BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M15

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596682.1|  PREDICTED: late embryogenesis abundant prote...    106   5e-26   Nicotiana tomentosiformis
ref|XP_009799351.1|  PREDICTED: late embryogenesis abundant prote...    104   4e-25   Nicotiana sylvestris
gb|AEW24432.1|  late embryogenesis abundant protein 3L-1              94.4    2e-21   Camellia sinensis [black tea]
gb|AAC06242.1|  late embryogenis abundant protein 5                   94.0    3e-21   Nicotiana tabacum [American tobacco]
emb|CDP17116.1|  unnamed protein product                              90.9    6e-20   Coffea canephora [robusta coffee]
ref|XP_009799468.1|  PREDICTED: late embryogenesis abundant prote...  90.1    1e-19   Nicotiana sylvestris
gb|AHI85715.1|  stress-induced protein 10                             88.6    4e-19   Capsicum annuum
ref|XP_009601603.1|  PREDICTED: late embryogenesis abundant prote...  88.6    4e-19   Nicotiana tomentosiformis
gb|AHI85716.1|  stress-induced protein 11                             88.6    4e-19   Capsicum annuum
emb|CAA66948.1|  protein induced upon tuberization                    86.3    3e-18   Solanum demissum
ref|XP_009793725.1|  PREDICTED: late embryogenesis abundant prote...  85.1    7e-18   Nicotiana sylvestris
ref|XP_011082454.1|  PREDICTED: late embryogenesis abundant prote...  84.7    9e-18   Sesamum indicum [beniseed]
gb|ABB87099.1|  unknown                                               83.6    3e-17   Solanum tuberosum [potatoes]
ref|XP_004247410.1|  PREDICTED: indole-3-acetic acid-induced prot...  83.6    3e-17   
ref|NP_001275471.1|  uncharacterized protein LOC102577657             82.4    8e-17   Solanum tuberosum [potatoes]
gb|ADW66129.1|  late embryogenesis abundant protein Lea5              81.6    1e-16   Solanum nigrum
ref|XP_009594113.1|  PREDICTED: indole-3-acetic acid-induced prot...  81.3    2e-16   Nicotiana tomentosiformis
ref|XP_006355810.1|  PREDICTED: late embryogenesis abundant prote...  79.3    8e-16   Solanum tuberosum [potatoes]
emb|CDY55365.1|  BnaA02g36510D                                        77.8    4e-15   Brassica napus [oilseed rape]
emb|CDY01913.1|  BnaC02g28140D                                        77.8    4e-15   
gb|EYU46739.1|  hypothetical protein MIMGU_mgv1a017080mg              77.4    6e-15   Erythranthe guttata [common monkey flower]
ref|XP_009111293.1|  PREDICTED: indole-3-acetic acid-induced prot...  77.0    6e-15   Brassica rapa
ref|XP_009772870.1|  PREDICTED: indole-3-acetic acid-induced prot...  77.0    8e-15   Nicotiana sylvestris
emb|CDY22046.1|  BnaA09g00750D                                        76.3    1e-14   Brassica napus [oilseed rape]
ref|XP_009144576.1|  PREDICTED: indole-3-acetic acid-induced prot...  76.3    1e-14   Brassica rapa
emb|CDY50390.1|  BnaCnng19220D                                        76.3    1e-14   Brassica napus [oilseed rape]
ref|NP_567231.1|  senescence-associated protein SAG21                 75.9    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004240547.1|  PREDICTED: late embryogenesis abundant prote...  75.1    3e-14   Solanum lycopersicum
ref|XP_002872843.1|  hypothetical protein ARALYDRAFT_327563           77.0    4e-14   
ref|XP_006288964.1|  hypothetical protein CARUB_v10002338mg           74.7    5e-14   Capsella rubella
ref|XP_010456043.1|  PREDICTED: late embryogenesis abundant prote...  74.3    7e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010429564.1|  PREDICTED: late embryogenesis abundant prote...  74.3    8e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004165917.1|  PREDICTED: late embryogenesis abundant prote...  74.3    9e-14   
gb|AAC19273.1|  T14P8.2                                               75.9    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422602.1|  PREDICTED: late embryogenesis abundant prote...  73.6    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_006396445.1|  hypothetical protein EUTSA_v10029091mg           73.6    1e-13   Eutrema salsugineum [saltwater cress]
ref|XP_002270639.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.8    2e-13   Vitis vinifera
ref|XP_011079638.1|  PREDICTED: late embryogenesis abundant prote...  72.0    4e-13   Sesamum indicum [beniseed]
ref|XP_010069902.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.0    5e-13   Eucalyptus grandis [rose gum]
ref|XP_004136021.1|  PREDICTED: indole-3-acetic acid-induced prot...  72.0    6e-13   Cucumis sativus [cucumbers]
ref|XP_007050958.1|  Indole-3-acetic acid-induced protein ARG2, p...  71.6    6e-13   
gb|KFK30826.1|  hypothetical protein AALP_AA6G030900                  71.6    7e-13   Arabis alpina [alpine rockcress]
emb|CDY57180.1|  BnaC03g73200D                                        70.5    2e-12   Brassica napus [oilseed rape]
ref|XP_010684355.1|  PREDICTED: late embryogenesis abundant prote...  70.5    2e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010069903.1|  PREDICTED: indole-3-acetic acid-induced prot...  70.1    2e-12   
gb|KJB23299.1|  hypothetical protein B456_004G090700                  70.5    3e-12   Gossypium raimondii
ref|XP_008451558.1|  PREDICTED: indole-3-acetic acid-induced prot...  70.1    3e-12   Cucumis melo [Oriental melon]
ref|XP_009134437.1|  PREDICTED: indole-3-acetic acid-induced prot...  69.3    5e-12   Brassica rapa
ref|XP_006444379.1|  hypothetical protein CICLE_v10023029mg           68.6    1e-11   
gb|ABG54481.1|  late embryogenesis abundant protein                   68.6    1e-11   Tamarix androssowii
gb|KJB23300.1|  hypothetical protein B456_004G090800                  67.0    4e-11   Gossypium raimondii
ref|XP_004165915.1|  PREDICTED: late embryogenesis abundant prote...  67.0    6e-11   
gb|KJB23298.1|  hypothetical protein B456_004G090700                  66.2    6e-11   Gossypium raimondii
ref|XP_006479985.1|  PREDICTED: indole-3-acetic acid-induced prot...  65.9    7e-11   Citrus sinensis [apfelsine]
gb|KCW58419.1|  hypothetical protein EUGRSUZ_H01105                   66.2    7e-11   Eucalyptus grandis [rose gum]
gb|KJB24378.1|  hypothetical protein B456_004G142600                  65.1    2e-10   Gossypium raimondii
ref|XP_002523101.1|  Indole-3-acetic acid-induced protein ARG2, p...  64.7    2e-10   Ricinus communis
ref|NP_001078346.1|  senescence-associated protein SAG21              64.3    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010026124.1|  PREDICTED: late embryogenesis abundant prote...  65.9    2e-10   Eucalyptus grandis [rose gum]
dbj|BAH57115.1|  AT4G02380                                            65.1    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAC39464.1|  late embryogenesis abundant protein homolog           63.9    2e-10   
ref|XP_006303463.1|  hypothetical protein CARUB_v10010737mg           63.9    4e-10   Capsella rubella
gb|KHG16920.1|  Indole-3-acetic acid-induced ARG2                     63.5    6e-10   Gossypium arboreum [tree cotton]
ref|XP_010325649.1|  PREDICTED: late embryogenesis abundant prote...  63.2    7e-10   Solanum lycopersicum
ref|XP_004246056.1|  PREDICTED: late embryogenesis abundant prote...  63.2    8e-10   Solanum lycopersicum
gb|KHG30665.1|  Late embryogenesis abundant Lea5-A                    63.2    8e-10   Gossypium arboreum [tree cotton]
ref|XP_002301483.2|  hypothetical protein POPTR_0002s20480g           63.9    9e-10   
gb|KHN26544.1|  Late embryogenesis abundant protein Lea5              62.8    9e-10   Glycine soja [wild soybean]
gb|AFK37878.1|  unknown                                               62.8    1e-09   Lotus japonicus
ref|XP_011042051.1|  PREDICTED: indole-3-acetic acid-induced prot...  62.4    1e-09   Populus euphratica
ref|XP_010474858.1|  PREDICTED: late embryogenesis abundant prote...  62.8    1e-09   Camelina sativa [gold-of-pleasure]
gb|KDP28178.1|  hypothetical protein JCGZ_13949                       62.4    1e-09   Jatropha curcas
ref|XP_008784753.1|  PREDICTED: late embryogenesis abundant prote...  62.4    1e-09   Phoenix dactylifera
ref|XP_007138926.1|  hypothetical protein PHAVU_009G249500g           62.4    1e-09   Phaseolus vulgaris [French bean]
gb|ABF29697.1|  late embryogenesis abundant protein 5                 62.4    1e-09   Populus suaveolens [Mongolian poplar]
ref|XP_003546362.1|  PREDICTED: late embryogenesis abundant prote...  62.4    1e-09   Glycine max [soybeans]
gb|ABK95975.1|  unknown                                               62.4    1e-09   Populus trichocarpa [western balsam poplar]
gb|KDO71712.1|  hypothetical protein CISIN_1g034332mg                 62.4    1e-09   Citrus sinensis [apfelsine]
ref|XP_010259514.1|  PREDICTED: late embryogenesis abundant prote...  62.4    1e-09   Nelumbo nucifera [Indian lotus]
ref|XP_002892126.1|  late embryogenesis abundant 3 family protein     62.0    2e-09   Arabidopsis lyrata subsp. lyrata
gb|EPS70797.1|  hypothetical protein M569_03965                       62.0    2e-09   Genlisea aurea
ref|XP_007035627.1|  Late embryogenesis abundant protein Lea5-D       62.4    2e-09   Theobroma cacao [chocolate]
ref|XP_006586916.1|  PREDICTED: late embryogenesis abundant prote...  62.4    2e-09   
ref|XP_011009435.1|  PREDICTED: indole-3-acetic acid-induced prot...  62.0    2e-09   Populus euphratica
gb|ABK96509.1|  unknown                                               62.0    2e-09   Populus trichocarpa x Populus deltoides
gb|ADP23916.1|  late embryogenesis abundant protein                   62.0    2e-09   Sesuvium portulacastrum [sea-purslane]
ref|NP_001276069.1|  late embryogenesis abundant protein Lea5         61.6    3e-09   Citrus sinensis [apfelsine]
gb|KDP28177.1|  hypothetical protein JCGZ_13948                       61.2    3e-09   Jatropha curcas
ref|XP_006576268.1|  PREDICTED: indole-3-acetic acid induced prot...  61.2    3e-09   
ref|XP_002321000.2|  hypothetical protein POPTR_0014s12250g           62.0    3e-09   
gb|KJB72703.1|  hypothetical protein B456_011G191500                  61.2    4e-09   Gossypium raimondii
ref|XP_008359415.1|  PREDICTED: indole-3-acetic acid-induced prot...  61.2    4e-09   
ref|NP_001238473.1|  indole-3-acetic acid induced protein ARG-2 h...  60.8    4e-09   
gb|KEH24388.1|  late embryogenesis abundant protein                   60.8    5e-09   Medicago truncatula
gb|KJB72701.1|  hypothetical protein B456_011G191500                  60.8    5e-09   Gossypium raimondii
gb|AAW31666.1|  putative late-embryogenesis protein-like protein      60.8    5e-09   Ammopiptanthus mongolicus
ref|XP_010921656.1|  PREDICTED: late embryogenesis abundant prote...  60.8    5e-09   Elaeis guineensis
sp|P46522.1|LEA5D_GOSHI  RecName: Full=Late embryogenesis abundan...  60.5    7e-09   Gossypium hirsutum [American cotton]
ref|NP_001042873.1|  Os01g0314800                                     60.1    7e-09   
gb|KHN43505.1|  Indole-3-acetic acid-induced protein ARG2             60.1    8e-09   Glycine soja [wild soybean]
gb|KDO71708.1|  hypothetical protein CISIN_1g034332mg                 60.1    9e-09   Citrus sinensis [apfelsine]
ref|XP_006419542.1|  hypothetical protein CICLE_v10006308mg           59.7    9e-09   
emb|CAA38314.1|  late embryogenesis abundant protein                  60.1    9e-09   Gossypium hirsutum [American cotton]
ref|NP_001237596.1|  uncharacterized protein LOC100527032             60.1    1e-08   Glycine max [soybeans]
gb|KDP27814.1|  hypothetical protein JCGZ_18894                       60.1    1e-08   Jatropha curcas
gb|KJB22519.1|  hypothetical protein B456_004G052200                  59.7    1e-08   Gossypium raimondii
ref|XP_010522797.1|  PREDICTED: indole-3-acetic acid-induced prot...  59.7    1e-08   Tarenaya hassleriana [spider flower]
sp|P46521.1|LEA5A_GOSHI  RecName: Full=Late embryogenesis abundan...  59.7    1e-08   Gossypium hirsutum [American cotton]
gb|KDO71713.1|  hypothetical protein CISIN_1g034332mg                 59.3    1e-08   Citrus sinensis [apfelsine]
ref|XP_010088289.1|  Indole-3-acetic acid-induced protein ARG2        59.7    1e-08   Morus notabilis
gb|AGW45454.1|  late embryogenesis abundant protein                   59.7    1e-08   Reaumuria trigyna
ref|XP_009335697.1|  PREDICTED: indole-3-acetic acid-induced prot...  59.7    1e-08   Pyrus x bretschneideri [bai li]
ref|XP_010039859.1|  PREDICTED: late embryogenesis abundant prote...  59.7    2e-08   Eucalyptus grandis [rose gum]
ref|XP_007201902.1|  hypothetical protein PRUPE_ppa013814mg           59.3    2e-08   Prunus persica
gb|AFN85538.1|  late embryogenesis abundant protein                   57.8    2e-08   Olea europaea
gb|ACV50424.1|  late embryogenesis protein-5                          58.9    2e-08   Jatropha curcas
ref|NP_171781.1|  late embryogenesis abundant 3-like protein          58.9    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414427.1|  hypothetical protein EUTSA_v10026659mg           58.9    2e-08   Eutrema salsugineum [saltwater cress]
ref|NP_193326.4|  protein DROUGHT-INDUCED 21                          58.9    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52818.1|  hypothetical protein Csa_4G001850                     58.5    3e-08   Cucumis sativus [cucumbers]
gb|KFK42636.1|  hypothetical protein AALP_AA1G021000                  58.5    3e-08   Arabis alpina [alpine rockcress]
gb|ABD93882.1|  group 5 late embryogenesis abundant protein           58.5    3e-08   Citrus unshiu [satsuma mandarin]
ref|XP_009335719.1|  PREDICTED: indole-3-acetic acid-induced prot...  58.9    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_010457272.1|  PREDICTED: late embryogenesis abundant prote...  58.5    3e-08   Camelina sativa [gold-of-pleasure]
gb|EPS60179.1|  hypothetical protein M569_14625                       58.2    3e-08   Genlisea aurea
ref|XP_010269579.1|  PREDICTED: late embryogenesis abundant prote...  58.5    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_009146595.1|  PREDICTED: late embryogenesis abundant prote...  58.5    3e-08   Brassica rapa
dbj|BAF00107.1|  hypothetical protein                                 57.4    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146587.1|  PREDICTED: late embryogenesis abundant prote...  58.5    3e-08   Brassica rapa
ref|XP_009348806.1|  PREDICTED: indole-3-acetic acid-induced prot...  58.5    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_006418300.1|  hypothetical protein EUTSA_v10009185mg           58.2    4e-08   Eutrema salsugineum [saltwater cress]
ref|NP_001238729.1|  uncharacterized protein LOC100306430             58.2    4e-08   
ref|XP_007145200.1|  hypothetical protein PHAVU_007G218700g           58.2    5e-08   Phaseolus vulgaris [French bean]
ref|XP_008235109.1|  PREDICTED: indole-3-acetic acid-induced prot...  58.2    5e-08   Prunus mume [ume]
emb|CAB10370.1|  drought-induced protein like                         57.8    5e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20395.1|  Indole-3-acetic acid-induced protein ARG2             57.8    6e-08   Glycine soja [wild soybean]
sp|P32292.1|ARG2_VIGRR  RecName: Full=Indole-3-acetic acid-induce...  57.8    7e-08   Vigna radiata var. radiata [golden gram]
ref|XP_008369025.1|  PREDICTED: indole-3-acetic acid-induced prot...  57.8    7e-08   
ref|XP_008454329.1|  PREDICTED: late embryogenesis abundant prote...  57.4    7e-08   Cucumis melo [Oriental melon]
ref|XP_008454328.1|  PREDICTED: late embryogenesis abundant prote...  57.0    9e-08   
gb|ABK26089.1|  unknown                                               57.4    9e-08   Picea sitchensis
emb|CDY44170.1|  BnaC01g22200D                                        57.4    9e-08   Brassica napus [oilseed rape]
gb|KDO71707.1|  hypothetical protein CISIN_1g034332mg                 57.0    1e-07   Citrus sinensis [apfelsine]
gb|AFK35936.1|  unknown                                               57.0    1e-07   Medicago truncatula
ref|XP_006284808.1|  hypothetical protein CARUB_v10006078mg           57.0    1e-07   Capsella rubella
ref|XP_004296856.1|  PREDICTED: late embryogenesis abundant prote...  56.6    1e-07   Fragaria vesca subsp. vesca
ref|XP_010105150.1|  Late embryogenesis abundant protein Lea5         56.6    1e-07   Morus notabilis
gb|ABK25244.1|  unknown                                               57.0    2e-07   Picea sitchensis
gb|ABK24221.1|  unknown                                               57.4    2e-07   Picea sitchensis
gb|ACJ46652.1|  intrinsically disordered protein 1                    56.2    2e-07   Lotus japonicus
ref|XP_007163120.1|  hypothetical protein PHAVU_001G207900g           56.6    2e-07   Phaseolus vulgaris [French bean]
ref|XP_002315512.1|  hypothetical protein POPTR_0010s01590g           56.6    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004494380.1|  PREDICTED: indole-3-acetic acid-induced prot...  56.2    2e-07   Cicer arietinum [garbanzo]
ref|XP_004967516.1|  PREDICTED: late embryogenesis abundant prote...  56.2    2e-07   Setaria italica
emb|CDY15266.1|  BnaC05g01450D                                        56.2    2e-07   Brassica napus [oilseed rape]
ref|XP_010914474.1|  PREDICTED: late embryogenesis abundant prote...  56.2    2e-07   Elaeis guineensis
gb|ABK23144.1|  unknown                                               56.2    2e-07   Picea sitchensis
ref|XP_010931673.1|  PREDICTED: late embryogenesis abundant prote...  56.2    2e-07   Elaeis guineensis
ref|XP_011010195.1|  PREDICTED: late embryogenesis abundant prote...  56.2    2e-07   Populus euphratica
gb|AFK36920.1|  unknown                                               55.8    2e-07   Lotus japonicus
ref|XP_009119608.1|  PREDICTED: late embryogenesis abundant prote...  55.8    3e-07   Brassica rapa
ref|XP_008789853.1|  PREDICTED: late embryogenesis abundant prote...  55.8    3e-07   Phoenix dactylifera
gb|ACJ84182.1|  unknown                                               55.8    3e-07   Medicago truncatula
gb|AFK48640.1|  unknown                                               55.8    3e-07   Lotus japonicus
emb|CDY69011.1|  BnaAnng29120D                                        54.7    3e-07   Brassica napus [oilseed rape]
ref|XP_002870200.1|  hypothetical protein ARALYDRAFT_493294           55.8    3e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_004290804.1|  PREDICTED: indole-3-acetic acid-induced prot...  55.5    3e-07   Fragaria vesca subsp. vesca
gb|ACJ09640.1|  putative late embryogenesis abundant protein          56.2    4e-07   Cupressus sempervirens
ref|XP_010449879.1|  PREDICTED: late embryogenesis abundant prote...  55.5    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_008223211.1|  PREDICTED: late embryogenesis abundant prote...  55.5    4e-07   Prunus mume [ume]
ref|NP_001237743.1|  uncharacterized protein LOC100306369             55.1    5e-07   Glycine max [soybeans]
ref|XP_010548983.1|  PREDICTED: late embryogenesis abundant prote...  55.1    6e-07   Tarenaya hassleriana [spider flower]
gb|ADB85105.1|  putative indole-3-acetic acid-induced protein ARG2    53.5    6e-07   Jatropha curcas
ref|NP_001237642.1|  uncharacterized protein LOC100500411             54.7    6e-07   
ref|XP_004967515.1|  PREDICTED: late embryogenesis abundant prote...  54.3    9e-07   Setaria italica
gb|AJA33571.1|  late embryogenesis abundant protein LEA3-2            54.3    9e-07   Pinus tabuliformis [southern Chinese pine]
gb|AJA33572.1|  late embryogenesis abundant protein LEA3-3            54.7    9e-07   Pinus tabuliformis [southern Chinese pine]
ref|XP_008673995.1|  PREDICTED: late embryogenesis abundant prote...  54.3    9e-07   
ref|XP_002516942.1|  Late embryogenesis abundant protein Lea5, pu...  54.3    1e-06   Ricinus communis
ref|XP_007227374.1|  hypothetical protein PRUPE_ppa027021mg           53.9    1e-06   
ref|XP_010481253.1|  PREDICTED: late embryogenesis abundant prote...  53.9    1e-06   
ref|XP_010434909.1|  PREDICTED: late embryogenesis abundant prote...  54.3    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002457756.1|  hypothetical protein SORBIDRAFT_03g012940        53.9    1e-06   Sorghum bicolor [broomcorn]
ref|XP_007147243.1|  hypothetical protein PHAVU_006G107900g           53.5    2e-06   Phaseolus vulgaris [French bean]
ref|XP_004152362.1|  PREDICTED: indole-3-acetic acid-induced prot...  53.9    2e-06   
gb|ABK93850.1|  unknown                                               53.5    2e-06   Populus trichocarpa [western balsam poplar]
gb|AAM28284.1|  late-embryogenesis abundant protein-like protein      52.8    3e-06   Ananas comosus
ref|XP_009417840.1|  PREDICTED: late embryogenesis abundant prote...  52.8    3e-06   
ref|NP_001152662.1|  late embryogenesis abundant protein              52.8    4e-06   Zea mays [maize]
gb|AGC51784.1|  ATDI21                                                52.8    4e-06   Manihot esculenta [manioc]
ref|XP_004508204.1|  PREDICTED: late embryogenesis abundant prote...  52.8    4e-06   Cicer arietinum [garbanzo]
ref|XP_008812281.1|  PREDICTED: late embryogenesis abundant prote...  52.4    4e-06   Phoenix dactylifera
ref|NP_001147291.1|  LOC100280899                                     52.4    4e-06   Zea mays [maize]
ref|XP_008807301.1|  PREDICTED: late embryogenesis abundant prote...  52.4    4e-06   Phoenix dactylifera
tpg|DAA54394.1|  TPA: late embryogeneis abundant protein              52.4    5e-06   
ref|XP_003609687.1|  Late embryogenesis abundant protein Lea5         52.4    5e-06   Medicago truncatula
gb|ABK21424.1|  unknown                                               52.4    5e-06   Picea sitchensis
gb|ABR16260.1|  unknown                                               52.4    5e-06   Picea sitchensis
emb|CDY49968.1|  BnaC08g10490D                                        52.0    5e-06   Brassica napus [oilseed rape]
ref|XP_010440235.1|  PREDICTED: late embryogenesis abundant prote...  52.0    6e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009352286.1|  PREDICTED: late embryogenesis abundant prote...  52.0    7e-06   Pyrus x bretschneideri [bai li]
ref|XP_006644122.1|  PREDICTED: LOW QUALITY PROTEIN: late embryog...  52.0    7e-06   Oryza brachyantha
ref|NP_001235600.1|  desiccation protective protein LEA5              52.4    7e-06   Glycine max [soybeans]
gb|AJA33570.1|  late embryogenesis abundant protein LEA3-1            52.0    8e-06   Pinus tabuliformis [southern Chinese pine]
ref|XP_009405433.1|  PREDICTED: late embryogenesis abundant prote...  51.6    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADQ91844.1|  late embryogenesis abundant protein group 6 protein   51.2    1e-05   Arachis hypogaea [goober]
gb|EMT12321.1|  Late embryogenesis abundant protein Lea5              50.8    2e-05   
ref|NP_001148295.1|  protein induced upon tuberization                50.8    2e-05   
dbj|BAJ92313.1|  predicted protein                                    50.4    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABG66530.1|  putative late embryogenesis abundant protein          50.4    2e-05   Prosopis juliflora [algorrobo]
gb|ABK23388.1|  unknown                                               50.1    3e-05   Picea sitchensis
ref|XP_010544998.1|  PREDICTED: late embryogenesis abundant prote...  49.7    4e-05   Tarenaya hassleriana [spider flower]
ref|XP_006840483.1|  hypothetical protein AMTR_s00045p00188290        49.7    4e-05   Amborella trichopoda
ref|XP_006840482.1|  hypothetical protein AMTR_s00045p00188150        49.7    5e-05   
ref|XP_002457757.1|  hypothetical protein SORBIDRAFT_03g012950        49.7    5e-05   Sorghum bicolor [broomcorn]
emb|CDM85327.1|  unnamed protein product                              49.3    5e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003567608.1|  PREDICTED: late embryogenesis abundant prote...  49.3    6e-05   Brachypodium distachyon [annual false brome]
ref|XP_008390644.1|  PREDICTED: late embryogenesis abundant prote...  49.3    6e-05   
gb|AFU81504.1|  LEA5-2.1                                              49.3    7e-05   Vigna unguiculata
ref|XP_007154177.1|  hypothetical protein PHAVU_003G096700g           48.9    9e-05   Phaseolus vulgaris [French bean]
gb|AFU81503.1|  LEA5-1                                                48.9    1e-04   Vigna unguiculata
gb|AFK39986.1|  unknown                                               48.9    1e-04   Lotus japonicus
gb|AAZ20280.1|  lea protein 3                                         48.5    1e-04   Arachis hypogaea [goober]
gb|ACF74336.1|  putative late-embryogenesis protein                   48.5    1e-04   Arachis hypogaea [goober]
ref|XP_008386774.1|  PREDICTED: indole-3-acetic acid-induced prot...  48.5    2e-04   
gb|ABC41130.1|  late embryognesis-abundant 5 protein                  46.2    4e-04   Arachis hypogaea [goober]
gb|ADE32492.1|  putative ABA-responsive LEA-like protein              46.6    5e-04   Picea purpurea
gb|AIE55471.1|  ABA-responsive LEA-like protein                       46.2    5e-04   Picea smithiana
ref|XP_008649522.1|  PREDICTED: late embryogenesis abundant prote...  46.6    5e-04   Zea mays [maize]
gb|ABK21040.1|  unknown                                               46.6    5e-04   Picea sitchensis
gb|ABA54780.1|  ABA-responsive LEA-like protein                       46.6    6e-04   Picea glauca
gb|AAK16696.1|AF323612_1  zinc-induced protein                        46.6    7e-04   Oryza sativa [red rice]
gb|ABA54779.1|  ABA-responsive LEA-like protein                       46.2    9e-04   Picea glauca



>ref|XP_009596682.1| PREDICTED: late embryogenesis abundant protein Lea5 [Nicotiana 
tomentosiformis]
Length=93

 Score =   106 bits (265),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 4/97 (4%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS SN+K +SAFV+D    + +   +    A  +    +G  N M+KKGG+ES K  T
Sbjct  1    MARSFSNSKLISAFVVD----TVSSFVSRRGYASSAGVRGSGVINIMMKKGGEESSKRTT  56

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            SW+PDPVTGYYRPESH  E+DAAELRQMLLK+  RQH
Sbjct  57   SWVPDPVTGYYRPESHAKEIDAAELRQMLLKHKPRQH  93



>ref|XP_009799351.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Nicotiana 
sylvestris]
Length=98

 Score =   104 bits (259),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsv-satrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA  292
            MARS SN+K +SAFV+D VS   + R Y AA++A           N M+KKGG+ES K  
Sbjct  1    MARSFSNSKLISAFVVDTVSSFVSRRGYAAASSASVPGGVRGSGVNIMMKKGGEESSKKT  60

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            TSW+PDPVTGYYRPESH  E+DAAELRQMLL +  RQH
Sbjct  61   TSWVPDPVTGYYRPESHAKEIDAAELRQMLLNHKPRQH  98



>gb|AEW24432.1| late embryogenesis abundant protein 3L-1 [Camellia sinensis]
Length=96

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS SNAK +SAFV+DR+S++ TR   AAA+   +   V  R   M KK G+E   + T
Sbjct  1    MARSFSNAKLLSAFVVDRISLAVTRRGYAAASQGVASGPVTARGGVMGKKDGEEEA-TKT  59

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            SW+PDPVTGYYRPE+  NE+D AELR+MLLKN  R+H
Sbjct  60   SWVPDPVTGYYRPENKANEIDVAELREMLLKNKIRRH  96



>gb|AAC06242.1| late embryogenis abundant protein 5 [Nicotiana tabacum]
Length=97

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS SN+K +SAFV+D VS   +R   AAA++     GV G    ++ K  +ES K  T
Sbjct  1    MARSFSNSKLISAFVVDTVSSFVSRRGYAAASSASVPGGVRGSGVNIMMKKWEESSKKTT  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            SW+PDPVTGYYRPESH  E+DAAELRQMLL +  RQH
Sbjct  61   SWVPDPVTGYYRPESHAKEIDAAELRQMLLNHKPRQH  97



>emb|CDP17116.1| unnamed protein product [Coffea canephora]
Length=99

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 5/97 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatr-----sytaaaaaqgsvsgvagrsNAMLKKGGDES  280
            MARS  NAK +SAFV+ R+SV+A+R     +  A+  A          +N M KKGG+ES
Sbjct  1    MARSFPNAKLISAFVVQRISVAASRHARGYAAGASQGAVPGSMRGGSNANMMRKKGGEES  60

Query  281  GKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
                TSW+PDPVTGYYRPE+H  E+DAAELR MLLK+
Sbjct  61   SSKTTSWVPDPVTGYYRPETHAAEIDAAELRNMLLKH  97



>ref|XP_009799468.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Nicotiana 
sylvestris]
Length=96

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MAR  SN+K VSAF++D    +A      AAA+QG V G   R+N ++KKG +ES K+ T
Sbjct  1    MARFFSNSKIVSAFIVD-SVSAAINRRGYAAASQGVVKGGVVRNNVLMKKGVEESNKT-T  58

Query  296  SWIPDPVTGYYRPESHVN-EVDAAELRQMLLKNTTRQH  406
            SW+PDPVTGYYRPE+HVN E+DAAELR+MLLK+   QH
Sbjct  59   SWVPDPVTGYYRPETHVNKEIDAAELRKMLLKHKPSQH  96



>gb|AHI85715.1| stress-induced protein 10 [Capsicum annuum]
Length=96

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MAR  SN+K V AFV+D    +A +    AAA+QG+ SG    SN M+KK   ES K+ T
Sbjct  1    MARYFSNSKIVCAFVVD-SVYAAIQRRGYAAASQGAASGNGRSSNVMMKKVVKESNKTTT  59

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQ  403
            SW PDPVTGYYRPESHV E+DAAELR MLLK+  RQ
Sbjct  60   SWGPDPVTGYYRPESHVKEIDAAELRNMLLKHKPRQ  95



>ref|XP_009601603.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Nicotiana 
tomentosiformis]
Length=96

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 3/98 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS SN+K VSAF++D    +A      AAA+QG+V G   RSN  +KKG +ES K+  
Sbjct  1    MARSFSNSKIVSAFIVD-SLSAAINRRGYAAASQGAVRGGVVRSNVTMKKGVEESNKT-I  58

Query  296  SWIPDPVTGYYRPESHVN-EVDAAELRQMLLKNTTRQH  406
            SW+PDPVTGYYRPESH N E+DAAELR+MLLK+   QH
Sbjct  59   SWVPDPVTGYYRPESHANKEIDAAELRKMLLKHKPSQH  96



>gb|AHI85716.1| stress-induced protein 11 [Capsicum annuum]
Length=96

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MAR   N+K V AFV+D    +A +    A A+Q + S     SN M+KK   ES K+ T
Sbjct  1    MARYFPNSKIVCAFVVD-SISAAIQRRGYAMASQVAASSNGRSSNVMMKKVVKESNKTTT  59

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQ  403
            SW PDPVTGYYRPESHV E+DAAELR MLLK+  RQ
Sbjct  60   SWGPDPVTGYYRPESHVKEIDAAELRNMLLKHKPRQ  95



>emb|CAA66948.1| protein induced upon tuberization [Solanum demissum]
Length=98

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 64/95 (67%), Gaps = 5/95 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagr---sNAMLKKGGDESGK  286
            MARS SN+K +SAFV D VS   +R   AAA+         G    SN M++K G+ES K
Sbjct  1    MARSFSNSKILSAFVSDSVSAFLSRRGYAAASQGAVSGVAKGGVPRSNVMMQKSGEESVK  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
              TSW+PDPVTGYYRPE   NE+DAAELR+MLLKN
Sbjct  61   --TSWVPDPVTGYYRPEGQANEIDAAELRKMLLKN  93



>ref|XP_009793725.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Nicotiana 
sylvestris]
Length=94

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 5/98 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsy-taaaaaqgsvsgvagrsNAMLKKGGDESGKSA  292
            MARS+SN+K  S FV DR+S+  TR     A  A G           M+KKGG+ES    
Sbjct  1    MARSLSNSKLYSTFVTDRLSLGVTRKGYAVAEVAGGRGGVAQSNMMIMMKKGGEES----  56

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
              W+PDPVTGYYRPE+  N++DA ELR+MLL N+TR H
Sbjct  57   APWVPDPVTGYYRPENQANQIDAVELRRMLLNNSTRGH  94



>ref|XP_011082454.1| PREDICTED: late embryogenesis abundant protein Lea5 [Sesamum 
indicum]
Length=90

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 65/97 (67%), Gaps = 7/97 (7%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MA S S+AK VSAFV    ++   R Y AA+    S +   G  N MLKKG +ES K  T
Sbjct  1    MAGSFSSAKTVSAFV----TLVTRRGYAAASQGGVSSALRTGAPNVMLKKGSEESSK--T  54

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            SW+PDPVTGYYRPE+   E+DAAELR+ML+ N TRQH
Sbjct  55   SWVPDPVTGYYRPETQAKEIDAAELREMLV-NKTRQH  90



>gb|ABB87099.1| unknown [Solanum tuberosum]
 gb|AEJ08687.1| Lea [Solanum tuberosum]
Length=98

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 63/95 (66%), Gaps = 5/95 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagr---sNAMLKKGGDESGK  286
            MAR  SN+K +SAFV D VS   +R   AAA+         G    SN M++K G+ES K
Sbjct  1    MARFFSNSKILSAFVSDSVSAFLSRRGYAAASQGAVSGVAKGGVPRSNVMMQKSGEESVK  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
              TSW+PDPVTGYYRPE   NE+DAAELR+MLLKN
Sbjct  61   --TSWVPDPVTGYYRPEGQANEIDAAELRKMLLKN  93



>ref|XP_004247410.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Solanum 
lycopersicum]
 gb|AAA34193.1| ORF [Solanum lycopersicum]
 gb|AAA86424.1| heat shock protein [Solanum lycopersicum]
Length=97

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 4/94 (4%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsv--satrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKS  289
            MARS SN+K +SAFV D VS   S      A+  A   V+    RSN M++K G+ES K 
Sbjct  1    MARSFSNSKTLSAFVSDSVSAFLSRRGYAAASQGAVSGVAKGVPRSNVMMQKSGEESVK-  59

Query  290  ATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
             TSW+PDPVTGYYRPE   NE+DAAELR+MLLK+
Sbjct  60   -TSWVPDPVTGYYRPEGQANEIDAAELRKMLLKH  92



>ref|NP_001275471.1| uncharacterized protein LOC102577657 [Solanum tuberosum]
 gb|ABA46753.1| unknown [Solanum tuberosum]
 gb|ABB16999.1| unknown [Solanum tuberosum]
Length=98

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 64/95 (67%), Gaps = 5/95 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagr---sNAMLKKGGDESGK  286
            MARS SN+K +SAFV D VS   +R   AAA+         G    SN +++K G+ES K
Sbjct  1    MARSFSNSKILSAFVSDSVSALLSRRGYAAASQGAVSGVAKGGVPRSNVIMQKSGEESVK  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
              TSW+PDPVTGYYRPE   NE+DAAELR+MLLK+
Sbjct  61   --TSWVPDPVTGYYRPEGQANEIDAAELRKMLLKH  93



>gb|ADW66129.1| late embryogenesis abundant protein Lea5 [Solanum nigrum]
Length=94

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 64/95 (67%), Gaps = 5/95 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvag---rsNAMLKKGGDESGK  286
            MARS SN+K +SA V D VS   +R   AAA+         G   RSN M+KK G+ES K
Sbjct  1    MARSFSNSKILSAVVSDSVSAFLSRRGYAAASQGAVFGVAKGGVPRSNVMMKKSGEESVK  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
              TSW+PDPVTGYYRPE   NE+DAAELR+MLLK+
Sbjct  61   --TSWVPDPVTGYYRPEGQANEIDAAELRKMLLKH  93



>ref|XP_009594113.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Nicotiana 
tomentosiformis]
Length=98

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagr---sNAMLKKGGDESGK  286
            MARS SN K +SAFV D VS   +R   AA +      G  G    SN M+ K G+ES K
Sbjct  1    MARSFSNTKVLSAFVSDSVSAFLSRRGYAAGSQGVVSGGAKGGVPRSNMMMNKSGEESVK  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
              TSW+PDPVTGYYRPE   NE+DAAELR+MLLK+  R +
Sbjct  61   --TSWVPDPVTGYYRPEGVANEIDAAELRKMLLKHKPRNN  98



>ref|XP_006355810.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Solanum 
tuberosum]
Length=89

 Score = 79.3 bits (194),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 63/97 (65%), Gaps = 8/97 (8%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MAR  SN K +SAFV+D VSV+  R   AAA+  G     A RSN M      ES K  T
Sbjct  1    MARYFSNCKNISAFVVDSVSVAIQRRGYAAASQGGVSGSGAVRSNVM------ESNK--T  52

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            SW+PDPVTGYYRPESH  E+DAAELR MLLK   RQ+
Sbjct  53   SWVPDPVTGYYRPESHAKEIDAAELRNMLLKYKPRQN  89



>emb|CDY55365.1| BnaA02g36510D [Brassica napus]
Length=93

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+SN KFVSAFV   +S +  R   AA AAQ S        +A++KKG +ES K   
Sbjct  1    MARSLSNVKFVSAFVSQELSNAIFRRGYAATAAQSSSGKGRAVVSAVMKKGVEESNKK-I  59

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            SWIPDP TGYYRPE+  NE+D AELR  LL
Sbjct  60   SWIPDPKTGYYRPETGSNEIDPAELRAALL  89



>emb|CDY01913.1| BnaC02g28140D [Brassica napus]
Length=93

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 59/90 (66%), Gaps = 1/90 (1%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+SN KFVSAFV   +S +  R   AA AAQ S        +A++KKG +ES K   
Sbjct  1    MARSLSNVKFVSAFVSQELSNAIFRRGYAATAAQSSTGKGRAVVSAVMKKGVEESNKK-I  59

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            SWIPDP TGYYRPE+  NE+D AELR  LL
Sbjct  60   SWIPDPKTGYYRPETGSNEIDPAELRAALL  89



>gb|EYU46739.1| hypothetical protein MIMGU_mgv1a017080mg [Erythranthe guttata]
Length=94

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 56/94 (60%), Gaps = 5/94 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS S AK VS+F+ + +      S     +            N MLKKG +E   S T
Sbjct  1    MARSFSGAKSVSSFLANEIRRGFAASTQGVVSGTVRSGAP----NVMLKKGSEEP-SSKT  55

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTT  397
            +W+PDPVTGYYRPE+  NE+D AELR++L+KN T
Sbjct  56   AWVPDPVTGYYRPENQGNEMDPAELREILIKNKT  89



>ref|XP_009111293.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Brassica 
rapa]
Length=94

 Score = 77.0 bits (188),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 59/90 (66%), Gaps = 0/90 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+S+ KFVSAFV  ++S +  R   AA  AQ S        +A++KKG +ES +   
Sbjct  1    MARSLSSVKFVSAFVSQQLSNAIFRRGFAATTAQPSGVKGGAVVSAVMKKGMEESNQKIA  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            +WIPDP TGYYRPE+  NE+D AELR  LL
Sbjct  61   AWIPDPKTGYYRPETGSNEIDPAELRAALL  90



>ref|XP_009772870.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Nicotiana 
sylvestris]
Length=98

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 63/100 (63%), Gaps = 5/100 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsv---satrsytaaaaaqgsvsgvagrsNAMLKKGGDESGK  286
            MARS SN+K +SA V D VS        +  +  A  G   G   RSN ++ K G+ES K
Sbjct  1    MARSFSNSKVLSAVVSDSVSAFLCRRGYAAGSQGALSGGAKGGVPRSNMIMNKSGEESVK  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
              TSW+PDPVTGYYRPE   NE+DAAELR+MLLK+  R +
Sbjct  61   --TSWVPDPVTGYYRPEGVANEIDAAELRKMLLKHKPRSN  98



>emb|CDY22046.1| BnaA09g00750D [Brassica napus]
Length=94

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+S+ KFVSAFV   +S +  R   AA  AQ S        +A++KKG +ES +   
Sbjct  1    MARSLSSVKFVSAFVSQELSNAIFRRGFAATTAQPSGGKGGAVVSAVMKKGVEESNQKIA  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            +WIPDP TGYYRPE+  NE+D AELR  LL
Sbjct  61   AWIPDPKTGYYRPETGSNEIDPAELRAALL  90



>ref|XP_009144576.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Brassica 
rapa]
Length=93

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 58/90 (64%), Gaps = 1/90 (1%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+SN KFVSAFV   +S +  R   AA AAQ S         A++KKG +ES K   
Sbjct  1    MARSLSNVKFVSAFVSQELSNAIFRRGYAATAAQPSSGKGRAVVPAVMKKGVEESNKK-I  59

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            SWIPDP TGYYRPE+  NE+D AELR  LL
Sbjct  60   SWIPDPKTGYYRPETGSNEIDPAELRAALL  89



>emb|CDY50390.1| BnaCnng19220D [Brassica napus]
Length=94

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+S+ KFVSAFV   +S +  R   AA  AQ S        +A++KKG +ES +   
Sbjct  1    MARSLSSVKFVSAFVSQELSNAIFRRGFAATTAQPSGGKGGAVVSAVVKKGVEESNQKIA  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            +WIPDP TGYYRPE+  NE+D AELR  LL
Sbjct  61   AWIPDPKTGYYRPETGSNEIDPAELRAALL  90



>ref|NP_567231.1| senescence-associated protein SAG21 [Arabidopsis thaliana]
 gb|AAK95287.1|AF410301_1 AT4g02380/T14P8_2 [Arabidopsis thaliana]
 gb|AAK62644.1| AT4g02380/T14P8_2 [Arabidopsis thaliana]
 gb|AAK96576.1| AT4g02380/T14P8_2 [Arabidopsis thaliana]
 gb|AAL06808.1| AT4g02380/T14P8_2 [Arabidopsis thaliana]
 gb|AAM64340.1| late embryogenis abundant protein [Arabidopsis thaliana]
 gb|AAW72736.1| late embryogenesis abundant-like protein [Arabidopsis thaliana]
 gb|AEE82161.1| senescence-associated protein [Arabidopsis thaliana]
Length=97

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 55/95 (58%), Gaps = 3/95 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFV---LDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGK  286
            MARSISN K VSAFV   L         + TAA  +  S       ++A++KK G E   
Sbjct  1    MARSISNVKIVSAFVSRELSNAIFRRGYAATAAQGSVSSGGRSGAVASAVMKKKGVEEST  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
               SW+PDP TGYYRPE+  NE+DAAELR  LL N
Sbjct  61   QKISWVPDPKTGYYRPETGSNEIDAAELRAALLNN  95



>ref|XP_004240547.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Solanum 
lycopersicum]
Length=94

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 67/97 (69%), Gaps = 3/97 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MAR +SN K +SAFV+D VSV+  R   AA AAQG VSG    S + ++    ES K  T
Sbjct  1    MARYLSNCKNISAFVVDSVSVAIQRRGYAATAAQGGVSGSVRGSGS-VRSNVMESNK--T  57

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            SW+PDPVTGYYRPE+H  E+DAAELR MLLK   RQ+
Sbjct  58   SWVPDPVTGYYRPETHAKEIDAAELRNMLLKYKPRQN  94



>ref|XP_002872843.1| hypothetical protein ARALYDRAFT_327563 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49102.1| hypothetical protein ARALYDRAFT_327563 [Arabidopsis lyrata subsp. 
lyrata]
Length=180

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 60/97 (62%), Gaps = 0/97 (0%)
 Frame = +2

Query  101  LWGDQMARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDES  280
            L   +MARS SN K VSAFV   +S +  R   AA AAQGS       ++A++KK G E 
Sbjct  82   LHTSKMARSFSNVKIVSAFVSRELSNAIFRRGYAATAAQGSGGRSGAAASAVMKKKGVEE  141

Query  281  GKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
                 SW+PDP TGYYRPE+  NE+DAAELR  LL N
Sbjct  142  STQKISWVPDPKTGYYRPETGSNEIDAAELRAALLNN  178



>ref|XP_006288964.1| hypothetical protein CARUB_v10002338mg [Capsella rubella]
 gb|EOA21862.1| hypothetical protein CARUB_v10002338mg [Capsella rubella]
Length=94

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+SN K VSAF+   +S +  R   AA A QGS       ++A +KK G E      
Sbjct  1    MARSLSNVKIVSAFLSHELSNAIFRRGYAATAVQGSGGRSGAVTSAAMKKKGVEESTQKI  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            SW+PDP TGYYRPE+  NE+DAAELR  LL N
Sbjct  61   SWVPDPKTGYYRPETGSNEIDAAELRAALLNN  92



>ref|XP_010456043.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=94

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+SN K VSAFV   +S +  R   AAAA QG        ++A++KK G E      
Sbjct  1    MARSLSNVKIVSAFVTHELSNAIFRRGYAAAAVQGGGGRSGAVASAVMKKKGVEESTKKI  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            SW+PDP TGYYRPE+  NE+D AELR  LL N
Sbjct  61   SWVPDPKTGYYRPETGSNEIDPAELRAALLNN  92



>ref|XP_010429564.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=94

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 58/92 (63%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+SN K VSAFV   +S +  R   AAAA QGS       ++A++KK G E      
Sbjct  1    MARSLSNVKIVSAFVSHELSNAIFRRGYAAAAVQGSGGRSGAVASAVMKKKGVEESTKKI  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            SW+PDP TGYYRPE+  NE+D AELR  LL N
Sbjct  61   SWVPDPKTGYYRPETGSNEIDPAELRAALLNN  92



>ref|XP_004165917.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like isoform 
3 [Cucumis sativus]
Length=114

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 63/105 (60%), Gaps = 10/105 (10%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD--------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGG  271
            MARS SNAK +SA V D        R   +A  S   A+ A    S  A RS+ +LKK G
Sbjct  1    MARSFSNAKILSAVVSDGFSSLLSSRGYAAAAGSQGVASTAVKGASVAAARSSNLLKKSG  60

Query  272  DESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            +E   +    SW+PDPVTGYYRPE+  +E+D AELR +LLKN T+
Sbjct  61   EEKVGTTEKVSWVPDPVTGYYRPENRSDEIDVAELRSILLKNKTK  105



>gb|AAC19273.1| T14P8.2 [Arabidopsis thaliana]
 emb|CAB80731.1| AT4g02380 [Arabidopsis thaliana]
Length=206

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 56/97 (58%), Gaps = 3/97 (3%)
 Frame = +2

Query  110  DQMARSISNAKFVSAFV---LDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDES  280
             +MARSISN K VSAFV   L         + TAA  +  S       ++A++KK G E 
Sbjct  108  SKMARSISNVKIVSAFVSRELSNAIFRRGYAATAAQGSVSSGGRSGAVASAVMKKKGVEE  167

Query  281  GKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
                 SW+PDP TGYYRPE+  NE+DAAELR  LL N
Sbjct  168  STQKISWVPDPKTGYYRPETGSNEIDAAELRAALLNN  204



>ref|XP_010422602.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=94

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+SN K VSAFV   +S +  R   AA A QGS       ++A +KK G E      
Sbjct  1    MARSLSNVKIVSAFVSHELSNAIFRRGYAATAVQGSGGRSGAVASAAMKKKGVEESTKKI  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            SW+PDP TGYYRPE+  NE+D AELR  LL N
Sbjct  61   SWVPDPKTGYYRPETGSNEIDPAELRAALLNN  92



>ref|XP_006396445.1| hypothetical protein EUTSA_v10029091mg [Eutrema salsugineum]
 gb|ESQ37898.1| hypothetical protein EUTSA_v10029091mg [Eutrema salsugineum]
Length=94

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 57/92 (62%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+S+ K VSAFV   +S +  R   AA AAQ S       ++A++KK G E      
Sbjct  1    MARSLSDVKLVSAFVSRELSNAIFRRGFAATAAQSSGGRSGAVASAVMKKKGAEESNQKI  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            SW+PDP TGYYRPE+  NE+D AELR  LL N
Sbjct  61   SWVPDPKTGYYRPETGSNEIDPAELRAALLNN  92



>ref|XP_002270639.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Vitis vinifera]
 emb|CBI36877.3| unnamed protein product [Vitis vinifera]
Length=97

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%), Gaps = 3/95 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDE-SGKSA  292
            MARS+SNAK +SA V+D  S++  R   AAA+   S      +S  ++KK G+E  G+++
Sbjct  1    MARSLSNAKVISAIVVDGFSLAIHRRGYAAASGAVSSVARGQKSGVVVKKLGEEMKGRAS  60

Query  293  TS--WIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
             +  W+PDPVTGYYRPE+   ++D AELRQ LLK+
Sbjct  61   ETSPWVPDPVTGYYRPENEAKQIDVAELRQTLLKH  95



>ref|XP_011079638.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Sesamum 
indicum]
Length=89

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 9/94 (10%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS SN K +SAF+  R   +A+ S  +++   G+        N MLK   ++  K  T
Sbjct  1    MARSFSNLKTLSAFIARRGYAAASPSVGSSSVRSGAP-------NVMLKTASEDPSK--T  51

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTT  397
            +W+PDPVTGYYRPE+ V E+D  E+R+ML+KN T
Sbjct  52   AWVPDPVTGYYRPENQVKELDPVEMREMLIKNKT  85



>ref|XP_010069902.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Eucalyptus 
grandis]
 gb|KCW58418.1| hypothetical protein EUGRSUZ_H01104 [Eucalyptus grandis]
Length=99

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatr---sytaaaaaqgsvsgvagrsNAMLKKGGDESGK  286
            MARS+SNAK  SA ++D +S S  R   +  +   A       A RS  M KK G+E  +
Sbjct  1    MARSLSNAKLFSAALVDGISASIARRGYAAASQGVASSFAKTGATRSTVMSKKTGEEKAR  60

Query  287  SA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            S    SW+PDP TGYYRPE+   E+D AELR MLLKN
Sbjct  61   STERVSWVPDPKTGYYRPENRAEEIDVAELRAMLLKN  97



>ref|XP_004136021.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Cucumis 
sativus]
 gb|KGN44947.1| Protein induced upon tuberization [Cucumis sativus]
Length=104

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 62/102 (61%), Gaps = 10/102 (10%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD--------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGG  271
            MARS SNAK +SA V D        R   +A  S   A++A    S  A RS+ +LKK G
Sbjct  1    MARSFSNAKILSAVVSDGFSSLLSSRGYAAAAGSQGVASSAVKGGSVAAARSSNLLKKSG  60

Query  272  DESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +E   +    SW+PDPVTGYYRPE+  +E+D AELR +LLKN
Sbjct  61   EEKVGTTEKVSWVPDPVTGYYRPENRSDEIDVAELRSILLKN  102



>ref|XP_007050958.1| Indole-3-acetic acid-induced protein ARG2, putative [Theobroma 
cacao]
 gb|EOX95115.1| Indole-3-acetic acid-induced protein ARG2, putative [Theobroma 
cacao]
Length=94

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDE--SGKS  289
            MARS SNAK  S FV D +S + +R   AAA+      G A  + A++KK G+E    K 
Sbjct  1    MARSFSNAKLFSTFVADGISNAISRRGYAAASQGVVSGGAARNA-AVVKKTGEEMAGAKE  59

Query  290  ATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
              SW+PDPVTG+YRPE+   E+D AELR MLLK
Sbjct  60   KVSWVPDPVTGFYRPENTAKEIDVAELRAMLLK  92



>gb|KFK30826.1| hypothetical protein AALP_AA6G030900 [Arabis alpina]
Length=98

 Score = 71.6 bits (174),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 52/96 (54%), Gaps = 4/96 (4%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsa----trsytaaaaaqgsvsgvagrsNAMLKKGGDESG  283
            MARS+SN K VSAFV   +S +       +     +            +A++KK G E  
Sbjct  1    MARSLSNVKIVSAFVSHELSNAIFRRGYAATAVQGSVSSGGKSGGAVVSAVMKKKGVEES  60

Query  284  KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            K   SWIPDP TGYYRPE+  NE+D AELR  LL N
Sbjct  61   KPKISWIPDPKTGYYRPETGSNEIDPAELRAALLNN  96



>emb|CDY57180.1| BnaC03g73200D [Brassica napus]
Length=94

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 55/92 (60%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+SN K VSAFV   +S +  R   AA AAQ SV       + ++KK G E      
Sbjct  1    MARSLSNVKIVSAFVSRELSNAIFRRGYAATAAQASVGKGGAVVSGVMKKKGVEESTQKI  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +WIPDP TGYYRPE+   E+D AELR  LL N
Sbjct  61   AWIPDPKTGYYRPETGSKEIDPAELRAALLNN  92



>ref|XP_010684355.1| PREDICTED: late embryogenesis abundant protein Lea5 [Beta vulgaris 
subsp. vulgaris]
Length=93

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS+SNAK   + V+D +S+++ R   AAA+   +  G         K G +E G+SA 
Sbjct  1    MARSLSNAKVFFSLVVDNISMASQRRGYAAASQGVAAVGRGSG-----KSGQEERGRSAE  55

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
             SW+PDPVTGYYRP +   E+D AELR+MLLK   R  
Sbjct  56   NSWVPDPVTGYYRPANRAAEIDVAELREMLLKQKIRSQ  93



>ref|XP_010069903.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Eucalyptus 
grandis]
 gb|KCW58417.1| hypothetical protein EUGRSUZ_H01103 [Eucalyptus grandis]
Length=99

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 58/97 (60%), Gaps = 5/97 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatr---sytaaaaaqgsvsgvagrsNAMLKKGGDESGK  286
            MARS+SNAK  SA ++D +S S  R   +  +   A       A RS  M KK G+E+ +
Sbjct  1    MARSLSNAKLFSAVLVDGISASFARRGYAAASQGVASSVAKTGATRSAVMSKKTGEETAR  60

Query  287  SA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            S    SW+PDP TGYYRPE+   E+D AELR  LLKN
Sbjct  61   STERVSWVPDPKTGYYRPENRAEEIDVAELRAALLKN  97



>gb|KJB23299.1| hypothetical protein B456_004G090700 [Gossypium raimondii]
Length=120

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 62/101 (61%), Gaps = 7/101 (7%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsN----AMLKKGGDE--  277
            MARS SNAK  S FV+D +S   +R   AAA+     SG+ G +     A++KK G+E  
Sbjct  1    MARSFSNAKLFSTFVVDGISNVISRRGYAAASQGIVSSGIRGGAGRSAAAVVKKTGEEMS  60

Query  278  -SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTT  397
               K   SW+PDPVTG YRPE+  NE D AELR  LLKNT+
Sbjct  61   GGAKEKVSWVPDPVTGCYRPENCANETDVAELRATLLKNTS  101



>ref|XP_008451558.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Cucumis 
melo]
Length=105

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 61/103 (59%), Gaps = 11/103 (11%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD--------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGG  271
            MARS SN K +SA V D        R   +A  S   A++A       A RS+ +LKK G
Sbjct  1    MARSFSNVKILSAVVSDGFSSLLTSRGYAAAAGSQGVASSAVKGAGVAAARSSNLLKKSG  60

Query  272  DESGKSAT---SWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +E    +T   SW+PDPVTGYYRPE+  +E+D AELR +LLKN
Sbjct  61   EEKVVGSTEKVSWVPDPVTGYYRPENRCDEIDVAELRSILLKN  103



>ref|XP_009134437.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Brassica 
rapa]
 emb|CDX90942.1| BnaA03g26220D [Brassica napus]
Length=94

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            M+RS+SN K VS+FV   +S +  R   AA AAQ SV       +A++KK G E      
Sbjct  1    MSRSLSNVKIVSSFVSHELSNAIFRRGYAATAAQASVGKGGAVVSAVMKKKGVEESTQKI  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +WIPDP TGYYRPE+   E+D AELR  LL N
Sbjct  61   AWIPDPKTGYYRPETGSKEIDPAELRAALLNN  92



>ref|XP_006444379.1| hypothetical protein CICLE_v10023029mg [Citrus clementina]
 gb|ESR57619.1| hypothetical protein CICLE_v10023029mg [Citrus clementina]
Length=98

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 58/96 (60%), Gaps = 4/96 (4%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsN--AMLKKGGDESGKS  289
            MARS SNAK  SAFV D +S +  +   +AA+         G  +  AMLKK  +E   S
Sbjct  1    MARSFSNAKLFSAFVADGISNAIYKRGYSAASQGAVSRATGGARSAAAMLKKPAEEMTGS  60

Query  290  A--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +   SW+PDPVTG YRPE+  NE+D A+LR M LK+
Sbjct  61   SEKVSWVPDPVTGVYRPENLANELDGADLRAMFLKH  96



>gb|ABG54481.1| late embryogenesis abundant protein [Tamarix androssowii]
Length=103

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 57/96 (59%), Gaps = 12/96 (13%)
 Frame = +2

Query  116  MAR-SISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA  292
            MAR S SNAK VS  V+D +S++ +R   A      + S      N M + GG  +  S 
Sbjct  1    MARCSYSNAKLVSTLVVDNLSLALSRRSYAQGMVMSNSS------NVMRRAGGSNNATST  54

Query  293  T-----SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            T     SW+PDPVTGYYRP +H ++VD AELR+MLL
Sbjct  55   TPNDENSWVPDPVTGYYRPANHADDVDVAELREMLL  90



>gb|KJB23300.1| hypothetical protein B456_004G090800 [Gossypium raimondii]
 gb|KJB23301.1| hypothetical protein B456_004G090800 [Gossypium raimondii]
Length=100

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 53/98 (54%), Gaps = 7/98 (7%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsat-----rsytaaaaaqgsvsgvagrsNAMLKKGGDES  280
            MARS+SNAK  S FV+D +S   +      +     ++          +    K G D S
Sbjct  1    MARSLSNAKLFSTFVVDGISNVISRRGYAAASQGIVSSGIRGGAGRSAATVAKKTGEDMS  60

Query  281  G--KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            G  K   SW+PDPVTG YRPE+  NE+D AELR MLLK
Sbjct  61   GGAKEKVSWVPDPVTGCYRPENCPNEIDVAELRSMLLK  98



>ref|XP_004165915.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like isoform 
1 [Cucumis sativus]
 ref|XP_004165916.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like isoform 
2 [Cucumis sativus]
Length=126

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +2

Query  254  MLKKGGDESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQ  403
            +LKK G+E   +    SW+PDPVTGYYRPE+  +E+D AELR +LLKN T+ 
Sbjct  67   LLKKSGEEKVGTTEKVSWVPDPVTGYYRPENRSDEIDVAELRSILLKNKTKS  118



>gb|KJB23298.1| hypothetical protein B456_004G090700 [Gossypium raimondii]
Length=99

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 59/98 (60%), Gaps = 7/98 (7%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsN----AMLKKGGDE--  277
            MARS SNAK  S FV+D +S   +R   AAA+     SG+ G +     A++KK G+E  
Sbjct  1    MARSFSNAKLFSTFVVDGISNVISRRGYAAASQGIVSSGIRGGAGRSAAAVVKKTGEEMS  60

Query  278  -SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
               K   SW+PDPVTG YRPE+  NE D AELR  LLK
Sbjct  61   GGAKEKVSWVPDPVTGCYRPENCANETDVAELRATLLK  98



>ref|XP_006479985.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Citrus 
sinensis]
 ref|XP_006479988.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Citrus 
sinensis]
 gb|KDO87182.1| hypothetical protein CISIN_1g034308mg [Citrus sinensis]
Length=98

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsN--AMLKKGGDESGKS  289
            MARS SNAK  SA V D +S +  +   +AA+         G  +  AMLKK  +E   S
Sbjct  1    MARSFSNAKLFSALVADGISNAIYKRGYSAASQGAVSRATGGARSAAAMLKKPAEEMTGS  60

Query  290  A--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +   SW+PDPVTG YRPE+  NE+D A+LR M LK+
Sbjct  61   SEKVSWVPDPVTGVYRPENLANELDGADLRAMFLKH  96



>gb|KCW58419.1| hypothetical protein EUGRSUZ_H01105, partial [Eucalyptus grandis]
Length=104

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +2

Query  248  NAMLKKGGDESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            N M KK G+E  +S    SW+PDP TGYYRPE+  +E+D AELR +LLKN
Sbjct  53   NVMSKKTGEEMARSTERVSWVPDPKTGYYRPENRADEIDVAELRALLLKN  102



>gb|KJB24378.1| hypothetical protein B456_004G142600 [Gossypium raimondii]
Length=98

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 61/96 (64%), Gaps = 5/96 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsN--AMLKKGGDE---S  280
            MARS SN K  S FV+D +S + +R   AA +   + +GV   +   A+LKK G++   +
Sbjct  1    MARSFSNVKVFSTFVVDGISNAISRRGYAATSQGVASNGVKEAARNAAVLKKTGEDMATA  60

Query  281  GKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
             K   +W+PDPVTG+YRPE+ VNE+  AELR  LLK
Sbjct  61   TKDKVNWVPDPVTGFYRPENTVNEICPAELRATLLK  96



>ref|XP_002523101.1| Indole-3-acetic acid-induced protein ARG2, putative [Ricinus 
communis]
 gb|EEF39286.1| Indole-3-acetic acid-induced protein ARG2, putative [Ricinus 
communis]
Length=95

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MA+S SNAK +S+ +   ++     +  +A+A+  +    A    AM+KK G+E   S  
Sbjct  1    MAQSFSNAKALSSLITKAITRRGFSAAASASASAAAPKATARSGAAMVKKTGEEVVGSTE  60

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
              SW+PDP TG+YRPE+   E+DAAELR MLLK 
Sbjct  61   KVSWVPDPRTGFYRPENVAKEIDAAELRAMLLKK  94



>ref|NP_001078346.1| senescence-associated protein SAG21 [Arabidopsis thaliana]
 gb|AEE82162.1| senescence-associated protein [Arabidopsis thaliana]
Length=78

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  248  NAMLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +A++KK G E      SW+PDP TGYYRPE+  NE+DAAELR  LL N
Sbjct  29   SAVMKKKGVEESTQKISWVPDPKTGYYRPETGSNEIDAAELRAALLNN  76



>ref|XP_010026124.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Eucalyptus 
grandis]
Length=166

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = +2

Query  248  NAMLKKGGDESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            N M KK G+E  +S    SW+PDP TGYYRPE+  +E+D AELR +LLKN
Sbjct  115  NVMSKKTGEEMARSTERVSWVPDPKTGYYRPENRADEIDVAELRALLLKN  164



>dbj|BAH57115.1| AT4G02380 [Arabidopsis thaliana]
Length=110

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  248  NAMLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +A++KK G E      SW+PDP TGYYRPE+  NE+DAAELR  LL N
Sbjct  61   SAVMKKKGVEESTQKISWVPDPKTGYYRPETGSNEIDAAELRAALLNN  108



>gb|AAC39464.1| late embryogenesis abundant protein homolog [Arabidopsis thaliana]
Length=72

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  248  NAMLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +A++KK G E      SW+PDP TGYYRPE+  NE+DAAELR  LL N
Sbjct  23   SAVMKKKGVEESTQKISWVPDPKTGYYRPETGSNEIDAAELRAALLNN  70



>ref|XP_006303463.1| hypothetical protein CARUB_v10010737mg [Capsella rubella]
 gb|EOA36361.1| hypothetical protein CARUB_v10010737mg [Capsella rubella]
Length=97

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 56/95 (59%), Gaps = 3/95 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNA---MLKKGGDESGK  286
            MARS+SNAK +S FV +++S +  R   A AA   S   V+   NA   ++K    E+  
Sbjct  1    MARSLSNAKIISVFVSEKLSNAVFRRGFAVAAKTASDGSVSSGGNASPAVMKNKIVEASS  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
                W+PDP TGYYRPE+   E+D AELR +LL N
Sbjct  61   DKAPWVPDPKTGYYRPETASEEIDPAELRAVLLNN  95



>gb|KHG16920.1| Indole-3-acetic acid-induced ARG2 [Gossypium arboreum]
Length=100

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 59/98 (60%), Gaps = 7/98 (7%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsN----AMLKKGGDESG  283
            MA S SNAK  S FV+D +S   +R   AAA+     SG+ G +      + KK G+E  
Sbjct  1    MALSFSNAKLFSTFVVDGISNVISRRGYAAASQGIVSSGIRGGAGRSAATVAKKTGEEMS  60

Query  284  KSA---TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            + A    SW+PDPVTG YRPE+  NE+D AELR MLLK
Sbjct  61   RGAKEKVSWVPDPVTGCYRPENCPNEIDVAELRSMLLK  98



>ref|XP_010325649.1| PREDICTED: late embryogenesis abundant protein Lea5-like isoform 
X2 [Solanum lycopersicum]
Length=96

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +2

Query  254  MLK-KGGDESGKSATS-WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            M+K KGGDE      S W+P PVTGYYRPE+  + +D  ELRQMLLKN  + H
Sbjct  44   MMKLKGGDEDQSPPKSPWVPHPVTGYYRPENQADMIDPVELRQMLLKNKFKGH  96



>ref|XP_004246056.1| PREDICTED: late embryogenesis abundant protein Lea5-like isoform 
X1 [Solanum lycopersicum]
Length=101

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +2

Query  254  MLK-KGGDESGKSATS-WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            M+K KGGDE      S W+P PVTGYYRPE+  + +D  ELRQMLLKN  + H
Sbjct  49   MMKLKGGDEDQSPPKSPWVPHPVTGYYRPENQADMIDPVELRQMLLKNKFKGH  101



>gb|KHG30665.1| Late embryogenesis abundant Lea5-A [Gossypium arboreum]
Length=105

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 8/105 (8%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD--------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGG  271
            MARS+S+ KF+ A V D        R    A  +   A+  +    G   R +AM +   
Sbjct  1    MARSVSSFKFLGASVFDALYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRHAMKESSS  60

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
             E+   +++W PDPVTGYYRPE+   E+DAAELR+MLL +  R  
Sbjct  61   SETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRSQ  105



>ref|XP_002301483.2| hypothetical protein POPTR_0002s20480g, partial [Populus trichocarpa]
 gb|EEE80756.2| hypothetical protein POPTR_0002s20480g, partial [Populus trichocarpa]
Length=151

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 57/94 (61%), Gaps = 6/94 (6%)
 Frame = +2

Query  113  QMARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA  292
            +MARS SNAK +S  + +    +      +A A+QG+    A    A++KK G+E  K+ 
Sbjct  60   RMARSFSNAKVISGLISE----AINGRGFSAVASQGAAVSKARSGAAVMKKTGEEVTKTT  115

Query  293  --TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
               SW+PDP TG+YRPE+   E+DAAELR  LLK
Sbjct  116  EKISWVPDPRTGFYRPENVAQEIDAAELRATLLK  149



>gb|KHN26544.1| Late embryogenesis abundant protein Lea5 [Glycine soja]
Length=97

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 49/95 (52%), Gaps = 3/95 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MA S S AK   AF L R   +     + +         V      + KK    SG S +
Sbjct  1    MAHSFSPAKRALAFALQRRGYAVASDASPSMRGGLDSISVME--KGVTKKSSGPSGTS-S  57

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            +W PDP+TGYYRP +H NE+D  ELR+MLLK+  R
Sbjct  58   AWAPDPITGYYRPINHTNEIDPVELRKMLLKHKVR  92



>gb|AFK37878.1| unknown [Lotus japonicus]
Length=94

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 54/92 (59%), Gaps = 6/92 (7%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS +N K +SA +LD      + S T    +  + +  A R + M K GG++ G S  
Sbjct  1    MARSFANTKALSALLLD----GISTSLTRRGYSAAAATQSATRGSGMTKMGGEDKGASTY  56

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
              SW+PDPVTGYY+PE+    VD AE+R MLL
Sbjct  57   KVSWVPDPVTGYYKPENTKEVVDVAEMRAMLL  88



>ref|XP_011042051.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Populus 
euphratica]
Length=92

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 5/93 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS SNAK +S  +         R ++A A+   +V      ++AM+KK G+E GKS  
Sbjct  1    MARSSSNAKVISGLI---SRAINGRGFSAVASQGAAVPKARSGADAMVKKTGEEVGKSTE  57

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
             TSW+PDP TG+YRP +   E+D A LR  LLK
Sbjct  58   KTSWVPDPRTGFYRPGNVAEEIDEAGLRASLLK  90



>ref|XP_010474858.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=97

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 54/95 (57%), Gaps = 3/95 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFV---LDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGK  286
            MARS+SNAK +S FV   L         +  A   ++GSVS     S+A++K    E+  
Sbjct  1    MARSLSNAKILSVFVSEKLSNAVFRRGFAVAAKTVSEGSVSSGETASSAVMKNKVVEASS  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
                W+PDP TGYYRPE+   E+D AELR +LL N
Sbjct  61   EKAPWVPDPKTGYYRPETVSEEIDPAELRAVLLNN  95



>gb|KDP28178.1| hypothetical protein JCGZ_13949 [Jatropha curcas]
Length=92

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 57/93 (61%), Gaps = 5/93 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS SNAK VSA V         R ++ AAA   +  G A RS AM+KK G+++  S  
Sbjct  1    MARSFSNAKVVSALVTK---AINRRGFSGAAAPTAAPQGAAARSGAMVKKSGEQTVGSTD  57

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
              SW+PDP TG YRPE+   E+DAAELR  LLK
Sbjct  58   KISWVPDPRTGCYRPENVNEEIDAAELRATLLK  90



>ref|XP_008784753.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Phoenix 
dactylifera]
Length=96

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MAR++SNA  ++ F      +++ R Y+A A            + A +K+ G     +++
Sbjct  1    MARALSNATLIAVFSDGIALLASRRGYSAVAGRGSRTVVEEKVAAAAMKRDGGLESAASS  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            SW+PDPVTG+YRP +   E+D AELR MLLK  + QH
Sbjct  61   SWVPDPVTGFYRPANRAAEIDPAELRAMLLKPKS-QH  96



>ref|XP_007138926.1| hypothetical protein PHAVU_009G249500g [Phaseolus vulgaris]
 gb|ESW10920.1| hypothetical protein PHAVU_009G249500g [Phaseolus vulgaris]
Length=94

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 52/95 (55%), Gaps = 3/95 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MA+SIS AK   AF L+R   +     ++  +A             + K G   SG S +
Sbjct  1    MAQSISQAKRALAFALNRRGYAVASDVSSFTSAARGGMSGIE--KGVAKNGSGPSGAS-S  57

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            +W+PDPVTGYYRP +H  E+D  ELR+MLL +  +
Sbjct  58   AWVPDPVTGYYRPINHREEIDPVELRKMLLNHKGK  92



>gb|ABF29697.1| late embryogenesis abundant protein 5 [Populus suaveolens]
Length=91

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 6/93 (6%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS SNAK +S  + +    +      +A A+QG+    A    A++KK G+E  K+  
Sbjct  1    MARSFSNAKVISGLISE----AINGRGFSAVASQGAAVSKARSGAAVMKKTGEEVTKTTE  56

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
              SW+PDP TG+YRPE+   E+DAAELR   LK
Sbjct  57   KISWVPDPRTGFYRPENVAQEIDAAELRAAFLK  89



>ref|XP_003546362.1| PREDICTED: late embryogenesis abundant protein Lea5 [Glycine 
max]
 gb|KHN14610.1| Late embryogenesis abundant protein Lea5 [Glycine soja]
Length=100

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 48/95 (51%), Gaps = 0/95 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MA+S S AK   AF L R   +     + +        G        + K       +++
Sbjct  1    MAQSFSPAKRALAFSLHRRGYAVASDASPSVRGGLDSIGSRSAIEKGVTKNNSGPSGASS  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            +W PDPVTGYYRP +H NE+D  ELR+MLLK+  R
Sbjct  61   AWAPDPVTGYYRPINHTNEIDPVELRRMLLKHKVR  95



>gb|ABK95975.1| unknown [Populus trichocarpa]
Length=92

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 5/93 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS SNAK +S  +         R ++A A+   +V      ++AM+KK G+E GKS  
Sbjct  1    MARSSSNAKVISGLI---SRAINGRGFSADASQGAAVPKARSGADAMVKKTGEEVGKSTE  57

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
             TSW+PDP TG+YRP +   E+D A LR  LLK
Sbjct  58   KTSWVPDPRTGFYRPGNVAEEIDEAGLRASLLK  90



>gb|KDO71712.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
Length=96

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+  AK + A V D +S+S  R Y AAA             N +     ++SG S +
Sbjct  1    MARSLFKAKLLLAPVADGISLSIGRGYAAAAPLGTISRTGIMEKNDLTPAVREDSGAS-S  59

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            +W PDP+TGYYRPE+   E+D AELR+MLL +  R H
Sbjct  60   AWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH  96



>ref|XP_010259514.1| PREDICTED: late embryogenesis abundant protein Lea5 [Nelumbo 
nucifera]
Length=101

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            +A+SWIPDP+TGYYRPE+H  E+D AELR++LL    R
Sbjct  61   AASSWIPDPITGYYRPENHGEEIDVAELRRVLLNQKIR  98



>ref|XP_002892126.1| late embryogenesis abundant 3 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68385.1| late embryogenesis abundant 3 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=97

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 52/95 (55%), Gaps = 3/95 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFV---LDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGK  286
            MARS++NAK +S FV   L         +  A  A  GSVS     S A +KK   E+  
Sbjct  1    MARSLANAKILSVFVSEKLSNAVFRRGFAAAAKTALDGSVSSGGTASAAEMKKNVGEASS  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
                W+PDP TGYYRPE+   E+D AELR +LL N
Sbjct  61   EKAPWVPDPKTGYYRPETVSEEIDPAELRAVLLNN  95



>gb|EPS70797.1| hypothetical protein M569_03965, partial [Genlisea aurea]
Length=92

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS S  K +SAFV   +S  + R + AA+ +  S     G  N MLKK   +  +  T
Sbjct  1    MARSFSGVKAISAFVEGEISTLSRRGFAAASRSIASSVVNRGAQNMMLKKSASDDNEK-T  59

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +W+PDPVTG+YRPE+   ++D AELR +L+ N
Sbjct  60   AWVPDPVTGFYRPENDGKDMDPAELRAILINN  91



>ref|XP_007035627.1| Late embryogenesis abundant protein Lea5-D [Theobroma cacao]
 gb|EOY06553.1| Late embryogenesis abundant protein Lea5-D [Theobroma cacao]
Length=104

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = +2

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            +ESG S T+W PDPVTGYYRPE+ + E+DAA LR+MLL +  R H
Sbjct  61   EESGAS-TAWAPDPVTGYYRPENCLAEIDAAGLREMLLNHKVRAH  104



>ref|XP_006586916.1| PREDICTED: late embryogenesis abundant protein Lea5 [Glycine 
max]
Length=106

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 4/54 (7%)
 Frame = +2

Query  251  AMLKKG--GDESGKSATS--WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            ++++KG   + SG S TS  W PDP+TGYYRP +H NE+D  ELR+MLLK+  R
Sbjct  48   SVMEKGVTKNSSGPSGTSSAWAPDPITGYYRPINHTNEIDPVELRKMLLKHKVR  101



>ref|XP_011009435.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Populus 
euphratica]
Length=91

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 6/93 (6%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS SNAK +S  + +    +      +A A+QG+    A    A++KK G+E  K+  
Sbjct  1    MARSFSNAKVISGLINE----AINGRGFSAVASQGAAVSKARSGAAVMKKTGEEVTKTTE  56

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
              SW+PDP TG+YRPE+   E+DAAELR   LK
Sbjct  57   KISWVPDPRTGFYRPENVAQEIDAAELRAAFLK  89



>gb|ABK96509.1| unknown [Populus trichocarpa x Populus deltoides]
Length=92

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 5/93 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS SNAK +S  +         R ++A A+   +V      ++AM+KK G+++GKS  
Sbjct  1    MARSSSNAKVISGLI---SRAINGRGFSADASQGAAVPKARSGADAMVKKTGEKAGKSTE  57

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
             TSW+PDP TG+YRP +   E+D A LR  LLK
Sbjct  58   KTSWVPDPRTGFYRPGNVAEEIDEAGLRASLLK  90



>gb|ADP23916.1| late embryogenesis abundant protein [Sesuvium portulacastrum]
Length=97

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 54/98 (55%), Gaps = 2/98 (2%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS+SNAK   + V D            AAA+QG    V   +  + K G +E G+   
Sbjct  1    MARSLSNAKVFVSLVSD-NLSIVLNRRGYAAASQGVAGTVGRGTGRIGKAGKEEVGRGGE  59

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
             SW+PDPVTGYYRP +  +E+D AELR++ LK   R  
Sbjct  60   NSWVPDPVTGYYRPANRPDEIDVAELREIFLKQKIRPQ  97



>ref|NP_001276069.1| late embryogenesis abundant protein Lea5 [Citrus sinensis]
 ref|XP_006419541.1| hypothetical protein CICLE_v10006308mg [Citrus clementina]
 sp|Q39644.1|LEA5_CITSI RecName: Full=Late embryogenesis abundant protein Lea5 [Citrus 
sinensis]
 emb|CAA86851.1| Lea5 protein [Citrus sinensis]
 gb|ESR32781.1| hypothetical protein CICLE_v10006308mg [Citrus clementina]
Length=97

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (61%), Gaps = 0/97 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+  AK + A V D +S+S +R   AAAA  G++S         L+    E   +++
Sbjct  1    MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASS  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            +W PDP+TGYYRPE+   E+D AELR+MLL +  R H
Sbjct  61   AWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH  97



>gb|KDP28177.1| hypothetical protein JCGZ_13948 [Jatropha curcas]
Length=88

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 9/93 (10%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS SNAK +SA +            +   +A    +G A RS  ++KK  +E  +S  
Sbjct  1    MARSFSNAKVLSALI-------TKAINSRGFSAAAPQAGAAARSGVVVKKTREEMARSTE  53

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
             TSW+PDP TG YRPE+   E+DAAELR MLLK
Sbjct  54   KTSWVPDPRTGCYRPENVAEEIDAAELRAMLLK  86



>ref|XP_006576268.1| PREDICTED: indole-3-acetic acid induced protein ARG-2 homolog 
isoform X1 [Glycine max]
 gb|ACU17303.1| unknown [Glycine max]
Length=90

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 60/93 (65%), Gaps = 10/93 (11%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARSI+NAK  SA VLD  S + TR   + +A +G V+       ++  K G++ G S+ 
Sbjct  1    MARSIANAKTFSALVLDGFSNTLTRRGYSQSATRGGVA-------SIAPKSGEDKGVSSY  53

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
              SW+PDPVTGYY+PE ++ EVD A+LR  LL+
Sbjct  54   KVSWVPDPVTGYYKPE-NIKEVDVADLRATLLR  85



>ref|XP_002321000.2| hypothetical protein POPTR_0014s12250g, partial [Populus trichocarpa]
 gb|EEE99315.2| hypothetical protein POPTR_0014s12250g, partial [Populus trichocarpa]
Length=149

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS SNAK +S  +         R ++A A+   +V      ++AM+KK G+E GKS  
Sbjct  58   MARSSSNAKVISGLI---SRAINGRGFSADASQGAAVPKARSGADAMVKKTGEEVGKSTE  114

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
             TSW+PDP TG+YRP +   E+D A LR  LLK 
Sbjct  115  KTSWVPDPRTGFYRPGNVAEEIDEAGLRASLLKK  148



>gb|KJB72703.1| hypothetical protein B456_011G191500 [Gossypium raimondii]
Length=104

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 56/104 (54%), Gaps = 7/104 (7%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD-------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGD  274
            MARS+S+ K + A V D       R    A  +   A+  +    G   R +AM +    
Sbjct  1    MARSVSSFKLLGASVFDGLYVSISRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSSS  60

Query  275  ESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            E+   +++W PDPVTGYYRPE+   E+DAAELR+MLL +  R  
Sbjct  61   ETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRSQ  104



>ref|XP_008359415.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Malus 
domestica]
Length=102

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD-------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGD  274
            MARS SNAKF+SA V+D       R   +A     A++  +G  +      N   K  G+
Sbjct  1    MARSFSNAKFLSALVVDGFSSSISRRGYAAGSQGVASSVVRGGGAATPRSVNVAKKNSGE  60

Query  275  E--SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            E     S  SW+PDP TG Y PE+   ++DAAELR  LLK
Sbjct  61   EKVXSTSKVSWVPDPKTGVYGPENGAEKIDAAELRAALLK  100



>ref|NP_001238473.1| indole-3-acetic acid induced protein ARG-2 homolog [Glycine max]
 gb|AAF05766.1|AF192758_1 indole-3-acetic acid induced protein ARG-2 homolog [Glycine max]
 gb|KHN35339.1| Indole-3-acetic acid-induced protein ARG2 [Glycine soja]
Length=86

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 50/93 (54%), Gaps = 14/93 (15%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARSI+NAK  SA VLD  S                         ++  K G++ G S+ 
Sbjct  1    MARSIANAKTFSALVLDGFSRRGYSQSATRGGVA-----------SIAPKSGEDKGVSSY  49

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
              SW+PDPVTGYY+PE ++ EVD A+LR  LL+
Sbjct  50   KVSWVPDPVTGYYKPE-NIKEVDVADLRATLLR  81



>gb|KEH24388.1| late embryogenesis abundant protein [Medicago truncatula]
Length=97

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MARS +NAK +SA +LD  S + TR   AAA    +  GV    N        E G SA 
Sbjct  1    MARSFANAKVLSAIILDGFSNTFTRRGYAAATESTTRGGVVSAGNKTGATKSREEGVSAY  60

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQML  382
              SW+PDPVTGYYRPE ++ ++DAAELR  L
Sbjct  61   KVSWVPDPVTGYYRPE-NIKDIDAAELRAKL  90



>gb|KJB72701.1| hypothetical protein B456_011G191500 [Gossypium raimondii]
 gb|KJB72702.1| hypothetical protein B456_011G191500 [Gossypium raimondii]
Length=105

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 8/105 (8%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD--------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGG  271
            MARS+S+ K + A V D        R    A  +   A+  +    G   R +AM +   
Sbjct  1    MARSVSSFKLLGASVFDGLYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSS  60

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
             E+   +++W PDPVTGYYRPE+   E+DAAELR+MLL +  R  
Sbjct  61   SETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRSQ  105



>gb|AAW31666.1| putative late-embryogenesis protein-like protein [Ammopiptanthus 
mongolicus]
Length=98

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrs--ytaaaaaqgsvsgvagrsNAMLKKGGDESGKS  289
            MARS +NAK +S  VL+R S S TR     A+A       GV   S  M  K G+E  K 
Sbjct  1    MARSFTNAKVLSVLVLNRFSSSLTRRGYAAASATQSAKRGGVVSISGKMAPKSGEE--KR  58

Query  290  AT----SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            AT    SW+PDPVTGYY+PE ++ E+D AELR  LL
Sbjct  59   ATTDKVSWVPDPVTGYYKPE-NIKEIDVAELRATLL  93



>ref|XP_010921656.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Elaeis 
guineensis]
Length=95

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +2

Query  251  AMLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            AM + GG ES  S +SW+PDPVTG+YRP +   E+D AELR MLLK  + QH
Sbjct  46   AMKRDGGLESAAS-SSWVPDPVTGFYRPANRAAEMDPAELRAMLLKPKS-QH  95



>sp|P46522.1|LEA5D_GOSHI RecName: Full=Late embryogenesis abundant protein Lea5-D [Gossypium 
hirsutum]
 gb|AAA18544.1| late embryogenesis-abundant protein [Gossypium hirsutum]
 gb|AAA18526.1| late embryogenesis-abundant protein [Gossypium hirsutum]
Length=105

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 8/105 (8%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD--------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGG  271
            MARS+S+ K + A + D        R    A  +   A+  +    G   R +AM +   
Sbjct  1    MARSVSSFKLLGASIFDGLYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSS  60

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
             E+   +++W PDPVTGYYRPE+   E+DAAELR+MLL +  R  
Sbjct  61   SETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRSQ  105



>ref|NP_001042873.1| Os01g0314800 [Oryza sativa Japonica Group]
 dbj|BAF04787.1| Os01g0314800 [Oryza sativa Japonica Group]
 gb|EAY73731.1| hypothetical protein OsI_01606 [Oryza sativa Indica Group]
 gb|EAZ11634.1| hypothetical protein OsJ_01496 [Oryza sativa Japonica Group]
Length=93

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  251  AMLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            A+ K+   ++ +  T+W+PDPVTGYYRP     EVDAAELR  LL N+ R
Sbjct  40   AVAKRTMAKAAEEKTAWVPDPVTGYYRPAGGAKEVDAAELRAKLLSNSKR  89



>gb|KHN43505.1| Indole-3-acetic acid-induced protein ARG2 [Glycine soja]
Length=98

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            M  S +N K  S+ VLD    + TR   A A+   +  GV   S  M  K G+++   +T
Sbjct  1    MTPSFTNVKIFSSLVLDGFFNALTRRGYAVASQSATKEGVGFMSGKMAPKSGEDNKGVST  60

Query  296  ---SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
               SW+PDPVTGYY+PE ++NE+D AELR MLL
Sbjct  61   YKVSWVPDPVTGYYKPE-NINEIDPAELRAMLL  92



>gb|KDO71708.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
 gb|KDO71709.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
 gb|KDO71710.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
 gb|KDO71711.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
Length=97

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 57/97 (59%), Gaps = 0/97 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+  AK + A V D +S+S  R   AAAA  G++S         L     E   +++
Sbjct  1    MARSLFKAKLLLAPVADGISLSIGRRGYAAAAPLGTISRTGIMEKNDLTPAVREDSGASS  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            +W PDP+TGYYRPE+   E+D AELR+MLL +  R H
Sbjct  61   AWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH  97



>ref|XP_006419542.1| hypothetical protein CICLE_v10006308mg [Citrus clementina]
 gb|ESR32782.1| hypothetical protein CICLE_v10006308mg [Citrus clementina]
Length=75

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  257  LKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            L+    E   ++++W PDP+TGYYRPE+   E+D AELR+MLL +  R H
Sbjct  26   LRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH  75



>emb|CAA38314.1| late embryogenesis abundant protein [Gossypium hirsutum]
Length=100

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsN---AMLKKGGDESGK  286
            MARS+S+ KF+ A V D + VS +R   AA  A     G  G+     AM +    E+  
Sbjct  1    MARSVSSFKFLGASVFDALYVSISRCTAAAVTASFGRPGAMGKVERRYAMKESSSSETRA  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
             +++W PDPVTGYYRPE+   E+DAA+LR+M+L +  R  
Sbjct  61   YSSAWAPDPVTGYYRPENCGAEIDAADLREMMLNHRVRSQ  100



>ref|NP_001237596.1| uncharacterized protein LOC100527032 [Glycine max]
 gb|ACU16069.1| unknown [Glycine max]
 gb|KHN08677.1| Indole-3-acetic acid-induced protein ARG2 [Glycine soja]
Length=98

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDE---SGK  286
            MARS SN K +SA V D  S + TR   AAA    +  G A  S+ +  K G++    G 
Sbjct  1    MARSFSNVKVLSALVADGFSNTLTRRGYAAATQSATRGGAASISSKIAPKSGEDKVGGGA  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
               SW+PDPVTGYY+PE ++ E+D AELR  +L
Sbjct  61   EKVSWVPDPVTGYYKPE-NIKEIDVAELRATVL  92



>gb|KDP27814.1| hypothetical protein JCGZ_18894 [Jatropha curcas]
Length=105

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +2

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            D+SG S+T+W PDP+TGYYRP +   E+D AELR+MLL N  R
Sbjct  62   DDSG-SSTAWAPDPITGYYRPANSAAEIDPAELREMLLHNRVR  103



>gb|KJB22519.1| hypothetical protein B456_004G052200 [Gossypium raimondii]
Length=92

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  248  NAMLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            NA + K   E  K   SW+PDPVTG YRPE+  NE+D AELR +LLK
Sbjct  44   NAAVAKQAREETKEKVSWVPDPVTGCYRPENCGNEIDVAELRAVLLK  90



>ref|XP_010522797.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Tarenaya 
hassleriana]
Length=92

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+SNA+ +S  V +        +  A A    S  G  G + A+ KK G+E+ + AT
Sbjct  1    MARSLSNARVLSNLVSN-AVCRRGFAAAATAHGSVSGGGRGGAATALKKKVGEENSQKAT  59

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
             W PDP TGYYRPE+   E+D AELR  LL N
Sbjct  60   -WGPDPKTGYYRPETGSQEIDPAELRATLLNN  90



>sp|P46521.1|LEA5A_GOSHI RecName: Full=Late embryogenesis abundant protein Lea5-A [Gossypium 
hirsutum]
 gb|AAA18545.1| late embryogenesis-abundant protein [Gossypium hirsutum]
 gb|AAA18538.1| Lea5-A late embryogenesis-abundant protein [Gossypium hirsutum]
Length=105

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 8/105 (8%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD--------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGG  271
            MARS+S+ KF+ A V D        R    A  +   A+  +    G   R  AM +   
Sbjct  1    MARSVSSFKFLGASVFDALYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRYAMKESSS  60

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
             E+   +++W PDPVTGYYRPE+   E+DAA+LR+M+L +  R  
Sbjct  61   SETRAYSSAWAPDPVTGYYRPENCGAEIDAADLREMMLNHRVRSQ  105



>gb|KDO71713.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
Length=75

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  275  ESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            E   ++++W PDP+TGYYRPE+   E+D AELR+MLL +  R H
Sbjct  32   EDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH  75



>ref|XP_010088289.1| Indole-3-acetic acid-induced protein ARG2 [Morus notabilis]
 gb|EXB33514.1| Indole-3-acetic acid-induced protein ARG2 [Morus notabilis]
Length=100

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 53/99 (54%), Gaps = 7/99 (7%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsat-----rsytaaaaaqgsvsgvagrsNAMLKKGGDE-  277
            MARS S AK ++A V+D  S   T      +      +  + +G    S ++ KK G++ 
Sbjct  1    MARSFSGAKALTALVIDGFSTVITRRGFSAAAPQGVVSSVARAGATAGSRSVKKKSGEKI  60

Query  278  -SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
                   SW+PDPVTGYYRPE+   E+D AELR  LLK 
Sbjct  61   VGNTEKVSWVPDPVTGYYRPENGAQEIDVAELRATLLKK  99



>gb|AGW45454.1| late embryogenesis abundant protein [Reaumuria trigyna]
Length=104

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = +2

Query  116  MAR-SISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA  292
            MAR S SNAK  S  V+D  S++ +R   AAA+   ++S  +             +  + 
Sbjct  1    MARCSFSNAKLFSTLVIDNFSLAFSRRTYAAASQGMAMSNSSNLLRRGGGSSSTSTSSTE  60

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
             SW+PDPVTGYYRP +H ++VD AELR+MLL
Sbjct  61   DSWVPDPVTGYYRPANHADDVDVAELREMLL  91



>ref|XP_009335697.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Pyrus 
x bretschneideri]
Length=102

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD-------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGD  274
            MARS SNAKF+SA V+D       R   +A     A++  +G  +      N   K  G+
Sbjct  1    MARSFSNAKFLSALVVDGFSSTISRRGYAAGSQGVASSVVRGGGATNPRSVNMTKKNSGE  60

Query  275  ESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            E   S    SW+PDP TG Y PE+   ++DAAELR  LLK
Sbjct  61   EKVGSTFKVSWVPDPKTGVYGPENGAEKIDAAELRAALLK  100



>ref|XP_010039859.1| PREDICTED: late embryogenesis abundant protein Lea5-D [Eucalyptus 
grandis]
Length=106

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            ++ G ++++W PDPVTGYYRP +   E+DAAELR MLL +  R  
Sbjct  62   EQPGGASSAWAPDPVTGYYRPANRAAEIDAAELRAMLLNHKVRTQ  106



>ref|XP_007201902.1| hypothetical protein PRUPE_ppa013814mg [Prunus persica]
 gb|EMJ03101.1| hypothetical protein PRUPE_ppa013814mg [Prunus persica]
Length=101

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 53/99 (54%), Gaps = 8/99 (8%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD-------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGD  274
            MARS SNAK +SA V D       R   +A     A++  +G  +      N +   G D
Sbjct  1    MARSFSNAKLLSALVADGFSSTITRRGYAAGSQGVASSVVRGGGATNPTSVNVVKNSGED  60

Query  275  E-SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            + S  S  SW+P+P TG+Y PE+   E+DAAELR  LLK
Sbjct  61   KVSSASKVSWVPNPKTGFYGPENGAEEIDAAELRAALLK  99



>gb|AFN85538.1| late embryogenesis abundant protein, partial [Olea europaea]
Length=34

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  305  PDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            PDPVTGYYRPE+   E+DAAELR  LLKNTT  H
Sbjct  1    PDPVTGYYRPENEAKEIDAAELRAQLLKNTTSSH  34



>gb|ACV50424.1| late embryogenesis protein-5 [Jatropha curcas]
Length=88

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 53/93 (57%), Gaps = 9/93 (10%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MAR  SNAK +SA +            +   +A    +G A RS  ++KK  +E  +S  
Sbjct  1    MARPFSNAKVLSALI-------TKAINSRGFSAAAPQAGAAARSGVVVKKTREEMARSTE  53

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
             TSW+PDP TG YRPE+   E+DAAELR MLLK
Sbjct  54   KTSWVPDPRTGCYRPENVAEEIDAAELRAMLLK  86



>ref|NP_171781.1| late embryogenesis abundant 3-like protein [Arabidopsis thaliana]
 gb|AAF02884.1|AC009525_18 Similar to late embryogenis abundant protein 5 [Arabidopsis thaliana]
 gb|AAM67133.1| late embryogenis abundant protein, putative [Arabidopsis thaliana]
 dbj|BAD44510.1| unknown protein [Arabidopsis thaliana]
 gb|ABD57466.1| At1g02820 [Arabidopsis thaliana]
 gb|AEE27475.1| late embryogenesis abundant 3-like protein [Arabidopsis thaliana]
Length=91

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 53/92 (58%), Gaps = 3/92 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS++NAK  S F  +++S +  R   AAAA       V+    A +KK   E+     
Sbjct  1    MARSLANAKIQSVFGSEKLSNAVFRRGFAAAAKTALDGSVS---TAEMKKRAGEASSEKA  57

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
             W+PDP TGYYRPE+   E+D AELR +LL N
Sbjct  58   PWVPDPKTGYYRPETVSEEIDPAELRAILLNN  89



>ref|XP_006414427.1| hypothetical protein EUTSA_v10026659mg [Eutrema salsugineum]
 dbj|BAJ34567.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55880.1| hypothetical protein EUTSA_v10026659mg [Eutrema salsugineum]
Length=97

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            ++W PDPVTGYYRP +  +E+D AELR+MLLKN  +
Sbjct  60   SAWAPDPVTGYYRPSNRTDEIDPAELREMLLKNKAK  95



>ref|NP_193326.4| protein DROUGHT-INDUCED 21 [Arabidopsis thaliana]
 emb|CAA55322.1| Di21 [Arabidopsis thaliana]
 gb|AAO24597.1| At4g15910 [Arabidopsis thaliana]
 gb|AEE83665.1| drought-induced 21 protein [Arabidopsis thaliana]
Length=104

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +2

Query  254  MLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            M ++G D+  +SA  W PDPVTGYYRP +   E+D AELR++LLKN  +
Sbjct  56   MEQRGLDQEAESA--WGPDPVTGYYRPSNRAAEIDPAELRELLLKNKAK  102



>gb|KGN52818.1| hypothetical protein Csa_4G001850 [Cucumis sativus]
Length=85

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  284  KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            K A SW+PDPVTGYYRPE+   E+DAA+LR MLL + T+
Sbjct  47   KKAVSWVPDPVTGYYRPENCGAEMDAADLRAMLLNSATK  85



>gb|KFK42636.1| hypothetical protein AALP_AA1G021000 [Arabis alpina]
Length=97

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 59/95 (62%), Gaps = 7/95 (7%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrs---ytaaaaaqgsvsgvagrsNAMLKK--GGDES  280
            MARS++NAK    FV +  S +  R      A  A+QG+V+     S A+LKK  GG+ +
Sbjct  1    MARSLANAKIFFVFVSEEFSNAIFRRGFCAAAKTASQGNVTSGVTGSAAVLKKNVGGEST  60

Query  281  GKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
             K+   W+PDP TGYYRPE+   E+DAAELR +LL
Sbjct  61   EKA--PWVPDPKTGYYRPETGYEEIDAAELRAVLL  93



>gb|ABD93882.1| group 5 late embryogenesis abundant protein [Citrus unshiu]
 gb|ABD93883.1| group 5 late embryogenesis abundant protein [Citrus unshiu]
Length=97

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  257  LKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            L+    E   ++++W PDP+TGYYRPE+   E+D AELR++LL +  R H
Sbjct  48   LRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREILLNHKVRAH  97



>ref|XP_009335719.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Pyrus 
x bretschneideri]
Length=102

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD-------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGD  274
            MARS SNAKF+SA V+D       R   +      A++  +G  +      N   K  G+
Sbjct  1    MARSFSNAKFLSALVVDGFSSTISRRGYAVGSQGVASSVVRGGGATNPRSVNMTKKNSGE  60

Query  275  ESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            E   S    SW+PDP TG Y PE+   ++DAAELR  LLK
Sbjct  61   EKVGSTFKVSWVPDPKTGVYGPENGAEKIDAAELRVALLK  100



>ref|XP_010457272.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=97

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 55/95 (58%), Gaps = 3/95 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFV---LDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGK  286
            MARS+SNAK +S FV   L         +  A  A++GSVS     S+A++K    E+  
Sbjct  1    MARSLSNAKILSVFVSEKLSNAVFRRGFAVAAKTASEGSVSSSENASSAVMKNKVVEASS  60

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
                W+PDP TGYYRPE+   E+D AELR +LL N
Sbjct  61   EKAPWVPDPKTGYYRPETVSEEIDPAELRAVLLNN  95



>gb|EPS60179.1| hypothetical protein M569_14625, partial [Genlisea aurea]
Length=66

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = +2

Query  248  NAMLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            NA LKK  + + KSA  W+PDP TG+YRPE++  E+D  ELR +L+KN
Sbjct  19   NATLKKTSEAAVKSA--WLPDPETGFYRPENYAKEMDPVELRALLIKN  64



>ref|XP_010269579.1| PREDICTED: late embryogenesis abundant protein Lea5-D-like [Nelumbo 
nucifera]
Length=106

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +E  + ++SW+PDPVTGYYRPE+   E+D AELR+M+L N
Sbjct  60   NERTEISSSWVPDPVTGYYRPENRGAEIDVAELREMVLNN  99



>ref|XP_009146595.1| PREDICTED: late embryogenesis abundant protein Lea5-like isoform 
X2 [Brassica rapa]
Length=98

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            ++W PDPVTGYYRP +  +E+D AELR+MLLKN  +
Sbjct  61   SAWAPDPVTGYYRPSNRADEIDPAELREMLLKNKAK  96



>dbj|BAF00107.1| hypothetical protein [Arabidopsis thaliana]
Length=53

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +2

Query  254  MLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            M ++G D+  +SA  W PDPVTGYYRP +   E+D AELR++LLKN  +
Sbjct  5    MEQRGLDQEAESA--WGPDPVTGYYRPSNRAAEIDPAELRELLLKNKAK  51



>ref|XP_009146587.1| PREDICTED: late embryogenesis abundant protein Lea5-like isoform 
X1 [Brassica rapa]
 emb|CDY22889.1| BnaA01g18270D [Brassica napus]
Length=99

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            ++W PDPVTGYYRP +  +E+D AELR+MLLKN  +
Sbjct  62   SAWAPDPVTGYYRPSNRADEIDPAELREMLLKNKAK  97



>ref|XP_009348806.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Pyrus 
x bretschneideri]
Length=102

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD-------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGD  274
            MARS SNAKF+SA V++       R   +A     A++  +G  +      N   K  G+
Sbjct  1    MARSFSNAKFLSALVVEGFSSSITRRGYAAGSQGVASSVVRGGGAATPRSVNVAKKNSGE  60

Query  275  ESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            E   S    SW+PDP TG Y PE+   ++DAAELR  LLK
Sbjct  61   EKVGSTFKVSWVPDPKTGVYGPENGAEKIDAAELRAALLK  100



>ref|XP_006418300.1| hypothetical protein EUTSA_v10009185mg [Eutrema salsugineum]
 gb|ESQ36653.1| hypothetical protein EUTSA_v10009185mg [Eutrema salsugineum]
Length=97

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 52/96 (54%), Gaps = 5/96 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNA----MLKKGGDESG  283
            MARS+SNA  +S FV +  S +  R   A AA       V+    A    M    G ES 
Sbjct  1    MARSLSNANILSVFVAEEFSNAIFRRGFAVAANTTLQGSVSSGGAASAAVMKNNVGQESS  60

Query  284  KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            + A  W+PDP TGYYRPE+   E+D AELR +LL N
Sbjct  61   EKAP-WVPDPKTGYYRPETVSEEIDPAELRAVLLNN  95



>ref|NP_001238729.1| uncharacterized protein LOC100306430 [Glycine max]
 gb|ACU14601.1| unknown [Glycine max]
Length=98

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            M  S ++ K  S+ VLD    + TR   A A+   +  GV   S  M  K G+++   +T
Sbjct  1    MTPSFTSVKIFSSLVLDGFFNALTRRGYAVASQSATKEGVGFMSGKMAPKSGEDNKGVST  60

Query  296  ---SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
               SW+PDPVTGYY+PE ++NE+D AELR MLL
Sbjct  61   HKVSWVPDPVTGYYKPE-NINEIDPAELRAMLL  92



>ref|XP_007145200.1| hypothetical protein PHAVU_007G218700g [Phaseolus vulgaris]
 gb|ESW17194.1| hypothetical protein PHAVU_007G218700g [Phaseolus vulgaris]
Length=99

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD--RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKS  289
            MARS +  K +SA V D    +++      AAA    +  G A  S  +  K G+E G+ 
Sbjct  1    MARSFTTVKVLSALVADGFSNTLTRRGFAAAAATQSATRGGGASISGNITPKSGEEKGRG  60

Query  290  A--TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            A   SW+PDPVTGYY+PE + NE+D A+LR M+L
Sbjct  61   AEKVSWVPDPVTGYYKPE-NTNEIDVADLRAMVL  93



>ref|XP_008235109.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Prunus 
mume]
Length=101

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 10/100 (10%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD-------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGD  274
            MARS SNAK +SA V D       R   +A     A++  +G  +      N ++K  G+
Sbjct  1    MARSFSNAKLLSALVADGFSSTITRRGYAAGSQRVASSVVRGGGATSPRSVN-VVKNSGE  59

Query  275  ESGKSAT--SWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            +  +SA+  SW+P+P TG+Y PE+   E+DAAELR  LLK
Sbjct  60   DKVRSASKVSWVPNPKTGFYGPENGAEEIDAAELRAALLK  99



>emb|CAB10370.1| drought-induced protein like [Arabidopsis thaliana]
 emb|CAB78633.1| drought-induced protein like [Arabidopsis thaliana]
Length=87

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +2

Query  254  MLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            M ++G D+  +SA  W PDPVTGYYRP +   E+D AELR++LLKN  +
Sbjct  39   MEQRGLDQEAESA--WGPDPVTGYYRPSNRAAEIDPAELRELLLKNKAK  85



>gb|KHN20395.1| Indole-3-acetic acid-induced protein ARG2 [Glycine soja]
Length=98

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  260  KKGGDESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            K G D  G S    SW+PDPVTGYY+PE ++NE+D AELR MLL
Sbjct  50   KSGEDNKGVSTYKVSWVPDPVTGYYKPE-NINEIDPAELRAMLL  92



>sp|P32292.1|ARG2_VIGRR RecName: Full=Indole-3-acetic acid-induced protein ARG2 [Vigna 
radiata var. radiata]
 dbj|BAA03307.1| hypothetical protein [Vigna radiata var. radiata]
Length=99

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 54/94 (57%), Gaps = 5/94 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD--RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDES--G  283
            MARS +N K +SA V D    + +      AAAA Q +  G A     M+ K G+E   G
Sbjct  1    MARSFTNVKVLSALVADGFSNTTTRHGFAAAAAATQSATRGGASIGGNMVPKSGEEKVRG  60

Query  284  KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
                SW+PDPVTGYYRPE + NE+D A++R  +L
Sbjct  61   GEKVSWVPDPVTGYYRPE-NTNEIDVADMRATVL  93



>ref|XP_008369025.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Malus domestica]
Length=102

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD-------RvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGD  274
            MARS SNAKF+S  V+D       R   +A     A++  +G  +      N   K  G+
Sbjct  1    MARSFSNAKFLSXLVVDGFSSSISRRGYAAGSQGVASSVVRGGGATNPRSVNXXKKNSGE  60

Query  275  ESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            E   S    SW+PDP TG Y PE+   ++DAAELR  LLK
Sbjct  61   EKVGSTFKVSWVPDPKTGVYGPENGTAKIDAAELRAALLK  100



>ref|XP_008454329.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like [Cucumis 
melo]
Length=85

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  284  KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            K A SW+PDPVTGYYRPE+   E+DAA+LR MLL   T+
Sbjct  47   KMAVSWVPDPVTGYYRPENCGAEMDAADLRAMLLNPATK  85



>ref|XP_008454328.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like [Cucumis 
melo]
Length=81

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  284  KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            K+A +W+PDPVTGYYRPE++V+E+D  +LR  LLK
Sbjct  40   KAAAAWMPDPVTGYYRPENYVDEMDPVDLRDKLLK  74



>gb|ABK26089.1| unknown [Picea sitchensis]
Length=114

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  278  SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +G   TSW+PDPVTGYY PE H  E D AELR+ +LKN
Sbjct  67   AGYRQTSWMPDPVTGYYIPEDHFGESDIAELRENILKN  104



>emb|CDY44170.1| BnaC01g22200D [Brassica napus]
Length=99

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            ++W PDPVTGYYRP +  +E+D AELR+MLLKN  +
Sbjct  62   SAWAPDPVTGYYRPFNRADEIDPAELREMLLKNKAK  97



>gb|KDO71707.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
Length=97

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSAT  295
            MARS+  AK + A V D +S+S  R   AAAA  G++S         L     E   +++
Sbjct  1    MARSLFKAKLLLAPVADGISLSIGRRGYAAAAPLGTISRTGIMEKNDLTPAVREDSGASS  60

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            +W PDP+TGYYRPE+   E+D AELR+MLL +  R
Sbjct  61   AWAPDPITGYYRPENRAVEIDPAELREMLLNHKLR  95



>gb|AFK35936.1| unknown [Medicago truncatula]
 gb|KEH24387.1| late embryogenesis abundant protein [Medicago truncatula]
Length=99

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 55/95 (58%), Gaps = 5/95 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD--RvsvsatrsytaaaaaqgsvsgvagrsNAM--LKKGGDESG  283
            MARS +NAK +SA VL+    +++      A  +A   V GV    N M   K G D S 
Sbjct  1    MARSFANAKVLSAVVLEGFSNTLTRRGYAAATESATRVVGGVVSVGNKMGPTKSGEDGSS  60

Query  284  KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
                SW+PDPVTGYY+PE ++ + DAA+LR  LL+
Sbjct  61   TYKVSWVPDPVTGYYKPE-NIKDTDAADLRAKLLR  94



>ref|XP_006284808.1| hypothetical protein CARUB_v10006078mg [Capsella rubella]
 gb|EOA17706.1| hypothetical protein CARUB_v10006078mg [Capsella rubella]
Length=107

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            ++W PDPVTGYYRP +  +E+D AELR++LLKN ++
Sbjct  69   SAWGPDPVTGYYRPSNRADEIDPAELRELLLKNKSK  104



>ref|XP_004296856.1| PREDICTED: late embryogenesis abundant protein Lea5 [Fragaria 
vesca subsp. vesca]
Length=96

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  284  KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            +S+++W PDP TGYYRP +  +E+D  ELRQMLL    RQ 
Sbjct  56   ESSSAWAPDPRTGYYRPANRADEIDPVELRQMLLNQKVRQQ  96



>ref|XP_010105150.1| Late embryogenesis abundant protein Lea5 [Morus notabilis]
 gb|EXC03958.1| Late embryogenesis abundant protein Lea5 [Morus notabilis]
Length=96

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  284  KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            + + +W PDP+TGYYRP +H +E+D  ELRQ LL N  R
Sbjct  56   EGSNAWAPDPLTGYYRPGNHADEIDPVELRQTLLNNKVR  94



>gb|ABK25244.1| unknown [Picea sitchensis]
Length=114

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  278  SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +G   TSW+PDPVTGYY PE H  E D AELR+ +LKN
Sbjct  67   AGCRQTSWMPDPVTGYYIPEDHFGESDIAELRENILKN  104



>gb|ABK24221.1| unknown [Picea sitchensis]
Length=144

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 2/46 (4%)
 Frame = +2

Query  260  KKGGDE--SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            K+G D+  SG    SW+PDPVTGYY PE H  E D AELR+ +LKN
Sbjct  89   KQGDDKAGSGYRQRSWMPDPVTGYYIPEDHFGESDIAELRENILKN  134



>gb|ACJ46652.1| intrinsically disordered protein 1 [Lotus japonicus]
Length=94

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDE--SGKS  289
            MARS +N K +SA V +  S S  R   AA A      G +        K G+E  + + 
Sbjct  1    MARSFTNIKAISALVAEEFSNSLARRGYAATAQSAGRVGASMSGKMGSTKSGEEKAAARE  60

Query  290  ATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
              SW+PDPVTGYY+PE ++ E+D AELR  +L
Sbjct  61   KVSWVPDPVTGYYKPE-NIKEIDVAELRSAVL  91



>ref|XP_007163120.1| hypothetical protein PHAVU_001G207900g [Phaseolus vulgaris]
 gb|ESW35114.1| hypothetical protein PHAVU_001G207900g [Phaseolus vulgaris]
Length=103

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 55/92 (60%), Gaps = 3/92 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKSA-  292
            MA S ++AK  S+F L   S S TR   A A+   +  GV   SN +    G++ G S  
Sbjct  1    MAPSFTSAKTFSSFFLHGFSNSLTRRGYAVASQNPAKGGVVSLSNKIAPTSGEDKGVSPY  60

Query  293  -TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
              SW+PDPV+GYY+PE ++NEVD AELR  LL
Sbjct  61   KVSWVPDPVSGYYKPE-NINEVDVAELRATLL  91



>ref|XP_002315512.1| hypothetical protein POPTR_0010s01590g [Populus trichocarpa]
 gb|EEF01683.1| hypothetical protein POPTR_0010s01590g [Populus trichocarpa]
Length=107

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  275  ESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            E  ++ ++W PDPVTGYYRP ++V E+D AELR+M+L +  R  
Sbjct  64   EDSEAYSAWAPDPVTGYYRPANYVAEIDPAELREMVLSHRVRPQ  107



>ref|XP_004494380.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Cicer 
arietinum]
Length=96

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGKS-A  292
            MARS +NAK +S  +L+  S + TR   AAA    S  G         K G ++SG +  
Sbjct  1    MARSFANAKVLSTILLNGFSNTLTRRGYAAATESASKVGSISGKITAPKSGEEKSGSTYK  60

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
             SW+PDPVTGYY+PE ++ ++DAA+LR  L+
Sbjct  61   VSWVPDPVTGYYKPE-NIKDIDAADLRAKLI  90



>ref|XP_004967516.1| PREDICTED: late embryogenesis abundant protein Lea5-D-like [Setaria 
italica]
Length=96

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            T W+PDPVTGYYRP     EVDAAELR MLL
Sbjct  58   TPWVPDPVTGYYRPAGGTMEVDAAELRAMLL  88



>emb|CDY15266.1| BnaC05g01450D [Brassica napus]
Length=98

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +2

Query  248  NAMLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +AM K  G+ES + A  WIPDP TGYYRP +   E+D AELR +LL N
Sbjct  50   SAMKKNVGEESSEKA-PWIPDPKTGYYRPATVSQEIDPAELRAVLLNN  96



>ref|XP_010914474.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Elaeis 
guineensis]
Length=102

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            W+PDPVTGYYRP +   EVDAAELR+ LL  T+R
Sbjct  68   WVPDPVTGYYRPGNRRAEVDAAELRETLLSRTSR  101



>gb|ABK23144.1| unknown [Picea sitchensis]
Length=112

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 2/46 (4%)
 Frame = +2

Query  260  KKGGDES--GKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            K+G D++  G    SW+PDPVTGYY PE H  E D AELR+ +LKN
Sbjct  57   KQGDDKAAAGYRQRSWMPDPVTGYYIPEDHFGESDIAELRENILKN  102



>ref|XP_010931673.1| PREDICTED: late embryogenesis abundant protein Lea5-D [Elaeis 
guineensis]
Length=100

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQ  403
            W+PDPVTGYYRP +   +VDAAELR++LL + +RQ
Sbjct  66   WVPDPVTGYYRPGNRRADVDAAELREILLSHRSRQ  100



>ref|XP_011010195.1| PREDICTED: late embryogenesis abundant protein Lea5 [Populus 
euphratica]
Length=107

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  275  ESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            E  ++ ++W PDPVTGYYRP ++V E+D AELR+M+L    R  
Sbjct  64   EGSEAYSAWAPDPVTGYYRPANYVPEIDPAELREMVLSRRVRPQ  107



>gb|AFK36920.1| unknown [Lotus japonicus]
Length=94

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDE--SGKS  289
            MARS +N K +SA V +  S S  R   AA A      G +        K G+E  + + 
Sbjct  1    MARSFTNIKAISALVAEEFSNSLARRGYAAIAQSAGRVGASMSGKMGSTKSGEEKAAARE  60

Query  290  ATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
              SW+PDPVTGYY+PE ++ E+D AELR  +L
Sbjct  61   KVSWVPDPVTGYYKPE-NIKEIDVAELRSAVL  91



>ref|XP_009119608.1| PREDICTED: late embryogenesis abundant protein Lea5 [Brassica 
rapa]
 emb|CDX89941.1| BnaA10g01410D [Brassica napus]
Length=98

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = +2

Query  251  AMLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            AM K  G+ES + A  WIPDP TGYYRP +   E+D AELR +LL N
Sbjct  51   AMKKNVGEESSEKA-PWIPDPKTGYYRPATVSEEIDPAELRAVLLNN  96



>ref|XP_008789853.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Phoenix 
dactylifera]
Length=102

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +2

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            + +   ++SW+PDPVTGYYRP +   E D AELR MLLK  + QH
Sbjct  59   EPAAAPSSSWVPDPVTGYYRPANRAAETDPAELRAMLLKPKS-QH  102



>gb|ACJ84182.1| unknown [Medicago truncatula]
Length=99

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 5/95 (5%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLD--RvsvsatrsytaaaaaqgsvsgvagrsNAM--LKKGGDESG  283
            MARS +NA+ +SA VL+    +++      A  +A   V GV    N M   K G D S 
Sbjct  1    MARSFANARVLSAVVLEGFSNTLTRRGYAAATESATRVVGGVVSVGNKMGPTKSGEDGSS  60

Query  284  KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
                SW+PDPVTGYY+PE ++ + DAA+LR  LL+
Sbjct  61   TYKVSWVPDPVTGYYKPE-NIKDTDAADLRAKLLR  94



>gb|AFK48640.1| unknown [Lotus japonicus]
Length=94

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 3/92 (3%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDE--SGKS  289
            MARS +N K +SA V +  S S  R   AA A      G +        K G+E  + + 
Sbjct  1    MARSFTNIKAISALVAEEFSNSLARRGYAATAQSAGRVGASMSGKMGSTKSGEEKAAARE  60

Query  290  ATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
              SW+PDPVTGYY+PE ++ E+D AELR  +L
Sbjct  61   KVSWVPDPVTGYYKPE-NIKEIDVAELRPAVL  91



>emb|CDY69011.1| BnaAnng29120D [Brassica napus]
Length=57

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = +2

Query  257  LKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            L++  ++  +SA  W PDPVTGYYRP +  +E+D AELR+MLL+N  +
Sbjct  10   LEQRANQEAESA--WAPDPVTGYYRPSNCADEIDPAELRKMLLENKAK  55



>ref|XP_002870200.1| hypothetical protein ARALYDRAFT_493294 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46459.1| hypothetical protein ARALYDRAFT_493294 [Arabidopsis lyrata subsp. 
lyrata]
Length=104

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            ++W PDPVTGYYRP +   E+D AELR++LLKN  +
Sbjct  67   SAWGPDPVTGYYRPSNRAAEIDPAELRELLLKNKAK  102



>ref|XP_004290804.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Fragaria 
vesca subsp. vesca]
Length=97

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 51/95 (54%), Gaps = 4/95 (4%)
 Frame = +2

Query  116  MARSISNAKFVSAFV---LDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDESGK  286
            MARS SNAK +SA V   + R   +A     AA   + + + V    N   K G D+ G 
Sbjct  1    MARSFSNAKLLSALVSNTIARRGYAAGSPGLAAVRGEVAAASVTRSVNLEKKSGEDKVGS  60

Query  287  S-ATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
                SW+P+P TG Y PE+  +E+D AELR  LLK
Sbjct  61   VFKVSWVPNPKTGVYGPENRADEIDVAELRNALLK  95



>gb|ACJ09640.1| putative late embryogenesis abundant protein [Cupressus sempervirens]
Length=145

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = +2

Query  95   QFLWGDQMAR-SISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGG  271
            Q    + MAR S SNAK VS  V+D        + TA ++   +   ++  SN   + GG
Sbjct  3    QLTLEEIMARCSYSNAKLVSTLVVD--------NLTALSSMSYAHIVMSNSSNVRRRAGG  54

Query  272  DESGKSATS----WIPDPVTGYYRPESHVNEVDAAELRQMLL  385
                 S TS    W+  PVTGYYRP +H ++VD AELR+MLL
Sbjct  55   SNHATSTTSNDESWV-HPVTGYYRPANHADDVDVAELREMLL  95



>ref|XP_010449879.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=104

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = +2

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            D+  +SA  W PDPVTGYYRP     E+D AELR++LLKN ++
Sbjct  62   DQEAESA--WGPDPVTGYYRPSDRAAEIDPAELRELLLKNKSK  102



>ref|XP_008223211.1| PREDICTED: late embryogenesis abundant protein Lea5 [Prunus mume]
Length=103

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +2

Query  272  DESG-KSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            +ESG  S+++W PDP+TGYYRP +  +E+D  ELR+MLLK+ T+
Sbjct  60   EESGLGSSSAWAPDPLTGYYRPSNCSDEIDPVELREMLLKHRTK  103



>ref|NP_001237743.1| uncharacterized protein LOC100306369 [Glycine max]
 gb|ACU14506.1| unknown [Glycine max]
 gb|KHN03714.1| Indole-3-acetic acid-induced protein ARG2 [Glycine soja]
Length=95

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 52/93 (56%), Gaps = 7/93 (8%)
 Frame = +2

Query  116  MARSISNAKFVSAFVLDRvsvsatrsytaaaaaqgsvsgvagrsNAMLKKGGDE---SGK  286
            MARS SN K +SA V D  S + TR   A A    +  G A  S    K G D+    G 
Sbjct  1    MARSFSNLKVLSALVADGFSNTLTRRGYAVATQSATRGGAASISG---KSGEDKVLGGGA  57

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
               SW+PDPVTGYY+PE ++ E+D AELR  +L
Sbjct  58   EKVSWVPDPVTGYYKPE-NIKEIDVAELRATVL  89



>ref|XP_010548983.1| PREDICTED: late embryogenesis abundant protein Lea5 [Tarenaya 
hassleriana]
Length=106

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            +W PDP+TGYYRP +   E+D AELR+MLLK+ ++
Sbjct  70   AWAPDPITGYYRPANRAAEIDPAELREMLLKHKSK  104



>gb|ADB85105.1| putative indole-3-acetic acid-induced protein ARG2 [Jatropha 
curcas]
Length=41

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            TSW+PDP TG YRPE+   E+DAAELR MLLK
Sbjct  8    TSWVPDPRTGCYRPENVAEEIDAAELRAMLLK  39



>ref|NP_001237642.1| uncharacterized protein LOC100500411 [Glycine max]
 gb|ACU15486.1| unknown [Glycine max]
Length=98

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = +2

Query  260  KKGGDESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            K G D  G S    SW+PDPVTGYY+PE ++NE+D AE R MLL
Sbjct  50   KSGEDNKGVSTYKVSWVPDPVTGYYKPE-NINEIDPAESRAMLL  92



>ref|XP_004967515.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Setaria 
italica]
Length=94

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            T+W+PDP TGYYRP     EVDAAELR  LL
Sbjct  59   TAWVPDPATGYYRPAGGAKEVDAAELRAKLL  89



>gb|AJA33571.1| late embryogenesis abundant protein LEA3-2 [Pinus tabuliformis]
Length=96

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = +2

Query  260  KKGGDES--GKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            K+G D++  G    SW+PDPVTGYY PE H  E D AELR+ +LK
Sbjct  41   KQGDDKAAAGYRQRSWMPDPVTGYYIPEDHFGETDIAELRENMLK  85



>gb|AJA33572.1| late embryogenesis abundant protein LEA3-3 [Pinus tabuliformis]
Length=106

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 2/46 (4%)
 Frame = +2

Query  260  KKGGDES--GKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            K+G D++  G    SW+PDPVTGYY PE H  E D AELR+ +LK 
Sbjct  51   KQGDDKAAAGYRQRSWMPDPVTGYYIPEDHFGETDIAELRENMLKE  96



>ref|XP_008673995.1| PREDICTED: late embryogenesis abundant protein Lea5-D-like [Zea 
mays]
 tpg|DAA54393.1| TPA: hypothetical protein ZEAMMB73_004031 [Zea mays]
Length=91

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            T W+PDPVTGYYRP     EVDAAELR  LL
Sbjct  55   TPWVPDPVTGYYRPAGGAKEVDAAELRARLL  85



>ref|XP_002516942.1| Late embryogenesis abundant protein Lea5, putative [Ricinus communis]
 gb|EEF45556.1| Late embryogenesis abundant protein Lea5, putative [Ricinus communis]
Length=97

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  275  ESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            E   + ++W PDPVTGYYRP +   E+D AELR+ LL +  R H
Sbjct  54   EDSGACSAWAPDPVTGYYRPANRAAEIDPAELRETLLNHRVRPH  97



>ref|XP_007227374.1| hypothetical protein PRUPE_ppa027021mg, partial [Prunus persica]
 gb|EMJ28573.1| hypothetical protein PRUPE_ppa027021mg, partial [Prunus persica]
Length=78

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            W PDP+TGYYRP +  NE+D  ELR+MLLK+ T+
Sbjct  45   WAPDPLTGYYRPSNCANEIDPVELREMLLKHRTK  78



>ref|XP_010481253.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=81

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  248  NAMLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +A++K    E+      W+PDP TGYYRPE+   E+D AELR +LL N
Sbjct  32   SAVMKNKVVEASSEKAPWVPDPKTGYYRPETVSEEIDPAELRAVLLNN  79



>ref|XP_010434909.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=104

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            W PDPVTGYYRP +   E+D AELR++LLKN  +
Sbjct  69   WGPDPVTGYYRPSNRAVEIDPAELRELLLKNKAK  102



>ref|XP_002457756.1| hypothetical protein SORBIDRAFT_03g012940 [Sorghum bicolor]
 gb|EES02876.1| hypothetical protein SORBIDRAFT_03g012940 [Sorghum bicolor]
Length=96

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            T W+PDPVTGYYRP     EVDAAELR  LL
Sbjct  60   TPWVPDPVTGYYRPAGGTKEVDAAELRARLL  90



>ref|XP_007147243.1| hypothetical protein PHAVU_006G107900g [Phaseolus vulgaris]
 gb|ESW19237.1| hypothetical protein PHAVU_006G107900g [Phaseolus vulgaris]
Length=94

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  263  KGGDESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            K G+E   S    SW+PDPVTGYY+PE ++NEVD A+LR  LL+
Sbjct  46   KSGEEKRVSTYEVSWVPDPVTGYYKPE-NINEVDVADLRATLLR  88



>ref|XP_004152362.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Cucumis 
sativus]
 gb|KGN52819.1| hypothetical protein Csa_4G001860 [Cucumis sativus]
Length=114

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +2

Query  260  KKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            K+  + S + A  WIPDPVTG YRPES+++E+DA +LR  LLK
Sbjct  65   KEESERSTEKAAVWIPDPVTGCYRPESNMDEMDAVDLRAKLLK  107



>gb|ABK93850.1| unknown [Populus trichocarpa]
Length=107

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  275  ESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            E  ++ ++W PDPVTGYYRP ++  E+D AELR+M+L +  R  
Sbjct  64   EDSEAYSAWAPDPVTGYYRPANYEAEIDPAELREMVLSHRVRPQ  107



>gb|AAM28284.1| late-embryogenesis abundant protein-like protein [Ananas comosus]
Length=93

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  290  ATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            A +W+PDPVTGYYRP +   E+DAA LR++LL
Sbjct  58   AVAWLPDPVTGYYRPANRAGEMDAAGLREVLL  89



>ref|XP_009417840.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Musa 
acuminata subsp. malaccensis]
Length=102

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            SW+PDP TGYYRP + + E+D AELR+M+L
Sbjct  66   SWVPDPATGYYRPANRMGEIDPAELREMML  95



>ref|NP_001152662.1| late embryogenesis abundant protein [Zea mays]
 gb|ACG48808.1| late embryogenesis abundant protein [Zea mays]
Length=102

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            W+PDPVTGYYRP     EVDAAELR  LL
Sbjct  68   WVPDPVTGYYRPAGSAKEVDAAELRSKLL  96



>gb|AGC51784.1| ATDI21 [Manihot esculenta]
Length=97

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = +2

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQH  406
            ++SG S ++W PDP+TGYYRP +   E+D AELR+MLL +  R  
Sbjct  54   EDSGAS-SAWAPDPITGYYRPANCGAEIDPAELREMLLNHRVRPQ  97



>ref|XP_004508204.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Cicer 
arietinum]
Length=104

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  275  ESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            +  ++ ++W PDP TGYYRP +H+ ++D  ELR +LLK+ +R
Sbjct  60   DGSEACSAWAPDPETGYYRPINHIPKIDPVELRNLLLKHNSR  101



>ref|XP_008812281.1| PREDICTED: late embryogenesis abundant protein Lea5-D-like [Phoenix 
dactylifera]
Length=100

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQ  403
            W+PDPVTGYYRP +   +VDAAELR+ LL +  R+
Sbjct  66   WVPDPVTGYYRPGNRRADVDAAELRERLLSDGPRR  100



>ref|NP_001147291.1| LOC100280899 [Zea mays]
 gb|ACG26616.1| late embryogenesis abundant protein [Zea mays]
Length=102

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            W+PDPVTGYYRP     EVDAAELR  LL
Sbjct  68   WVPDPVTGYYRPAGSAKEVDAAELRAKLL  96



>ref|XP_008807301.1| PREDICTED: late embryogenesis abundant protein Lea5-D-like [Phoenix 
dactylifera]
Length=98

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQ  403
            W+PDPVTGYYRP +   EVDAAELR+  L + +R 
Sbjct  64   WVPDPVTGYYRPGNRRAEVDAAELRETFLSHRSRH  98



>tpg|DAA54394.1| TPA: late embryogeneis abundant protein [Zea mays]
Length=102

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            W+PDPVTGYYRP     EVDAAELR  LL
Sbjct  68   WVPDPVTGYYRPAGSAKEVDAAELRAKLL  96



>ref|XP_003609687.1| Late embryogenesis abundant protein Lea5 [Medicago truncatula]
 gb|AES91884.1| late embryogenesis abundant protein [Medicago truncatula]
Length=103

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = +2

Query  257  LKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            + K G E+    ++W PDP +GYYRP ++  ++D  ELRQMLLK  TR
Sbjct  56   MSKDGQEA---CSAWAPDPESGYYRPINYTPKIDPVELRQMLLKRNTR  100



>gb|ABK21424.1| unknown [Picea sitchensis]
Length=110

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  278  SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +G    SW+PDPVTGYY PE H  E D AE R+ +L+N
Sbjct  63   AGYKQRSWMPDPVTGYYIPEDHFGEADVAEQRENILRN  100



>gb|ABR16260.1| unknown [Picea sitchensis]
 gb|ACN40639.1| unknown [Picea sitchensis]
Length=110

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  278  SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +G    SW+PDPVTGYY PE H  E D AE R+ +L+N
Sbjct  63   AGYKQRSWMPDPVTGYYIPEDHFGEADVAEQRENILRN  100



>emb|CDY49968.1| BnaC08g10490D [Brassica napus]
Length=94

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 2/48 (4%)
 Frame = +2

Query  257  LKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            L++  ++  +SA  W PD VTGYYRP +  +E+D AELR+MLLKN  +
Sbjct  47   LEQRANQEAESA--WAPDSVTGYYRPSNCADEIDPAELREMLLKNKAK  92



>ref|XP_010440235.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=104

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            ++W PDPVTGYY P +   E+D AELR++LLKN
Sbjct  67   SAWGPDPVTGYYSPSNRAAEIDPAELRELLLKN  99



>ref|XP_009352286.1| PREDICTED: late embryogenesis abundant protein Lea5-D [Pyrus 
x bretschneideri]
Length=97

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 2/45 (4%)
 Frame = +2

Query  272  DESGKSATS--WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            +ESG  A S  W PDP TGYYRP +  +E+D  ELR+MLL +  +
Sbjct  53   EESGLGAPSSAWAPDPRTGYYRPANRADEIDPVELREMLLNHKAK  97



>ref|XP_006644122.1| PREDICTED: LOW QUALITY PROTEIN: late embryogenesis abundant protein 
Lea5-D-like [Oryza brachyantha]
Length=94

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            W+PDPVTGYYRP     EVDAAELR  LL
Sbjct  59   WVPDPVTGYYRPAGGAKEVDAAELRAKLL  87



>ref|NP_001235600.1| desiccation protective protein LEA5 [Glycine max]
 gb|AAB38782.1| desiccation protective protein LEA5 [Glycine max]
 gb|ACU14115.1| unknown [Glycine max]
 gb|KHN03353.1| Late embryogenesis abundant protein Lea5 [Glycine soja]
Length=113

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  272  DESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            D S   +T W PDPVTGYYRP +H  E+D  ELR  LL++
Sbjct  62   DGSKAYSTDWAPDPVTGYYRPINHTPEIDPVELRHRLLRS  101



>gb|AJA33570.1| late embryogenesis abundant protein LEA3-1 [Pinus tabuliformis]
Length=113

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +2

Query  278  SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            SG    SW+PDPVTGYY PE H    D AELR+ +LK
Sbjct  66   SGYRQRSWMPDPVTGYYIPEDHFGVTDVAELRENMLK  102



>ref|XP_009405433.1| PREDICTED: late embryogenesis abundant protein Lea5-D [Musa acuminata 
subsp. malaccensis]
Length=102

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            SW+PDPVTGYYRP +   +VDAAELR+M L
Sbjct  69   SWVPDPVTGYYRPSNLRAQVDAAELREMTL  98



>gb|ADQ91844.1| late embryogenesis abundant protein group 6 protein [Arachis 
hypogaea]
Length=97

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 1/31 (3%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
             SW+PDPVTGYY+PE ++ E+D AELR  LL
Sbjct  65   VSWVPDPVTGYYKPE-NIKEIDVAELRASLL  94



>gb|EMT12321.1| Late embryogenesis abundant protein Lea5 [Aegilops tauschii]
Length=90

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  278  SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQML  382
            +G    +W+PDPVTGYYRP     EVDAA+LR  L
Sbjct  54   AGVEKAAWVPDPVTGYYRPSGAAKEVDAADLRAKL  88



>ref|NP_001148295.1| protein induced upon tuberization [Zea mays]
 gb|ACG30433.1| protein induced upon tuberization [Zea mays]
Length=96

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +2

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            +W+PDPVTGYYRP     EVDAAELR  LL
Sbjct  65   AWLPDPVTGYYRPAGSHREVDAAELRAKLL  94



>dbj|BAJ92313.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=90

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  278  SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQML  382
            +G    +W+PDPVTGYYRP     EVDAA+LR  L
Sbjct  54   AGAEKAAWVPDPVTGYYRPSGAAKEVDAADLRAKL  88



>gb|ABG66530.1| putative late embryogenesis abundant protein [Prosopis juliflora]
Length=93

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 1/30 (3%)
 Frame = +2

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            +W+PDPVTGYYRPE +  E+D AELR  LL
Sbjct  62   AWVPDPVTGYYRPE-NTKEIDVAELRATLL  90



>gb|ABK23388.1| unknown [Picea sitchensis]
Length=110

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  278  SGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +G    SW+PDPVTGYY PE H  E D AE R+ +L+ 
Sbjct  63   AGYKQRSWMPDPVTGYYIPEDHFGEADVAEQRENILRT  100



>ref|XP_010544998.1| PREDICTED: late embryogenesis abundant protein Lea5-D-like [Tarenaya 
hassleriana]
Length=88

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +2

Query  260  KKGGDESGKSATSWIPDPVTGYYRPESHVNE-VDAAELRQMLL  385
            +KG   S +  +SW PDP TGYYRP+   NE VDAAELR  LL
Sbjct  41   RKGTRGSREKPSSWAPDPKTGYYRPDPSANELVDAAELRASLL  83



>ref|XP_006840483.1| hypothetical protein AMTR_s00045p00188290 [Amborella trichopoda]
 gb|ERN02158.1| hypothetical protein AMTR_s00045p00188290 [Amborella trichopoda]
Length=98

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            W+PDPVTGYY PE H  E D A+LR+ LL
Sbjct  62   WMPDPVTGYYLPEDHFGETDVAQLREELL  90



>ref|XP_006840482.1| hypothetical protein AMTR_s00045p00188150 [Amborella trichopoda]
 gb|ERN02157.1| hypothetical protein AMTR_s00045p00188150 [Amborella trichopoda]
Length=105

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTT  397
            W+PDPVTGYY PE H  E D A+LR+ LL   T
Sbjct  69   WMPDPVTGYYVPEDHFGETDVAQLREELLNQKT  101



>ref|XP_002457757.1| hypothetical protein SORBIDRAFT_03g012950 [Sorghum bicolor]
 gb|EES02877.1| hypothetical protein SORBIDRAFT_03g012950 [Sorghum bicolor]
Length=102

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 23/30 (77%), Gaps = 1/30 (3%)
 Frame = +2

Query  299  WIPDPVTGYYRPE-SHVNEVDAAELRQMLL  385
            W+PDPVTGYYRP  S   EVDAAELR  LL
Sbjct  67   WVPDPVTGYYRPAGSAAKEVDAAELRAKLL  96



>emb|CDM85327.1| unnamed protein product [Triticum aestivum]
Length=91

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 2/38 (5%)
 Frame = +2

Query  275  ESGKSA--TSWIPDPVTGYYRPESHVNEVDAAELRQML  382
            E G SA   +W+PDPVTGYYRP     EVDAA+LR  L
Sbjct  52   EVGASAEKAAWVPDPVTGYYRPSGAPKEVDAADLRAKL  89



>ref|XP_003567608.1| PREDICTED: late embryogenesis abundant protein Lea5-D-like [Brachypodium 
distachyon]
Length=89

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQML  382
            W+PDPVTG YRP S   EVDAAELR  L
Sbjct  61   WVPDPVTGCYRPSSGAKEVDAAELRSKL  88



>ref|XP_008390644.1| PREDICTED: late embryogenesis abundant protein Lea5-A [Malus 
domestica]
Length=97

 Score = 49.3 bits (116),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 2/45 (4%)
 Frame = +2

Query  272  DESGKSATS--WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            +ESG  A S  W PDP TGYYRP +  +E+D   LR+MLL +  +
Sbjct  53   EESGLGAPSSAWAPDPRTGYYRPANRADEIDPVGLREMLLNHKAK  97



>gb|AFU81504.1| LEA5-2.1, partial [Vigna unguiculata]
 gb|AFU81505.1| LEA5-2.2, partial [Vigna unguiculata]
 gb|AFU81507.1| LEA5-2.1 [Vigna unguiculata]
 gb|AFU81508.1| LEA5-2.2 [Vigna unguiculata]
 gb|AGI03025.1| late embryogenesis abundant [Vigna unguiculata]
Length=107

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  275  ESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +  K+ + W PDPVTG YRP +H  E+D  ELR+MLL +
Sbjct  63   DGAKAYSDWAPDPVTGDYRPINHTPEIDPVELRRMLLNH  101



>ref|XP_007154177.1| hypothetical protein PHAVU_003G096700g [Phaseolus vulgaris]
 gb|ESW26171.1| hypothetical protein PHAVU_003G096700g [Phaseolus vulgaris]
Length=104

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +2

Query  275  ESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +  K+ + W PDPVTG YRP +H   +D  ELRQMLL +
Sbjct  60   DGAKAYSDWAPDPVTGDYRPMNHTPGIDPVELRQMLLNH  98



>gb|AFU81503.1| LEA5-1, partial [Vigna unguiculata]
 gb|AFU81506.1| LEA5-1 [Vigna unguiculata]
Length=107

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  275  ESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLLKN  391
            +  K+ + W PDP+TG YRP +H  E+D  ELR+MLL +
Sbjct  63   DGAKAYSDWAPDPITGDYRPINHTPEIDPVELRRMLLNH  101



>gb|AFK39986.1| unknown [Lotus japonicus]
Length=100

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  293  TSWIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTR  400
            + W PDPVTGYYRP +   ++D  ELRQMLL +  R
Sbjct  62   SPWAPDPVTGYYRPINCTPQIDPVELRQMLLNHKFR  97



>gb|AAZ20280.1| lea protein 3 [Arachis hypogaea]
Length=95

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +2

Query  269  GDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            G   G     W PDPV+GYYRP +H  ++D  ELR M L
Sbjct  43   GKGGGGVCRDWAPDPVSGYYRPINHTPQIDPVELRHMFL  81



>gb|ACF74336.1| putative late-embryogenesis protein [Arachis hypogaea]
 gb|ADQ91845.1| late embryogenesis abundant protein group 6 protein [Arachis 
hypogaea]
Length=91

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 1/30 (3%)
 Frame = +2

Query  296  SWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            SW+PDPVTGYY+PE ++ ++D A+LR  LL
Sbjct  57   SWVPDPVTGYYKPE-NIKDIDVADLRATLL  85



>ref|XP_008386774.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Malus 
domestica]
Length=124

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +2

Query  287  SATSWIPDPVTGYYRPESHVNEVDAAELRQMLLK  388
            S  SW+PDP TG Y PE+   ++DAAELR  LLK
Sbjct  89   SKVSWVPDPKTGVYGPENGAEKIDAAELRAALLK  122



>gb|ABC41130.1| late embryognesis-abundant 5 protein [Arachis hypogaea]
Length=58

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 22/37 (59%), Gaps = 0/37 (0%)
 Frame = +2

Query  269  GDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQM  379
            G   G     W PDPV+GYYRP +H  ++D  ELR M
Sbjct  22   GKGGGGVCIDWAPDPVSGYYRPINHTPQIDPVELRHM  58



>gb|ADE32492.1| putative ABA-responsive LEA-like protein [Picea purpurea]
 gb|ADE32494.1| putative ABA-responsive LEA-like protein [Picea schrenkiana]
 gb|ADE32495.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32496.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32497.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32498.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32499.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32500.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32501.1| putative ABA-responsive LEA-like protein [Picea schrenkiana]
 gb|ADE32502.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32503.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32504.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32505.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32506.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32507.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32508.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32509.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32510.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32511.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32512.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|ADE32513.1| putative ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54550.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54551.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54552.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54553.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54554.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54555.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54556.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54557.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54558.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54559.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54560.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54561.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54562.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54563.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54564.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54565.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54566.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54567.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54568.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54569.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54570.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54571.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54572.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54573.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54574.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54575.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54576.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54577.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54578.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54579.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54580.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54581.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54582.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54583.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54584.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54585.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54586.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54587.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54588.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54589.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54590.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54591.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54592.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54593.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54594.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54595.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54596.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54597.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54598.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54599.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54600.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54601.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54602.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54603.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54604.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54605.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54606.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54607.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54608.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE54609.1| ABA-responsive LEA-like protein, partial [Picea schrenkiana]
 gb|AIE55421.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55422.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55433.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55434.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55487.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55488.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55503.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55504.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
Length=71

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +2

Query  269  GDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            G  + K    W+ DP TGY+ PE H  E D AELRQ LL
Sbjct  29   GGGNNKRTVFWMRDPATGYWIPEDHFGETDTAELRQKLL  67



>gb|AIE55471.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55472.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55473.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55474.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55479.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
 gb|AIE55480.1| ABA-responsive LEA-like protein, partial [Picea smithiana]
Length=71

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +2

Query  269  GDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            G  + K    W+ DP TGY+ PE H  E D AELRQ LL
Sbjct  29   GGGNNKRTVFWMRDPATGYWIPEDHFGETDTAELRQKLL  67



>ref|XP_008649522.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like [Zea 
mays]
 gb|AFW77658.1| hypothetical protein ZEAMMB73_310558 [Zea mays]
Length=93

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = +2

Query  299  WIPDPVTGYYRPESHVNEVDAAELRQMLLKNTTRQ  403
            W PDP TGYYRP +   EVDAA+LR  +LK    Q
Sbjct  57   WEPDPETGYYRPVTGTKEVDAADLRAEMLKRRILQ  91



>gb|ABK21040.1| unknown [Picea sitchensis]
Length=95

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +2

Query  269  GDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            G  + K    W+ DP TGY+ PE H  E D AELRQ LL
Sbjct  53   GGGNNKRTVFWMRDPATGYWIPEDHFGETDTAELRQKLL  91



>gb|ABA54780.1| ABA-responsive LEA-like protein [Picea glauca]
Length=93

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +2

Query  269  GDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            G  + K    W+ DP TGY+ PE H  E D AELRQ LL
Sbjct  51   GGGNNKRTVFWMRDPATGYWIPEDHFGETDTAELRQKLL  89



>gb|AAK16696.1|AF323612_1 zinc-induced protein [Oryza sativa]
Length=117

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  251  AMLKKGGDESGKSATSWIPDPVTGYYRPESHVNEVDAAE  367
            A+ K+   ++ +  T+W+PDPVTGYYRP     EVDAA+
Sbjct  40   AVAKRTMAKAAEEKTAWVPDPVTGYYRPAGGAKEVDAAD  78



>gb|ABA54779.1| ABA-responsive LEA-like protein [Picea glauca]
Length=105

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 23/39 (59%), Gaps = 0/39 (0%)
 Frame = +2

Query  269  GDESGKSATSWIPDPVTGYYRPESHVNEVDAAELRQMLL  385
            G  + K    W+ DP TGY+ PE H  E D AELRQ LL
Sbjct  51   GGGNNKRTVFWMRDPATGYWIPEDHFGETDTAELRQKLL  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760