTATR  127

Query  404  QGEAERKKGTPWTEEEHR  457
              E ERKKG PWTEEEHR
Sbjct  128  PSEQERKKGVPWTEEEHR  145



>ref|XP_009370204.1| PREDICTED: transcription factor DIVARICATA [Pyrus x bretschneideri]
Length=307

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 75/136 (55%), Gaps = 19/136 (14%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  +S     + A WT  E+K+FE +L L+  D  DRW ++A+ IPGK+  DV
Sbjct  13   YLQNSNWLFEES-----TGAEWTVEENKLFENALALYDKDTPDRWLRVAAMIPGKTVGDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSF--------GWDQGEPSQISFGN----SKKQG  409
            I  ++ L  DV +I++G + +P Y  ++F        G+D G     S G     S +  
Sbjct  68   IKQYKELEEDVSDIEAGLIPIPGYISNNFTTEWVNNQGFD-GLEQFYSVGGKRSASTRPA  126

Query  410  EAERKKGTPWTEEEHR  457
            + ERKKG PWTEEEHR
Sbjct  127  DQERKKGVPWTEEEHR  142



>ref|XP_003532025.1| PREDICTED: transcription factor DIVARICATA-like isoform X1 [Glycine 
max]
 ref|XP_006585964.1| PREDICTED: transcription factor DIVARICATA-like isoform X2 [Glycine 
max]
 ref|XP_006585965.1| PREDICTED: transcription factor DIVARICATA-like isoform X3 [Glycine 
max]
 ref|XP_006585966.1| PREDICTED: transcription factor DIVARICATA-like isoform X4 [Glycine 
max]
Length=296

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 73/128 (57%), Gaps = 16/128 (13%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V  + S++ W++ +DK FE +L + P D  DRW+KIA+ +PGK+  ++  H+E LV DV
Sbjct  2    TVDEVGSSSEWSKEQDKAFENALAIHPEDASDRWEKIAADVPGKTLEEIKHHYELLVEDV  61

Query  299  GEIDSGRVELPSY-----------PDDSFGWDQGEP----SQISFGNSKKQGEAERKKGT  433
             +I+SG V LPSY            D+  G   G      ++ + G    + + ER+KG 
Sbjct  62   NQIESGCVPLPSYNSSPEGSTSHASDEGAGKKGGHSWNSNNESNHGTKASRSDQERRKGI  121

Query  434  PWTEEEHR  457
             WTE+EHR
Sbjct  122  AWTEDEHR  129



>ref|XP_006363051.1| PREDICTED: transcription factor DIVARICATA-like [Solanum tuberosum]
Length=292

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 72/137 (53%), Gaps = 19/137 (14%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  ++         WT  E+KVFE++L LF  D  D+W  +A+ IPGK+  DV
Sbjct  13   YIKNSSWLFEEN-----KGTRWTPEENKVFEEALALFDKDTPDKWYNVAAMIPGKTVNDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYP------------DDSF-GWDQGEPSQISFGNSKKQ  406
            I  +  LV D+ +I++G + +P Y              D+F G+ Q        G+S + 
Sbjct  68   IKQYRELVEDISDIEAGLIPVPGYTTSNSFTLEWVNNQDAFHGFKQLYGQSGKRGSSNRS  127

Query  407  GEAERKKGTPWTEEEHR  457
             E ERKKG PWTEEEH+
Sbjct  128  SEHERKKGVPWTEEEHK  144



>ref|XP_010262772.1| PREDICTED: transcription factor DIVARICATA-like [Nelumbo nucifera]
Length=301

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 76/139 (55%), Gaps = 14/139 (10%)
 Frame = +2

Query  83   MMYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSAL  259
            ++  AN+ +   +       ++ WT  E+K+FE +L +F  D  DRW K+AS IPGK+  
Sbjct  8    VLSPANYHFTNSNWFVQESKSSGWTHEENKMFENALAVFDKDTPDRWYKVASMIPGKTVE  67

Query  260  DVIAHFEALVHDVGEIDSGRVELPSYPDDSF--------GWDQGEPSQISFGNSKKQ---  406
            DV+  ++ LV DVG I++GR+ +P Y    F        G+D  + S +S G        
Sbjct  68   DVVKQYKELVADVGHIEAGRIPIPGYRTSPFTLEWVNNRGFDGLKQSFVSGGRRGGGASG  127

Query  407  --GEAERKKGTPWTEEEHR  457
               + ERKKG PWTEEEH+
Sbjct  128  RPSDQERKKGVPWTEEEHK  146



>ref|XP_004168809.1| PREDICTED: transcription factor DIVARICATA-like isoform 1 [Cucumis 
sativus]
 gb|KGN47103.1| hypothetical protein Csa_6G187960 [Cucumis sativus]
Length=315

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 71/128 (55%), Gaps = 16/128 (13%)
 Frame = +2

Query  107  WMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEA  283
            W  GD       A+ WT  E+K+FE +L +F  D  DRWQK+AS IPGK+  DVI  ++ 
Sbjct  20   WSSGDG-----KASRWTVAENKMFENALAIFDTDTPDRWQKVASMIPGKTVGDVIRQYKE  74

Query  284  LVHDVGEIDSGRVELPSYPDDSFGWD-----QGEPSQISFG-----NSKKQGEAERKKGT  433
            L  DV  I++G + +P Y    F  D       +  + S+G     +S +  + ERKKG 
Sbjct  75   LEADVSSIEAGLIPIPGYDTSQFTLDWVNSHSYDGFKQSYGLIGKRSSGRSADQERKKGV  134

Query  434  PWTEEEHR  457
            PWTEEEH+
Sbjct  135  PWTEEEHK  142



>gb|KJB76153.1| hypothetical protein B456_012G075600 [Gossypium raimondii]
Length=278

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 63/107 (59%), Gaps = 5/107 (5%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT+ E+K FE +L ++  D  DRW K+A+ IPGK+  DVI  +  L  DV +I+SGR+ +
Sbjct  27   WTKEENKRFESALAIYGEDVPDRWMKVAAMIPGKTVSDVIKQYRELEEDVFDIESGRIPI  86

Query  329  PSYPDDSFGWDQGEPSQI----SFGNSKKQGEAERKKGTPWTEEEHR  457
            P Y   SF ++  +           N  K  + ERKKG PWTEEEHR
Sbjct  87   PGYLTSSFTFEMVDNHDFEPYRKRSNGAKGPDHERKKGVPWTEEEHR  133



>ref|XP_004246338.1| PREDICTED: transcription factor DIVARICATA-like [Solanum lycopersicum]
Length=292

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 72/137 (53%), Gaps = 19/137 (14%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  ++         WT  E+KVFE++L LF  D  D+W  +A+ IPGK+  DV
Sbjct  13   YIKNSSWLFEEN-----KGTRWTPEENKVFEEALALFDKDTPDKWYNVAAMIPGKTVNDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYP------------DDSF-GWDQGEPSQISFGNSKKQ  406
            I  +  LV D+ +I++G + +P Y              D+F G+ Q        G+S + 
Sbjct  68   IKQYRELVEDISDIEAGLIPVPGYTTSNSFTLEWVNNQDAFHGFKQFYGQSGKRGSSNRS  127

Query  407  GEAERKKGTPWTEEEHR  457
             E ERKKG PWTEEEH+
Sbjct  128  SEHERKKGVPWTEEEHK  144



>ref|XP_008349577.1| PREDICTED: transcription factor DIVARICATA-like [Malus domestica]
 ref|XP_008366242.1| PREDICTED: transcription factor DIVARICATA-like [Malus domestica]
Length=307

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 14/119 (12%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            +A WT  E+K+FE +L ++  D  DRW ++A+ IPGK+  DV   +E L  DVG+I++G 
Sbjct  26   SARWTSAENKMFENALAVYDRDTPDRWHQVAAMIPGKTVRDVKKQYEELEADVGQIEAGL  85

Query  320  VELPSYPDDSF---------GWDQGEPSQISFG----NSKKQGEAERKKGTPWTEEEHR  457
            V +P Y    F         G+D  +     FG    +S +  + ERKKG PWTEEEH+
Sbjct  86   VPIPGYSTSPFTLEWVNRHGGYDGFKQQAYGFGGKRSSSNRPSDHERKKGVPWTEEEHK  144



>ref|XP_009133230.1| PREDICTED: transcription factor DIVARICATA-like [Brassica rapa]
 emb|CDY07753.1| BnaA03g17580D [Brassica napus]
Length=297

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 65/119 (55%), Gaps = 17/119 (14%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT  E+K FE +L  +  D  DRW K+A+ +PGK+  DVI  +  L  D+ +I++G + +
Sbjct  29   WTHEENKKFENALAFYDKDTPDRWNKVAAMLPGKTVGDVIKQYRELEEDLSDIEAGLIPI  88

Query  329  PSYPDDSF-----GWDQGE-----------PSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            P Y  DSF     G+D G             +    G++ +  E ERKKG PWTEEEHR
Sbjct  89   PGYASDSFTLDWGGYDAGNNGFNMNGYYFPAAGGKRGSAARAAEHERKKGVPWTEEEHR  147



>ref|NP_001235748.1| MYB transcription factor MYB75 [Glycine max]
 gb|ABH02835.1| MYB transcription factor MYB75 [Glycine max]
Length=306

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 70/129 (54%), Gaps = 10/129 (8%)
 Frame = +2

Query  86   MYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALD  262
             +  N  W + +S      +  WTR ++K FE +L ++  D  DRW K+A+ IPGK+  D
Sbjct  10   CFMPNSNWFVQES-----HSTEWTREDNKKFESALAIYDNDTPDRWFKVAAMIPGKTVFD  64

Query  263  VIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKG  430
            VI  +  L  DV EI++GRV +P Y   SF ++  +         +    +  + ERKKG
Sbjct  65   VIKQYRELEEDVSEIEAGRVPIPGYLASSFTFELVDNHNYDGCRRRLAPVRGSDQERKKG  124

Query  431  TPWTEEEHR  457
             PWTE+EHR
Sbjct  125  VPWTEDEHR  133



>gb|KHN13083.1| Transcription factor MYB1R1 [Glycine soja]
Length=289

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 69/125 (55%), Gaps = 10/125 (8%)
 Frame = +2

Query  98   NHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAH  274
            N  W + +S++       WTR ++K FE +L ++  D  DRW K+A+ IPGK+  DVI  
Sbjct  3    NSNWFVQESLST-----EWTREDNKKFESALAIYDKDTPDRWFKVAAMIPGKTVFDVIKQ  57

Query  275  FEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKGTPWT  442
            +  L  DV EI++G V +P Y   SF ++  +         +    +  + ERKKG PWT
Sbjct  58   YRELEEDVSEIEAGHVPIPGYLASSFTFELVDNHNYDGCRRRLAPVRGSDQERKKGVPWT  117

Query  443  EEEHR  457
            EEEHR
Sbjct  118  EEEHR  122



>emb|CDX71148.1| BnaC03g12320D [Brassica napus]
Length=289

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 70/135 (52%), Gaps = 17/135 (13%)
 Frame = +2

Query  104  RWMMGDS-----VTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDV  265
             W+M ++     + A   AATWT  E+K FE +L ++ D   DRWQK+A+ I GK+  DV
Sbjct  16   NWLMEETESNVPLAASPDAATWTVAENKAFENALAVYDDNTPDRWQKVAAAISGKTVSDV  75

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSF-----------GWDQGEPSQISFGNSKKQGE  412
            I  +  L  D+  I++G + +P Y    F           G+  G P       + +  E
Sbjct  76   IKQYNDLKADLSSIEAGLIPVPGYITSPFTLDWAAGGGCDGFKPGHPVGNKRSPAGRSPE  135

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEH+
Sbjct  136  LERKKGVPWTEEEHK  150



>ref|XP_003589445.1| Myb-like protein J [Medicago truncatula]
 ref|XP_003628698.1| Myb-like protein J [Medicago truncatula]
 gb|AET03174.1| myb-like transcription factor family protein [Medicago truncatula]
Length=290

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 63/111 (57%), Gaps = 7/111 (6%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            S+  W+R +DK FE +L  +P D  DRW+KIA+ +PGK+  ++  H+  L  D+  I+SG
Sbjct  6    SSCEWSRDQDKAFENTLANYPEDAVDRWEKIAADVPGKTLEEIKRHYVVLFDDINHIESG  65

Query  317  RVELPSYPDDSFGWDQ----GEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
             V LP Y  DSF        GE   +  G        ER+KG PWTE+EHR
Sbjct  66   FVPLPDY--DSFSKSSTTCAGEGGAVKKGTKASSSYQERRKGVPWTEDEHR  114



>ref|XP_009770756.1| PREDICTED: transcription factor DIVARICATA [Nicotiana sylvestris]
Length=282

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 68/119 (57%), Gaps = 13/119 (11%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            S++ W+R +DK FE +L  +P D  DRW+KIAS +PGK+  +V  H++ L+ DV  I+SG
Sbjct  7    SSSIWSREQDKAFENALATYPEDSPDRWEKIASDVPGKTLKEVKHHYDLLLDDVSRIESG  66

Query  317  RVELPSY-----------PDDSFGWDQGEPS-QISFGNSKKQGEAERKKGTPWTEEEHR  457
             V LP Y            D+  G   G  + + + G    + + ER+KG  WTE+EHR
Sbjct  67   CVPLPCYNSSSDSSTSHGADEGIGKKSGNSNGESNHGGKSTRADQERRKGIAWTEDEHR  125



>gb|ACR09741.1| DIV2A protein [Heptacodium miconioides]
Length=253

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 69/115 (60%), Gaps = 7/115 (6%)
 Frame = +2

Query  134  MQSAAT-WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEI  307
            MQS  + WTR E+K FE +L ++  +  DRW K+A+ +PGKS  DV+  ++ LV DV +I
Sbjct  18   MQSCKSKWTREENKCFESALAIYDKETPDRWIKVAALVPGKSEFDVMEQYQELVEDVTDI  77

Query  308  DSGRVELPSY-PDDSFGWD----QGEPSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            ++G V +P Y    SF  D     G  S     ++ +  + ERKKG PWTE+EHR
Sbjct  78   ENGLVPIPGYITKSSFTLDLVHNSGFNSFKKRASTGRSSDHERKKGVPWTEDEHR  132



>emb|CDX93328.1| BnaC04g45680D [Brassica napus]
Length=298

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 17/119 (14%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT  E+K FE +L  +  D  DRW K+A+ +PGK+  DVI  +  L  DV +I++G + +
Sbjct  30   WTAEENKKFENALAFYDKDTSDRWFKVAAMLPGKTVGDVIKQYRELEEDVSDIEAGLIPI  89

Query  329  PSYPDDSF-----GWDQGEP----SQISF-------GNSKKQGEAERKKGTPWTEEEHR  457
            P Y  DSF     G+D G      +   F       G++ +  E ERKKG PWTEEEHR
Sbjct  90   PGYASDSFTLDWGGYDAGNNGFNMNGYYFAAVGGKRGSAARAAEHERKKGVPWTEEEHR  148



>ref|XP_009613368.1| PREDICTED: transcription factor DIVARICATA [Nicotiana tomentosiformis]
Length=290

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 67/119 (56%), Gaps = 13/119 (11%)
 Frame = +2

Query  140  SAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSG  316
            S++ W+R +DK FE +L  +P D  DRW+KIAS +PGK+  +V  H+  L+ DV  I+SG
Sbjct  7    SSSIWSREQDKAFENALATYPEDSPDRWEKIASDVPGKTLKEVKHHYNLLLDDVSRIESG  66

Query  317  RVELPSY-----------PDDSFGWDQGEPS-QISFGNSKKQGEAERKKGTPWTEEEHR  457
             V LP Y            D+  G   G  + + + G    + + ER+KG  WTE+EHR
Sbjct  67   CVPLPCYNSSSDSSTSHGADEGIGKKSGNSNGESNHGGKSTRADQERRKGIAWTEDEHR  125



>gb|KHN20871.1| Transcription factor MYB1R1 [Glycine soja]
Length=295

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 69/125 (55%), Gaps = 10/125 (8%)
 Frame = +2

Query  98   NHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAH  274
            N  W + +S      +  WTR ++K FE +L ++  D  DRW K+A+ IPGK+  DVI  
Sbjct  3    NSNWFVQES-----HSTEWTREDNKKFESALAIYDNDTPDRWFKVAAMIPGKTVFDVIKQ  57

Query  275  FEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKGTPWT  442
            +  L  DV EI++GRV +P Y   SF ++  +         +    +  + ERKKG PWT
Sbjct  58   YRELEEDVSEIEAGRVPIPGYLASSFTFELVDNHNYDGCRRRLAPVRGSDQERKKGVPWT  117

Query  443  EEEHR  457
            E+EHR
Sbjct  118  EDEHR  122



>ref|XP_007153659.1| hypothetical protein PHAVU_003G054100g [Phaseolus vulgaris]
 ref|XP_007153660.1| hypothetical protein PHAVU_003G054100g [Phaseolus vulgaris]
 gb|ESW25653.1| hypothetical protein PHAVU_003G054100g [Phaseolus vulgaris]
 gb|ESW25654.1| hypothetical protein PHAVU_003G054100g [Phaseolus vulgaris]
Length=294

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 74/128 (58%), Gaps = 16/128 (13%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V  + S++ W++ +DK FE +L + P D  DRW+KIA+ +PGK+  ++  H+E LV DV
Sbjct  2    TVDEVGSSSEWSKEQDKAFENALAIHPEDASDRWKKIAADVPGKTLEEIKHHYELLVEDV  61

Query  299  GEIDSGRVELPSYPDDSFG-----WDQGEPSQ----------ISFGNSKKQGEAERKKGT  433
             +I+SG V LPSY   S G      D+G   +           + GN   + + ER+KG 
Sbjct  62   NQIESGCVPLPSYNYSSEGSAGHASDEGAGKKGGSSWNSNNESNHGNKASRSDQERRKGI  121

Query  434  PWTEEEHR  457
             WTE+EH+
Sbjct  122  AWTEDEHK  129



>ref|XP_006848111.1| hypothetical protein AMTR_s00029p00215750 [Amborella trichopoda]
 gb|ERN09692.1| hypothetical protein AMTR_s00029p00215750 [Amborella trichopoda]
Length=285

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 68/114 (60%), Gaps = 9/114 (8%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            ++ WT  E+K+FE++L L+  +  DRW  IA  IPGK+  D++ H++ LV D+  I++G 
Sbjct  12   SSIWTLEENKLFEKALALYDKETPDRWHMIAKIIPGKTISDLMGHYKQLVDDISRIEAGW  71

Query  320  VELPSYPDDSF--GWDQGEPSQI------SFGNSKKQGEAERKKGTPWTEEEHR  457
            +ELPSY    F   W  G+   +      S   S K  + ERKKG PW+E+EHR
Sbjct  72   IELPSYNSSGFRLDWFSGDSQSVDGLKNGSRRASAKPPDHERKKGVPWSEDEHR  125



>ref|XP_008464056.1| PREDICTED: transcription factor DIVARICATA isoform X2 [Cucumis 
melo]
Length=305

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (59%), Gaps = 11/116 (9%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            A+ WT  E+K+FE +L +F  D  DRWQK+AS IPGK+  DVI  ++ L  DV  I++G 
Sbjct  27   ASRWTVAENKMFENALAIFDTDTPDRWQKVASMIPGKTVGDVIRQYKDLEADVSSIEAGL  86

Query  320  VELPSYPDDSFGWD-----QGEPSQISFG-----NSKKQGEAERKKGTPWTEEEHR  457
            + +P Y    F  D       +  + S+G     +S +  + ERKKG PWTEEEH+
Sbjct  87   IPIPGYDTSQFTLDWVNSHSYDGFKQSYGLIGKRSSGRSADQERKKGVPWTEEEHK  142



>ref|XP_002322964.2| hypothetical protein POPTR_0016s11980g [Populus trichocarpa]
 gb|EEF04725.2| hypothetical protein POPTR_0016s11980g [Populus trichocarpa]
Length=307

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 66/135 (49%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W   +S         WT  E+K FE +L L+  D  DRW K+A+ IPGK+  DV
Sbjct  13   YLQNSNWFFHES-----RGTKWTPEENKQFENALALYDKDTPDRWLKVAAMIPGKTVGDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSF-----------GWDQGEPSQISFGNSKKQGE  412
            I  +  L  DV +I++G + +P Y  D F           G  Q        G + +  E
Sbjct  68   IKQYRELEEDVSDIEAGLIPIPGYNSDCFTLEWVSNHGYEGLKQFYSPGGKRGTATRPSE  127

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEHR
Sbjct  128  QERKKGVPWTEEEHR  142



>ref|XP_004492415.1| PREDICTED: transcription factor DIVARICATA-like [Cicer arietinum]
Length=312

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 69/135 (51%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  ++       A WT+ E+K+FE +L  +  D  DRW ++A  IPGK+  DV
Sbjct  26   YIQNSNWLFQEN-----KGAKWTQEENKLFENALAYYDKDTPDRWIRVAEMIPGKTVGDV  80

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFGWD----QGEPSQISF-------GNSKKQGE  412
            I  +  L  DV  I++G + +P Y   SF  D    QG      F       G S +  E
Sbjct  81   IKQYRELEEDVCVIEAGLIPVPGYTTSSFTLDWANNQGFDEFKQFCSVGGKRGASTRPTE  140

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEHR
Sbjct  141  QERKKGVPWTEEEHR  155



>ref|XP_006425017.1| hypothetical protein CICLE_v10028910mg [Citrus clementina]
 ref|XP_006488482.1| PREDICTED: transcription factor DIVARICATA-like [Citrus sinensis]
 gb|ESR38257.1| hypothetical protein CICLE_v10028910mg [Citrus clementina]
 gb|KDO66796.1| hypothetical protein CISIN_1g021816mg [Citrus sinensis]
Length=307

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 77/137 (56%), Gaps = 20/137 (15%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y ++  W++ +S      +  WT  E+K+FE +L ++  D  DRWQK+A+ IPGK+ +DV
Sbjct  13   YISSSNWLLEES-----KSTRWTAAENKMFENALAVYDKDSPDRWQKVAAMIPGKTVVDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDS---------FGWDQGEPSQISFG----NSKKQ  406
            I  ++ L  D+  I++G + LP Y + S          G+D G     + G    +S + 
Sbjct  68   IKQYKELEADISNIEAGLIPLPGYGNSSPFTLEWVNNHGYD-GFKHPYAVGGKRSSSVRP  126

Query  407  GEAERKKGTPWTEEEHR  457
             E ERKKG PWTEEEH+
Sbjct  127  AEHERKKGVPWTEEEHK  143



>ref|XP_008464057.1| PREDICTED: transcription factor DIVARICATA isoform X3 [Cucumis 
melo]
Length=298

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (59%), Gaps = 11/116 (9%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            A+ WT  E+K+FE +L +F  D  DRWQK+AS IPGK+  DVI  ++ L  DV  I++G 
Sbjct  27   ASRWTVAENKMFENALAIFDTDTPDRWQKVASMIPGKTVGDVIRQYKDLEADVSSIEAGL  86

Query  320  VELPSYPDDSFGWD-----QGEPSQISFG-----NSKKQGEAERKKGTPWTEEEHR  457
            + +P Y    F  D       +  + S+G     +S +  + ERKKG PWTEEEH+
Sbjct  87   IPIPGYDTSQFTLDWVNSHSYDGFKQSYGLIGKRSSGRSADQERKKGVPWTEEEHK  142



>ref|XP_008388135.1| PREDICTED: transcription factor DIVARICATA-like [Malus domestica]
Length=304

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 72/132 (55%), Gaps = 17/132 (13%)
 Frame = +2

Query  98   NHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAH  274
            N  W+  +S       A WT  E+K+FE +L L+  D  +RW  +A+ IPGK+  DVI  
Sbjct  14   NSNWLFQES-----KGADWTAEENKLFENALALYDKDTPERWLSVAAMIPGKTVGDVIKQ  68

Query  275  FEALVHDVGEIDSGRVELPSYPDDSFG--W--DQGEPSQISF-------GNSKKQGEAER  421
            ++ L  DV +I++G + +P Y  ++F   W  DQG      F       G S +  + ER
Sbjct  69   YKELEEDVSDIEAGLIPIPGYTSNNFTLEWVNDQGFDGLKQFYSVGGKRGASTRPADQER  128

Query  422  KKGTPWTEEEHR  457
            KKG PWTEEEHR
Sbjct  129  KKGVPWTEEEHR  140



>emb|CDY64223.1| BnaCnng43450D [Brassica napus]
Length=295

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 17/119 (14%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT  E+K FE +L  +  D  DRW K+A+ +PGK+  DVI  +  L  DV +I++G + +
Sbjct  29   WTAEENKKFENALAFYDKDTPDRWFKVAAMLPGKTVGDVIKQYRELEEDVSDIEAGLIPI  88

Query  329  PSYPDDSF-----GWDQGE-----------PSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            P Y  DSF     G+D G             +    G++ +  E ERKKG PWTEEEHR
Sbjct  89   PGYASDSFTLDWGGYDAGSNGFNMNGYYFAAAGGKRGSAARAAEHERKKGVPWTEEEHR  147



>gb|AFH03060.1| R2R3-MYB transcription factor MYB8 [Epimedium sagittatum]
Length=298

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 72/131 (55%), Gaps = 13/131 (10%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y +N  W++  S TA      WT  E+K+FE +L +   +  DRWQK+A  IPGK+  DV
Sbjct  9    YHSNTNWLLEQSKTA-----KWTHEENKLFETALAICDKETPDRWQKVAEMIPGKTVSDV  63

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDD-SFGWDQGEPSQISF------GNSKKQGEAERK  424
            I  ++ L  DV +I++G V +P Y    +  W   +    SF       +S +  E ERK
Sbjct  64   IKQYKELEDDVSDIEAGLVPIPGYTTSFTLDWMNNQTFGQSFDANGKRSSSGRPTEQERK  123

Query  425  KGTPWTEEEHR  457
            KG PWTE+EH+
Sbjct  124  KGVPWTEDEHK  134



>ref|XP_008392914.1| PREDICTED: transcription factor DIVARICATA-like [Malus domestica]
Length=286

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 8/109 (7%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPD-GDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT+ E+K+FE +L +F +   DRW+K+A  IPGK+ +DVI  ++ L  DV EI+SGR  +
Sbjct  19   WTKEENKMFESALAMFDEKTPDRWRKVAEMIPGKTEIDVIKQYQDLEEDVCEIESGRFPI  78

Query  329  -PSYPDDSFGWDQGEPSQISFGNSKKQGEA-----ERKKGTPWTEEEHR  457
             P YP   F  + G+    +  N K+   A     ERK+G PWT EEHR
Sbjct  79   PPGYPQSYFTLELGDDRDFN-ANRKRPAAARGSDQERKRGIPWTPEEHR  126



>ref|XP_011036008.1| PREDICTED: transcription factor DIVARICATA-like [Populus euphratica]
Length=293

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 68/129 (53%), Gaps = 13/129 (10%)
 Frame = +2

Query  86   MYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALD  262
             Y +N  W              WTR E+K FE +L +F + + DRW K+A+ IPGK+  D
Sbjct  8    CYMSNSNWFT--------QTTEWTREENKEFEIALAIFDEHEPDRWLKVAAMIPGKTVYD  59

Query  263  VIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKG  430
            VI  ++ L  DV +I++GRV +P Y   SF +     S       +    K  + +RKKG
Sbjct  60   VIKQYKELEEDVSDIEAGRVPVPGYLSSSFTFQLVGNSNFDAYRKRSLTAKSADQQRKKG  119

Query  431  TPWTEEEHR  457
             PWTE+EHR
Sbjct  120  VPWTEDEHR  128



>ref|XP_006593114.1| PREDICTED: transcription factor DIVARICATA-like [Glycine max]
Length=209

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 20/130 (15%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V  + S++ W+  +DK FE +L + P D  DRW+KI + IPGK+  ++  H+E LV DV
Sbjct  74   TVDEVGSSSEWSTEQDKAFENALAIHPEDASDRWEKIVADIPGKTLEEIKHHYELLVEDV  133

Query  299  GEIDSGRVELPSY-----------PDDSFG------WDQGEPSQISFGNSKKQGEAERKK  427
             +I+SG V LPSY            D+  G      W+    S  + G    + + ER+K
Sbjct  134  NQIESGCVPLPSYNSSPEGSTSHASDEGAGKKGGHSWNSNNES--NHGTKASRSDKERRK  191

Query  428  GTPWTEEEHR  457
            G  WTE+EHR
Sbjct  192  GIAWTEDEHR  201



>ref|XP_006411010.1| hypothetical protein EUTSA_v10017008mg [Eutrema salsugineum]
 gb|ESQ52463.1| hypothetical protein EUTSA_v10017008mg [Eutrema salsugineum]
Length=297

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 65/119 (55%), Gaps = 17/119 (14%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT  E+K FE +L  +  D  DRW K+A+ +PGK+  DVI  +  L  DV +I++G + +
Sbjct  29   WTAEENKKFENALAFYDKDTPDRWVKVAAMLPGKTIGDVIKQYRELEEDVSDIEAGLIPI  88

Query  329  PSYPDDSF-----GWDQGE-----------PSQISFGNSKKQGEAERKKGTPWTEEEHR  457
            P Y  DSF     G+D G             +    G++ +  E ERKKG PWTEEEHR
Sbjct  89   PGYASDSFTLDWGGYDAGNNGFNMNGYYFAAAGGKRGSAARAAEHERKKGVPWTEEEHR  147



>ref|XP_009786719.1| PREDICTED: transcription factor DIVARICATA-like [Nicotiana sylvestris]
Length=283

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 68/137 (50%), Gaps = 19/137 (14%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  ++         WT  E+K+FE +L LF  D  D+W  +A+ IPGK+  DV
Sbjct  13   YIKNSSWLFEEN-----KVTKWTAEENKMFEDALALFDKDTPDKWYNVAAMIPGKTVNDV  67

Query  266  IAHFEALVHDVGEIDSGRVELPSYP-------------DDSFGWDQGEPSQISFGNSKKQ  406
            I  +  LV D+ +I++G + +P Y              D   G+ Q        G S + 
Sbjct  68   IKQYRELVEDISDIEAGLIPVPGYTTSNSFTLEWVNNQDGFHGFKQFYGQNGKRGASNRS  127

Query  407  GEAERKKGTPWTEEEHR  457
             E ERKKG PWTEEEHR
Sbjct  128  SEHERKKGVPWTEEEHR  144



>gb|KHN30676.1| Transcription factor MYB1R1 [Glycine soja]
Length=323

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 79/148 (53%), Gaps = 15/148 (10%)
 Frame = +2

Query  53   KEKLKIAEQMMMYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKI  229
            K +++I      Y+ N  W++ D+ T   +   WT  E+K+FE +L ++  D  +RW K+
Sbjct  2    KWEMEILPPASPYTYNSNWLLDDNRT--NNNTKWTPAENKLFENALAVYDKDTPERWHKV  59

Query  230  ASRIPGKSALDVIAHFEALVHDVGEIDSGRVELPSYPDDS----FGWDQGEPS-------  376
            A  IPGK+ +DV+  ++ L  DV +I++G + +P Y   +    F  D   P+       
Sbjct  60   AEMIPGKTVMDVVKQYKELEADVCDIEAGLISIPGYRSTTTTSPFTLDWVNPAYGDGFKG  119

Query  377  -QISFGNSKKQGEAERKKGTPWTEEEHR  457
                  +S +  E ERKKG PWTEEEH+
Sbjct  120  LTAKRSSSGRPPEQERKKGVPWTEEEHK  147



>ref|XP_008464055.1| PREDICTED: transcription factor DIVARICATA isoform X1 [Cucumis 
melo]
Length=315

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (59%), Gaps = 11/116 (9%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
            A+ WT  E+K+FE +L +F  D  DRWQK+AS IPGK+  DVI  ++ L  DV  I++G 
Sbjct  27   ASRWTVAENKMFENALAIFDTDTPDRWQKVASMIPGKTVGDVIRQYKDLEADVSSIEAGL  86

Query  320  VELPSYPDDSFGWD-----QGEPSQISFG-----NSKKQGEAERKKGTPWTEEEHR  457
            + +P Y    F  D       +  + S+G     +S +  + ERKKG PWTEEEH+
Sbjct  87   IPIPGYDTSQFTLDWVNSHSYDGFKQSYGLIGKRSSGRSADQERKKGVPWTEEEHK  142



>ref|XP_010553252.1| PREDICTED: transcription factor DIVARICATA-like [Tarenaya hassleriana]
Length=293

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 64/126 (51%), Gaps = 21/126 (17%)
 Frame = +2

Query  143  AATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGR  319
               WT  E+K FE +L LF  D  DRW ++A+ +PGK+  DVI  +  L  DV +I++G 
Sbjct  26   GTNWTAEENKKFENALALFDKDTPDRWYRVAAMLPGKTVGDVIKQYRELEEDVSDIEAGL  85

Query  320  VELPSYPDDSF-------GWDQGEPSQISF---------GNSKKQG----EAERKKGTPW  439
            + +P Y  DSF       G D       SF         G  +  G    E ERKKG PW
Sbjct  86   IPIPGYASDSFTLDWGGGGCDGSVAGNNSFNVNGYYYFAGGKRSSGGRTPEQERKKGVPW  145

Query  440  TEEEHR  457
            TEEEHR
Sbjct  146  TEEEHR  151



>ref|XP_011077580.1| PREDICTED: transcription factor DIVARICATA-like [Sesamum indicum]
Length=306

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 71/136 (52%), Gaps = 20/136 (15%)
 Frame = +2

Query  92   SANHRWMMG-DSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            +++  W+ G D VT       WT  E+K FE +L LF  D  DRW  +A+ IPGK+  DV
Sbjct  12   ASSSNWLFGEDKVTK------WTAEENKRFENALALFDKDTPDRWHNVAAMIPGKTVSDV  65

Query  266  IAHFEALVHDVGEIDSGRVELPSY------------PDDSFGWDQGEPSQISFGNSKKQG  409
            I  ++ LV DV +I++G + +P Y            PD   G+ Q          S +  
Sbjct  66   IKQYKELVEDVSDIEAGLIPIPGYGNTPFTLELASDPDYQGGFKQLYSPGGKRNTSTRCP  125

Query  410  EAERKKGTPWTEEEHR  457
            + ERKKG PWTEEEHR
Sbjct  126  DHERKKGVPWTEEEHR  141



>gb|KHG28080.1| Transcription factor MYB1R1 [Gossypium arboreum]
Length=287

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 71/125 (57%), Gaps = 13/125 (10%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V    S++ W+R +DK FE +L  +P D  DRW+KIA+ +PGK+  ++  H+E L  DV
Sbjct  2    TVEEADSSSKWSREQDKAFENALATYPEDSSDRWEKIAADVPGKTLEEIKEHYELLEDDV  61

Query  299  GEIDSGRVELPSY-PDDSFGWDQGE-----------PSQISFGNSKKQGEAERKKGTPWT  442
              I+SG V LP Y   +S   D+G             S+ + G+   + + ER+KG  WT
Sbjct  62   NRIESGCVPLPPYNSSESSAGDEGAGKKGSSHSGNCNSESNHGSKNSRSDQERRKGIAWT  121

Query  443  EEEHR  457
            E+EHR
Sbjct  122  EDEHR  126



>gb|KEH23148.1| MYB transcription factor MYB51 [Medicago truncatula]
Length=313

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 69/135 (51%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  ++     + + WT  E+K+FE +L  +  D  DRW ++A  IPGK+  DV
Sbjct  19   YIQNSNWLFQEN-----NGSKWTSEENKLFENALAYYDKDTPDRWIRVAEMIPGKTVGDV  73

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--WDQGEP----SQISFGNSKKQG-----E  412
            I  +  L  DV  I++G + +P Y   SF   WD  E      Q      K+ G     E
Sbjct  74   IKQYRELEEDVCVIEAGLIPVPGYTTSSFTLDWDNSEGYDEFKQFCSVGGKRNGSTRPSE  133

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEHR
Sbjct  134  QERKKGVPWTEEEHR  148



>ref|XP_002311931.2| syringolide-induced protein 1-3-1B, partial [Populus trichocarpa]
 gb|EEE89298.2| syringolide-induced protein 1-3-1B, partial [Populus trichocarpa]
Length=193

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 66/103 (64%), Gaps = 11/103 (11%)
 Frame = +2

Query  176  FEQSLVLFPDG-DDRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVELPSYPD-DS  349
            FE +LV FP+   DRWQ+I + + G+SA +V   +E L+ DV EIDS R+ELP Y D ++
Sbjct  3    FEAALVNFPEEFRDRWQRIGAYV-GQSAWEVKERYEILIQDVYEIDSDRIELPRYKDEEA  61

Query  350  FGWDQG------EPS-QISFGNSKKQGEAERKKGTPWTEEEHR  457
              WD G       PS QIS G   KQ EAE +KG PWTEEEH+
Sbjct  62   VSWDSGGMVAAAAPSGQISCGGKAKQ-EAEGRKGNPWTEEEHK  103



>ref|XP_010655991.1| PREDICTED: transcription factor DIVARICATA isoform X2 [Vitis 
vinifera]
Length=301

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 73/130 (56%), Gaps = 17/130 (13%)
 Frame = +2

Query  110  MMGDSVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEAL  286
            M GD V+    ++ W+R ++K FE +L  +P D  DRW+KIA+ +PGK+  +V  H+E L
Sbjct  1    MTGDEVS---DSSLWSREQNKAFENALATYPEDLSDRWEKIAADVPGKTLEEVKHHYELL  57

Query  287  VHDVGEIDSGRVELPSYP-----------DDSFG--WDQGEPSQISFGNSKKQGEAERKK  427
            V DV +I+SG V LP Y            D++ G        S+ + G    + + ER+K
Sbjct  58   VEDVTQIESGSVPLPCYNSSSEGSSSHVGDEAVGKKGSHFSNSESNHGGKASRSDQERRK  117

Query  428  GTPWTEEEHR  457
            G  WTE+EHR
Sbjct  118  GVAWTEDEHR  127



>ref|XP_007163513.1| hypothetical protein PHAVU_001G240300g [Phaseolus vulgaris]
 ref|XP_007163514.1| hypothetical protein PHAVU_001G240300g [Phaseolus vulgaris]
 gb|ESW35507.1| hypothetical protein PHAVU_001G240300g [Phaseolus vulgaris]
 gb|ESW35508.1| hypothetical protein PHAVU_001G240300g [Phaseolus vulgaris]
Length=299

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 67/129 (52%), Gaps = 10/129 (8%)
 Frame = +2

Query  86   MYSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALD  262
             + +N  W + +S         WT  E+K FE +L ++  D  DRW ++A+ +PGKS  D
Sbjct  10   CFMSNSNWFVQES-----DYTEWTTEENKKFESALAIYDKDTPDRWLRVAAMLPGKSVYD  64

Query  263  VIAHFEALVHDVGEIDSGRVELPSYPDDSFGWDQGEPSQISFGNSK----KQGEAERKKG  430
            V+  +  L  DV EI++GR+ +P Y    F  +  +         K    +  + ERKKG
Sbjct  65   VMKQYRELEEDVSEIEAGRIPVPGYLTSCFSLEMVDNQCYDACRKKPATVRSSDQERKKG  124

Query  431  TPWTEEEHR  457
             PWTEEEHR
Sbjct  125  IPWTEEEHR  133



>ref|XP_009350979.1| PREDICTED: transcription factor DIVARICATA-like [Pyrus x bretschneideri]
Length=288

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 10/111 (9%)
 Frame = +2

Query  152  WTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVIAHFEALVHDVGEIDSGRVEL  328
            WT+ E+K+FE +L +F +   DRW+K+A  IPGK+ +DVI  ++ L  DV EI+SGR  +
Sbjct  19   WTKEENKMFESALAMFDEKTPDRWRKVAEMIPGKTEIDVIKQYQDLEEDVCEIESGRFPI  78

Query  329  -PSYPDDSFGWDQGEPSQISFGNSKKQGEA-------ERKKGTPWTEEEHR  457
             P YP   F  + G+       N K+  +A       ERKKG PWT EEHR
Sbjct  79   PPGYPQSYFTLELGDDRDFD-ANRKRPAKAAARGSDQERKKGIPWTPEEHR  128



>ref|NP_001240091.1| uncharacterized protein LOC100819797 [Glycine max]
 ref|XP_006601854.1| PREDICTED: uncharacterized protein LOC100819797 isoform X1 [Glycine 
max]
 ref|XP_006601855.1| PREDICTED: uncharacterized protein LOC100819797 isoform X2 [Glycine 
max]
 gb|ACU20895.1| unknown [Glycine max]
 gb|KHN20621.1| Transcription factor MYB1R1 [Glycine soja]
Length=296

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 73/130 (56%), Gaps = 20/130 (15%)
 Frame = +2

Query  122  SVTAMQSAATWTRYEDKVFEQSLVLFP-DGDDRWQKIASRIPGKSALDVIAHFEALVHDV  298
            +V  + S++ W++ +DK FE +L + P D  DRW+KIA+ +PGK+  ++  H+E LV DV
Sbjct  2    TVDEVGSSSQWSKEQDKAFENALAIHPEDASDRWEKIAADVPGKTLEEIKHHYELLVEDV  61

Query  299  GEIDSGRVELPSY---PDDS--------------FGWDQGEPSQISFGNSKKQGEAERKK  427
             +I+SG V LPSY   P+ S                W+    S  + G    + + ER+K
Sbjct  62   SQIESGYVPLPSYNSSPEGSTSHASEEGAGKKGGHSWNSNNES--NHGTKASRSDQERRK  119

Query  428  GTPWTEEEHR  457
            G  WTE+EHR
Sbjct  120  GIAWTEDEHR  129



>gb|ABR28332.1| MYB transcription factor MYB33 [Medicago truncatula]
Length=313

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 69/135 (51%), Gaps = 17/135 (13%)
 Frame = +2

Query  89   YSANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLF-PDGDDRWQKIASRIPGKSALDV  265
            Y  N  W+  ++     + + WT  E+K+FE +L  +  D  DRW ++A  IPGK+  DV
Sbjct  19   YIQNSNWLFQEN-----NGSKWTSEENKLFENALAYYDKDTPDRWIRVAEMIPGKTVGDV  73

Query  266  IAHFEALVHDVGEIDSGRVELPSYPDDSFG--WDQGEP----SQISFGNSKKQG-----E  412
            I  +  L  DV  I++G + +P Y   SF   WD  E      Q      K+ G     E
Sbjct  74   IKQYRELEEDVCVIEAGLIPVPGYTTSSFTLDWDNSEGYDEFKQFCSVGGKRNGSTRPSE  133

Query  413  AERKKGTPWTEEEHR  457
             ERKKG PWTEEEHR
Sbjct  134  QERKKGVPWTEEEHR  148



>ref|XP_009122177.1| PREDICTED: transcription factor DIVARICATA [Brassica rapa]
Length=270

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 77/129 (60%), Gaps = 11/129 (9%)
 Frame = +2

Query  92   SANHRWMMGDSVTAMQSAATWTRYEDKVFEQSLVLFPDGD-DRWQKIASRIPGKSALDVI  268
            +++HR+++ + +    S  TWT+ E+K FE++L ++ D   DRW K+A+ IPGK+  DV+
Sbjct  13   TSDHRFVVQEMMCLQTS--TWTKEENKKFERALAIYADDTPDRWFKVAAMIPGKTISDVM  70

Query  269  AHFEALVHDVGEIDSGRVELPSYPDDSFGWDQ-GEPSQISFGNSKKQGEA-----ERKKG  430
              +  L  D+ +I++G V +P YP  S G+DQ   P        +  G A     +R+KG
Sbjct  71   TQYSKLEEDLFDIEAGLVPIPGYP--SAGFDQLVSPYDHDLYRKRPNGGARGFDQDRRKG  128

Query  431  TPWTEEEHR  457
             PWTEEEHR
Sbjct  129  VPWTEEEHR  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325