BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M14

Length=562
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAD58628.1|  SUI1 protein                                           228   5e-73   Coffea arabica [arabica coffee]
emb|CDP05794.1|  unnamed protein product                                223   3e-71   Coffea canephora [robusta coffee]
emb|CAD58629.1|  SUI1 protein                                           221   2e-70   Coffea arabica [arabica coffee]
ref|XP_004248369.1|  PREDICTED: protein translation factor SUI1 h...    219   6e-70   Solanum lycopersicum
ref|XP_006447521.1|  hypothetical protein CICLE_v10017243mg             219   1e-69   Citrus clementina [clementine]
gb|EYU19220.1|  hypothetical protein MIMGU_mgv1a016636mg                218   2e-69   Erythranthe guttata [common monkey flower]
ref|XP_010694233.1|  PREDICTED: protein translation factor SUI1 h...    218   2e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006352492.1|  PREDICTED: protein translation factor SUI1 h...    218   4e-69   Solanum tuberosum [potatoes]
ref|XP_004244151.1|  PREDICTED: protein translation factor SUI1 h...    217   5e-69   Solanum lycopersicum
ref|XP_011097918.1|  PREDICTED: protein translation factor SUI1 h...    217   7e-69   Sesamum indicum [beniseed]
ref|XP_010240920.1|  PREDICTED: protein translation factor SUI1 h...    217   8e-69   Nelumbo nucifera [Indian lotus]
ref|XP_006475205.1|  PREDICTED: protein translation factor SUI1 h...    217   8e-69   Citrus sinensis [apfelsine]
gb|EPS74118.1|  hypothetical protein M569_00639                         216   9e-69   Genlisea aurea
ref|XP_011096112.1|  PREDICTED: protein translation factor SUI1 h...    216   1e-68   Sesamum indicum [beniseed]
ref|XP_002281872.1|  PREDICTED: protein translation factor SUI1 h...    216   1e-68   Vitis vinifera
ref|XP_009611793.1|  PREDICTED: protein translation factor SUI1 h...    216   1e-68   Nicotiana tomentosiformis
ref|XP_002316980.1|  hypothetical protein POPTR_0011s13810g             216   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_004159225.1|  PREDICTED: protein translation factor SUI1 h...    218   2e-68   
ref|XP_009771770.1|  PREDICTED: protein translation factor SUI1 h...    216   2e-68   Nicotiana sylvestris
ref|XP_006363526.1|  PREDICTED: protein translation factor SUI1 h...    215   3e-68   Solanum tuberosum [potatoes]
ref|XP_007132953.1|  hypothetical protein PHAVU_011G139000g             215   3e-68   Phaseolus vulgaris [French bean]
gb|ABY75806.1|  SUI1 A protein                                          215   3e-68   Opuntia streptacantha
ref|XP_008341979.1|  PREDICTED: protein translation factor SUI1 h...    215   3e-68   Malus domestica [apple tree]
ref|XP_009594373.1|  PREDICTED: protein translation factor SUI1 h...    215   4e-68   Nicotiana tomentosiformis
ref|XP_010062975.1|  PREDICTED: protein translation factor SUI1 h...    214   7e-68   Eucalyptus grandis [rose gum]
gb|EYU33614.1|  hypothetical protein MIMGU_mgv1a016641mg                214   8e-68   Erythranthe guttata [common monkey flower]
ref|XP_004294347.1|  PREDICTED: protein translation factor SUI1 h...    214   9e-68   Fragaria vesca subsp. vesca
gb|KHG06771.1|  hypothetical protein F383_09792                         214   1e-67   Gossypium arboreum [tree cotton]
ref|XP_007132952.1|  hypothetical protein PHAVU_011G138900g             214   1e-67   Phaseolus vulgaris [French bean]
sp|O48650.1|SUI1_SALBA  RecName: Full=Protein translation factor ...    214   1e-67   Salix bakko [Japanese willow]
ref|XP_004144489.1|  PREDICTED: protein translation factor SUI1 h...    214   1e-67   Cucumis sativus [cucumbers]
ref|XP_002310460.1|  hypothetical protein POPTR_0007s02520g             213   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_009342251.1|  PREDICTED: protein translation factor SUI1 h...    213   1e-67   Pyrus x bretschneideri [bai li]
ref|XP_011030847.1|  PREDICTED: protein translation factor SUI1 h...    213   1e-67   Populus euphratica
ref|XP_008341842.1|  PREDICTED: protein translation factor SUI1 h...    213   2e-67   Malus domestica [apple tree]
ref|NP_001239651.1|  uncharacterized protein LOC100784390               213   2e-67   Glycine max [soybeans]
ref|XP_009774027.1|  PREDICTED: protein translation factor SUI1 h...    213   2e-67   Nicotiana sylvestris
gb|AFW78548.1|  LOW QUALITY PROTEIN: protein translation factor SUI1    216   2e-67   
ref|XP_002310461.1|  SUI1 family protein                                213   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_010267759.1|  PREDICTED: protein translation factor SUI1 h...    213   2e-67   Nelumbo nucifera [Indian lotus]
ref|XP_009397784.1|  PREDICTED: protein translation factor SUI1 h...    213   3e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009624679.1|  PREDICTED: protein translation factor SUI1 h...    213   3e-67   Nicotiana tomentosiformis
ref|XP_010923943.1|  PREDICTED: protein translation factor SUI1 h...    213   3e-67   Elaeis guineensis
gb|EPS65463.1|  hypothetical protein M569_09315                         213   3e-67   Genlisea aurea
gb|KHN46541.1|  Protein translation factor SUI1 like 1                  214   3e-67   Glycine soja [wild soybean]
ref|XP_008803218.1|  PREDICTED: protein translation factor SUI1 h...    213   3e-67   Phoenix dactylifera
ref|XP_010930963.1|  PREDICTED: protein translation factor SUI1 h...    213   3e-67   Elaeis guineensis
ref|NP_001238017.1|  uncharacterized protein LOC100306129               213   4e-67   Glycine max [soybeans]
gb|KHG30632.1|  hypothetical protein F383_00215                         212   4e-67   Gossypium arboreum [tree cotton]
gb|KJB62619.1|  hypothetical protein B456_009G426400                    216   5e-67   Gossypium raimondii
ref|XP_007132567.1|  hypothetical protein PHAVU_011G105700g             212   5e-67   Phaseolus vulgaris [French bean]
ref|XP_007213988.1|  hypothetical protein PRUPE_ppa013607mg             212   5e-67   Prunus persica
ref|XP_004304159.1|  PREDICTED: protein translation factor SUI1 h...    212   6e-67   Fragaria vesca subsp. vesca
ref|XP_004487600.1|  PREDICTED: protein translation factor SUI1 h...    212   6e-67   
gb|KHG23747.1|  hypothetical protein F383_10557                         211   9e-67   Gossypium arboreum [tree cotton]
ref|XP_008244365.1|  PREDICTED: protein translation factor SUI1 h...    211   9e-67   Prunus mume [ume]
gb|AFK35113.1|  unknown                                                 211   9e-67   Lotus japonicus
ref|XP_008809850.1|  PREDICTED: protein translation factor SUI1 h...    211   9e-67   Phoenix dactylifera
gb|ABQ42058.1|  putative translation factor                             211   1e-66   Sonneratia caseolaris
ref|XP_007216425.1|  hypothetical protein PRUPE_ppa022105mg             213   1e-66   
ref|XP_010232448.1|  PREDICTED: protein translation factor SUI1 h...    212   1e-66   Brachypodium distachyon [annual false brome]
ref|XP_010035571.1|  PREDICTED: protein translation factor SUI1 h...    211   2e-66   Eucalyptus grandis [rose gum]
ref|NP_001236633.1|  uncharacterized protein LOC100499833               211   2e-66   Glycine max [soybeans]
ref|XP_009417250.1|  PREDICTED: protein translation factor SUI1 h...    211   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004234488.1|  PREDICTED: protein translation factor SUI1 h...    210   4e-66   Solanum lycopersicum
ref|XP_008230087.1|  PREDICTED: protein translation factor SUI1 h...    210   4e-66   Prunus mume [ume]
gb|ADV04053.1|  eukaryotic translation initiation factor 2              210   5e-66   Hevea brasiliensis [jebe]
ref|XP_009401666.1|  PREDICTED: protein translation factor SUI1 h...    210   5e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP39065.1|  hypothetical protein JCGZ_00822                         209   5e-66   Jatropha curcas
ref|XP_011048301.1|  PREDICTED: protein translation factor SUI1 h...    209   5e-66   Populus euphratica
gb|ABQ42057.1|  putative translation factor                             209   5e-66   Sonneratia alba
ref|XP_008365631.1|  PREDICTED: protein translation factor SUI1 h...    209   5e-66   Malus domestica [apple tree]
gb|ADV04054.1|  eukaryotic translation initiation factor 3              209   6e-66   Hevea brasiliensis [jebe]
gb|AFC01199.1|  eukaryotic translation initiation factor                209   6e-66   Ammopiptanthus mongolicus
ref|XP_007215170.1|  hypothetical protein PRUPE_ppa013601mg             209   6e-66   Prunus persica
ref|XP_006370639.1|  hypothetical protein POPTR_0001s44450g             209   7e-66   Populus trichocarpa [western balsam poplar]
gb|KJB13596.1|  hypothetical protein B456_002G083300                    209   7e-66   Gossypium raimondii
ref|XP_010931827.1|  PREDICTED: protein translation factor SUI1 h...    209   8e-66   Elaeis guineensis
ref|XP_009800522.1|  PREDICTED: protein translation factor SUI1 h...    209   9e-66   Nicotiana sylvestris
ref|XP_003596650.1|  Translation factor Sui1-like protein               209   9e-66   Medicago truncatula
ref|XP_009408662.1|  PREDICTED: protein translation factor SUI1 h...    209   9e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG06773.1|  hypothetical protein F383_09794                         209   1e-65   Gossypium arboreum [tree cotton]
ref|XP_002280157.1|  PREDICTED: protein translation factor SUI1 h...    209   1e-65   
ref|NP_001044504.2|  Os01g0794500                                       209   1e-65   
ref|NP_001274850.1|  uncharacterized protein LOC102577437               208   1e-65   Solanum tuberosum [potatoes]
gb|ABI48954.1|  putative protein translation factor Sui1                208   1e-65   Viola baoshanensis
gb|KDP20792.1|  hypothetical protein JCGZ_21263                         208   1e-65   Jatropha curcas
ref|XP_009378877.1|  PREDICTED: protein translation factor SUI1 h...    208   1e-65   Pyrus x bretschneideri [bai li]
ref|NP_001059843.1|  Os07g0529800                                       208   2e-65   
ref|XP_003527483.1|  PREDICTED: protein translation factor SUI1 h...    208   2e-65   Glycine max [soybeans]
ref|XP_002458630.1|  hypothetical protein SORBIDRAFT_03g036990          208   2e-65   Sorghum bicolor [broomcorn]
gb|EEE67305.1|  hypothetical protein OsJ_24532                          212   2e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009603077.1|  PREDICTED: protein translation factor SUI1 h...    208   2e-65   Nicotiana tomentosiformis
ref|XP_004515084.1|  PREDICTED: protein translation factor SUI1 h...    208   2e-65   Cicer arietinum [garbanzo]
ref|XP_010909791.1|  PREDICTED: protein translation factor SUI1 h...    208   2e-65   Elaeis guineensis
ref|XP_003527319.1|  PREDICTED: protein translation factor SUI1 h...    208   2e-65   Glycine max [soybeans]
ref|NP_001150984.1|  GOS2 homolog                                       208   3e-65   
gb|KHG12156.1|  hypothetical protein F383_20129                         207   3e-65   Gossypium arboreum [tree cotton]
ref|XP_007021029.1|  Translation initiation factor SUI1 family pr...    207   4e-65   
ref|XP_004287929.1|  PREDICTED: protein translation factor SUI1 h...    207   4e-65   Fragaria vesca subsp. vesca
sp|Q9SM41.1|SUI1_SPOST  RecName: Full=Protein translation factor ...    207   5e-65   Sporobolus stapfianus [resurrection grass]
emb|CDO99708.1|  unnamed protein product                                207   6e-65   Coffea canephora [robusta coffee]
gb|KEH29652.1|  eukaryotic translation initiation factor SUI1           207   6e-65   Medicago truncatula
ref|NP_001152681.1|  LOC100286322                                       207   6e-65   Zea mays [maize]
ref|XP_010545205.1|  PREDICTED: protein translation factor SUI1 h...    207   6e-65   Tarenaya hassleriana [spider flower]
emb|CAC84489.1|  putative translation factor                            207   7e-65   Pinus pinaster [cluster pine]
gb|EEE55519.1|  hypothetical protein OsJ_03741                          208   7e-65   Oryza sativa Japonica Group [Japonica rice]
gb|KHN41202.1|  Protein translation factor SUI1 like                    206   8e-65   Glycine soja [wild soybean]
ref|NP_001104887.1|  protein translation factor SUI1 homolog            206   9e-65   Zea mays [maize]
ref|XP_008784556.1|  PREDICTED: protein translation factor SUI1 h...    206   9e-65   Phoenix dactylifera
gb|ABO15891.1|  translation initiation factor eIF1                      206   1e-64   synthetic construct
ref|XP_004957905.1|  PREDICTED: protein translation factor SUI1 h...    206   1e-64   
gb|KCW46999.1|  hypothetical protein EUGRSUZ_K00804                     206   1e-64   Eucalyptus grandis [rose gum]
gb|AFK43238.1|  unknown                                                 206   1e-64   Medicago truncatula
gb|EEC79466.1|  hypothetical protein OsI_20483                          209   1e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_009412007.1|  PREDICTED: protein translation factor SUI1 h...    206   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK48465.1|  unknown                                                 206   1e-64   Lotus japonicus
emb|CDY46663.1|  BnaA03g48450D                                          208   2e-64   Brassica napus [oilseed rape]
gb|KJB62620.1|  hypothetical protein B456_009G426500                    206   2e-64   Gossypium raimondii
ref|XP_010539284.1|  PREDICTED: protein translation factor SUI1 h...    205   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_004970238.1|  PREDICTED: protein translation factor SUI1 h...    206   2e-64   Setaria italica
gb|AFK48865.1|  unknown                                                 205   3e-64   Lotus japonicus
ref|XP_009388867.1|  PREDICTED: protein translation factor SUI1 h...    205   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009109147.1|  PREDICTED: protein translation factor SUI1 h...    205   3e-64   Brassica rapa
ref|XP_002867520.1|  hypothetical protein ARALYDRAFT_492082             205   4e-64   
ref|XP_002522857.1|  translation factor sui1, putative                  206   4e-64   
ref|XP_003564393.1|  PREDICTED: protein translation factor SUI1 h...    205   4e-64   Brachypodium distachyon [annual false brome]
ref|NP_194443.1|  protein translation factor SUI1-1                     204   5e-64   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27827.1|  hypothetical protein MIMGU_mgv1a016640mg                204   5e-64   Erythranthe guttata [common monkey flower]
ref|NP_001055949.1|  Os05g0498400                                       204   6e-64   
ref|XP_010542418.1|  PREDICTED: protein translation factor SUI1 h...    204   8e-64   Tarenaya hassleriana [spider flower]
emb|CDX92777.1|  BnaC07g40350D                                          207   8e-64   
ref|XP_010272070.1|  PREDICTED: protein translation factor SUI1 h...    204   9e-64   Nelumbo nucifera [Indian lotus]
ref|XP_006413104.1|  hypothetical protein EUTSA_v10026037mg             208   1e-63   
ref|XP_010448172.1|  PREDICTED: protein translation factor SUI1 h...    203   1e-63   Camelina sativa [gold-of-pleasure]
ref|NP_175831.1|  protein translation factor SUI1-2                     203   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003568176.1|  PREDICTED: protein translation factor SUI1 h...    203   2e-63   Brachypodium distachyon [annual false brome]
gb|AGT16828.1|  protein translation factor SUI1                         203   2e-63   Saccharum hybrid cultivar R570
ref|NP_200287.1|  translation initiation factor SUI1 family protein     202   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644837.1|  PREDICTED: protein translation factor SUI1 h...    202   3e-63   Oryza brachyantha
gb|ACG24808.1|  protein translation factor SUI1                         202   3e-63   Zea mays [maize]
emb|CDP20340.1|  unnamed protein product                                202   3e-63   Coffea canephora [robusta coffee]
ref|XP_008810164.1|  PREDICTED: protein translation factor SUI1 h...    205   3e-63   
gb|KHG11307.1|  hypothetical protein F383_12372                         202   4e-63   Gossypium arboreum [tree cotton]
sp|Q9SQF4.1|SUI1_BRAOL  RecName: Full=Protein translation factor ...    202   4e-63   Brassica oleracea
ref|XP_009137639.1|  PREDICTED: protein translation factor SUI1 h...    202   4e-63   Brassica rapa
ref|XP_006304318.1|  hypothetical protein CARUB_v10010698mg             202   6e-63   Capsella rubella
ref|XP_006284787.1|  hypothetical protein CARUB_v10006056mg             201   2e-62   
ref|XP_006279715.1|  hypothetical protein CARUB_v10027405mg             201   2e-62   Capsella rubella
ref|XP_010501111.1|  PREDICTED: protein translation factor SUI1 h...    201   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_002960838.1|  hypothetical protein SELMODRAFT_437304             198   2e-61   Selaginella moellendorffii
gb|ACN30624.1|  unknown                                                 198   2e-61   Zea mays [maize]
gb|EEC82174.1|  hypothetical protein OsI_26284                          214   4e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_009106912.1|  PREDICTED: protein translation factor SUI1 h...    196   7e-61   Brassica rapa
gb|KJB39023.1|  hypothetical protein B456_007G314400                    196   1e-60   Gossypium raimondii
ref|XP_006833020.1|  hypothetical protein AMTR_s00094p00033760          196   1e-60   
emb|CDY26128.1|  BnaC06g10680D                                          195   3e-60   Brassica napus [oilseed rape]
ref|XP_010105571.1|  Protein translation factor SUI1-1-like protein     198   5e-60   
gb|KCW70138.1|  hypothetical protein EUGRSUZ_F03432                     196   6e-60   Eucalyptus grandis [rose gum]
ref|XP_002985789.1|  hypothetical protein SELMODRAFT_234882             194   7e-60   Selaginella moellendorffii
ref|XP_006827315.1|  hypothetical protein AMTR_s00010p00266770          195   1e-59   
gb|ADJ67213.1|  hypothetical protein                                    192   2e-59   Jatropha curcas
gb|ACS68685.1|  putative translation factor                             192   2e-59   Sonneratia alba
gb|EMS63057.1|  Protein translation factor SUI1-like protein            193   2e-59   Triticum urartu
gb|KEH38844.1|  eukaryotic translation initiation factor SUI1           192   3e-59   Medicago truncatula
ref|XP_009398183.1|  PREDICTED: protein translation factor SUI1 h...    192   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY10602.1|  BnaC03g70120D                                          192   4e-59   Brassica napus [oilseed rape]
ref|XP_008647990.1|  PREDICTED: LOC100286322 isoform X2                 191   7e-59   Zea mays [maize]
ref|XP_001756581.1|  predicted protein                                  191   9e-59   
ref|XP_002976303.1|  hypothetical protein SELMODRAFT_232756             190   2e-58   Selaginella moellendorffii
gb|ADJ67174.1|  hypothetical protein                                    190   2e-58   Jatropha curcas
gb|ADU56181.1|  hypothetical protein                                    189   2e-58   Jatropha curcas
ref|XP_006475204.1|  PREDICTED: protein translation factor SUI1 h...    190   3e-58   
gb|EMT21575.1|  Protein translation factor SUI1-like protein            190   4e-58   
gb|EMT13356.1|  Protein translation factor SUI1-like protein            189   7e-58   
ref|XP_002280065.1|  PREDICTED: protein translation factor SUI1 h...    189   9e-58   Vitis vinifera
ref|XP_004144491.1|  PREDICTED: protein translation factor SUI1 h...    188   1e-57   
ref|XP_008351221.1|  PREDICTED: protein translation factor SUI1 h...    189   1e-57   
ref|XP_003562997.1|  PREDICTED: protein translation factor SUI1 h...    188   1e-57   Brachypodium distachyon [annual false brome]
ref|XP_009624686.1|  PREDICTED: protein translation factor SUI1 h...    186   5e-57   
ref|XP_010109526.1|  Protein translation factor SUI1-1-like protein     187   9e-57   
ref|XP_006372949.1|  hypothetical protein POPTR_0017s06480g             185   1e-56   
ref|XP_011097879.1|  PREDICTED: protein translation factor SUI1 h...    185   2e-56   Sesamum indicum [beniseed]
gb|EMS51805.1|  Protein translation factor SUI1-like protein            187   2e-56   Triticum urartu
gb|AAM34279.1|AF508969_1  translation initiation factor                 185   2e-56   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006591819.1|  PREDICTED: uncharacterized protein LOC100306...    185   2e-56   
ref|XP_006586085.1|  PREDICTED: protein translation factor SUI1 h...    186   3e-56   Glycine max [soybeans]
ref|XP_007021023.1|  Translation initiation factor SUI1 family pr...    185   9e-56   
ref|XP_004487599.1|  PREDICTED: protein translation factor SUI1 h...    184   1e-55   
ref|XP_004961617.1|  PREDICTED: protein translation factor SUI1 h...    182   3e-55   
ref|XP_006370638.1|  hypothetical protein POPTR_0001s44450g             182   3e-55   Populus trichocarpa [western balsam poplar]
gb|AFW78550.1|  hypothetical protein ZEAMMB73_586492                    182   4e-55   
ref|XP_004970237.1|  PREDICTED: protein translation factor SUI1 h...    182   5e-55   
ref|XP_006602202.1|  PREDICTED: protein translation factor SUI1 h...    181   7e-55   Glycine max [soybeans]
gb|KEH38845.1|  eukaryotic translation initiation factor SUI1           181   9e-55   Medicago truncatula
gb|KEH38847.1|  eukaryotic translation initiation factor SUI1           181   1e-54   Medicago truncatula
gb|KJB39025.1|  hypothetical protein B456_007G314400                    180   2e-54   Gossypium raimondii
ref|XP_011095399.1|  PREDICTED: protein translation factor SUI1 h...    180   2e-54   Sesamum indicum [beniseed]
ref|XP_003600096.1|  Translation factor SUI1-like protein               180   2e-54   Medicago truncatula
ref|XP_004244116.1|  PREDICTED: protein translation factor SUI1 h...    179   3e-54   Solanum lycopersicum
ref|XP_010448878.1|  PREDICTED: protein translation factor SUI1 h...    179   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_004500068.1|  PREDICTED: protein translation factor SUI1 h...    179   3e-54   Cicer arietinum [garbanzo]
ref|XP_006346213.1|  PREDICTED: protein translation factor SUI1 h...    179   4e-54   Solanum tuberosum [potatoes]
gb|AFY13590.1|  translation factor SUI1                                 179   4e-54   Aeschynomene evenia
ref|XP_007212250.1|  hypothetical protein PRUPE_ppa013625mg             179   4e-54   Prunus persica
ref|XP_010675717.1|  PREDICTED: protein translation factor SUI1 h...    179   4e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007146479.1|  hypothetical protein PHAVU_006G043900g             179   4e-54   Phaseolus vulgaris [French bean]
emb|CDY52575.1|  BnaC03g71830D                                          181   5e-54   Brassica napus [oilseed rape]
ref|XP_004139787.1|  PREDICTED: protein translation factor SUI1 h...    179   5e-54   Cucumis sativus [cucumbers]
ref|XP_009628718.1|  PREDICTED: protein translation factor SUI1 h...    179   8e-54   Nicotiana tomentosiformis
ref|XP_001752498.1|  predicted protein                                  178   8e-54   
ref|XP_004152930.1|  PREDICTED: protein translation factor SUI1 h...    178   9e-54   
gb|AAM77753.1|AF521961_1  translation initiation factor B04             178   1e-53   Helianthus annuus
gb|ACJ85979.1|  unknown                                                 178   1e-53   Medicago truncatula
gb|ABY75807.1|  SUI1 B protein                                          178   1e-53   Opuntia streptacantha
emb|CDY43020.1|  BnaA03g11670D                                          178   1e-53   Brassica napus [oilseed rape]
gb|AFY13584.1|  translation factor SUI1                                 178   1e-53   Aeschynomene evenia
gb|ABK24036.1|  unknown                                                 177   2e-53   Picea sitchensis
dbj|BAN10326.1|  translation initiation factor SUI1 family protein      177   2e-53   Buxus microphylla var. japonica
gb|AGS78110.1|  translation factor SUI1                                 177   2e-53   Aeschynomene filosa
gb|AGS78105.1|  translation factor SUI1                                 177   2e-53   Aeschynomene indica
ref|XP_010276095.1|  PREDICTED: protein translation factor SUI1 h...    177   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009338696.1|  PREDICTED: protein translation factor SUI1 h...    177   3e-53   Pyrus x bretschneideri [bai li]
ref|XP_010278682.1|  PREDICTED: protein translation factor SUI1 h...    177   3e-53   Nelumbo nucifera [Indian lotus]
ref|XP_008359266.1|  PREDICTED: protein translation factor SUI1 h...    177   3e-53   
ref|XP_009360995.1|  PREDICTED: protein translation factor SUI1 h...    176   5e-53   Pyrus x bretschneideri [bai li]
sp|O82569.1|SUI1_PIMBR  RecName: Full=Protein translation factor ...    176   5e-53   Spuriopimpinella brachycarpa
emb|CDP05760.1|  unnamed protein product                                176   6e-53   Coffea canephora [robusta coffee]
emb|CAB56294.1|  putative protein translation factor                    175   1e-52   Phleum pratense [timothy]
ref|XP_010092161.1|  Protein translation factor SUI1-2-like protein     175   1e-52   Morus notabilis
gb|AFK38938.1|  unknown                                                 175   2e-52   Lotus japonicus
gb|EPS65465.1|  hypothetical protein M569_09317                         175   2e-52   Genlisea aurea
ref|XP_006401506.1|  hypothetical protein EUTSA_v10015063mg             175   2e-52   Eutrema salsugineum [saltwater cress]
ref|XP_004171416.1|  PREDICTED: protein translation factor SUI1 h...    175   2e-52   
gb|ADK79108.1|  putative eukaryotic translation initiation factor...    174   3e-52   Catharanthus roseus [chatas]
gb|EYU33643.1|  hypothetical protein MIMGU_mgv1a016664mg                174   3e-52   Erythranthe guttata [common monkey flower]
ref|XP_008349901.1|  PREDICTED: protein translation factor SUI1 h...    174   4e-52   
ref|XP_004294387.1|  PREDICTED: protein translation factor SUI1 h...    174   5e-52   Fragaria vesca subsp. vesca
dbj|BAN10309.1|  eukaryotic translation initiation factor SUI1          173   6e-52   Chamaecyparis obtusa
ref|XP_009132417.1|  PREDICTED: protein translation factor SUI1 h...    172   1e-51   Brassica rapa
ref|XP_010060345.1|  PREDICTED: protein translation factor SUI1 h...    172   2e-51   Eucalyptus grandis [rose gum]
ref|XP_002866067.1|  hypothetical protein ARALYDRAFT_918633             172   2e-51   Arabidopsis lyrata subsp. lyrata
gb|KJB11840.1|  hypothetical protein B456_002G088900                    172   3e-51   Gossypium raimondii
gb|KCW66993.1|  hypothetical protein EUGRSUZ_F00759                     176   4e-51   Eucalyptus grandis [rose gum]
gb|KCW66994.1|  hypothetical protein EUGRSUZ_F00759                     176   4e-51   Eucalyptus grandis [rose gum]
ref|NP_568818.1|  translation initiation factor SUI1 family protein     171   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281351.1|  hypothetical protein CARUB_v10027407mg             171   9e-51   
gb|ADB85107.1|  translation initiation factor-like protein              171   1e-50   Jatropha curcas
ref|XP_009120023.1|  PREDICTED: protein translation factor SUI1 h...    170   1e-50   
ref|XP_010482910.1|  PREDICTED: protein translation factor SUI1 h...    170   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010545223.1|  PREDICTED: protein translation factor SUI1 h...    170   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_008365050.1|  PREDICTED: protein translation factor SUI1 h...    170   2e-50   
gb|KJB81730.1|  hypothetical protein B456_013G159400                    169   3e-50   Gossypium raimondii
ref|XP_003617548.1|  Translation factor SUI1-like protein               169   3e-50   Medicago truncatula
ref|XP_004491401.1|  PREDICTED: protein translation factor SUI1 h...    169   5e-50   Cicer arietinum [garbanzo]
ref|XP_010533344.1|  PREDICTED: protein translation factor SUI1 h...    167   9e-50   Tarenaya hassleriana [spider flower]
emb|CDY17292.1|  BnaA10g09260D                                          172   1e-49   Brassica napus [oilseed rape]
gb|ACV50429.1|  eukaryotic translation initiation factor SUI1           167   2e-49   Jatropha curcas
ref|XP_007020819.1|  Translation initiation factor SUI1 family pr...    167   3e-49   
ref|XP_006352509.1|  PREDICTED: protein translation factor SUI1 h...    167   3e-49   Solanum tuberosum [potatoes]
gb|KHG17081.1|  Protein translation factor SUI1                         168   6e-49   Gossypium arboreum [tree cotton]
ref|XP_007142286.1|  hypothetical protein PHAVU_008G267800g             165   2e-48   Phaseolus vulgaris [French bean]
ref|XP_008776100.1|  PREDICTED: protein translation factor SUI1 h...    166   2e-48   Phoenix dactylifera
dbj|BAF63490.1|  translational initiation factor eIF1                   163   4e-48   Potamogeton distinctus
gb|AFD22856.1|  eukaryotic translation initiation factor SUI1-lik...    163   7e-48   Tamarix androssowii
gb|KHN11920.1|  Protein translation factor SUI1-like protein            163   8e-48   Glycine soja [wild soybean]
ref|XP_011011189.1|  PREDICTED: protein translation factor SUI1 h...    161   3e-47   Populus euphratica
gb|KHN38274.1|  Protein translation factor SUI1 like                    158   6e-46   Glycine soja [wild soybean]
ref|XP_005645489.1|  translation initiation factor SU                   158   9e-46   Coccomyxa subellipsoidea C-169
ref|XP_002316065.1|  hypothetical protein POPTR_0010s16160g             157   1e-45   Populus trichocarpa [western balsam poplar]
ref|XP_002532561.1|  translation factor sui1, putative                  157   2e-45   Ricinus communis
gb|EMT19520.1|  Protein translation factor SUI1-like protein            158   3e-45   
ref|XP_002949286.1|  hypothetical protein VOLCADRAFT_109710             156   6e-45   Volvox carteri f. nagariensis
ref|XP_001691459.1|  translation initiation protein                     155   8e-45   Chlamydomonas reinhardtii
gb|KJB45591.1|  hypothetical protein B456_007G314200                    152   5e-44   Gossypium raimondii
gb|KJB13597.1|  hypothetical protein B456_002G083300                    152   8e-44   Gossypium raimondii
ref|XP_006452372.1|  hypothetical protein CICLE_v10009975mg             152   1e-43   Citrus clementina [clementine]
gb|KJB78392.1|  hypothetical protein B456_013G163400                    152   1e-43   Gossypium raimondii
ref|XP_004515083.1|  PREDICTED: protein translation factor SUI1 h...    152   2e-43   
gb|KJB13598.1|  hypothetical protein B456_002G083300                    151   2e-43   
gb|AFW78551.1|  hypothetical protein ZEAMMB73_586492                    150   9e-43   
gb|KJB62621.1|  hypothetical protein B456_009G426500                    149   1e-42   
ref|XP_010092162.1|  Protein translation factor SUI1-like protein       150   1e-42   
ref|XP_010327265.1|  PREDICTED: protein translation factor SUI1 h...    150   1e-42   
gb|AFW75026.1|  hypothetical protein ZEAMMB73_109319                    147   7e-42   
gb|KIZ01467.1|  putative Protein translation factor SUI1 like pro...    151   8e-42   
tpg|DAA62968.1|  TPA: translation initiation factor1                    147   1e-41   
gb|KEH38846.1|  eukaryotic translation initiation factor SUI1           146   2e-41   
ref|XP_008650268.1|  PREDICTED: protein translation factor SUI1 h...    146   2e-41   
ref|XP_006284788.1|  hypothetical protein CARUB_v10006056mg             146   5e-41   
gb|KJB24471.1|  hypothetical protein B456_004G147000                    145   5e-41   
gb|KDD75795.1|  hypothetical protein H632_c495p1                        145   1e-40   
gb|KHN02839.1|  Protein translation factor SUI1 like 2                  144   4e-40   
ref|XP_009138116.1|  PREDICTED: probable phenylalanine--tRNA liga...    146   6e-40   
gb|KIY98436.1|  putative Protein translation factor SUI1 like pro...    139   2e-38   
ref|XP_011389050.1|  putative translation initiation factor eIF1        138   5e-38   
dbj|BAD97168.1|  translation factor sui1 homolog                        137   8e-38   
emb|CBQ73048.1|  probable translation initiation factor SUI1            137   1e-37   
emb|CCF52891.1|  probable translation initiation factor SUI1            137   1e-37   
ref|XP_006377837.1|  hypothetical protein POPTR_0011s13810g             135   2e-37   
dbj|GAC71792.1|  translation initiation factor 1                        136   3e-37   
emb|CDI53525.1|  probable translation initiation factor SUI1            136   4e-37   
gb|EIE79257.1|  translation initiation factor SUI1                      135   8e-37   
gb|ACN30667.1|  unknown                                                 135   9e-37   
ref|XP_005344888.1|  PREDICTED: eukaryotic translation initiation...    134   2e-36   
emb|CDY02665.1|  BnaC02g07700D                                          139   3e-36   
ref|XP_003580602.2|  PREDICTED: splicing factor, proline- and glu...    138   5e-36   
gb|EST05525.1|  translation initiation factor 1                         133   6e-36   
ref|XP_006041882.1|  PREDICTED: eukaryotic translation initiation...    132   1e-35   
ref|XP_005847583.1|  hypothetical protein CHLNCDRAFT_133842             132   1e-35   
ref|XP_009025362.1|  hypothetical protein HELRODRAFT_163156             132   2e-35   
gb|ADB54840.1|  eukaryotic translation initiation factor 1              131   2e-35   
ref|XP_011396751.1|  Translation factor SUI1-like protein 1             132   2e-35   
gb|KJB39022.1|  hypothetical protein B456_007G314400                    130   2e-35   
ref|NP_001037082.1|  protein translation factor SUI1 homolog            131   2e-35   
gb|ADM67806.1|  putative eukaryotic translation initiation factor...    130   2e-35   
ref|XP_008382302.1|  PREDICTED: protein translation factor SUI1 h...    131   3e-35   
ref|XP_002448570.1|  hypothetical protein SORBIDRAFT_06g029340          135   3e-35   
dbj|BAK05450.1|  predicted protein                                      131   4e-35   
ref|XP_004706531.1|  PREDICTED: eukaryotic translation initiation...    131   4e-35   
ref|XP_972771.1|  PREDICTED: protein translation factor SUI1 homolog    130   5e-35   
ref|XP_011423571.1|  PREDICTED: eukaryotic translation initiation...    130   6e-35   
gb|EAY95661.1|  hypothetical protein OsI_17527                          134   6e-35   
ref|XP_534229.2|  PREDICTED: eukaryotic translation initiation fa...    130   6e-35   
gb|ACD99647.1|  translation initiation factor                           134   7e-35   
emb|CAJ86367.1|  OSIGBa0117N13.11                                       134   7e-35   
gb|ADM67808.1|  putative eukaryotic translation initiation factor...    128   8e-35   
gb|EIE77311.1|  translation initiation factor SUI1                      129   1e-34   
emb|CEG82542.1|  Putative Translation initiation factor SUI1            129   1e-34   
gb|AFM87132.1|  translation factor sui1-like protein                    129   1e-34   
ref|XP_002130503.1|  PREDICTED: eukaryotic translation initiation...    129   2e-34   
ref|XP_006675909.1|  hypothetical protein BATDEDRAFT_84447              129   2e-34   
ref|XP_005539321.1|  probable eukaryotic translation initiation f...    129   2e-34   
emb|CDY33072.1|  BnaC06g07070D                                          129   2e-34   
gb|ENN73110.1|  hypothetical protein YQE_10251                          129   2e-34   
gb|AGM32795.1|  eukaryotic initiation factor 1                          129   2e-34   
ref|XP_004895335.1|  PREDICTED: eukaryotic translation initiation...    128   3e-34   
ref|XP_008551957.1|  PREDICTED: protein translation factor SUI1 h...    128   4e-34   
gb|ETN67045.1|  sui1                                                    128   4e-34   
emb|CEJ03608.1|  Putative Translation initiation factor SUI1            128   5e-34   
gb|ETS64770.1|  hypothetical protein PaG_00729                          132   5e-34   
ref|XP_002199008.1|  PREDICTED: eukaryotic translation initiation...    127   5e-34   
ref|XP_011122353.1|  hypothetical protein AOL_s00079g176                127   5e-34   
gb|ACO52071.1|  Eukaryotic translation initiation factor 1b             127   5e-34   
ref|XP_006634521.1|  PREDICTED: eukaryotic translation initiation...    127   6e-34   
ref|XP_004519899.1|  PREDICTED: protein translation factor SUI1 h...    127   6e-34   
ref|XP_011056576.1|  PREDICTED: protein translation factor SUI1 h...    130   6e-34   
ref|NP_005866.1|  eukaryotic translation initiation factor 1b           127   9e-34   
ref|XP_006108120.1|  PREDICTED: eukaryotic translation initiation...    127   9e-34   
ref|NP_001155788.1|  eukaryotic translation initiation factor 1         127   9e-34   
ref|XP_009686092.1|  PREDICTED: eukaryotic translation initiation...    127   9e-34   
gb|AAX37073.1|  translation factor sui1-like                            127   1e-33   
ref|XP_003486256.1|  PREDICTED: protein translation factor SUI1 h...    127   1e-33   
ref|XP_008709929.1|  PREDICTED: eukaryotic translation initiation...    127   1e-33   
ref|XP_011257191.1|  PREDICTED: LOW QUALITY PROTEIN: protein tran...    130   1e-33   
gb|ELR59745.1|  Eukaryotic translation initiation factor 1b             127   1e-33   
dbj|BAB29089.1|  unnamed protein product                                127   1e-33   
ref|XP_316499.2|  AGAP006459-PA                                         127   1e-33   
ref|XP_010226577.1|  PREDICTED: eukaryotic translation initiation...    127   1e-33   
ref|XP_418815.1|  PREDICTED: eukaryotic translation initiation fa...    127   1e-33   
ref|XP_006036433.1|  PREDICTED: eukaryotic translation initiation...    127   1e-33   
ref|NP_989015.1|  eukaryotic translation initiation factor 1B           127   1e-33   
dbj|BAN20281.1|  conserved hypothetical protein                         126   1e-33   
ref|XP_001501911.1|  PREDICTED: eukaryotic translation initiation...    127   1e-33   
gb|ELU11301.1|  hypothetical protein CAPTEDRAFT_160473                  126   1e-33   
gb|EMC80722.1|  Eukaryotic translation initiation factor 1b             127   1e-33   
ref|XP_007907610.1|  PREDICTED: eukaryotic translation initiation...    126   2e-33   
gb|ABV44713.1|  translation initiation factor 1-like protein            126   2e-33   
ref|XP_001948896.1|  PREDICTED: protein translation factor SUI1 h...    126   2e-33   
ref|XP_005187256.1|  PREDICTED: protein translation factor SUI1 h...    126   2e-33   
gb|KDR15926.1|  Translation factor SUI1-like protein                    125   2e-33   
ref|XP_002432016.1|  translation factor sui1, putative                  125   3e-33   
ref|XP_001661080.1|  AAEL010843-PA                                      125   3e-33   
gb|ACQ57868.1|  Eukaryotic translation initiation factor 1b             125   3e-33   
gb|KFB35115.1|  AGAP006459-PA-like protein                              125   3e-33   
ref|XP_001731784.1|  hypothetical protein MGL_1052                      126   3e-33   
ref|XP_007067400.1|  PREDICTED: eukaryotic translation initiation...    126   3e-33   
gb|EHB02833.1|  Eukaryotic translation initiation factor 1              125   3e-33   
gb|ABR27954.1|  translation initiation factor 1                         125   3e-33   
gb|AFM90303.1|  translation factor sui1-like protein                    125   4e-33   
ref|XP_006894618.1|  PREDICTED: eukaryotic translation initiation...    125   4e-33   
emb|CDH49154.1|  eukaryotic translation initiation factor 1             125   5e-33   
ref|XP_010872984.1|  PREDICTED: eukaryotic translation initiation...    125   5e-33   
gb|EFX82803.1|  hypothetical protein DAPPUDRAFT_302358                  125   5e-33   
emb|CEG78008.1|  Putative Translation initiation factor SUI1            125   5e-33   
ref|NP_001158665.1|  eukaryotic translation initiation factor 1B        125   5e-33   
gb|ERZ95524.1|  hypothetical protein GLOINDRAFT_341178                  125   5e-33   
ref|XP_005707772.1|  protein translation factor                         125   5e-33   
ref|XP_007523629.1|  PREDICTED: eukaryotic translation initiation...    125   6e-33   
gb|EUC62160.1|  eukaryotic translation initiation factor SUI1           125   6e-33   
dbj|GAN03056.1|  eukaryotic translation initiation factor SUI1          125   6e-33   
ref|XP_008328667.1|  PREDICTED: eukaryotic translation initiation...    125   6e-33   
gb|EPB81403.1|  hypothetical protein HMPREF1544_11892                   125   6e-33   
ref|NP_001053955.1|  Os04g0627900                                       129   6e-33   
gb|KIL68601.1|  hypothetical protein M378DRAFT_120853                   125   7e-33   
gb|ELW58342.1|  Eukaryotic translation initiation factor 1b             125   7e-33   
ref|XP_006008886.1|  PREDICTED: eukaryotic translation initiation...    125   7e-33   
ref|XP_009070720.1|  PREDICTED: eukaryotic translation initiation...    124   7e-33   
emb|CCO28058.1|  Protein translation factor SUI1                        124   7e-33   
ref|XP_004712205.1|  PREDICTED: eukaryotic translation initiation...    125   8e-33   
ref|XP_003362611.1|  PREDICTED: eukaryotic translation initiation...    124   8e-33   
ref|XP_007300579.1|  eukaryotic translation initiation factor 1         124   9e-33   
dbj|BAH71030.1|  ACYPI004195                                            124   1e-32   
gb|AAD19900.1|  putative translation initiation factor A121/Sui1        124   1e-32   
ref|XP_003737509.1|  PREDICTED: protein translation factor SUI1 h...    124   1e-32   
ref|XP_010014638.1|  PREDICTED: eukaryotic translation initiation...    124   1e-32   
ref|XP_004855393.1|  PREDICTED: eukaryotic translation initiation...    124   1e-32   
ref|XP_004477759.1|  PREDICTED: eukaryotic translation initiation...    124   1e-32   
ref|XP_003756178.1|  PREDICTED: eukaryotic translation initiation...    124   1e-32   
ref|XP_007418771.1|  hypothetical protein MELLADRAFT_84135              124   1e-32   
gb|AAP36749.1|  Homo sapiens putative translation initiation factor     124   1e-32   
ref|XP_004434545.1|  PREDICTED: eukaryotic translation initiation...    124   1e-32   
gb|ELR53946.1|  Eukaryotic translation initiation factor 1              124   1e-32   
ref|XP_009462783.1|  PREDICTED: eukaryotic translation initiation...    125   2e-32   
ref|NP_001291770.1|  eukaryotic translation initiation factor 1         124   2e-32   
ref|NP_005792.1|  eukaryotic translation initiation factor 1            124   2e-32   
gb|KFH67692.1|  protein translation factor sui1                         124   2e-32   
ref|XP_005695626.1|  PREDICTED: eukaryotic translation initiation...    124   2e-32   
gb|EQB58948.1|  hypothetical protein CGLO_00736                         124   2e-32   
ref|XP_006770429.1|  PREDICTED: eukaryotic translation initiation...    124   2e-32   
gb|ACO07675.1|  Eukaryotic translation initiation factor 1b             124   2e-32   
ref|XP_009970819.1|  PREDICTED: eukaryotic translation initiation...    124   2e-32   
ref|XP_007338565.1|  eukaryotic translation initiation factor 1         124   2e-32   
ref|XP_004416968.1|  PREDICTED: eukaryotic translation initiation...    125   2e-32   
ref|XP_010072243.1|  PREDICTED: eukaryotic translation initiation...    124   2e-32   
pdb|2IF1|A  Chain A, Human Translation Initiation Factor Eif1, Nm...    124   2e-32   
ref|XP_005973972.1|  PREDICTED: eukaryotic translation initiation...    125   2e-32   
ref|XP_009910702.1|  PREDICTED: eukaryotic translation initiation...    123   2e-32   
ref|XP_009693970.1|  PREDICTED: eukaryotic translation initiation...    123   2e-32   
ref|XP_010944267.1|  PREDICTED: eukaryotic translation initiation...    125   2e-32   
ref|XP_004662060.1|  PREDICTED: eukaryotic translation initiation...    123   2e-32   
ref|NP_035638.1|  eukaryotic translation initiation factor 1            123   2e-32   
gb|ELK01507.1|  Eukaryotic translation initiation factor 1              125   3e-32   
ref|XP_010183735.1|  PREDICTED: eukaryotic translation initiation...    123   3e-32   
ref|XP_001989273.1|  GH10143                                            123   3e-32   
ref|XP_003931038.1|  PREDICTED: eukaryotic translation initiation...    124   3e-32   
ref|XP_005383637.1|  PREDICTED: eukaryotic translation initiation...    123   3e-32   
ref|XP_004717826.1|  PREDICTED: eukaryotic translation initiation...    123   3e-32   
ref|XP_009903279.1|  PREDICTED: eukaryotic translation initiation...    123   3e-32   
ref|XP_005860472.1|  PREDICTED: eukaryotic translation initiation...    123   3e-32   
ref|XP_001833664.2|  eukaryotic translation initiation factor 1         123   3e-32   
ref|NP_001161207.1|  eukaryotic translation initiation factor 1         123   3e-32   
ref|XP_004614671.1|  PREDICTED: eukaryotic translation initiation...    123   3e-32   
gb|KIY50999.1|  eukaryotic translation initiation factor 1              123   3e-32   
ref|XP_007385723.1|  eukaryotic translation initiation factor 1         123   3e-32   
gb|KJA27496.1|  hypothetical protein HYPSUDRAFT_35413                   123   3e-32   
ref|XP_009992408.1|  PREDICTED: eukaryotic translation initiation...    123   3e-32   
ref|XP_001863733.1|  sui1                                               123   4e-32   
ref|XP_008927798.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    123   4e-32   
ref|XP_007879556.1|  hypothetical protein PFL1_03842                    123   4e-32   
ref|XP_006131879.1|  PREDICTED: eukaryotic translation initiation...    124   4e-32   
ref|XP_005093096.1|  PREDICTED: protein translation factor SUI1 h...    123   4e-32   
ref|XP_003224005.1|  PREDICTED: eukaryotic translation initiation...    122   4e-32   
ref|XP_006879641.1|  PREDICTED: eukaryotic translation initiation...    123   4e-32   
ref|NP_014155.1|  translation initiation factor eIF1                    122   4e-32   
gb|KIM87020.1|  hypothetical protein PILCRDRAFT_815455                  123   4e-32   
ref|XP_006770599.1|  PREDICTED: eukaryotic translation initiation...    122   4e-32   
ref|XP_010160350.1|  PREDICTED: eukaryotic translation initiation...    124   4e-32   
gb|KII88592.1|  hypothetical protein PLICRDRAFT_111559                  123   4e-32   
gb|AJT06393.1|  Sui1p                                                   122   4e-32   
gb|EFB21079.1|  hypothetical protein PANDA_016343                       122   4e-32   
ref|XP_004783325.1|  PREDICTED: eukaryotic translation initiation...    122   4e-32   
ref|XP_009319514.1|  PREDICTED: eukaryotic translation initiation...    122   5e-32   
ref|XP_006264602.1|  PREDICTED: eukaryotic translation initiation...    122   5e-32   
ref|XP_011105142.1|  sui1p                                              122   5e-32   
ref|XP_006638396.1|  PREDICTED: eukaryotic translation initiation...    122   5e-32   
ref|XP_005437189.1|  PREDICTED: eukaryotic translation initiation...    122   5e-32   
ref|XP_010286929.1|  PREDICTED: eukaryotic translation initiation...    122   5e-32   
dbj|GAA25864.1|  K7_Sui1p                                               122   5e-32   
ref|XP_009943291.1|  PREDICTED: eukaryotic translation initiation...    123   5e-32   
emb|CDO92794.1|  unnamed protein product                                122   5e-32   
gb|KGL74328.1|  Eukaryotic translation initiation factor 1b             122   5e-32   
ref|XP_007664384.1|  PREDICTED: eukaryotic translation initiation...    122   5e-32   
ref|XP_009805725.1|  PREDICTED: eukaryotic translation initiation...    122   5e-32   
ref|XP_008485331.1|  PREDICTED: uncharacterized protein LOC103522001    125   6e-32   
ref|XP_006194773.1|  PREDICTED: eukaryotic translation initiation...    122   6e-32   
ref|XP_009511501.1|  PREDICTED: eukaryotic translation initiation...    122   6e-32   
ref|XP_004661782.1|  PREDICTED: eukaryotic translation initiation...    122   6e-32   
ref|XP_010118990.1|  PREDICTED: eukaryotic translation initiation...    122   6e-32   
ref|XP_009288746.1|  PREDICTED: eukaryotic translation initiation...    122   6e-32   
gb|KDQ60757.1|  hypothetical protein JAAARDRAFT_31728                   122   6e-32   
ref|XP_008491423.1|  PREDICTED: eukaryotic translation initiation...    122   6e-32   
ref|XP_452335.1|  hypothetical protein                                  122   6e-32   
ref|XP_007763994.1|  eukaryotic translation initiation factor SUI1      122   6e-32   
ref|XP_010897319.1|  PREDICTED: eukaryotic translation initiation...    122   6e-32   
gb|AAC17112.1|  GC20 protein                                            122   6e-32   
gb|ACI69508.1|  Eukaryotic translation initiation factor 1b             122   7e-32   
ref|XP_002066294.1|  GK18213                                            122   7e-32   
gb|EFQ29558.1|  translation initiation factor SUI1                      122   7e-32   
gb|KFM00537.1|  Eukaryotic translation initiation factor 1b             122   7e-32   
ref|XP_001878593.1|  predicted protein                                  122   7e-32   
gb|ACO09093.1|  Eukaryotic translation initiation factor 1b             122   7e-32   
ref|XP_010209549.1|  PREDICTED: eukaryotic translation initiation...    122   7e-32   
ref|XP_010723031.1|  PREDICTED: eukaryotic translation initiation...    122   7e-32   
ref|XP_002052718.1|  GJ20177                                            122   8e-32   
ref|XP_009951784.1|  PREDICTED: eukaryotic translation initiation...    122   8e-32   
ref|XP_005876693.1|  PREDICTED: eukaryotic translation initiation...    122   8e-32   
ref|XP_001863732.1|  eukaryotic translation initiation factor 1b        122   8e-32   
ref|XP_006196298.1|  PREDICTED: eukaryotic translation initiation...    122   8e-32   
ref|XP_003477467.1|  PREDICTED: eukaryotic translation initiation...    122   8e-32   



>emb|CAD58628.1| SUI1 protein [Coffea arabica]
Length=113

 Score =   228 bits (580),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFDLQTPAAFDPFAEANA++SGDGSKDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGDGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>emb|CDP05794.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   223 bits (568),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFDLQTPAAFDPFAEANA++SG GSKDYVHIR+QQRNGRKSLTTVQGL K+FSYNKIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLNKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>emb|CAD58629.1| SUI1 protein [Coffea arabica]
Length=113

 Score =   221 bits (562),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFDLQTPAAFDPFAEANA++SG GSKDYVHIR+QQRNGRKSLTTVQGL K+FSYNKIL
Sbjct  1    MSEFDLQTPAAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLNKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHG  489
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKKEHIKIHG
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHG  112



>ref|XP_004248369.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=113

 Score =   219 bits (559),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ DLQ PAAFDPFAEANA++SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDLQVPAAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_006447521.1| hypothetical protein CICLE_v10017243mg [Citrus clementina]
 ref|XP_006469705.1| PREDICTED: protein translation factor SUI1 homolog [Citrus sinensis]
 gb|ESR60761.1| hypothetical protein CICLE_v10017243mg [Citrus clementina]
 gb|KDO59835.1| hypothetical protein CISIN_1g039810mg [Citrus sinensis]
Length=113

 Score =   219 bits (557),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD Q P+AFDPFAEANAE SG GSKDYVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSEFDTQIPSAFDPFAEANAEDSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEFIKIHGF  113



>gb|EYU19220.1| hypothetical protein MIMGU_mgv1a016636mg [Erythranthe guttata]
Length=113

 Score =   218 bits (556),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P+A+DPFA+ANAE+SG GSKDYVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDIQVPSAYDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_010694233.1| PREDICTED: protein translation factor SUI1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=113

 Score =   218 bits (556),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q PAA+DPFA+ANAE+SG GSKDYVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDIDVQIPAAYDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_006352492.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=113

 Score =   218 bits (554),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ DLQ PAAFDPFAEANA++SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDLQVPAAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEYIKIHGF  113



>ref|XP_004244151.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
 ref|XP_004244152.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=113

 Score =   217 bits (553),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFAEANA++SG GSKDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_011097918.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=113

 Score =   217 bits (552),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFA+ANAE+SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIQVPTAFDPFADANAENSGAGAKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_010240920.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   217 bits (552),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P  FDPFAEANAE SG GSK+YVH+R+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDIQIPTTFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_006475205.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO52967.1| hypothetical protein CISIN_1g033711mg [Citrus sinensis]
Length=113

 Score =   217 bits (552),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+FD+Q PAAFDPFA+A AE SG GSK+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDFDIQVPAAFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKMHGF  113



>gb|EPS74118.1| hypothetical protein M569_00639 [Genlisea aurea]
Length=113

 Score =   216 bits (551),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+FD+Q P  FDPFA+ANAE+SG GSKDYVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDFDVQIPTTFDPFADANAENSGAGSKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_011096112.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
 ref|XP_011096113.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=113

 Score =   216 bits (551),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+FD+Q P+AFDPFAEA AE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDFDVQIPSAFDPFAEAKAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_002281872.1| PREDICTED: protein translation factor SUI1 homolog [Vitis vinifera]
 emb|CBI23936.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   216 bits (550),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P AFDPFAEANAE SG GSKDYVHIR+QQRNGRKSLTTVQGL+K+FSYNKIL
Sbjct  1    MSELDIQIPTAFDPFAEANAEDSGAGSKDYVHIRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEDIKIHGF  113



>ref|XP_009611793.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009792850.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009792852.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   216 bits (550),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE DLQ P AFDPFAEANA++SG GSKDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDLQVPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQA IVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAEIVKKEHIKIHGF  113



>ref|XP_002316980.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 ref|XP_006377838.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 gb|ABK93182.1| unknown [Populus trichocarpa]
 gb|ABK93949.1| unknown [Populus trichocarpa]
 gb|EEE97592.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
 gb|ERP55635.1| hypothetical protein POPTR_0011s13810g [Populus trichocarpa]
Length=113

 Score =   216 bits (549),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+FD QTP+A+DPFA+ANAE SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDFDAQTPSAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKESIKIHGF  113



>ref|XP_004159225.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis sativus]
Length=177

 Score =   218 bits (555),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 120/133 (90%), Gaps = 3/133 (2%)
 Frame = +1

Query  94   ASKFCTGGLSVRSFNCQPRFMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNG  273
            A  FC   L V S++ QP FMSEF++Q P+AFDPFA+ANAE SG G+K+YVH+R+QQRNG
Sbjct  48   AQSFCW--LPV-SYSGQPSFMSEFNVQIPSAFDPFADANAEDSGAGAKEYVHVRIQQRNG  104

Query  274  RKSLTTVQGLKKDFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA  453
            RKS TTVQGLKK+FSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA
Sbjct  105  RKSPTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA  164

Query  454  GIVKKEHIKIHGF  492
            GIVKKE+IKIHGF
Sbjct  165  GIVKKENIKIHGF  177



>ref|XP_009771770.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009771771.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   216 bits (549),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ DLQ P AFDPFAEANA++SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDLQVPNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQ GIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKKEHIKIHGF  113



>ref|XP_006363526.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Solanum 
tuberosum]
Length=113

 Score =   215 bits (548),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ DLQ P AFDPFAEANAE+SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDLQVPNAFDPFAEANAENSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGVVKKEHIKIHGF  113



>ref|XP_007132953.1| hypothetical protein PHAVU_011G139000g [Phaseolus vulgaris]
 gb|ESW04947.1| hypothetical protein PHAVU_011G139000g [Phaseolus vulgaris]
Length=113

 Score =   215 bits (548),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFAEANA+ SG GSK+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDAQIPTAFDPFAEANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KD+KKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>gb|ABY75806.1| SUI1 A protein [Opuntia streptacantha]
Length=113

 Score =   215 bits (548),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q PAA+DPFA+ANAE+SG G+KDYVHIRVQQRNGRKSLTTVQGL K FSYNKIL
Sbjct  1    MSDLDIQVPAAYDPFADANAENSGAGAKDYVHIRVQQRNGRKSLTTVQGLNKQFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVV+DPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVZDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_008341979.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=113

 Score =   215 bits (548),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD Q P+AFDPFA+ANAE+SG G+K+YVH+RVQQRNGRKSLTTVQGLKK++SYNKIL
Sbjct  1    MSEFDTQVPSAFDPFADANAENSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVV+DPELGQVIQLQGDQRKNVS+FLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_009594373.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009594374.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
Length=113

 Score =   215 bits (547),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D Q P AFDPFAEANA++SG GSKDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDAQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>ref|XP_010062975.1| PREDICTED: protein translation factor SUI1 homolog 2 [Eucalyptus 
grandis]
Length=113

 Score =   214 bits (546),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDAQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>gb|EYU33614.1| hypothetical protein MIMGU_mgv1a016641mg [Erythranthe guttata]
Length=113

 Score =   214 bits (545),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P  FDPFA+ANAE+SG G+KDYVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIQIPTTFDPFADANAENSGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_004294347.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   214 bits (545),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P AFDPFAEANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>gb|KHG06771.1| hypothetical protein F383_09792 [Gossypium arboreum]
 gb|KJB11988.1| hypothetical protein B456_002G083600 [Gossypium raimondii]
Length=113

 Score =   214 bits (544),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFA+ANAE SG G+KDYVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_007132952.1| hypothetical protein PHAVU_011G138900g [Phaseolus vulgaris]
 gb|ESW04946.1| hypothetical protein PHAVU_011G138900g [Phaseolus vulgaris]
Length=113

 Score =   214 bits (544),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFAEANA+ SG GSK+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDAQIPTAFDPFAEANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KD+KKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  61   KDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAGIVKKEHIKIHGF  113



>sp|O48650.1|SUI1_SALBA RecName: Full=Protein translation factor SUI1 homolog [Salix 
bakko]
 dbj|BAA24697.1| SUI1 homolog [Salix bakko]
Length=113

 Score =   214 bits (544),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD   P AFDPFAEANAE SG G+KDYVH+RVQQRNGRKSLTTVQGLKKD+SYNKIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKDYSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKENIKIHGF  113



>ref|XP_004144489.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
1 [Cucumis sativus]
 ref|XP_004144490.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
2 [Cucumis sativus]
 ref|XP_008455418.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 ref|XP_008455419.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 ref|XP_008455420.1| PREDICTED: protein translation factor SUI1 homolog [Cucumis melo]
 gb|KGN43535.1| hypothetical protein Csa_7G044260 [Cucumis sativus]
Length=113

 Score =   214 bits (544),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEF++Q P+AFDPFA+ANAE SG G+K+YVH+R+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSEFNVQIPSAFDPFADANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_002310460.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 ref|XP_006380311.1| SUI1 family protein [Populus trichocarpa]
 ref|XP_006380312.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 ref|XP_011026342.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
 ref|XP_011026343.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
 gb|ABK95531.1| unknown [Populus trichocarpa]
 gb|EEE90910.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
 gb|ERP58108.1| SUI1 family protein [Populus trichocarpa]
 gb|ERP58109.1| hypothetical protein POPTR_0007s02520g [Populus trichocarpa]
Length=113

 Score =   213 bits (543),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD   P AFDPFAEANAE SG G+KDYVH+RVQQRNGRKSLTTVQGLKK++SYNKIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_009342251.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=113

 Score =   213 bits (543),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD Q P+AFDPF +ANAE+SG G+K+YVH+RVQQRNGRKSLTTVQGLKK++SYNKIL
Sbjct  1    MSEFDTQVPSAFDPFTDANAENSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVV+DPELGQVIQLQGDQRKNVS+FLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_011030847.1| PREDICTED: protein translation factor SUI1 homolog [Populus euphratica]
Length=113

 Score =   213 bits (543),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+FD QTP A+DPFA+ANAE SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDFDAQTPTAYDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQ GIVKKE IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKKESIKIHGF  113



>ref|XP_008341842.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
 ref|XP_009371031.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
 ref|XP_009373712.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=113

 Score =   213 bits (543),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P AFDPFAEANAE SG G+KDYVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPE GQVIQLQGDQRKNVS FLVQAGIVKK+HIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSAFLVQAGIVKKDHIKIHGF  113



>ref|NP_001239651.1| uncharacterized protein LOC100784390 [Glycine max]
 ref|XP_006591863.1| PREDICTED: uncharacterized protein LOC100784390 isoform X1 [Glycine 
max]
 gb|ACU18971.1| unknown [Glycine max]
 gb|KHN22844.1| Protein translation factor SUI1 like [Glycine soja]
Length=113

 Score =   213 bits (543),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD   P AFDPFAEANAE SG G+K+YVH+RVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSEFDTNIPTAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKLHGF  113



>ref|XP_009774027.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
 ref|XP_009774028.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=113

 Score =   213 bits (543),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D Q P AFDPFAEANA++SG GSKDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDAQIPTAFDPFAEANADNSGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLVQAGIVKKEHIKIHGF  113



>gb|AFW78548.1| LOW QUALITY PROTEIN: protein translation factor SUI1 [Zea mays]
Length=185

 Score =   216 bits (549),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 2/126 (2%)
 Frame = +1

Query  121  SVRSFNCQPRFMSEFDLQTPAAFDPFAEANAESSG--DGSKDYVHIRVQQRNGRKSLTTV  294
            SV +   QP FMS+ D+Q P+AFDPFAEANAE SG   G+KDYVH+R+QQRNGRKSLTTV
Sbjct  60   SVPTKPQQPSFMSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTV  119

Query  295  QGLKKDFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEH  474
            QGLKK+FSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGI KKE+
Sbjct  120  QGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKEN  179

Query  475  IKIHGF  492
            IKIHGF
Sbjct  180  IKIHGF  185



>ref|XP_002310461.1| SUI1 family protein [Populus trichocarpa]
 gb|EEE90911.1| SUI1 family protein [Populus trichocarpa]
Length=113

 Score =   213 bits (542),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD   P AFDPFAEANAE SG G+KDYVH+RVQQRNGRKSLTTVQGLKK++SYNKIL
Sbjct  1    MSEFDNAIPTAFDPFAEANAEDSGAGTKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKESIKIHGF  113



>ref|XP_010267759.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   213 bits (542),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P  FDPFAEANAE SG GSK+YVH+R+QQRNGRKSLTTVQGL+K+FSYNKIL
Sbjct  1    MSELDIQIPTTFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA IVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQARIVKKEHIKIHGF  113



>ref|XP_009397784.1| PREDICTED: protein translation factor SUI1 homolog 2 [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   213 bits (542),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ ++Q P AFDPFA+ANAE SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLNVQIPTAFDPFADANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>ref|XP_009624679.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Nicotiana tomentosiformis]
Length=113

 Score =   213 bits (542),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ DL  P AFDPFAEANA++SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDLLVPNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQ GIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVGIVKKEHIKIHGF  113



>ref|XP_010923943.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   213 bits (542),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS  D+Q P A+DPFAEANAE SG G+K+YVH+R+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSGLDIQVPTAYDPFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>gb|EPS65463.1| hypothetical protein M569_09315 [Genlisea aurea]
Length=113

 Score =   213 bits (542),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D++TP +FDPFA+ANAE+SG GSKDY+HIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIETPISFDPFADANAENSGPGSKDYIHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>gb|KHN46541.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=155

 Score =   214 bits (545),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  142  QPRFMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSY  321
            +  FMSE D Q P AFDPFA+ANA+ SG GSK+YVHIRVQQRNGRKSLTTVQGLKK+FSY
Sbjct  39   ESSFMSELDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSY  98

Query  322  NKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            NKILKD+KKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK+HIKIHGF
Sbjct  99   NKILKDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  155



>ref|XP_008803218.1| PREDICTED: protein translation factor SUI1 homolog [Phoenix dactylifera]
Length=113

 Score =   213 bits (541),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P  FDPFAEANAE SG G+K+YVH+R+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQIPTTFDPFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_010930963.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   213 bits (541),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFAEANA+ SG G+K+YVH+R+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFAEANADDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|NP_001238017.1| uncharacterized protein LOC100306129 [Glycine max]
 gb|ACU14161.1| unknown [Glycine max]
 gb|KHN47859.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=113

 Score =   213 bits (541),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+ANA+ SG GSK+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KD+KKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>gb|KHG30632.1| hypothetical protein F383_00215 [Gossypium arboreum]
Length=113

 Score =   212 bits (540),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>gb|KJB62619.1| hypothetical protein B456_009G426400 [Gossypium raimondii]
Length=213

 Score =   216 bits (549),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +1

Query  151  FMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            FMS+ D+Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKI
Sbjct  100  FMSDLDVQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  159

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  160  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  213



>ref|XP_007132567.1| hypothetical protein PHAVU_011G105700g [Phaseolus vulgaris]
 gb|ESW04561.1| hypothetical protein PHAVU_011G105700g [Phaseolus vulgaris]
Length=113

 Score =   212 bits (540),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEF+   P+AFDPFAEANAE SG G+K+YVH+RVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSEFETNIPSAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKLHGF  113



>ref|XP_007213988.1| hypothetical protein PRUPE_ppa013607mg [Prunus persica]
 gb|EMJ15187.1| hypothetical protein PRUPE_ppa013607mg [Prunus persica]
Length=113

 Score =   212 bits (540),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P AFDPFAEANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>ref|XP_004304159.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   212 bits (540),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P AFDPFAEANAE SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPE GQVIQLQGDQRKNVS FLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSAFLVQAGIVKKENIKIHGF  113



>ref|XP_004487600.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X2 [Cicer arietinum]
Length=113

 Score =   212 bits (540),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P  FDPFAEANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDAQIPTTFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPE GQVIQLQGDQRKNVSTFL+QAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLIQAGIVKKEHIKIHGF  113



>gb|KHG23747.1| hypothetical protein F383_10557 [Gossypium arboreum]
 gb|KJB45588.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB45589.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB45590.1| hypothetical protein B456_007G314200 [Gossypium raimondii]
 gb|KJB78391.1| hypothetical protein B456_013G163400 [Gossypium raimondii]
Length=113

 Score =   211 bits (538),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_008244365.1| PREDICTED: protein translation factor SUI1 homolog 2 [Prunus 
mume]
Length=113

 Score =   211 bits (538),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P AFDPFAEANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FL+QAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLIQAGIVKKDNIKIHGF  113



>gb|AFK35113.1| unknown [Lotus japonicus]
 gb|AFK48780.1| unknown [Lotus japonicus]
Length=114

 Score =   211 bits (538),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 106/114 (93%), Gaps = 1/114 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGS-KDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            MSE D   P AFDPFAEANAE SG GS K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKI
Sbjct  1    MSELDAAIPTAFDPFAEANAEDSGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  114



>ref|XP_008809850.1| PREDICTED: protein translation factor SUI1 homolog [Phoenix dactylifera]
Length=113

 Score =   211 bits (538),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P A+DPFAEANA  SG GSK+YVH+R+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQIPTAYDPFAEANAGDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>gb|ABQ42058.1| putative translation factor [Sonneratia caseolaris]
Length=114

 Score =   211 bits (537),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +1

Query  151  FMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            FM + D Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKI
Sbjct  1    FMVDLDAQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE IKIHGF
Sbjct  61   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKERIKIHGF  114



>ref|XP_007216425.1| hypothetical protein PRUPE_ppa022105mg, partial [Prunus persica]
 gb|EMJ17624.1| hypothetical protein PRUPE_ppa022105mg, partial [Prunus persica]
Length=170

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  142  QPRFMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSY  321
            Q  FMSEFD Q P+AFDPFA+ANAE SG G+K+YVH+RVQQRNGRKSLTTVQGLKK++SY
Sbjct  54   QSSFMSEFDTQVPSAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSY  113

Query  322  NKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            NKILKDLKKEFCCNGTVV+DPELGQVIQLQGDQRKNVS+FLVQAGIVKKE IK+HGF
Sbjct  114  NKILKDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEDIKLHGF  170



>ref|XP_010232448.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Brachypodium distachyon]
Length=143

 Score =   212 bits (540),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 110/119 (92%), Gaps = 2/119 (2%)
 Frame = +1

Query  142  QPRFMSEFDLQTPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDF  315
            QP FMS+ D+Q P+AFDPFAEANAE  S+G GSKDYVH+RVQQRNGRKSLTTVQGLKK++
Sbjct  25   QPSFMSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRVQQRNGRKSLTTVQGLKKEY  84

Query  316  SYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            SYNKILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNV+TFLVQAG+ KKE IKIHGF
Sbjct  85   SYNKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  143



>ref|XP_010035571.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Eucalyptus 
grandis]
 ref|XP_010035572.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Eucalyptus 
grandis]
 gb|KCW46998.1| hypothetical protein EUGRSUZ_K00804 [Eucalyptus grandis]
Length=113

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P  FDPFA+A AE SG GSK+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDVQVPTTFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKERIKIHGF  113



>ref|NP_001236633.1| uncharacterized protein LOC100499833 [Glycine max]
 gb|ACU13849.1| unknown [Glycine max]
Length=113

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+ANA+ SG GSK+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KD+KKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK+HIKIHGF
Sbjct  61   KDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  113



>ref|XP_009417250.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Musa 
acuminata subsp. malaccensis]
Length=113

 Score =   211 bits (536),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+  P AFDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVHIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGI+KKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIIKKEHIKIHGF  113



>ref|XP_004234488.1| PREDICTED: protein translation factor SUI1 homolog 1 [Solanum 
lycopersicum]
 ref|XP_006343300.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Solanum 
tuberosum]
Length=113

 Score =   210 bits (534),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P  FDPFA+ANA++SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDIQVPTTFDPFADANAQNSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFL+QAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKKDNIKIHGF  113



>ref|XP_008230087.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 ref|XP_008230088.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
Length=113

 Score =   210 bits (534),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD Q P+AFDPFA+ANAE SG G+K+YVH+RVQQRNGRKSLTTVQGLKK++SYNKIL
Sbjct  1    MSEFDTQVPSAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVV+DPELGQVIQLQGDQRKNVS+FLVQAGIVKKE IK+HGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEDIKLHGF  113



>gb|ADV04053.1| eukaryotic translation initiation factor 2 [Hevea brasiliensis]
Length=113

 Score =   210 bits (534),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE + Q P  FDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELETQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_009401666.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   210 bits (534),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFAEANA+ SG G+K+YVH+RVQQRNGRK LTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQLPTAFDPFAEANADDSGVGAKEYVHVRVQQRNGRKCLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKEHIKIHGF  113



>gb|KDP39065.1| hypothetical protein JCGZ_00822 [Jatropha curcas]
Length=113

 Score =   209 bits (533),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE + Q P  FDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELEAQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_011048301.1| PREDICTED: protein translation factor SUI1 homolog 2 [Populus 
euphratica]
Length=113

 Score =   209 bits (533),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+QTP AFDPFA+ANAE SG G+K+YVHIR QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIQTPTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>gb|ABQ42057.1| putative translation factor [Sonneratia alba]
 gb|ABQ42059.1| putative translation factor [Sonneratia ovata]
 gb|ABQ42060.1| putative translation factor [Sonneratia apetala]
Length=114

 Score =   209 bits (533),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +1

Query  151  FMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            FM + D Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKI
Sbjct  1    FMVDLDAQVPTAFDPFADANAEDSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK+ IKIHGF
Sbjct  61   LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDRIKIHGF  114



>ref|XP_008365631.1| PREDICTED: protein translation factor SUI1 homolog 2 [Malus domestica]
 ref|XP_009358111.1| PREDICTED: protein translation factor SUI1 homolog 2 [Pyrus x 
bretschneideri]
 ref|XP_009345194.1| PREDICTED: protein translation factor SUI1 homolog 2 [Pyrus x 
bretschneideri]
Length=113

 Score =   209 bits (533),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFAEA AE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDIDVQLPTAFDPFAEATAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>gb|ADV04054.1| eukaryotic translation initiation factor 3 [Hevea brasiliensis]
Length=113

 Score =   209 bits (533),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE + Q P+ FDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELETQIPSTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEKIKIHGF  113



>gb|AFC01199.1| eukaryotic translation initiation factor [Ammopiptanthus mongolicus]
Length=113

 Score =   209 bits (533),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD   P  FDPFAEANAE SG G+K+YVH+RVQQRNGRKSLTTVQGLKK++SY KIL
Sbjct  1    MSEFDTNIPTTFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|XP_007215170.1| hypothetical protein PRUPE_ppa013601mg [Prunus persica]
 ref|XP_008230362.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Prunus 
mume]
 gb|EMJ16369.1| hypothetical protein PRUPE_ppa013601mg [Prunus persica]
Length=113

 Score =   209 bits (533),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P AFDPFAEANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDVQIPTAFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPE GQVIQLQGDQRKNVS+FLVQAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>ref|XP_006370639.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 ref|XP_006370640.1| Protein translation factor SUI1 1 family protein [Populus trichocarpa]
 gb|ABK94414.1| unknown [Populus trichocarpa]
 gb|ERP67208.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 gb|ERP67209.1| Protein translation factor SUI1 1 family protein [Populus trichocarpa]
Length=113

 Score =   209 bits (532),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+QTP AFDPFA+ANAE SG G+K+YVHIR QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQTPTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>gb|KJB13596.1| hypothetical protein B456_002G083300 [Gossypium raimondii]
Length=113

 Score =   209 bits (532),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVV+DPELGQVIQLQGDQRKNVSTFLVQAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>ref|XP_010931827.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   209 bits (532),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ ++Q P  FDPFAEANA+ SG G+K+YVH+R+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLNVQLPTTFDPFAEANADDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_009800522.1| PREDICTED: protein translation factor SUI1 homolog 2 [Nicotiana 
sylvestris]
Length=113

 Score =   209 bits (532),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P  FDPFA+ANA++SG G+K+YVHIRVQQRNGRKSLTTVQGLK++FSYNKIL
Sbjct  1    MSEIDVQIPTNFDPFADANAQNSGAGAKEYVHIRVQQRNGRKSLTTVQGLKREFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFL+QAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKKENIKIHGF  113



>ref|XP_003596650.1| Translation factor Sui1-like protein [Medicago truncatula]
 gb|AES66901.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK43860.1| unknown [Medicago truncatula]
Length=114

 Score =   209 bits (532),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 106/114 (93%), Gaps = 1/114 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGS-KDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            MSE D Q P A+DPFAEANAE +G GS K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKI
Sbjct  1    MSELDAQIPTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKDLKKEFCCNGTVVQDPE GQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   LKDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  114



>ref|XP_009408662.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408663.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   209 bits (531),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ + Q P+AFDPFA+ANA+ SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLEAQIPSAFDPFADANADDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKN S FLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNASNFLVQAGIVKKEHIKIHGF  113



>gb|KHG06773.1| hypothetical protein F383_09794 [Gossypium arboreum]
Length=113

 Score =   209 bits (531),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AF+PFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIQIPTAFNPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>ref|XP_002280157.1| PREDICTED: protein translation factor SUI1 homolog 1 [Vitis vinifera]
 ref|XP_003633291.1| PREDICTED: protein translation factor SUI1 homolog 1 [Vitis vinifera]
 emb|CBI28951.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   209 bits (531),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D   P  FDPFA+ANAE SG G+K+YVH+R+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDANIPTTFDPFADANAEDSGAGTKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  113



>ref|NP_001044504.2| Os01g0794500 [Oryza sativa Japonica Group]
 dbj|BAD53005.1| putative translation initiation factor [Oryza sativa Japonica 
Group]
 gb|EEC71629.1| hypothetical protein OsI_04056 [Oryza sativa Indica Group]
 dbj|BAF06418.2| Os01g0794500 [Oryza sativa Japonica Group]
Length=115

 Score =   209 bits (531),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 108/115 (94%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESS--GDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P+AFDPFAEANAE S  G GSKDYVH+R+QQRNGRKSLTTVQGLKK++SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSVGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKKE IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKESIKIHGF  115



>ref|NP_001274850.1| uncharacterized protein LOC102577437 [Solanum tuberosum]
 gb|ABB02649.1| unknown [Solanum tuberosum]
Length=113

 Score =   208 bits (530),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q   AFDPFAEANA++ G GSKDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIQIRTAFDPFAEANADNFGAGSKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQ DQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQDDQRKNVSTFLVQAGIVKKEHIKIHGF  113



>gb|ABI48954.1| putative protein translation factor Sui1 [Viola baoshanensis]
Length=113

 Score =   208 bits (530),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P+AFDPFA+A+ E SG G+KDYVHIR+QQRNGRKSLTTVQGLKKDFSYNKIL
Sbjct  1    MSDLDIQIPSAFDPFADASTEDSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKDFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KD KKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK++IKIHGF
Sbjct  61   KDXKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>gb|KDP20792.1| hypothetical protein JCGZ_21263 [Jatropha curcas]
Length=113

 Score =   208 bits (530),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P AFDP AEANA  SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYN IL
Sbjct  1    MSERDIQIPTAFDPLAEANAADSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNMIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA IVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQARIVKKEHIKIHGF  113



>ref|XP_009378877.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Pyrus 
x bretschneideri]
Length=113

 Score =   208 bits (530),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFAEA AE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDIDVQLPTAFDPFAEATAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKDNIKIHGF  113



>ref|NP_001059843.1| Os07g0529800 [Oryza sativa Japonica Group]
 sp|Q0D5W6.1|SUI1_ORYSJ RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2; AltName: Full=Protein eIF1; AltName: Full=Translation 
initiation factor 1 [Oryza sativa Japonica Group]
 sp|A6MZM2.1|SUI1_ORYSI RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2; AltName: Full=Protein eIF1; AltName: Full=Translation 
initiation factor 1 [Oryza sativa Indica Group]
 gb|AAK56324.1|AF380357_1 translational initiation factor eIF1 [Oryza coarctata]
 emb|CAA36190.1| GOS2 [Oryza sativa Indica Group]
 gb|AAC67556.1| translation initiation factor [Oryza sativa Japonica Group]
 dbj|BAC45143.1| translational initiation factor eIF1 [Oryza sativa Japonica Group]
 dbj|BAF21757.1| Os07g0529800 [Oryza sativa Japonica Group]
 gb|ABR25442.1| putative protein translation factor sui1 [Oryza sativa Indica 
Group]
 gb|ABR26117.1| protein translation factor sui1 [Oryza sativa Indica Group]
 gb|ACJ09228.1| translation initiation factor eIF1 [Oryza sativa Indica Group]
 dbj|BAH00131.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AFI71284.1| protein translation factor SUI 1 [Oryza sativa Japonica Group]
Length=115

 Score =   208 bits (530),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGD--GSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P AFDPFAEANA  SG   GSKDYVH+R+QQRNGRKSLTTVQGLKK+FSYNK
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|XP_003527483.1| PREDICTED: protein translation factor SUI1 homolog isoform 1 
[Glycine max]
 ref|XP_003527484.1| PREDICTED: protein translation factor SUI1 homolog isoform 2 
[Glycine max]
Length=113

 Score =   208 bits (530),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD   P AFDPFA+ANAE SG G+K+YVH+RVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSEFDTNIPTAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFL+QAGIVKKE+IK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLMQAGIVKKEYIKLHGF  113



>ref|XP_002458630.1| hypothetical protein SORBIDRAFT_03g036990 [Sorghum bicolor]
 gb|EES03750.1| hypothetical protein SORBIDRAFT_03g036990 [Sorghum bicolor]
Length=115

 Score =   208 bits (530),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 109/115 (95%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P+AFDPFAEANAE  S+G GSKDYVH+R+QQRNGRKSLTTVQGLKK++SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLV+AGIVKKE IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVEAGIVKKESIKIHGF  115



>gb|EEE67305.1| hypothetical protein OsJ_24532 [Oryza sativa Japonica Group]
Length=230

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 111/129 (86%), Gaps = 2/129 (2%)
 Frame = +1

Query  112  GGLSVRSFNCQPRFMSEFDLQTPAAFDPFAEANAESSGD--GSKDYVHIRVQQRNGRKSL  285
            G L V     Q  FMS+ D+Q P AFDPFAEANA  SG   GSKDYVH+R+QQRNGRKSL
Sbjct  102  GVLGVACHFHQQSFMSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSL  161

Query  286  TTVQGLKKDFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVK  465
            TTVQGLKK+FSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVK
Sbjct  162  TTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVK  221

Query  466  KEHIKIHGF  492
            KEHIKIHGF
Sbjct  222  KEHIKIHGF  230



>ref|XP_009603077.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Nicotiana 
tomentosiformis]
Length=113

 Score =   208 bits (529),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P  FDPFA+ANA++SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSEHDVQIPTTFDPFADANAQNSGAGAKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FL+QAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSAFLIQAGIVKKENIKIHGF  113



>ref|XP_004515084.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Cicer arietinum]
Length=113

 Score =   208 bits (529),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD   P+ FDPFAEANAE SG G+K+YVH+RVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSEFDTNIPSTFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVV+DPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IK+HGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKLHGF  113



>ref|XP_010909791.1| PREDICTED: protein translation factor SUI1 homolog [Elaeis guineensis]
Length=113

 Score =   208 bits (529),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ ++Q P AFD FAEANAE SG G+K+YVH+R+QQRNGRKSLTTVQGLKK+FSY+KIL
Sbjct  1    MSDLNVQLPTAFDSFAEANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKKEHIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGF  113



>ref|XP_003527319.1| PREDICTED: protein translation factor SUI1 homolog 1 [Glycine 
max]
 gb|KHN46542.1| Protein translation factor SUI1 like 1 [Glycine soja]
Length=113

 Score =   208 bits (529),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS  D Q P AFDPFA+ANA+ SG GSK+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSGLDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KD+KKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK+HIKIHGF
Sbjct  61   KDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  113



>ref|NP_001150984.1| GOS2 homolog [Zea mays]
 gb|ACG41169.1| protein translation factor SUI1 [Zea mays]
 gb|ACG48501.1| protein translation factor SUI1 [Zea mays]
 tpg|DAA57283.1| TPA: protein translation factor SUI1 isoform 1 [Zea mays]
 tpg|DAA57284.1| TPA: protein translation factor SUI1 isoform 2 [Zea mays]
Length=115

 Score =   208 bits (529),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 109/115 (95%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P+AFDPFAEANAE  S+G GSKDYVH+R+QQRNGRKSLTTVQGLKK++SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKK+ IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKDSIKIHGF  115



>gb|KHG12156.1| hypothetical protein F383_20129 [Gossypium arboreum]
Length=113

 Score =   207 bits (528),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFA+ANAE +G G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDAGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELG+VIQLQGDQRKNVSTFLVQAGIVKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGKVIQLQGDQRKNVSTFLVQAGIVKKDSIKIHGF  113



>ref|XP_007021029.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
 gb|EOY12554.1| Translation initiation factor SUI1 family protein [Theobroma 
cacao]
Length=113

 Score =   207 bits (527),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQIPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK++IKIHGF
Sbjct  61   KDLKKVFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>ref|XP_004287929.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Fragaria 
vesca subsp. vesca]
Length=113

 Score =   207 bits (527),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE + Q P+ FDPFA+ANAE SG G+K+YVH+RVQQRNGRKSLTTVQGLKK++SYNKIL
Sbjct  1    MSELETQVPSTFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FLVQAGIVKKE+IK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLVQAGIVKKENIKLHGF  113



>sp|Q9SM41.1|SUI1_SPOST RecName: Full=Protein translation factor SUI1 homolog [Sporobolus 
stapfianus]
 emb|CAB61837.1| putative translation initiation factor eIF-1 [Sporobolus stapfianus]
Length=115

 Score =   207 bits (527),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGD--GSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P AFDPF+EANA  SG   GSKDYVH+R+QQRNGRKSLTTVQGLKK+FSYNK
Sbjct  1    MSDLDIQIPTAFDPFSEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>emb|CDO99708.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   207 bits (526),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P  FDPFA+ANA++S  GSK+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDIQIPTTFDPFADANADNSSAGSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNGTVVQDPELGQVIQLQGDQRKNVSTFL+QAGIVKKE+IK+HGF
Sbjct  61   KDLKKDFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLIQAGIVKKENIKLHGF  113



>gb|KEH29652.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=113

 Score =   207 bits (526),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD   P  +DPFAEANAE SG G+K+YVH+RVQQRNGRKSLTTVQGLKK+FSY+KIL
Sbjct  1    MSEFDTNIPTTYDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEFSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVV+DPELGQVIQLQGDQRKNVSTFLVQAGIVKKE IK+HGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEKIKLHGF  113



>ref|NP_001152681.1| LOC100286322 [Zea mays]
 ref|XP_002440017.1| hypothetical protein SORBIDRAFT_09g024530 [Sorghum bicolor]
 ref|XP_004961618.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
 ref|XP_008647991.1| PREDICTED: LOC100286322 isoform X1 [Zea mays]
 gb|ACF83099.1| unknown [Zea mays]
 gb|ACG26980.1| protein translation factor SUI1 [Zea mays]
 gb|ACG32428.1| protein translation factor SUI1 [Zea mays]
 gb|ACG47286.1| protein translation factor SUI1 [Zea mays]
 gb|ACG48899.1| protein translation factor SUI1 [Zea mays]
 gb|ACN35402.1| unknown [Zea mays]
 gb|EES18447.1| hypothetical protein SORBIDRAFT_09g024530 [Sorghum bicolor]
 gb|AFW78549.1| protein translation factor SUI1 [Zea mays]
Length=115

 Score =   207 bits (526),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 108/115 (94%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSG--DGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P+AFDPFAEANAE SG   G+KDYVH+R+QQRNGRKSLTTVQGLKK+FSYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGI KKE+IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKENIKIHGF  115



>ref|XP_010545205.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya 
hassleriana]
 ref|XP_010545206.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Tarenaya 
hassleriana]
Length=113

 Score =   207 bits (526),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P  FDPFA+ANAE SG GSK+YVHIRVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSEIDTQIPTTFDPFADANAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>emb|CAC84489.1| putative translation factor [Pinus pinaster]
 gb|ABK20970.1| unknown [Picea sitchensis]
 gb|ABK22220.1| unknown [Picea sitchensis]
 gb|ABK23355.1| unknown [Picea sitchensis]
 gb|ABK26752.1| unknown [Picea sitchensis]
 gb|ABR16497.1| unknown [Picea sitchensis]
 gb|ABR18467.1| unknown [Picea sitchensis]
 gb|ACN39759.1| unknown [Picea sitchensis]
 gb|ACN40001.1| unknown [Picea sitchensis]
 gb|ACN40379.1| unknown [Picea sitchensis]
 gb|ACN40927.1| unknown [Picea sitchensis]
Length=113

 Score =   207 bits (526),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P A+DPFA+ANAE SG GSK+YVH+R+QQRNGRKSLTTVQGL+K+FSYNKIL
Sbjct  1    MSDLDVQIPGAYDPFADANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLRKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKDNIKIHGF  113



>gb|EEE55519.1| hypothetical protein OsJ_03741 [Oryza sativa Japonica Group]
Length=165

 Score =   208 bits (530),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 2/116 (2%)
 Frame = +1

Query  151  FMSEFDLQTPAAFDPFAEANAESS--GDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYN  324
            F S+ D+Q P+AFDPFAEANAE S  G GSKDYVH+R+QQRNGRKSLTTVQGLKK++SYN
Sbjct  50   FRSDLDVQLPSAFDPFAEANAEDSSVGAGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYN  109

Query  325  KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKKE IKIHGF
Sbjct  110  KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKESIKIHGF  165



>gb|KHN41202.1| Protein translation factor SUI1 like [Glycine soja]
Length=113

 Score =   206 bits (525),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD   P AFDPFA+ANAE SG G+K+YVH+RVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSEFDTNIPTAFDPFADANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFL+QAGIVKKE IK+HGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLMQAGIVKKEFIKLHGF  113



>ref|NP_001104887.1| protein translation factor SUI1 homolog [Zea mays]
 ref|XP_006657782.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 ref|XP_006659299.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 sp|P56330.1|SUI1_MAIZE RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Protein GOS2 [Zea mays]
 gb|AAB88615.1| translation initiation factor [Zea mays]
 gb|ACF80856.1| unknown [Zea mays]
 gb|ACG27240.1| protein translation factor SUI1 [Zea mays]
 gb|ACG28108.1| protein translation factor SUI1 [Zea mays]
 gb|ACG30000.1| protein translation factor SUI1 [Zea mays]
 gb|ACG30907.1| protein translation factor SUI1 [Zea mays]
 gb|ACG37835.1| protein translation factor SUI1 [Zea mays]
 tpg|DAA62967.1| TPA: translation initiation factor1 [Zea mays]
Length=115

 Score =   206 bits (525),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGD--GSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P AFDPFAEANA  SG   GSKDYVH+R+QQRNGRKSLTTVQGLKK+FSY+K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|XP_008784556.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Phoenix 
dactylifera]
Length=113

 Score =   206 bits (525),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ + Q P  FDPFAEANAE SG G+K+YVH+R QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLNAQLPTTFDPFAEANAEDSGAGAKEYVHVRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKKE IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEQIKIHGF  113



>gb|ABO15891.1| translation initiation factor eIF1 [synthetic construct]
 gb|ABX61094.1| putative translation initiation factor [Triticum aestivum]
 gb|ADD62702.1| eukaryotic translation initiation factor 1 [Leymus chinensis]
 emb|CDM84532.1| unnamed protein product [Triticum aestivum]
Length=115

 Score =   206 bits (525),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDG--SKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P AFDPFAEANAE SG G  SK+YVH+RVQQRNGRKSLTTVQGLKKD+SYNK
Sbjct  1    MSDLDVQVPTAFDPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAG+ KKE IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  115



>ref|XP_004957905.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Setaria italica]
 ref|XP_004957906.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
Length=115

 Score =   206 bits (525),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGD--GSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P AFDPFAEANA  SG   GSKDYVH+R+QQRNGRKSLTTVQGLKK+FSY+K
Sbjct  1    MSDLDVQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>gb|KCW46999.1| hypothetical protein EUGRSUZ_K00804 [Eucalyptus grandis]
Length=114

 Score =   206 bits (525),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 105/114 (92%), Gaps = 1/114 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+Q P  FDPFA+A AE SG GSK+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDVQVPTTFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLV-QAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLV QAGIVKKE IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQQAGIVKKERIKIHGF  114



>gb|AFK43238.1| unknown [Medicago truncatula]
Length=113

 Score =   206 bits (524),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEFD   P  +DPFAEANAE SG G+K+YVH+RVQQRNGR+SLTTVQGLKK+FSY+KIL
Sbjct  1    MSEFDTNIPTTYDPFAEANAEDSGAGTKEYVHVRVQQRNGRRSLTTVQGLKKEFSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVV+DPELGQVIQLQGDQRKNVSTFLVQAGIVKKE IK+HGF
Sbjct  61   KDLKKEFCCNGTVVEDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEKIKLHGF  113



>gb|EEC79466.1| hypothetical protein OsI_20483 [Oryza sativa Indica Group]
 gb|EEE64240.1| hypothetical protein OsJ_19073 [Oryza sativa Japonica Group]
Length=213

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 111/121 (92%), Gaps = 2/121 (2%)
 Frame = +1

Query  136  NCQPRFMSEFDLQTPAAFDPFAEANAESSG--DGSKDYVHIRVQQRNGRKSLTTVQGLKK  309
            N Q  FMS+ D+Q P+AFDPFAEANAE SG   G+KDYVH+R+QQRNGRKSLTTVQGLKK
Sbjct  93   NQQTSFMSDLDVQLPSAFDPFAEANAEDSGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKK  152

Query  310  DFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHG  489
            ++SYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGI KK++IKIHG
Sbjct  153  EYSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKDNIKIHG  212

Query  490  F  492
            F
Sbjct  213  F  213



>ref|XP_009412007.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412008.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   206 bits (524),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFAEANA+ SG G+K+YVH+RVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQLPTAFDPFAEANADDSGAGAKEYVHVRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FL Q GIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLSQTGIVKKEYIKIHGF  113



>gb|AFK48465.1| unknown [Lotus japonicus]
Length=116

 Score =   206 bits (524),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 106/116 (91%), Gaps = 3/116 (3%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDG---SKDYVHIRVQQRNGRKSLTTVQGLKKDFSYN  324
            MSE D Q P AFDPFAEAN + SG G   +KDYVHIRVQQRNGRKSLTTVQGLKK+FSYN
Sbjct  1    MSELDAQIPTAFDPFAEANVDESGAGGAGTKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  60

Query  325  KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK++IKIHGF
Sbjct  61   KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  116



>emb|CDY46663.1| BnaA03g48450D [Brassica napus]
Length=196

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  142  QPRFMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSY  321
            Q  FMSE D Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY
Sbjct  80   QQSFMSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSY  139

Query  322  NKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            +KILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  140  SKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  196



>gb|KJB62620.1| hypothetical protein B456_009G426500 [Gossypium raimondii]
 gb|KJB62622.1| hypothetical protein B456_009G426500 [Gossypium raimondii]
Length=113

 Score =   206 bits (523),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+  P AFDPFA+ANAE +G G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIHIPTAFDPFADANAEDAGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELG+VIQLQGDQRKNVSTFLVQAGIVKK+ IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGKVIQLQGDQRKNVSTFLVQAGIVKKDSIKIHGF  113



>ref|XP_010539284.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya 
hassleriana]
 ref|XP_010539285.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Tarenaya 
hassleriana]
Length=113

 Score =   205 bits (522),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D Q P  FDPFA+ANAE SG GSK+YVHIRVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSDLDTQLPTTFDPFADANAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_004970238.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Setaria italica]
Length=115

 Score =   206 bits (523),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 107/115 (93%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P+AFDPFAEANAE  S+G GSK+YVH+RVQQRNGRKSLTTVQGLKK++SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFL QAGI KKE IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLTQAGIAKKETIKIHGF  115



>gb|AFK48865.1| unknown [Lotus japonicus]
Length=116

 Score =   205 bits (522),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 105/116 (91%), Gaps = 3/116 (3%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGS---KDYVHIRVQQRNGRKSLTTVQGLKKDFSYN  324
            MSE D Q P AFDPFAEAN + SG G    KDYVHIRVQQRNGRKSLTTVQGLKK+FSYN
Sbjct  1    MSELDAQIPTAFDPFAEANVDESGAGGAGIKDYVHIRVQQRNGRKSLTTVQGLKKEFSYN  60

Query  325  KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK++IKIHGF
Sbjct  61   KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  116



>ref|XP_009388867.1| PREDICTED: protein translation factor SUI1 homolog [Musa acuminata 
subsp. malaccensis]
Length=113

 Score =   205 bits (522),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P  FDPFA+ANA+ SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQIPTTFDPFADANADDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLK+EFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKE IKIHGF
Sbjct  61   KDLKREFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKERIKIHGF  113



>ref|XP_009109147.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Brassica 
rapa]
Length=113

 Score =   205 bits (521),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+ANAE SG G K+YVHIRVQQRNGRKSLTTVQGLKKD+SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGKKEYVHIRVQQRNGRKSLTTVQGLKKDYSYTKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_002867520.1| hypothetical protein ARALYDRAFT_492082 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_009143120.1| PREDICTED: protein translation factor SUI1 homolog 1 [Brassica 
rapa]
 gb|EFH43779.1| hypothetical protein ARALYDRAFT_492082 [Arabidopsis lyrata subsp. 
lyrata]
 emb|CDY29277.1| BnaC01g19290D [Brassica napus]
 emb|CDX89276.1| BnaA01g16170D [Brassica napus]
Length=113

 Score =   205 bits (521),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_002522857.1| translation factor sui1, putative [Ricinus communis]
 gb|EEF39555.1| translation factor sui1, putative [Ricinus communis]
Length=138

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +1

Query  133  FNCQPRFMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKD  312
            F  Q  FMSE + Q P  FDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+
Sbjct  19   FTDQLSFMSELESQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKE  78

Query  313  FSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            FSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS+FL  AGIVKKE+IKIHGF
Sbjct  79   FSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSSFLTGAGIVKKENIKIHGF  138



>ref|XP_003564393.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Brachypodium distachyon]
Length=115

 Score =   205 bits (521),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 107/115 (93%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P+AFDPFAEANAE  S+G GSKDYVH+RVQQRNGRKSLTTVQGLKK++SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKDYVHVRVQQRNGRKSLTTVQGLKKEYSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNV+TFLVQAG+ KKE IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  115



>ref|NP_194443.1| protein translation factor SUI1-1 [Arabidopsis thaliana]
 ref|XP_010448590.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 ref|XP_010443052.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 ref|XP_010482884.1| PREDICTED: protein translation factor SUI1 homolog 1 [Camelina 
sativa]
 sp|P41568.2|SUI11_ARATH RecName: Full=Protein translation factor SUI1 homolog 1 [Arabidopsis 
thaliana]
 gb|AAB68033.1| translation initiation factor [Arabidopsis thaliana]
 emb|CAB38843.1| translation initiation factor [Arabidopsis thaliana]
 emb|CAB79568.1| translation initiation factor [Arabidopsis thaliana]
 gb|AAK59834.1| AT4g27130/T24A18_80 [Arabidopsis thaliana]
 gb|AAL31168.1| AT4g27130/T24A18_80 [Arabidopsis thaliana]
 gb|AAM65827.1| translation initiation factor [Arabidopsis thaliana]
 gb|AEE85305.1| protein translation factor SUI1-1 [Arabidopsis thaliana]
 emb|CDY14282.1| BnaA08g14130D [Brassica napus]
 emb|CDX97378.1| BnaC08g12430D [Brassica napus]
Length=113

 Score =   204 bits (520),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>gb|EYU27827.1| hypothetical protein MIMGU_mgv1a016640mg [Erythranthe guttata]
Length=113

 Score =   204 bits (520),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D Q P+ FDPFAEA AE SG GSK+YVHIR+QQRNGRKSLTTVQGLKK+FSY KIL
Sbjct  1    MSDLDTQIPSPFDPFAEAKAEDSGVGSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYTKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAGIVKK+HIKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF  113



>ref|NP_001055949.1| Os05g0498400 [Oryza sativa Japonica Group]
 ref|XP_006654596.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
 gb|AAT44286.1| putative protein translation factor Sui1 [Oryza sativa Japonica 
Group]
 dbj|BAF17863.1| Os05g0498400 [Oryza sativa Japonica Group]
 dbj|BAG91879.1| unnamed protein product [Oryza sativa Japonica Group]
Length=115

 Score =   204 bits (520),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 108/115 (94%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSG--DGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P+AFDPFAEANAE SG   G+KDYVH+R+QQRNGRKSLTTVQGLKK++SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGI KK++IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKDNIKIHGF  115



>ref|XP_010542418.1| PREDICTED: protein translation factor SUI1 homolog 1 [Tarenaya 
hassleriana]
Length=113

 Score =   204 bits (519),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D Q P  FDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSDLDSQIPTTFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>emb|CDX92777.1| BnaC07g40350D [Brassica napus]
Length=203

 Score =   207 bits (527),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  142  QPRFMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSY  321
            Q  FMSE D Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY
Sbjct  87   QQSFMSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSY  146

Query  322  NKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            +KILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  147  SKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  203



>ref|XP_010272070.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010272071.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010272072.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=112

 Score =   204 bits (518),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFAEANAE SG GSK+YVH+R+QQRNGRKSLTTVQGL K+FSY KIL
Sbjct  1    MSDLDVQIPTAFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLTKEFSYTKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDL KE CCNGTVVQDPELGQV+QLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   KDL-KELCCNGTVVQDPELGQVVQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  112



>ref|XP_006413104.1| hypothetical protein EUTSA_v10026037mg [Eutrema salsugineum]
 gb|ESQ54557.1| hypothetical protein EUTSA_v10026037mg [Eutrema salsugineum]
Length=256

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  142  QPRFMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSY  321
            Q  FMSE D Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY
Sbjct  140  QQSFMSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSY  199

Query  322  NKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            +KILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  200  SKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  256



>ref|XP_010448172.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
Length=113

 Score =   203 bits (517),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+ANAE +G G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|NP_175831.1| protein translation factor SUI1-2 [Arabidopsis thaliana]
 ref|XP_002894486.1| hypothetical protein ARALYDRAFT_474560 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006392693.1| hypothetical protein EUTSA_v10011880mg [Eutrema salsugineum]
 sp|Q94JV4.1|SUI12_ARATH RecName: Full=Protein translation factor SUI1 homolog 2 [Arabidopsis 
thaliana]
 gb|AAD25609.1|AC005287_11 translation initiation factor [Arabidopsis thaliana]
 gb|AAK49626.1|AF372910_1 At1g54290/F20D21_53 [Arabidopsis thaliana]
 gb|AAN18215.1| At1g54290/F20D21_53 [Arabidopsis thaliana]
 gb|EFH70745.1| hypothetical protein ARALYDRAFT_474560 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE33076.1| protein translation factor SUI1-2 [Arabidopsis thaliana]
 gb|ESQ29979.1| hypothetical protein EUTSA_v10011880mg [Eutrema salsugineum]
Length=113

 Score =   203 bits (516),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ ++Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_003568176.1| PREDICTED: protein translation factor SUI1 homolog [Brachypodium 
distachyon]
Length=115

 Score =   203 bits (516),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+  P+AFDPFAEANAE   +G G+KDYVH+R+QQRNGRKSLTTVQGLKK+FSYNK
Sbjct  1    MSDLDVTLPSAFDPFAEANAEDAGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGI KKE IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKELIKIHGF  115



>gb|AGT16828.1| protein translation factor SUI1 [Saccharum hybrid cultivar R570]
Length=116

 Score =   203 bits (516),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 3/116 (3%)
 Frame = +1

Query  154  MSEFDLQ-TPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYN  324
            MS+ DLQ  P+AFDPFAEANAE  S+G GSKDYVH+R QQRNGRKSLTTVQGLKK++SYN
Sbjct  1    MSDLDLQQLPSAFDPFAEANAEDSSAGAGSKDYVHVRSQQRNGRKSLTTVQGLKKEYSYN  60

Query  325  KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKK+ IKIHGF
Sbjct  61   KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKDSIKIHGF  116



>ref|NP_200287.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_001119436.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_001190540.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|XP_002864353.1| hypothetical protein ARALYDRAFT_495556 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010433396.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
 ref|XP_010438654.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
 dbj|BAB08755.1| protein translation factor Sui1 homolog [Arabidopsis thaliana]
 gb|AAO64771.1| At5g54760 [Arabidopsis thaliana]
 gb|EFH40612.1| hypothetical protein ARALYDRAFT_495556 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED96536.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96537.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96538.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
Length=113

 Score =   202 bits (515),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+AN E SG G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_006644837.1| PREDICTED: protein translation factor SUI1 homolog [Oryza brachyantha]
Length=115

 Score =   202 bits (515),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESS--GDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P+AFDPFAEANAE S  G GSKDYVH+R+QQRNGRKSLTTVQGLKK++SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSVGTGSKDYVHVRIQQRNGRKSLTTVQGLKKEYSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFL +AGI KKE IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLDKAGIAKKESIKIHGF  115



>gb|ACG24808.1| protein translation factor SUI1 [Zea mays]
Length=115

 Score =   202 bits (515),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 105/115 (91%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGD--GSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P AFDPFAEANA  SG   GSKDYVH+R+QQRNGRKSLTTVQGLKK+FSY+K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEF CNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  61   ILKDLKKEFYCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>emb|CDP20340.1| unnamed protein product [Coffea canephora]
Length=113

 Score =   202 bits (515),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D+QTP  FDPFA+A A+ SG G+K+YVH+RVQQRNGRKSLTTVQGL+K++SYNKIL
Sbjct  1    MSEHDIQTPTTFDPFADATADDSGAGAKEYVHVRVQQRNGRKSLTTVQGLRKEYSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNGTVVQDPELG+VIQLQGDQRKNVS FLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKDFCCNGTVVQDPELGKVIQLQGDQRKNVSAFLVQAGIVKKENIKIHGF  113



>ref|XP_008810164.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Phoenix 
dactylifera]
Length=180

 Score =   205 bits (521),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P +FDPFAEANAE S  G+K+YVH+R+QQRNGRK LTTVQGLKK+FS NKIL
Sbjct  1    MSDLDVQLPTSFDPFAEANAEDSDAGAKEYVHVRIQQRNGRKCLTTVQGLKKEFSCNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF*SARTIS  513
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGIVKKEHIKIHGF     +S
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIVKKEHIKIHGFGVTTYLS  120

Query  514  TSI  522
              I
Sbjct  121  NYI  123



>gb|KHG11307.1| hypothetical protein F383_12372 [Gossypium arboreum]
Length=113

 Score =   202 bits (514),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+  P AFDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDILIPTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELGQVIQLQGDQRKNVSTFLVQAGIVKK++IKIHGF
Sbjct  61   KDLKKEFCCNGIVVQDLELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF  113



>sp|Q9SQF4.1|SUI1_BRAOL RecName: Full=Protein translation factor SUI1 homolog; AltName: 
Full=Translation initiation factor nps45 [Brassica oleracea]
 gb|AAF04624.1|AF098672_1 translation initiation factor nps45 [Brassica oleracea]
Length=113

 Score =   202 bits (514),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK+ I+IHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDDIQIHGF  113



>ref|XP_009137639.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Brassica 
rapa]
Length=113

 Score =   202 bits (514),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+ANAE SG G K+YVHIRVQQRNGRKSLTTV+GLKK++SY+KIL
Sbjct  1    MSELDSQVPTAFDPFADANAEDSGAGKKEYVHIRVQQRNGRKSLTTVKGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_006304318.1| hypothetical protein CARUB_v10010698mg [Capsella rubella]
 ref|XP_010462345.1| PREDICTED: protein translation factor SUI1 homolog 2 [Camelina 
sativa]
 ref|XP_010480023.1| PREDICTED: protein translation factor SUI1 homolog 2 [Camelina 
sativa]
 gb|EOA37216.1| hypothetical protein CARUB_v10010698mg [Capsella rubella]
Length=113

 Score =   202 bits (513),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ ++Q P AFDPFA+ANAE +G G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_006284787.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
 gb|EOA17685.1| hypothetical protein CARUB_v10006056mg [Capsella rubella]
Length=113

 Score =   201 bits (510),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+AN E SG G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQA +VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQASLVKKDNIKIHGF  113



>ref|XP_006279715.1| hypothetical protein CARUB_v10027405mg [Capsella rubella]
 gb|EOA12613.1| hypothetical protein CARUB_v10027405mg [Capsella rubella]
Length=113

 Score =   201 bits (510),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+AN E S  G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY KIL
Sbjct  1    MSELDSQVPTAFDPFADANVEDSSAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_010501111.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Camelina 
sativa]
Length=113

 Score =   201 bits (510),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ ++Q P AFDPFA+ANAE  G G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY+KIL
Sbjct  1    MSDLEVQVPTAFDPFADANAEDVGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  113



>ref|XP_002960838.1| hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii]
 ref|XP_002983834.1| hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii]
 gb|EFJ14846.1| hypothetical protein SELMODRAFT_268797 [Selaginella moellendorffii]
 gb|EFJ38377.1| hypothetical protein SELMODRAFT_437304 [Selaginella moellendorffii]
Length=114

 Score =   198 bits (503),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 104/114 (91%), Gaps = 1/114 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGD-GSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            MSE D+Q P A+DPFAEANAE SG  GS +YVH+RVQQRNGRKSLTTVQGL+K+F+YNKI
Sbjct  1    MSEADIQIPGAYDPFAEANAEESGGVGSAEYVHVRVQQRNGRKSLTTVQGLRKEFNYNKI  60

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKD KKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAG+VKK+ IKIHGF
Sbjct  61   LKDFKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSQFLVQAGVVKKDLIKIHGF  114



>gb|ACN30624.1| unknown [Zea mays]
Length=110

 Score =   198 bits (503),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 101/110 (92%), Gaps = 2/110 (2%)
 Frame = +1

Query  169  LQTPAAFDPFAEANAESSGD--GSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDL  342
            +  P AFDPFAEANA  SG   GSKDYVH+R+QQRNGRKSLTTVQGLKK+FSY+KILKDL
Sbjct  1    MWIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDL  60

Query  343  KKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  61   KKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  110



>gb|EEC82174.1| hypothetical protein OsI_26284 [Oryza sativa Indica Group]
Length=843

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 108/119 (91%), Gaps = 2/119 (2%)
 Frame = +1

Query  142  QPRFMSEFDLQTPAAFDPFAEANAESSGD--GSKDYVHIRVQQRNGRKSLTTVQGLKKDF  315
            Q  FMS+ D+Q P AFDPFAEANA  SG   GSKDYVH+R+QQRNGRKSLTTVQGLKK+F
Sbjct  725  QQSFMSDLDIQIPTAFDPFAEANAGDSGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEF  784

Query  316  SYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            SYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  785  SYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  843



>ref|XP_009106912.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Brassica 
rapa]
 ref|XP_009107080.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Brassica 
rapa]
 emb|CDY08224.1| BnaA05g13950D [Brassica napus]
Length=115

 Score =   196 bits (499),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ ++Q P AFDPFA+ANAE   +G G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQAG+VKK++IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF  115



>gb|KJB39023.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39024.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39026.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
 gb|KJB39027.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
Length=111

 Score =   196 bits (498),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 105/113 (93%), Gaps = 2/113 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDL KEFCCNGTVVQDPELGQVIQLQGDQR NVSTFLVQAGIV K++IKIHGF
Sbjct  61   KDL-KEFCCNGTVVQDPELGQVIQLQGDQRNNVSTFLVQAGIV-KDNIKIHGF  111



>ref|XP_006833020.1| hypothetical protein AMTR_s00094p00033760, partial [Amborella 
trichopoda]
 gb|ERM98298.1| hypothetical protein AMTR_s00094p00033760, partial [Amborella 
trichopoda]
Length=100

 Score =   196 bits (497),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/100 (93%), Positives = 98/100 (98%), Gaps = 0/100 (0%)
 Frame = +1

Query  193  PFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCNGTV  372
            PFAEANAE SG GSK+YVH+R+QQRNGRKSLTTVQGLKK+FSY+KILKDLKKEFCCNGTV
Sbjct  1    PFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFCCNGTV  60

Query  373  VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  61   VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  100



>emb|CDY26128.1| BnaC06g10680D [Brassica napus]
 emb|CDY08222.1| BnaA05g13970D [Brassica napus]
Length=115

 Score =   195 bits (496),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ ++Q P AFDPFA+ANAE   +G G+K+YVHIRVQQRNGRKSLTTVQG+KK++SY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGIKKEYSYTK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFL+QAG+VKK++IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLIQAGLVKKDNIKIHGF  115



>ref|XP_010105571.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
 gb|EXC05100.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
Length=222

 Score =   198 bits (503),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  142  QPRFMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSY  321
            QPRFMSE D Q P AFDPFAEANAE SG GSK+YVHIR+QQRNGRKSLTTVQGLKK+FSY
Sbjct  110  QPRFMSEIDDQIPTAFDPFAEANAEDSGAGSKEYVHIRIQQRNGRKSLTTVQGLKKEFSY  169

Query  322  NKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIV  462
            NKILKDLKKEFCCNGTVVQDPE GQVIQLQGDQRKNVSTFL+QA  +
Sbjct  170  NKILKDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLIQASFL  216



>gb|KCW70138.1| hypothetical protein EUGRSUZ_F03432 [Eucalyptus grandis]
Length=180

 Score =   196 bits (499),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 102/116 (88%), Gaps = 7/116 (6%)
 Frame = +1

Query  145  PRFMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYN  324
            PRF+            PFA+ANAE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYN
Sbjct  72   PRFLLPL-------VHPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYN  124

Query  325  KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  125  KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  180



>ref|XP_002985789.1| hypothetical protein SELMODRAFT_234882 [Selaginella moellendorffii]
 gb|EFJ12966.1| hypothetical protein SELMODRAFT_234882 [Selaginella moellendorffii]
Length=113

 Score =   194 bits (493),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+FD+Q P AFDPFAEAN +  G GSK+YVH+R+QQRNGRKSLTTVQGLKK+F+YN+IL
Sbjct  1    MSDFDIQIPGAFDPFAEANVDDQGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFNYNRIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KD K+EFCCNGTVV D ELGQVIQLQGDQRKNVS FLVQAG+ KK+ IKIHGF
Sbjct  61   KDFKREFCCNGTVVDDTELGQVIQLQGDQRKNVSQFLVQAGVAKKDQIKIHGF  113



>ref|XP_006827315.1| hypothetical protein AMTR_s00010p00266770 [Amborella trichopoda]
 gb|ERM94552.1| hypothetical protein AMTR_s00010p00266770 [Amborella trichopoda]
Length=177

 Score =   195 bits (496),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  151  FMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            FMS+ D+Q P  FDPFA+A  E SG G+KDYVH+RVQQRNGRK LTTVQG+KK+F+YNKI
Sbjct  64   FMSDLDIQVPGVFDPFADALGEDSGAGTKDYVHVRVQQRNGRKCLTTVQGVKKEFNYNKI  123

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKD KKEFCCNGTVVQD ELGQVIQLQGDQRKNVS FLVQAGIVKK++IKIHGF
Sbjct  124  LKDFKKEFCCNGTVVQDKELGQVIQLQGDQRKNVSNFLVQAGIVKKDNIKIHGF  177



>gb|ADJ67213.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   192 bits (489),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/100 (92%), Positives = 98/100 (98%), Gaps = 0/100 (0%)
 Frame = +1

Query  193  PFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCNGTV  372
            PFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKILKDLKKEFCCNGTV
Sbjct  1    PFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTV  60

Query  373  VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  61   VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  100



>gb|ACS68685.1| putative translation factor [Sonneratia alba]
 gb|ACS68756.1| putative translation factor, partial [Sonneratia alba]
Length=102

 Score =   192 bits (489),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +1

Query  172  QTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKE  351
            Q P AFDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSY+KILKDLKKE
Sbjct  2    QVPTAFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKE  61

Query  352  FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEH  474
            FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEH
Sbjct  62   FCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEH  102



>gb|EMS63057.1| Protein translation factor SUI1-like protein [Triticum urartu]
Length=119

 Score =   193 bits (490),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 100/113 (88%), Gaps = 2/113 (2%)
 Frame = +1

Query  160  EFDLQTPAAFDPFAEANAESSGDG--SKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            E  L  P   DPFAEANAE SG G  SK+YVH+RVQQRNGRKSLTTVQGLKKD+SYNKIL
Sbjct  7    ELLLTFPRGTDPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNKIL  66

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAG+ KKE IKIHGF
Sbjct  67   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  119



>gb|KEH38844.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=116

 Score =   192 bits (489),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 98/103 (95%), Gaps = 1/103 (1%)
 Frame = +1

Query  187  FDPFAEANAESSGDGS-KDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCN  363
             DPFAEANAE +G GS K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKILKDLKKEFCCN
Sbjct  14   LDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCN  73

Query  364  GTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            GTVVQDPE GQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF
Sbjct  74   GTVVQDPEQGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  116



>ref|XP_009398183.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Musa 
acuminata subsp. malaccensis]
Length=113

 Score =   192 bits (488),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D Q P AFDPFA+ANA+ S  G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDAQIPTAFDPFADANADDSDAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKE+IKIHGF
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKENIKIHGF  113



>emb|CDY10602.1| BnaC03g70120D [Brassica napus]
 emb|CDY02466.1| BnaA08g00730D [Brassica napus]
Length=116

 Score =   192 bits (488),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 3/116 (3%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ ++Q P AFDPFA+ANAE   +G G+K+YVHIRVQQRNGRKSLTTVQGLKK++SY K
Sbjct  1    MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLV-QAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLV QAG+VKK++IKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQQAGLVKKDNIKIHGF  116



>ref|XP_008647990.1| PREDICTED: LOC100286322 isoform X2 [Zea mays]
Length=120

 Score =   191 bits (486),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 100/111 (90%), Gaps = 2/111 (2%)
 Frame = +1

Query  166  DLQTPAAFDPFAEANAESSG--DGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKD  339
            D    +  DPFAEANAE SG   G+KDYVH+R+QQRNGRKSLTTVQGLKK+FSYNKILKD
Sbjct  10   DGMASSLIDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKD  69

Query  340  LKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGI KKE+IKIHGF
Sbjct  70   LKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKENIKIHGF  120



>ref|XP_001756581.1| predicted protein [Physcomitrella patens]
 ref|XP_001781716.1| predicted protein [Physcomitrella patens]
 gb|EDQ53445.1| predicted protein [Physcomitrella patens]
 gb|EDQ78535.1| predicted protein [Physcomitrella patens]
Length=116

 Score =   191 bits (486),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 100/111 (90%), Gaps = 2/111 (2%)
 Frame = +1

Query  166  DLQTPAAFDPFAEANAESSGDGSKD--YVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKD  339
            D + PA+FDPFAEAN E SG GSK   YVH+RVQQRNGRKSLTTVQGLKK+F+YNKILKD
Sbjct  6    DTEIPASFDPFAEANVEDSGVGSKGSGYVHVRVQQRNGRKSLTTVQGLKKEFNYNKILKD  65

Query  340  LKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKKEFCCNG VVQDPELGQVIQLQGDQRKNVS FLVQAGIVKK+ IKIHGF
Sbjct  66   LKKEFCCNGVVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKDLIKIHGF  116



>ref|XP_002976303.1| hypothetical protein SELMODRAFT_232756 [Selaginella moellendorffii]
 gb|EFJ22563.1| hypothetical protein SELMODRAFT_232756 [Selaginella moellendorffii]
Length=114

 Score =   190 bits (483),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAF-DPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            MS+FD+Q P AF DPFAEAN +  G GSK+YVH+R+QQRNGRKSLTTVQGLKK+F+YNKI
Sbjct  1    MSDFDIQIPGAFADPFAEANVDDQGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFNYNKI  60

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKD K+EFCCNGTVV D ELGQVIQLQGDQRKNVS FLVQAG+ KK+ IKIHGF
Sbjct  61   LKDFKREFCCNGTVVDDTELGQVIQLQGDQRKNVSQFLVQAGVAKKDQIKIHGF  114



>gb|ADJ67174.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   190 bits (482),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +1

Query  193  PFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCNGTV  372
            PFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKILKDLKKEFCCNGTV
Sbjct  1    PFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTV  60

Query  373  VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            VQDPELGQVIQLQGDQRK VSTFLVQAGIVKKE IKIHGF
Sbjct  61   VQDPELGQVIQLQGDQRKKVSTFLVQAGIVKKEKIKIHGF  100



>gb|ADU56181.1| hypothetical protein [Jatropha curcas]
Length=100

 Score =   189 bits (481),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +1

Query  196  FAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCNGTVV  375
            FA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKILKDLKKEFCCNGTVV
Sbjct  2    FADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVV  61

Query  376  QDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            QDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIHGF
Sbjct  62   QDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIHGF  100



>ref|XP_006475204.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Citrus sinensis]
Length=115

 Score =   190 bits (482),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+FD+Q PAAFDPFA+A AE SG GSK+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDFDIQVPAAFDPFADAKAEDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA  453
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQ 
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQV  100



>gb|EMT21575.1| Protein translation factor SUI1-like protein [Aegilops tauschii]
Length=124

 Score =   190 bits (482),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 103/118 (87%), Gaps = 4/118 (3%)
 Frame = +1

Query  145  PRFMSEFDLQTPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFS  318
            PR +S   +  P   DPFAEANAE   +G G+KDYVH+R+QQRNGRKSLTTVQGLKK+FS
Sbjct  9    PRRVSSLFICPPG--DPFAEANAEDAGAGPGAKDYVHVRIQQRNGRKSLTTVQGLKKEFS  66

Query  319  YNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            YNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQAGI KKE IKIHGF
Sbjct  67   YNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQAGIAKKELIKIHGF  124



>gb|EMT13356.1| Protein translation factor SUI1-like protein [Aegilops tauschii]
Length=120

 Score =   189 bits (480),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 97/103 (94%), Gaps = 2/103 (2%)
 Frame = +1

Query  190  DPFAEANAESSGDG--SKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCN  363
            DPFAEANAE SG G  SK+YVH+RVQQRNGRKSLTTVQGLKKD+SYNKILKDLKKEFCCN
Sbjct  18   DPFAEANAEDSGAGAGSKNYVHVRVQQRNGRKSLTTVQGLKKDYSYNKILKDLKKEFCCN  77

Query  364  GTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            GTVVQDPELGQVIQLQGDQRKNV+TFLVQAG+ KKE IKIHGF
Sbjct  78   GTVVQDPELGQVIQLQGDQRKNVATFLVQAGLAKKESIKIHGF  120



>ref|XP_002280065.1| PREDICTED: protein translation factor SUI1 homolog [Vitis vinifera]
 emb|CBI26638.3| unnamed protein product [Vitis vinifera]
Length=112

 Score =   189 bits (479),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E DLQ P+AFDPFAEA  +S   G+K+YVHIR+QQRNG+KSLTTVQGLKKD+SY KIL
Sbjct  1    MVELDLQIPSAFDPFAEAK-DSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLVQAG+VKKE IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSNFLVQAGLVKKEQIKIHGF  112



>ref|XP_004144491.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
3 [Cucumis sativus]
Length=105

 Score =   188 bits (478),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSEF++Q P+AFDPFA+ANAE SG G+K+YVH+R+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSEFNVQIPSAFDPFADANAEDSGAGAKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGI  459
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQ  +
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVMV  102



>ref|XP_008351221.1| PREDICTED: protein translation factor SUI1 homolog 2-like, partial 
[Malus domestica]
Length=124

 Score =   189 bits (479),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +1

Query  190  DPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCNGT  369
            DPFAEA AE SG G+K+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKILKDLKKEFCCNGT
Sbjct  7    DPFAEATAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGT  66

Query  370  VVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIH  486
            VVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKK++IKIH
Sbjct  67   VVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIH  105



>ref|XP_003562997.1| PREDICTED: protein translation factor SUI1 homolog [Brachypodium 
distachyon]
Length=115

 Score =   188 bits (478),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 105/115 (91%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDG--SKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P AFDPFAEANA  +G    SKDYVH+R+QQRNGRKSLTTVQGLKK+FSY+K
Sbjct  1    MSDLDIQIPTAFDPFAEANAGEAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|XP_009624686.1| PREDICTED: protein translation factor SUI1 homolog isoform X2 
[Nicotiana tomentosiformis]
Length=102

 Score =   186 bits (473),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ DL  P AFDPFAEANA++SG G+KDYVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDLLVPNAFDPFAEANADNSGAGTKDYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGI  459
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQ  I
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQELI  102



>ref|XP_010109526.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
 gb|EXC23130.1| Protein translation factor SUI1-1-like protein [Morus notabilis]
Length=149

 Score =   187 bits (475),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P+AFDPFA+A+A+ S  G K+YVH+RVQQRNGRKSLTTVQGLKK +SY+KIL
Sbjct  1    MSELDQQLPSAFDPFADASADDSSAGGKEYVHVRVQQRNGRKSLTTVQGLKKQYSYSKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIH  486
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKE+IKIH
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKENIKIH  111



>ref|XP_006372949.1| hypothetical protein POPTR_0017s06480g, partial [Populus trichocarpa]
 gb|ERP50746.1| hypothetical protein POPTR_0017s06480g, partial [Populus trichocarpa]
Length=100

 Score =   185 bits (470),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +1

Query  193  PFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCNGTV  372
            PFAEANA+ SG G+KDYVH+RVQQRNGRKSLTTVQGLKK++SY+KI KDLKKEFCCNGTV
Sbjct  1    PFAEANADDSGAGAKDYVHVRVQQRNGRKSLTTVQGLKKEYSYSKIQKDLKKEFCCNGTV  60

Query  373  VQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            VQDPELGQVIQLQGDQRKNVSTFL+Q+GI KKE+IKIHGF
Sbjct  61   VQDPELGQVIQLQGDQRKNVSTFLIQSGIAKKENIKIHGF  100



>ref|XP_011097879.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=112

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E DLQ P+AFDPFAEA  +S   G+K+YVHIR+QQRNG+KSLTTVQGL+K+FSY KIL
Sbjct  1    MVEVDLQIPSAFDPFAEAK-DSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELG+VIQLQGDQRKNVS FL+ AGIVKK+ IKIHGF
Sbjct  60   KDLKKEFCCNGTVVQDKELGKVIQLQGDQRKNVSQFLISAGIVKKDQIKIHGF  112



>gb|EMS51805.1| Protein translation factor SUI1-like protein [Triticum urartu]
Length=163

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 105/116 (91%), Gaps = 2/116 (2%)
 Frame = +1

Query  151  FMSEFDLQTPAAFDPFAEANAESSGDG--SKDYVHIRVQQRNGRKSLTTVQGLKKDFSYN  324
            FMS+ D+Q P AFDPFAEANA  +G    SKDYVH+R+QQRNGRKSLTTVQGLKK+FSY+
Sbjct  48   FMSDLDVQIPTAFDPFAEANAGDAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYS  107

Query  325  KILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  108  KILKDLKKEFCCNGTVVQDTELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  163



>gb|AAM34279.1|AF508969_1 translation initiation factor [Triticum aestivum]
Length=115

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 104/115 (90%), Gaps = 2/115 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDG--SKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P AFDPFAEANA  +G    SKDYVH+R+QQRNGRKSLTTVQGLKK+FSY+K
Sbjct  1    MSDLDVQIPTAFDPFAEANAGDAGAAAGSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            ILKDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  61   ILKDLKKEFCCNGTVVQDTELGQVIQLQGDQRKNVSNFLVQAGIVKKEHIKIHGF  115



>ref|XP_006591819.1| PREDICTED: uncharacterized protein LOC100306129 isoform X1 [Glycine 
max]
Length=114

 Score =   185 bits (469),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P AFDPFA+ANA+ SG GSK+YVHIRVQQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDDQIPTAFDPFADANADDSGAGSKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGI  459
            KD+KKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQ  I
Sbjct  61   KDVKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQVTI  102



>ref|XP_006586085.1| PREDICTED: protein translation factor SUI1 homolog 2 [Glycine 
max]
 gb|KHM99561.1| Protein translation factor SUI1 like 2 [Glycine soja]
Length=157

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 109/131 (83%), Gaps = 8/131 (6%)
 Frame = +1

Query  121  SVRSFNC-------QPRFMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRK  279
            S RS+ C       Q ++M + ++Q P+AFDPFAEA  ES   G+K+YVHIR+QQRNG+K
Sbjct  28   SCRSYPCYLFPSLQQAKYMVDLEIQVPSAFDPFAEAR-ESDAPGAKEYVHIRIQQRNGKK  86

Query  280  SLTTVQGLKKDFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGI  459
            SLTTVQGLKK+FSY KILKDLKK+FCCNGTVVQD ELG++IQLQGDQRKNVS FLVQAG+
Sbjct  87   SLTTVQGLKKEFSYEKILKDLKKDFCCNGTVVQDKELGKIIQLQGDQRKNVSHFLVQAGL  146

Query  460  VKKEHIKIHGF  492
            V+K+ +KIHGF
Sbjct  147  VRKDQVKIHGF  157



>ref|XP_007021023.1| Translation initiation factor SUI1 family protein, putative [Theobroma 
cacao]
 gb|EOY12548.1| Translation initiation factor SUI1 family protein, putative [Theobroma 
cacao]
Length=163

 Score =   185 bits (470),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P  FDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQIPTTFDPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA  453
            KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQ 
Sbjct  61   KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQG  100



>ref|XP_004487599.1| PREDICTED: protein translation factor SUI1 homolog 1-like isoform 
X1 [Cicer arietinum]
Length=125

 Score =   184 bits (466),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MSE D Q P  FDPFAEANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSELDAQIPTTFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAG  456
            KDLKKEFCCNGTVVQDPE GQVIQLQGDQRKNVSTFL+Q  
Sbjct  61   KDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLIQVA  101



>ref|XP_004961617.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Setaria italica]
Length=120

 Score =   182 bits (463),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 2/102 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSG--DGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P+AFDPFAEANAE SG   G+KDYVH+R+QQRNGRKSLTTVQGLKK+FSYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA  453
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQ 
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQV  102



>ref|XP_006370638.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
 gb|ABK95287.1| unknown [Populus trichocarpa]
 gb|ERP67207.1| hypothetical protein POPTR_0001s44450g [Populus trichocarpa]
Length=125

 Score =   182 bits (463),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+QTP AFDPFA+ANAE SG G+K+YVHIR QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDVQTPTAFDPFADANAEDSGAGAKEYVHIRTQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA  453
            KDLKKEFCCNGTVVQD ELGQVIQLQGDQRKNVSTFLVQ 
Sbjct  61   KDLKKEFCCNGTVVQDLELGQVIQLQGDQRKNVSTFLVQV  100



>gb|AFW78550.1| hypothetical protein ZEAMMB73_586492 [Zea mays]
Length=118

 Score =   182 bits (461),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 95/102 (93%), Gaps = 2/102 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSG--DGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P+AFDPFAEANAE SG   G+KDYVH+R+QQRNGRKSLTTVQGLKK+FSYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSGAGPGTKDYVHVRIQQRNGRKSLTTVQGLKKEFSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA  453
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFLVQ 
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLVQV  102



>ref|XP_004970237.1| PREDICTED: protein translation factor SUI1 homolog isoform X1 
[Setaria italica]
Length=118

 Score =   182 bits (461),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 96/105 (91%), Gaps = 2/105 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAE--SSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNK  327
            MS+ D+Q P+AFDPFAEANAE  S+G GSK+YVH+RVQQRNGRKSLTTVQGLKK++SYNK
Sbjct  1    MSDLDVQLPSAFDPFAEANAEDSSAGAGSKEYVHVRVQQRNGRKSLTTVQGLKKEYSYNK  60

Query  328  ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIV  462
            ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNV+TFL Q   +
Sbjct  61   ILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVATFLTQVSSI  105



>ref|XP_006602202.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X1 [Glycine max]
 ref|XP_006602203.1| PREDICTED: protein translation factor SUI1 homolog 2-like isoform 
X2 [Glycine max]
Length=112

 Score =   181 bits (459),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + ++Q P  FDPFAEA  ES   G+K+YVHIR+QQRNG+KSLTTVQGLKK+FSY KIL
Sbjct  1    MVDLEIQVPTPFDPFAEAR-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVVQD ELG++IQLQGDQRKNVS FLVQAG+V+K+ IKIHGF
Sbjct  60   KDLKKEFCCNGTVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>gb|KEH38845.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=115

 Score =   181 bits (459),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 97/114 (85%), Gaps = 3/114 (3%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGS-KDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            MSE D Q P A+DPFAEANAE +G GS K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKI
Sbjct  1    MSELDAQIPTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA--GIVKKEHIKIH  486
            LKDLKKEFCCNGTVVQDPE GQVIQLQGDQRKNVSTFLVQ     V K  I +H
Sbjct  61   LKDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLVQMIFNSVNKVLIPLH  114



>gb|KEH38847.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
Length=110

 Score =   181 bits (458),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 92/101 (91%), Gaps = 1/101 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGS-KDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            MSE D Q P A+DPFAEANAE +G GS K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKI
Sbjct  1    MSELDAQIPTAYDPFAEANAEDAGAGSSKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKI  60

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQA  453
            LKDLKKEFCCNGTVVQDPE GQVIQLQGDQRKNVSTFLVQ 
Sbjct  61   LKDLKKEFCCNGTVVQDPEQGQVIQLQGDQRKNVSTFLVQV  101



>gb|KJB39025.1| hypothetical protein B456_007G314400 [Gossypium raimondii]
Length=111

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 94/103 (91%), Gaps = 1/103 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P AFDPFA+ANAE SG G+K+YVHIR+QQRNGRKSLTTVQGLKK+FSYNKIL
Sbjct  1    MSDLDIQIPTAFDPFADANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIV  462
            KDL KEFCCNGTVVQDPELGQVIQLQGDQR NVSTFLVQ  ++
Sbjct  61   KDL-KEFCCNGTVVQDPELGQVIQLQGDQRNNVSTFLVQVIVI  102



>ref|XP_011095399.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
 ref|XP_011095400.1| PREDICTED: protein translation factor SUI1 homolog [Sesamum indicum]
Length=112

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + DLQ P AFDPFAEA  +S   G+K+YVHIR+QQRNG+KSLTTVQGL+K+FSY KIL
Sbjct  1    MVDLDLQIPTAFDPFAEAK-DSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KD+KKEFCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AGIVKK+ IKIHGF
Sbjct  60   KDVKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLISAGIVKKDQIKIHGF  112



>ref|XP_003600096.1| Translation factor SUI1-like protein [Medicago truncatula]
 gb|AES70347.1| eukaryotic translation initiation factor SUI1 [Medicago truncatula]
 gb|AFK42757.1| unknown [Medicago truncatula]
Length=112

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P AFDPFA+A  ES   G K+YVHIR+QQRNG+KSLTTVQGLKKD+SY KIL
Sbjct  1    MVELDIQIPTAFDPFADA-IESDAPGGKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRK VS FLVQAG+V+K+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQAGLVRKDQIKIHGF  112



>ref|XP_004244116.1| PREDICTED: protein translation factor SUI1 homolog [Solanum lycopersicum]
Length=112

 Score =   179 bits (455),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + D+Q P+AFDPFAEA  +S   G+K+YVHIR+QQRNG+KSLTTVQGL+K+FSY KIL
Sbjct  1    MVDIDIQIPSAFDPFAEAK-DSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKKDQIKIHGF  112



>ref|XP_010448878.1| PREDICTED: protein translation factor SUI1 homolog [Camelina 
sativa]
 ref|XP_010443083.1| PREDICTED: protein translation factor SUI1 homolog [Camelina 
sativa]
Length=112

 Score =   179 bits (455),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P+A+DPFAEA  +S   G+KDY+HIR+QQRNG+KSLTTVQGLKK++SY +IL
Sbjct  1    MVELDIQVPSAYDPFAEAK-DSDAPGAKDYIHIRIQQRNGKKSLTTVQGLKKEYSYERIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD ELG++IQLQGDQRK VS FLVQ GI KK+HIKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDHIKIHGF  112



>ref|XP_004500068.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cicer 
arietinum]
Length=112

 Score =   179 bits (455),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E ++Q P  FDPFAEA  ES   G+K+YVHIR+QQRNG+KSLTTVQGLKK+FSY KIL
Sbjct  1    MVELEIQVPTPFDPFAEAK-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRKNVS FLVQ G+V+K+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQVGLVRKDQIKIHGF  112



>ref|XP_006346213.1| PREDICTED: protein translation factor SUI1 homolog [Solanum tuberosum]
Length=112

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + D+Q P+AFDPFAEA  +S   G+K+YVHIR+QQRNG+KSLTTVQGL+K+FSY KIL
Sbjct  1    MVDIDVQIPSAFDPFAEAK-DSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKEFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKKDQIKIHGF  112



>gb|AFY13590.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13591.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13592.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13593.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13594.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13595.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13596.1| translation factor SUI1 [Aeschynomene denticulata]
 gb|AGC95066.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGC95067.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGC95068.1| translation factor SUI1 [Aeschynomene ciliata]
 gb|AGS78101.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78102.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78103.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78104.1| translation factor SUI1 [Aeschynomene indica]
 gb|AGS78106.1| translation factor SUI1 [Aeschynomene scabra]
 gb|AGS78107.1| translation factor SUI1 [Aeschynomene rudis]
 gb|AGS78108.1| translation factor SUI1 [Aeschynomene sensitiva]
 gb|AGS78109.1| translation factor SUI1 [Aeschynomene sp. CPI104040]
 gb|AGS78111.1| translation factor SUI1 [Aeschynomene tambacoundensis]
 gb|AGS78112.1| translation factor SUI1 [Aeschynomene deamii]
 gb|AGS78114.1| translation factor SUI1 [Aeschynomene pratensis]
 gb|AGS78115.1| translation factor SUI1 [Aeschynomene virginica]
 gb|AGS78116.1| translation factor SUI1 [Aeschynomene virginica]
Length=112

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + ++Q P  FDPFAEA  ES   G+K+YVHIR+QQRNG+KSLTTVQGLKKDFSY KIL
Sbjct  1    MVDLEIQFPTPFDPFAEAK-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRKNVS FLVQAG+V+K+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>ref|XP_007212250.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 ref|XP_007212251.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 ref|XP_008226898.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 ref|XP_008226900.1| PREDICTED: protein translation factor SUI1 homolog [Prunus mume]
 gb|EMJ13449.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
 gb|EMJ13450.1| hypothetical protein PRUPE_ppa013625mg [Prunus persica]
Length=112

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P AFDPFAEA  ++   G+K+YVHIRVQQRNG+K LTTVQGLKKDFSY KIL
Sbjct  1    MVELDVQIPTAFDPFAEAK-DADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRKNV  FLVQA IVKKE IK+HGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKEQIKMHGF  112



>ref|XP_010675717.1| PREDICTED: protein translation factor SUI1 homolog [Beta vulgaris 
subsp. vulgaris]
Length=111

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + D Q PAA DPFAEA  ES   G K+YVHIR+QQRNG+KSLTTVQGLKKD+SY KIL
Sbjct  1    MVDIDFQIPAALDPFAEA--ESGAPGVKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKIL  58

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRK V+ FLVQAG+VKK+ IKIHGF
Sbjct  59   KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKKVANFLVQAGLVKKDQIKIHGF  111



>ref|XP_007146479.1| hypothetical protein PHAVU_006G043900g [Phaseolus vulgaris]
 gb|ESW18473.1| hypothetical protein PHAVU_006G043900g [Phaseolus vulgaris]
Length=112

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E ++Q P  FDPFAEA  ES   G+K+YVHIR+QQRNG+KSLTTVQGLKK+FSY KIL
Sbjct  1    MVELEIQVPTPFDPFAEAR-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKEFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD ELG++IQLQGDQRKNVS FLVQAG+V+K+ IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>emb|CDY52575.1| BnaC03g71830D, partial [Brassica napus]
Length=158

 Score =   181 bits (458),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 98/117 (84%), Gaps = 1/117 (1%)
 Frame = +1

Query  142  QPRFMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSY  321
            Q  +M E D+Q P+AFDPFAEA  ES   G+K+Y+H+R+QQRNG+KSLTTVQGLKK +SY
Sbjct  43   QVYYMVELDIQVPSAFDPFAEAQ-ESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSY  101

Query  322  NKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
             KILKDLKK+FCCNG VVQD ELG++IQLQGDQRK VS FLVQ GI KKE IKIHGF
Sbjct  102  EKILKDLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSHFLVQTGIAKKEQIKIHGF  158



>ref|XP_004139787.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis 
sativus]
 ref|XP_008447738.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Cucumis 
melo]
 gb|KGN44162.1| hypothetical protein Csa_7G209580 [Cucumis sativus]
Length=112

 Score =   179 bits (454),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D Q P+AFDPFA+A  +S   G+K+YVHIRVQQRNG+K LTTVQGLKK+FSY KIL
Sbjct  1    MVELDFQIPSAFDPFADAK-DSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KD+KKEFCCNG VVQD ELG++IQLQGDQRKNVS FLVQAG+VKK+ IKIHGF
Sbjct  60   KDVKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIHGF  112



>ref|XP_009628718.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
tomentosiformis]
 ref|XP_009778004.1| PREDICTED: protein translation factor SUI1 homolog [Nicotiana 
sylvestris]
Length=112

 Score =   179 bits (453),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + D+Q P+AFDPFAEA  +S   G+K+YVHIR+QQRNG+KSLTTVQGL+K FSY KIL
Sbjct  1    MVDIDVQIPSAFDPFAEAK-DSGAPGAKEYVHIRIQQRNGKKSLTTVQGLRKQFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKNVS FLV AG+VKK+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNVSHFLVTAGVVKKDQIKIHGF  112



>ref|XP_001752498.1| predicted protein [Physcomitrella patens]
 gb|EDQ82737.1| predicted protein, partial [Physcomitrella patens]
Length=103

 Score =   178 bits (451),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 94/103 (91%), Gaps = 2/103 (2%)
 Frame = +1

Query  190  DPFAEANAESSGDGSKD--YVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCN  363
            DPFAEA+ E SG GSK   YVH+RVQQRNGRKSLTTVQGLKK+F+YNKILKDLKKEFCCN
Sbjct  1    DPFAEADVEDSGVGSKGSGYVHVRVQQRNGRKSLTTVQGLKKEFNYNKILKDLKKEFCCN  60

Query  364  GTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            G VVQDPELGQVIQLQGDQRKNVS FLVQAGIVKK+ IKIHGF
Sbjct  61   GVVVQDPELGQVIQLQGDQRKNVSNFLVQAGIVKKDLIKIHGF  103



>ref|XP_004152930.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis 
sativus]
 ref|XP_004168731.1| PREDICTED: protein translation factor SUI1 homolog 2-like [Cucumis 
sativus]
 ref|XP_008463414.1| PREDICTED: protein translation factor SUI1 homolog 2 [Cucumis 
melo]
 gb|KGN56126.1| hypothetical protein Csa_3G077610 [Cucumis sativus]
Length=112

 Score =   178 bits (452),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + D+Q P+AFDPFA+A  +S   G+K+YVHIRVQQRNG+K LTTVQGLKK+FSY+KIL
Sbjct  1    MVDLDVQIPSAFDPFADAK-DSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYDKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD ELG++IQLQGDQRKNVS FLVQAG+VKK+ IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIHGF  112



>gb|AAM77753.1|AF521961_1 translation initiation factor B04 [Helianthus annuus]
Length=114

 Score =   178 bits (452),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGD-GSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            M + ++Q P+AFDPFA+   +S G  G K+YVHIR+QQRNGRKSLTTVQGLKK+ SY+KI
Sbjct  1    MVDIEVQIPSAFDPFADVEQDSGGGAGVKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKI  60

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKDLKKEFCCNGTVVQD ELG+VIQLQGDQRKNVS FL +AGIVKK+ IKIHGF
Sbjct  61   LKDLKKEFCCNGTVVQDKELGKVIQLQGDQRKNVSAFLSRAGIVKKDQIKIHGF  114



>gb|ACJ85979.1| unknown [Medicago truncatula]
Length=112

 Score =   178 bits (452),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P AFDPFA+A  ES   G K+YVHIR+QQRNG+K LTTVQGLKKD+SY KIL
Sbjct  1    MVELDIQIPTAFDPFADA-IESDAPGGKEYVHIRIQQRNGKKGLTTVQGLKKDYSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRK VS FLVQAG+V+K+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQAGLVRKDQIKIHGF  112



>gb|ABY75807.1| SUI1 B protein [Opuntia streptacantha]
Length=112

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M ++++Q PAAFDPF+ A  +S   G+K+YV IR+QQRNG+KSLTTVQGL+KDFSY +IL
Sbjct  1    MVDYEVQIPAAFDPFSGAK-DSGAPGAKEYVRIRIQQRNGKKSLTTVQGLRKDFSYERIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRKNV+ FLVQAG+VKK+HIKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVANFLVQAGLVKKDHIKIHGF  112



>emb|CDY43020.1| BnaA03g11670D [Brassica napus]
Length=112

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P+AFDPFAEA  ES   G+K+Y+H+R+QQRNG+KSLTTVQGLKK +SY KIL
Sbjct  1    MVELDIQVPSAFDPFAEAQ-ESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD ELG++IQLQGDQRK VS FLVQ GI KKE IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSHFLVQTGIAKKEQIKIHGF  112



>gb|AFY13584.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13585.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13586.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13587.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13588.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AFY13589.1| translation factor SUI1 [Aeschynomene evenia]
 gb|AGS78113.1| translation factor SUI1 [Aeschynomene pratensis]
Length=112

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + ++Q P  FDPFAEA  ES   G+K+YVHIR+QQRNG+KSLTTVQGLKKDFSY KIL
Sbjct  1    MVDLEIQFPTPFDPFAEAK-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD ELG++IQLQGDQRKNVS FLVQAG+V+K+ IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>gb|ABK24036.1| unknown [Picea sitchensis]
Length=112

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            MS+ D+Q P  FDPF ++ A+ +G G+KDYVH+R+QQRNGRK LTT+QGL+KD++YNKIL
Sbjct  1    MSDQDIQIPT-FDPFKDSEADDAGPGTKDYVHVRIQQRNGRKCLTTIQGLRKDYNYNKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KD KKEFCCNGTVVQD ELGQ+IQLQGDQRKNVS FL+ AG+VKK+ IKIHGF
Sbjct  60   KDFKKEFCCNGTVVQDLELGQIIQLQGDQRKNVSQFLINAGLVKKDKIKIHGF  112



>dbj|BAN10326.1| translation initiation factor SUI1 family protein, partial [Buxus 
microphylla var. japonica]
Length=91

 Score =   177 bits (448),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +1

Query  181  AAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCC  360
            +AFDPFA+ANAE SG GSK+YVH+RVQQRNGRKSLTTVQGLKK+FSYNKILKDLKKEFCC
Sbjct  1    SAFDPFADANAEDSGAGSKEYVHVRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCC  60

Query  361  NGTVVQDPELGQVIQLQGDQRKNVSTFLVQA  453
            NGTVVQDPELGQVIQLQGDQRKNVSTFLVQA
Sbjct  61   NGTVVQDPELGQVIQLQGDQRKNVSTFLVQA  91



>gb|AGS78110.1| translation factor SUI1 [Aeschynomene filosa]
Length=112

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + ++Q P  FDPFAEA  ES   G+K+YVHIR+QQRNG+KSLTTVQGLKKDFSY KIL
Sbjct  1    MVDLEIQFPTPFDPFAEAK-ESDAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VV D ELG++IQLQGDQRKNVS FLVQAG+V+K+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVHDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>gb|AGS78105.1| translation factor SUI1 [Aeschynomene indica]
Length=112

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + ++Q P+ FDPFAEA  ES   G+K+YVHIRVQQRNG+KSLTTVQGLKK FSY KIL
Sbjct  1    MVDLEIQFPSPFDPFAEAK-ESDAPGAKEYVHIRVQQRNGKKSLTTVQGLKKGFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRKNVS FLVQAG+V+K+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSHFLVQAGLVRKDQIKIHGF  112



>ref|XP_010276095.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   177 bits (449),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 98/114 (86%), Gaps = 2/114 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P+AFDPF EA  +S   G+K+YVHIR+QQRNG+KSLTTVQGLKK FSY KIL
Sbjct  1    MVELDIQIPSAFDPFFEAK-DSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKTFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPEL-GQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNGTVV D EL G+VIQLQGDQRKNVS FLV+AGIVKKE IKIHGF
Sbjct  60   KDLKKEFCCNGTVVPDEELGGKVIQLQGDQRKNVSNFLVKAGIVKKEQIKIHGF  113



>ref|XP_009338696.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
 ref|XP_009338697.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=112

 Score =   177 bits (449),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P AFDPF+EA  ++   G+KDYVHIRVQQRNG+K LTTVQGLKKDF Y+KIL
Sbjct  1    MVELDVQIPTAFDPFSEAK-DADAPGAKDYVHIRVQQRNGKKCLTTVQGLKKDFIYDKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRKNV  FLVQA IVKK+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDRIKIHGF  112



>ref|XP_010278682.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010278683.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
 ref|XP_010278684.1| PREDICTED: protein translation factor SUI1 homolog [Nelumbo nucifera]
Length=113

 Score =   177 bits (449),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 99/114 (87%), Gaps = 2/114 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P+AFDPFAEA  +S   G K+YVHIR+QQRNG+K LTTVQGLKK+FSY KIL
Sbjct  1    MVELDVQIPSAFDPFAEAK-DSGVPGVKEYVHIRIQQRNGKKCLTTVQGLKKEFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPEL-GQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            K+LKKEFCCNGT+V D EL G+VIQLQGDQRKNVS FLV+AGIVKKEHIKIHGF
Sbjct  60   KNLKKEFCCNGTIVPDEELGGKVIQLQGDQRKNVSNFLVKAGIVKKEHIKIHGF  113



>ref|XP_008359266.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=112

 Score =   177 bits (448),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P AFDPF+EA  ++   G+K+YVHIRVQQRNG+K LTTVQGLKKDFSY KIL
Sbjct  1    MVELDVQIPTAFDPFSEAK-DADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYXKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRKNV  FLVQA IVKK+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDQIKIHGF  112



>ref|XP_009360995.1| PREDICTED: protein translation factor SUI1 homolog [Pyrus x bretschneideri]
Length=112

 Score =   176 bits (447),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P AFDPFAEA  +    G+K+YVHIRVQQRNG+K LTTVQGLKKDFSY+KIL
Sbjct  1    MVERDVQIPTAFDPFAEAK-DVDAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYDKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRKNV  FLVQA IVKK+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDQIKIHGF  112



>sp|O82569.1|SUI1_PIMBR RecName: Full=Protein translation factor SUI1 homolog [Spuriopimpinella 
brachycarpa]
 gb|AAC61599.1| protein translation factor SUI1 homolog [Spuriopimpinella brachycarpa]
Length=113

 Score =   176 bits (447),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + D+Q P +FDPFAEA    +   +K+YVHIR+QQRNGRKSLTTVQGLKK+ SY+KIL
Sbjct  1    MVDSDIQIPTSFDPFAEAEITDATGSTKEYVHIRIQQRNGRKSLTTVQGLKKELSYDKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK  CCNGTVV D ELG+VIQLQGDQRKNVSTF+VQAGIVKK+ IK+H F
Sbjct  61   KDLKKALCCNGTVVNDKELGKVIQLQGDQRKNVSTFIVQAGIVKKDQIKVHNF  113



>emb|CDP05760.1| unnamed protein product [Coffea canephora]
Length=112

 Score =   176 bits (447),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + D+Q PAAFDPF E N +S   G+K+YVHIRVQQRNG+K LTT+QGLKKDFS  KIL
Sbjct  1    MVDLDIQIPAAFDPFTEDN-DSGAPGAKEYVHIRVQQRNGKKCLTTIQGLKKDFSLEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG+VIQLQGDQRKN S FLV AGIVKK+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKVIQLQGDQRKNASQFLVTAGIVKKDQIKIHGF  112



>emb|CAB56294.1| putative protein translation factor [Phleum pratense]
Length=95

 Score =   175 bits (443),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = +1

Query  229  GSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCCNGTVVQDPELGQVIQL  408
            GSKDYVH+R+QQRNGRKSLTTVQGLKK+FSY+KILKDLKKEFCCNGTVVQDPELGQVIQL
Sbjct  8    GSKDYVHVRIQQRNGRKSLTTVQGLKKEFSYSKILKDLKKEFCCNGTVVQDPELGQVIQL  67

Query  409  QGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            QGDQRKNVS FLVQAGIVKKEHIKIHGF
Sbjct  68   QGDQRKNVSNFLVQAGIVKKEHIKIHGF  95



>ref|XP_010092161.1| Protein translation factor SUI1-2-like protein [Morus notabilis]
 gb|EXB50312.1| Protein translation factor SUI1-2-like protein [Morus notabilis]
Length=111

 Score =   175 bits (444),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (87%), Gaps = 2/113 (2%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + D+Q P  FDPFA  ++++ G  +K+YVHIRVQQRNG+K LTTVQGLKK+FSY KIL
Sbjct  1    MVDQDVQIPTTFDPFAAIDSDAPG--AKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKIL  58

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRKNVS FLVQAG+VKK+HIKIHGF
Sbjct  59   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDHIKIHGF  111



>gb|AFK38938.1| unknown [Lotus japonicus]
Length=112

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + ++Q P  FDPFAEA  ES   G K+YVH+R+QQRNG+KSLTTVQGLKK+FSY KIL
Sbjct  1    MVDLEIQIPNRFDPFAEAK-ESDAPGVKEYVHVRIQQRNGKKSLTTVQGLKKEFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VV D ELG++IQLQGDQRKNVS FLVQAG+VKK+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVHDKELGKIIQLQGDQRKNVSHFLVQAGLVKKDRIKIHGF  112



>gb|EPS65465.1| hypothetical protein M569_09317 [Genlisea aurea]
Length=113

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E +++  +AFDPFAEA  +S   G+K+Y+HIR+QQRNG+KSLTTVQGL+K+FSY KIL
Sbjct  1    MVELEVEIRSAFDPFAEAKEDSDAPGAKEYIHIRIQQRNGKKSLTTVQGLRKEFSYEKIL  60

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VV D ELG+VIQLQGDQRKNVS FL+ AG+VKK+ IKIHGF
Sbjct  61   KDLKKDFCCNGNVVHDKELGKVIQLQGDQRKNVSQFLINAGLVKKDQIKIHGF  113



>ref|XP_006401506.1| hypothetical protein EUTSA_v10015063mg [Eutrema salsugineum]
 dbj|BAJ34327.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42959.1| hypothetical protein EUTSA_v10015063mg [Eutrema salsugineum]
Length=112

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P+AFDPFAEA  ++   G+K+YVHIR+QQRNG+KSLTTVQGLKKD+SY +IL
Sbjct  1    MVELDIQIPSAFDPFAEAQ-DTDAPGTKEYVHIRIQQRNGKKSLTTVQGLKKDYSYERIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD ELG++IQLQGDQRK VS FLVQ GI  K+ IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIANKDQIKIHGF  112



>ref|XP_004171416.1| PREDICTED: protein translation factor SUI1 homolog 1-like, partial 
[Cucumis sativus]
Length=110

 Score =   175 bits (443),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 96/111 (86%), Gaps = 1/111 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D Q P+AFDPFA+A  +S   G+K+YVHIRVQQRNG+K LTTVQGLKK+FSY KIL
Sbjct  1    MVELDFQIPSAFDPFADAK-DSDAPGTKEYVHIRVQQRNGKKCLTTVQGLKKEFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIH  486
            KD+KKEFCCNG VVQD ELG++IQLQGDQRKNVS FLVQAG+VKK+ IKIH
Sbjct  60   KDVKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVQAGLVKKDQIKIH  110



>gb|ADK79108.1| putative eukaryotic translation initiation factor SUI1 [Catharanthus 
roseus]
Length=112

 Score =   174 bits (442),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + D+Q P AFDPFAEA  +S   G+K+YVHIRVQQRNG+K LTT+QGLKK+FS  KIL
Sbjct  1    MVDLDIQIPTAFDPFAEAK-DSGAPGAKEYVHIRVQQRNGKKCLTTIQGLKKEFSLEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD ELG+VIQLQGDQRKNVS FL+ AGIVKK+ IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKELGKVIQLQGDQRKNVSQFLITAGIVKKDQIKIHGF  112



>gb|EYU33643.1| hypothetical protein MIMGU_mgv1a016664mg [Erythranthe guttata]
Length=112

 Score =   174 bits (442),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P+AFDPFA+A  +    G+K+YVHIR+QQRNG+KSLTTVQGLKK+F+Y KIL
Sbjct  1    MVELDIQIPSAFDPFADAE-DLGAIGAKEYVHIRIQQRNGKKSLTTVQGLKKEFNYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            K+LKKEFCCNG VVQD ELG+V+QLQGDQRKNVS FL+ AGIVKK+ IKIHGF
Sbjct  60   KNLKKEFCCNGNVVQDKELGKVVQLQGDQRKNVSQFLIGAGIVKKDQIKIHGF  112



>ref|XP_008349901.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
 ref|XP_008349902.1| PREDICTED: protein translation factor SUI1 homolog [Malus domestica]
Length=112

 Score =   174 bits (441),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P AFDPF+EA  ++   G+K+YVHIRVQQRNG+K LTTVQGLKKDFSY KIL
Sbjct  1    MVELDVQIPTAFDPFSEAK-DADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYXKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK FCCNG VVQD ELG++IQLQGDQRKNV  FLVQA IVKK+ IKIHGF
Sbjct  60   KDLKKVFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLVQAKIVKKDQIKIHGF  112



>ref|XP_004294387.1| PREDICTED: protein translation factor SUI1 homolog [Fragaria 
vesca subsp. vesca]
Length=112

 Score =   174 bits (440),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+    AFDPFAEA  ++   G+K+YVHIRVQQRNG+K LTTVQGLKKDFSY KIL
Sbjct  1    MVELDVVITTAFDPFAEAR-DADAPGAKEYVHIRVQQRNGKKCLTTVQGLKKDFSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRKNV  FL+QA IVKKE IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVLQFLIQARIVKKEQIKIHGF  112



>dbj|BAN10309.1| eukaryotic translation initiation factor SUI1, partial [Chamaecyparis 
obtusa]
Length=90

 Score =   173 bits (438),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +1

Query  181  AAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKILKDLKKEFCC  360
             AFDPFAEANAE SG GSK+YVH+R+QQRNGRKSLTTVQGLKK+FSYNKILKDLKKEFCC
Sbjct  1    GAFDPFAEANAEDSGAGSKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCC  60

Query  361  NGTVVQDPELGQVIQLQGDQRKNVSTFLVQ  450
            NGTVVQDPELGQVIQLQGDQRKNVS FL+Q
Sbjct  61   NGTVVQDPELGQVIQLQGDQRKNVSNFLIQ  90



>ref|XP_009132417.1| PREDICTED: protein translation factor SUI1 homolog [Brassica 
rapa]
Length=112

 Score =   172 bits (437),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+  P+AFDPFAEA  ES   G+K+Y+H+R+QQRNG+KSLTTVQGLKK +SY KIL
Sbjct  1    MVELDIHVPSAFDPFAEAQ-ESDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKAYSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD ELG++IQLQGDQRK VS F VQ GI KK+ IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSHFFVQTGIAKKDQIKIHGF  112



>ref|XP_010060345.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Eucalyptus 
grandis]
 ref|XP_010060381.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Eucalyptus 
grandis]
 gb|KCW67040.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
 gb|KCW67041.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
 gb|KCW67042.1| hypothetical protein EUGRSUZ_F00808 [Eucalyptus grandis]
Length=112

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D + P AFDPFAE   +S   G+K+YVHIR+QQRNG+KSLTTVQGLKKD+SY KIL
Sbjct  1    MVEGDFELPTAFDPFAEGK-DSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKKEFCCNG VVQD ELG++IQLQGDQRKNVS FLV   IVKK+ IKIHGF
Sbjct  60   KDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIVKKDQIKIHGF  112



>ref|XP_002866067.1| hypothetical protein ARALYDRAFT_918633 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42326.1| hypothetical protein ARALYDRAFT_918633 [Arabidopsis lyrata subsp. 
lyrata]
Length=112

 Score =   172 bits (436),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P+AFDPFAEA  +S   G+K+ +HIR+QQRNG+KSLTTVQGLKK++SY +IL
Sbjct  1    MVELDIQIPSAFDPFAEAK-DSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD ELG++IQLQGDQRK VS FLVQ GI KK+ IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF  112



>gb|KJB11840.1| hypothetical protein B456_002G088900 [Gossypium raimondii]
Length=112

 Score =   172 bits (435),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 94/113 (83%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + D+Q P  FDPFAEA  E  G G+K+YVHIR+QQRNG+KSLTTVQGL+ D SY KIL
Sbjct  1    MVDLDVQIPTTFDPFAEA-GEFGGTGTKEYVHIRIQQRNGKKSLTTVQGLRHDLSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            K LKK+FCCNG VV+D ELG++IQLQGDQRKNVS FLV AGIVKK+ IKIHGF
Sbjct  60   KSLKKDFCCNGNVVKDKELGKIIQLQGDQRKNVSQFLVNAGIVKKDQIKIHGF  112



>gb|KCW66993.1| hypothetical protein EUGRSUZ_F00759 [Eucalyptus grandis]
Length=261

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +1

Query  151  FMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            +M E D + P AFDPFAE   +S   G+K+YVHIR+QQRNG+KSLTTVQGLKKD+SY KI
Sbjct  149  YMVEGDFELPTAFDPFAEGK-DSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKI  207

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKDLKKEFCCNG VVQD ELG++IQLQGDQRKNVS FLV   IVKK+ IKIHGF
Sbjct  208  LKDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIVKKDQIKIHGF  261



>gb|KCW66994.1| hypothetical protein EUGRSUZ_F00759 [Eucalyptus grandis]
Length=260

 Score =   176 bits (447),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +1

Query  151  FMSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKI  330
            +M E D + P AFDPFAE   +S   G+K+YVHIR+QQRNG+KSLTTVQGLKKD+SY KI
Sbjct  148  YMVEGDFELPTAFDPFAEGK-DSGAPGAKEYVHIRIQQRNGKKSLTTVQGLKKDYSYEKI  206

Query  331  LKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            LKDLKKEFCCNG VVQD ELG++IQLQGDQRKNVS FLV   IVKK+ IKIHGF
Sbjct  207  LKDLKKEFCCNGNVVQDKELGKIIQLQGDQRKNVSQFLVHNNIVKKDQIKIHGF  260



>ref|NP_568818.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 ref|NP_851192.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AAK60326.1|AF385736_1 AT5g54940/MBG8_21 [Arabidopsis thaliana]
 dbj|BAB08773.1| translation initiation factor-like protein [Arabidopsis thaliana]
 gb|AAM64690.1| translation initiation factor-like protein [Arabidopsis thaliana]
 gb|AAM91507.1| AT5g54940/MBG8_21 [Arabidopsis thaliana]
 gb|AED96560.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
 gb|AED96561.1| translation initiation factor SUI1 family protein [Arabidopsis 
thaliana]
Length=112

 Score =   171 bits (434),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P+A+DPFAEA  +S   G+K+ +HIR+QQRNG+KSLTTVQGLKK++SY +IL
Sbjct  1    MVELDIQIPSAYDPFAEAK-DSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD ELG++IQLQGDQRK VS FLVQ GI KK+ IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF  112



>ref|XP_006281351.1| hypothetical protein CARUB_v10027407mg [Capsella rubella]
 gb|EOA14249.1| hypothetical protein CARUB_v10027407mg [Capsella rubella]
Length=112

 Score =   171 bits (432),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P+A+DPFAEA  +S   G+K+ +HIR+QQRNG+KSLTTVQGLKK++SY +IL
Sbjct  1    MVELDIQIPSAYDPFAEA-IDSDAPGTKENIHIRIQQRNGKKSLTTVQGLKKEYSYERIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD ELG++IQLQGDQRK VS FLVQ+G+ KK+ IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQSGLAKKDQIKIHGF  112



>gb|ADB85107.1| translation initiation factor-like protein [Jatropha curcas]
 gb|KDP39133.1| hypothetical protein JCGZ_00890 [Jatropha curcas]
Length=112

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M + ++Q PAAFDPF+EA  +S   G+K+YVHIR+QQRNGRKSLTTVQGL K+FSY KI+
Sbjct  1    MVDLEIQVPAAFDPFSEAK-DSGAPGAKEYVHIRIQQRNGRKSLTTVQGLPKEFSYEKIV  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            K LKKEFCCNG VVQD ELG+VIQLQGDQRKNV +FLV A +V+K+ IKIHGF
Sbjct  60   KALKKEFCCNGNVVQDKELGKVIQLQGDQRKNVQSFLVNAQLVRKDQIKIHGF  112



>ref|XP_009120023.1| PREDICTED: protein translation factor SUI1 homolog [Brassica 
rapa]
Length=112

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P A+DPFAEA  ++   G+K+Y+H+R+QQRNG+KSLTTVQGLKK++SY KIL
Sbjct  1    MVELDIQVPLAYDPFAEAQ-DTDAPGTKEYIHVRIQQRNGKKSLTTVQGLKKEYSYEKIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQD  LG++IQLQGDQRK VS FLVQ GI KK+ IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQDKVLGKIIQLQGDQRKKVSHFLVQTGIAKKDQIKIHGF  112



>ref|XP_010482910.1| PREDICTED: protein translation factor SUI1 homolog 1-like [Camelina 
sativa]
Length=112

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +1

Query  154  MSEFDLQTPAAFDPFAEANAESSGDGSKDYVHIRVQQRNGRKSLTTVQGLKKDFSYNKIL  333
            M E D+Q P+A+DPFAEA  +S   G+K+ +HIR+QQRNG+KSLTTVQGLKK++SY +IL
Sbjct  1    MVELDIQVPSAYDPFAEAK-DSDAPGAKENIHIRIQQRNGKKSLTTVQGLKKEYSYERIL  59

Query  334  KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF  492
            KDLKK+FCCNG VVQ+ ELG++IQLQGDQRK VS FLVQAGI +K+ IKIHGF
Sbjct  60   KDLKKDFCCNGNVVQNKELGKIIQLQGDQRKKVSQFLVQAGIAEKDQIKIHGF  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880