BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M13

Length=486
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073578.1|  PREDICTED: probable inactive receptor kinase...  82.4    4e-15   Sesamum indicum [beniseed]
ref|XP_006343895.1|  PREDICTED: probable inactive receptor kinase...  82.0    7e-15   Solanum tuberosum [potatoes]
ref|XP_004245544.1|  PREDICTED: probable inactive receptor kinase...  81.6    8e-15   Solanum lycopersicum
ref|XP_009629119.1|  PREDICTED: probable inactive receptor kinase...  80.9    1e-14   
ref|XP_009799943.1|  PREDICTED: probable inactive receptor kinase...  79.7    5e-14   Nicotiana sylvestris
gb|EYU23390.1|  hypothetical protein MIMGU_mgv1a003016mg              77.4    2e-13   Erythranthe guttata [common monkey flower]
ref|XP_011080874.1|  PREDICTED: probable inactive receptor kinase...  76.3    5e-13   Sesamum indicum [beniseed]
emb|CDP12117.1|  unnamed protein product                              76.3    6e-13   Coffea canephora [robusta coffee]
gb|KDO76442.1|  hypothetical protein CISIN_1g006922mg                 75.5    1e-12   Citrus sinensis [apfelsine]
ref|XP_006476438.1|  PREDICTED: probable inactive receptor kinase...  75.5    1e-12   Citrus sinensis [apfelsine]
ref|XP_006439412.1|  hypothetical protein CICLE_v10019314mg           75.5    1e-12   Citrus clementina [clementine]
ref|XP_007040424.1|  Leucine-rich repeat protein kinase family pr...  75.5    1e-12   
ref|XP_011026937.1|  PREDICTED: probable inactive receptor kinase...  74.3    2e-12   Populus euphratica
ref|XP_011026938.1|  PREDICTED: probable inactive receptor kinase...  74.3    2e-12   Populus euphratica
ref|XP_002299495.1|  leucine-rich repeat transmembrane protein ki...  74.3    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_002509916.1|  ATP binding protein, putative                    73.9    3e-12   
ref|XP_007210296.1|  hypothetical protein PRUPE_ppa002579mg           70.5    5e-11   Prunus persica
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...  70.1    7e-11   Vitis vinifera
ref|XP_011022559.1|  PREDICTED: probable inactive receptor kinase...  69.3    1e-10   Populus euphratica
emb|CBI22555.3|  unnamed protein product                              69.3    1e-10   Vitis vinifera
ref|XP_010676354.1|  PREDICTED: probable inactive receptor kinase...  68.9    2e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...  68.6    2e-10   Nicotiana sylvestris
ref|XP_010053173.1|  PREDICTED: probable inactive receptor kinase...  68.6    3e-10   Eucalyptus grandis [rose gum]
ref|XP_009760490.1|  PREDICTED: probable inactive receptor kinase...  68.6    3e-10   Nicotiana sylvestris
ref|XP_008392458.1|  PREDICTED: probable inactive receptor kinase...  68.2    3e-10   
ref|XP_009352353.1|  PREDICTED: probable inactive receptor kinase...  68.2    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_010055829.1|  PREDICTED: probable inactive receptor kinase...  68.2    4e-10   Eucalyptus grandis [rose gum]
ref|XP_008239079.1|  PREDICTED: probable inactive receptor kinase...  67.8    4e-10   Prunus mume [ume]
ref|XP_006490586.1|  PREDICTED: probable inactive receptor kinase...  67.8    4e-10   Citrus sinensis [apfelsine]
gb|KDO56147.1|  hypothetical protein CISIN_1g007167mg                 67.8    4e-10   Citrus sinensis [apfelsine]
gb|KDP25339.1|  hypothetical protein JCGZ_20495                       67.4    5e-10   Jatropha curcas
ref|XP_006413522.1|  hypothetical protein EUTSA_v10024674mg           67.4    6e-10   Eutrema salsugineum [saltwater cress]
ref|XP_006422104.1|  hypothetical protein CICLE_v10004549mg           67.0    8e-10   
gb|EYU25187.1|  hypothetical protein MIMGU_mgv1a002923mg              66.6    8e-10   Erythranthe guttata [common monkey flower]
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...  66.6    1e-09   Nicotiana tomentosiformis
gb|KJB19053.1|  hypothetical protein B456_003G082600                  66.6    1e-09   Gossypium raimondii
ref|XP_009336254.1|  PREDICTED: probable inactive receptor kinase...  66.6    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_011001931.1|  PREDICTED: probable inactive receptor kinase...  66.6    1e-09   Populus euphratica
ref|XP_011001936.1|  PREDICTED: probable inactive receptor kinase...  66.2    1e-09   Populus euphratica
ref|XP_004235218.1|  PREDICTED: probable inactive receptor kinase...  66.2    2e-09   Solanum lycopersicum
ref|XP_006357316.1|  PREDICTED: probable inactive receptor kinase...  65.9    2e-09   Solanum tuberosum [potatoes]
ref|XP_010421220.1|  PREDICTED: inactive leucine-rich repeat rece...  65.9    2e-09   
ref|XP_006287298.1|  hypothetical protein CARUB_v10000491mg           65.9    2e-09   Capsella rubella
ref|XP_010493544.1|  PREDICTED: inactive leucine-rich repeat rece...  65.9    2e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010658906.1|  PREDICTED: probable inactive receptor kinase...  65.5    2e-09   Vitis vinifera
ref|XP_006280204.1|  hypothetical protein CARUB_v10026109mg           65.5    2e-09   Capsella rubella
ref|XP_009368693.1|  PREDICTED: probable inactive receptor kinase...  65.1    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_009357339.1|  PREDICTED: probable inactive receptor kinase...  65.1    3e-09   
ref|XP_008376682.1|  PREDICTED: probable inactive receptor kinase...  65.1    4e-09   Malus domestica [apple tree]
emb|CDY03527.1|  BnaC01g15550D                                        63.5    4e-09   
ref|XP_009137362.1|  PREDICTED: probable inactive receptor kinase...  64.7    4e-09   Brassica rapa
ref|XP_008439323.1|  PREDICTED: probable inactive receptor kinase...  64.7    4e-09   Cucumis melo [Oriental melon]
ref|XP_002303623.1|  leucine-rich repeat transmembrane protein ki...  64.7    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010454700.1|  PREDICTED: inactive leucine-rich repeat rece...  64.7    5e-09   Camelina sativa [gold-of-pleasure]
ref|XP_011084477.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  64.7    5e-09   Sesamum indicum [beniseed]
ref|XP_008234792.1|  PREDICTED: probable inactive receptor kinase...  64.3    5e-09   
ref|XP_007220432.1|  hypothetical protein PRUPE_ppa002831mg           64.3    6e-09   Prunus persica
ref|XP_006358156.1|  PREDICTED: probable inactive receptor kinase...  64.3    6e-09   Solanum tuberosum [potatoes]
ref|XP_008456255.1|  PREDICTED: probable inactive receptor kinase...  64.3    6e-09   
gb|AAL09719.1|  AT3g08680/F17O14_15                                   63.5    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004308019.1|  PREDICTED: probable inactive receptor kinase...  64.3    6e-09   Fragaria vesca subsp. vesca
emb|CDY47625.1|  BnaA01g13400D                                        64.3    7e-09   Brassica napus [oilseed rape]
ref|XP_010244554.1|  PREDICTED: probable inactive receptor kinase...  63.9    7e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010104998.1|  putative inactive receptor kinase                63.9    7e-09   Morus notabilis
ref|XP_006350601.1|  PREDICTED: probable inactive receptor kinase...  63.9    7e-09   Solanum tuberosum [potatoes]
emb|CDY35996.1|  BnaA05g29540D                                        63.9    8e-09   Brassica napus [oilseed rape]
ref|XP_007038934.1|  Leucine-rich repeat protein kinase family pr...  63.9    8e-09   
ref|XP_004139930.1|  PREDICTED: probable inactive receptor kinase...  63.9    8e-09   Cucumis sativus [cucumbers]
ref|XP_009146990.1|  PREDICTED: probable inactive receptor kinase...  63.9    8e-09   Brassica rapa
ref|XP_008437363.1|  PREDICTED: probable inactive receptor kinase...  63.5    1e-08   
emb|CDY27986.1|  BnaC05g43880D                                        63.5    1e-08   Brassica napus [oilseed rape]
ref|XP_004143879.1|  PREDICTED: probable inactive receptor kinase...  63.5    1e-08   Cucumis sativus [cucumbers]
ref|XP_004167870.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  63.5    1e-08   
ref|XP_002317741.1|  hypothetical protein POPTR_0012s01230g           63.5    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010445702.1|  PREDICTED: probable inactive receptor kinase...  63.5    1e-08   Camelina sativa [gold-of-pleasure]
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                 63.5    1e-08   Citrus sinensis [apfelsine]
ref|NP_187480.1|  leucine-rich repeat protein kinase family protein   63.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg           63.5    1e-08   Citrus clementina [clementine]
gb|ACC91242.1|  leucine-rich repeat transmembrane protein kinase      63.2    1e-08   Arabidopsis halleri
gb|EYU19612.1|  hypothetical protein MIMGU_mgv1a026050mg              62.8    2e-08   Erythranthe guttata [common monkey flower]
ref|XP_002869766.1|  hypothetical protein ARALYDRAFT_914223           63.2    2e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_002882579.1|  hypothetical protein ARALYDRAFT_478170           62.8    2e-08   
ref|XP_010463311.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  62.8    2e-08   Camelina sativa [gold-of-pleasure]
gb|KEH21182.1|  LRR receptor-like kinase                              62.8    2e-08   Medicago truncatula
ref|XP_004149452.1|  PREDICTED: probable inactive receptor kinase...  62.4    2e-08   
ref|XP_006297193.1|  hypothetical protein CARUB_v10013201mg           62.4    2e-08   Capsella rubella
ref|XP_011076041.1|  PREDICTED: probable inactive receptor kinase...  62.4    2e-08   Sesamum indicum [beniseed]
ref|XP_010464477.1|  PREDICTED: probable inactive receptor kinase...  62.4    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010482722.1|  PREDICTED: probable inactive receptor kinase...  62.4    2e-08   Camelina sativa [gold-of-pleasure]
gb|KCW46493.1|  hypothetical protein EUGRSUZ_K00318                   62.0    3e-08   Eucalyptus grandis [rose gum]
ref|XP_010453493.1|  PREDICTED: probable inactive receptor kinase...  62.4    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010035197.1|  PREDICTED: probable inactive receptor kinase...  62.4    3e-08   Eucalyptus grandis [rose gum]
ref|XP_006401720.1|  hypothetical protein EUTSA_v10013013mg           62.0    3e-08   Eutrema salsugineum [saltwater cress]
ref|NP_197798.1|  Leucine-rich repeat protein kinase family protein   62.0    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002520893.1|  Receptor protein kinase CLAVATA1 precursor, ...  62.0    3e-08   
ref|XP_009374410.1|  PREDICTED: probable inactive receptor kinase...  62.0    4e-08   Pyrus x bretschneideri [bai li]
ref|XP_007160136.1|  hypothetical protein PHAVU_002G295600g           62.0    4e-08   Phaseolus vulgaris [French bean]
ref|NP_194105.1|  Leucine-rich repeat protein kinase family protein   62.0    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010059849.1|  PREDICTED: probable inactive receptor kinase...  62.0    4e-08   Eucalyptus grandis [rose gum]
ref|XP_004300851.1|  PREDICTED: probable inactive receptor kinase...  61.6    4e-08   Fragaria vesca subsp. vesca
ref|XP_010251541.1|  PREDICTED: probable inactive receptor kinase...  61.6    4e-08   
gb|AES72427.2|  LRR receptor-like kinase                              61.6    4e-08   Medicago truncatula
ref|XP_002872091.1|  hypothetical protein ARALYDRAFT_489266           61.6    4e-08   
ref|XP_006280146.1|  hypothetical protein CARUB_v10026045mg           61.6    4e-08   
dbj|BAE99195.1|  receptor protein kinase like protein                 61.2    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123870.1|  PREDICTED: probable inactive receptor kinase...  61.2    5e-08   Brassica rapa
ref|NP_200144.1|  putative inactive receptor kinase                   61.2    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394667.1|  hypothetical protein EUTSA_v10003837mg           61.2    5e-08   Eutrema salsugineum [saltwater cress]
ref|XP_010483401.1|  PREDICTED: probable inactive receptor kinase...  61.2    5e-08   
ref|XP_003602176.1|  Leucine-rich repeat receptor-like protein ki...  61.6    5e-08   
ref|XP_009132067.1|  PREDICTED: probable inactive receptor kinase...  61.2    6e-08   Brassica rapa
ref|XP_009141903.1|  PREDICTED: inactive leucine-rich repeat rece...  60.8    7e-08   Brassica rapa
emb|CDX88667.1|  BnaA03g09820D                                        60.8    7e-08   
ref|XP_004253440.1|  PREDICTED: probable inactive receptor kinase...  60.5    7e-08   Solanum lycopersicum
emb|CBI15804.3|  unnamed protein product                              60.8    8e-08   Vitis vinifera
emb|CDX87143.1|  BnaC09g04580D                                        60.8    8e-08   
emb|CDY19849.1|  BnaA09g05020D                                        60.8    8e-08   Brassica napus [oilseed rape]
ref|XP_010442890.1|  PREDICTED: probable inactive receptor kinase...  60.8    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002276162.3|  PREDICTED: probable inactive receptor kinase...  60.8    8e-08   Vitis vinifera
ref|XP_006407752.1|  hypothetical protein EUTSA_v10020278mg           60.8    8e-08   Eutrema salsugineum [saltwater cress]
ref|XP_008380496.1|  PREDICTED: probable inactive receptor kinase...  60.8    9e-08   
ref|XP_006283317.1|  hypothetical protein CARUB_v10004355mg           60.5    9e-08   
gb|KHN35064.1|  Putative inactive receptor kinase                     60.5    9e-08   Glycine soja [wild soybean]
ref|XP_010443551.1|  PREDICTED: probable inactive receptor kinase...  60.5    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010550530.1|  PREDICTED: inactive leucine-rich repeat rece...  60.5    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_008810859.1|  PREDICTED: probable inactive receptor kinase...  60.5    1e-07   Phoenix dactylifera
ref|XP_009375580.1|  PREDICTED: probable inactive receptor kinase...  60.5    1e-07   Pyrus x bretschneideri [bai li]
ref|XP_006590496.1|  PREDICTED: probable inactive receptor kinase...  60.1    1e-07   Glycine max [soybeans]
ref|XP_009352112.1|  PREDICTED: probable inactive receptor kinase...  60.1    1e-07   Pyrus x bretschneideri [bai li]
emb|CDP05105.1|  unnamed protein product                              60.1    1e-07   Coffea canephora [robusta coffee]
emb|CDY10963.1|  BnaA03g46220D                                        59.7    1e-07   Brassica napus [oilseed rape]
ref|XP_009137388.1|  PREDICTED: probable inactive receptor kinase...  60.1    1e-07   Brassica rapa
emb|CDX94213.1|  BnaC07g38470D                                        59.7    2e-07   
emb|CDY54343.1|  BnaC03g14930D                                        59.7    2e-07   Brassica napus [oilseed rape]
emb|CDY58565.1|  BnaC03g12450D                                        59.7    2e-07   Brassica napus [oilseed rape]
ref|XP_011007941.1|  PREDICTED: probable inactive receptor kinase...  59.7    2e-07   Populus euphratica
gb|KJB52635.1|  hypothetical protein B456_008G271600                  59.3    2e-07   Gossypium raimondii
ref|XP_002865969.1|  hypothetical protein ARALYDRAFT_357577           59.7    2e-07   Arabidopsis lyrata subsp. lyrata
gb|KJB52637.1|  hypothetical protein B456_008G271600                  59.7    2e-07   Gossypium raimondii
gb|KJB52632.1|  hypothetical protein B456_008G271600                  59.7    2e-07   Gossypium raimondii
ref|XP_004241083.1|  PREDICTED: probable inactive receptor kinase...  59.7    2e-07   
ref|XP_010322111.1|  PREDICTED: probable inactive receptor kinase...  59.7    2e-07   Solanum lycopersicum
ref|XP_006374322.1|  hypothetical protein POPTR_0015s06040g           59.7    2e-07   Populus trichocarpa [western balsam poplar]
gb|KJB29842.1|  hypothetical protein B456_005G120900                  59.7    2e-07   Gossypium raimondii
emb|CDY47068.1|  BnaA03g12300D                                        59.7    2e-07   Brassica napus [oilseed rape]
gb|KHF99691.1|  hypothetical protein F383_18108                       59.7    2e-07   Gossypium arboreum [tree cotton]
gb|KHG27491.1|  hypothetical protein F383_14041                       59.7    2e-07   Gossypium arboreum [tree cotton]
ref|XP_009380537.1|  PREDICTED: probable inactive receptor kinase...  59.7    2e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009132484.1|  PREDICTED: probable inactive receptor kinase...  59.3    2e-07   Brassica rapa
ref|XP_009628885.1|  PREDICTED: probable inactive receptor kinase...  59.3    2e-07   Nicotiana tomentosiformis
gb|KJB52636.1|  hypothetical protein B456_008G271600                  59.3    2e-07   Gossypium raimondii
ref|XP_009796898.1|  PREDICTED: probable inactive receptor kinase...  59.3    2e-07   Nicotiana sylvestris
gb|KEH34523.1|  LRR receptor-like kinase                              59.3    2e-07   Medicago truncatula
ref|XP_010938046.1|  PREDICTED: probable inactive receptor kinase...  59.3    2e-07   Elaeis guineensis
ref|XP_004502606.1|  PREDICTED: probable inactive receptor kinase...  59.3    2e-07   
ref|XP_004502605.1|  PREDICTED: probable inactive receptor kinase...  59.3    2e-07   Cicer arietinum [garbanzo]
ref|XP_010938045.1|  PREDICTED: probable inactive receptor kinase...  59.3    2e-07   Elaeis guineensis
ref|XP_003600547.1|  Leucine-rich repeat receptor-like protein ki...  59.3    3e-07   
ref|XP_004503646.1|  PREDICTED: probable inactive receptor kinase...  59.3    3e-07   Cicer arietinum [garbanzo]
ref|XP_010433865.1|  PREDICTED: probable inactive receptor kinase...  58.9    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007158557.1|  hypothetical protein PHAVU_002G162400g           58.9    3e-07   Phaseolus vulgaris [French bean]
ref|XP_010448663.1|  PREDICTED: probable inactive receptor kinase...  58.9    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010445167.1|  PREDICTED: probable inactive receptor kinase...  58.9    3e-07   
gb|KDP22183.1|  hypothetical protein JCGZ_26014                       58.9    3e-07   Jatropha curcas
ref|XP_006356869.1|  PREDICTED: probable inactive receptor kinase...  58.9    3e-07   Solanum tuberosum [potatoes]
ref|XP_010541406.1|  PREDICTED: probable inactive receptor kinase...  58.9    3e-07   Tarenaya hassleriana [spider flower]
gb|KHG17391.1|  hypothetical protein F383_22576                       58.9    3e-07   Gossypium arboreum [tree cotton]
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...  58.9    4e-07   Solanum lycopersicum
ref|XP_009399834.1|  PREDICTED: probable inactive receptor kinase...  58.9    4e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399835.1|  PREDICTED: probable inactive receptor kinase...  58.9    4e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010671535.1|  PREDICTED: probable inactive receptor kinase...  58.5    4e-07   
ref|XP_006401105.1|  hypothetical protein EUTSA_v10012925mg           58.5    4e-07   Eutrema salsugineum [saltwater cress]
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...  58.5    4e-07   
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...  58.5    5e-07   
ref|XP_010043603.1|  PREDICTED: probable inactive receptor kinase...  58.5    5e-07   Eucalyptus grandis [rose gum]
ref|XP_007142022.1|  hypothetical protein PHAVU_008G245900g           58.5    5e-07   Phaseolus vulgaris [French bean]
emb|CDY02807.1|  BnaC02g10820D                                        55.1    5e-07   
gb|EPS58213.1|  hypothetical protein M569_16602                       58.2    5e-07   Genlisea aurea
ref|XP_010541472.1|  PREDICTED: probable inactive receptor kinase...  58.2    5e-07   Tarenaya hassleriana [spider flower]
ref|XP_008384658.1|  PREDICTED: probable inactive receptor kinase...  58.2    5e-07   
gb|EPS73425.1|  hypothetical protein M569_01324                       58.2    5e-07   Genlisea aurea
ref|XP_006374053.1|  leucine-rich repeat transmembrane protein ki...  58.2    5e-07   
ref|XP_006371315.1|  putative plant disease resistance family pro...  58.2    6e-07   
ref|XP_010094441.1|  putative inactive receptor kinase                58.2    6e-07   Morus notabilis
ref|XP_010541471.1|  PREDICTED: probable inactive receptor kinase...  58.2    6e-07   
ref|XP_008810858.1|  PREDICTED: probable inactive receptor kinase...  58.2    6e-07   Phoenix dactylifera
ref|XP_009409433.1|  PREDICTED: probable inactive receptor kinase...  58.2    6e-07   
ref|XP_006371316.1|  hypothetical protein POPTR_0019s09010g           58.2    6e-07   
ref|XP_010538821.1|  PREDICTED: probable inactive receptor kinase...  57.8    8e-07   Tarenaya hassleriana [spider flower]
gb|EPS62971.1|  hypothetical protein M569_11816                       57.8    8e-07   Genlisea aurea
ref|XP_003518282.1|  PREDICTED: probable inactive receptor kinase...  57.8    8e-07   Glycine max [soybeans]
ref|XP_009413825.1|  PREDICTED: probable inactive receptor kinase...  57.8    8e-07   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP21623.1|  hypothetical protein JCGZ_03294                       57.4    9e-07   Jatropha curcas
ref|XP_007033487.1|  Leucine-rich repeat protein kinase family pr...  57.4    1e-06   
ref|XP_010252005.1|  PREDICTED: probable inactive receptor kinase...  57.4    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_007146903.1|  hypothetical protein PHAVU_006G080200g           57.4    1e-06   Phaseolus vulgaris [French bean]
ref|XP_009355011.1|  PREDICTED: probable inactive receptor kinase...  57.4    1e-06   
ref|XP_010999642.1|  PREDICTED: probable inactive receptor kinase...  57.4    1e-06   Populus euphratica
ref|XP_008239856.1|  PREDICTED: probable inactive receptor kinase...  57.4    1e-06   Prunus mume [ume]
ref|NP_200638.1|  leucine-rich repeat protein kinase family protein   57.4    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007140053.1|  hypothetical protein PHAVU_008G080500g           57.0    1e-06   Phaseolus vulgaris [French bean]
gb|AFK45382.1|  unknown                                               57.0    1e-06   Medicago truncatula
ref|XP_003611028.1|  Probably inactive receptor-like protein kinase   57.0    1e-06   Medicago truncatula
ref|XP_008793397.1|  PREDICTED: probable inactive receptor kinase...  57.0    1e-06   Phoenix dactylifera
ref|XP_010999639.1|  PREDICTED: probable inactive receptor kinase...  57.0    1e-06   Populus euphratica
ref|XP_010999638.1|  PREDICTED: probable inactive receptor kinase...  57.0    1e-06   Populus euphratica
ref|XP_008793541.1|  PREDICTED: probable inactive receptor kinase...  57.0    1e-06   Phoenix dactylifera
emb|CDY32713.1|  BnaA02g07750D                                        57.0    1e-06   Brassica napus [oilseed rape]
gb|KHN44239.1|  Putative inactive receptor kinase                     57.0    1e-06   Glycine soja [wild soybean]
ref|XP_003522551.1|  PREDICTED: probable inactive receptor kinase...  57.0    1e-06   Glycine max [soybeans]
ref|XP_009772876.1|  PREDICTED: probable inactive receptor kinase...  57.0    1e-06   Nicotiana sylvestris
ref|XP_010097875.1|  putative inactive receptor kinase                57.0    2e-06   
gb|KHN23405.1|  Putative inactive receptor kinase                     57.0    2e-06   Glycine soja [wild soybean]
ref|XP_003526687.1|  PREDICTED: probable inactive receptor kinase...  57.0    2e-06   Glycine max [soybeans]
ref|XP_006584744.1|  PREDICTED: probable inactive receptor kinase...  56.6    2e-06   Glycine max [soybeans]
ref|XP_011041759.1|  PREDICTED: probable inactive receptor kinase...  56.6    2e-06   Populus euphratica
ref|XP_002325632.1|  putative plant disease resistance family pro...  56.6    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009126766.1|  PREDICTED: probable inactive receptor kinase...  56.6    2e-06   Brassica rapa
ref|XP_006432052.1|  hypothetical protein CICLE_v10000513mg           56.6    2e-06   Citrus clementina [clementine]
ref|XP_004498388.1|  PREDICTED: probable inactive receptor kinase...  56.6    2e-06   Cicer arietinum [garbanzo]
gb|KDO54914.1|  hypothetical protein CISIN_1g005693mg                 56.6    2e-06   Citrus sinensis [apfelsine]
ref|XP_006432053.1|  hypothetical protein CICLE_v10000513mg           56.6    2e-06   Citrus clementina [clementine]
ref|XP_007208318.1|  hypothetical protein PRUPE_ppa002781mg           56.6    2e-06   
ref|XP_010558411.1|  PREDICTED: probable inactive receptor kinase...  56.6    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_007137558.1|  hypothetical protein PHAVU_009G136800g           56.6    2e-06   Phaseolus vulgaris [French bean]
gb|KDO54912.1|  hypothetical protein CISIN_1g005693mg                 56.6    2e-06   Citrus sinensis [apfelsine]
gb|KDO54913.1|  hypothetical protein CISIN_1g005693mg                 56.2    2e-06   Citrus sinensis [apfelsine]
gb|KJB67957.1|  hypothetical protein B456_010G219700                  56.2    2e-06   Gossypium raimondii
ref|XP_009337799.1|  PREDICTED: probable inactive receptor kinase...  56.2    2e-06   
gb|KJB71491.1|  hypothetical protein B456_011G125200                  56.2    2e-06   Gossypium raimondii
ref|XP_009592168.1|  PREDICTED: probable inactive receptor kinase...  56.2    2e-06   Nicotiana tomentosiformis
ref|XP_006602721.1|  PREDICTED: probable inactive receptor kinase...  56.2    2e-06   Glycine max [soybeans]
gb|KHN08297.1|  Putative inactive receptor kinase                     56.2    2e-06   Glycine soja [wild soybean]
gb|KHN40609.1|  Putative inactive receptor kinase                     56.2    3e-06   Glycine soja [wild soybean]
ref|XP_006596280.1|  PREDICTED: probable inactive receptor kinase...  56.2    3e-06   Glycine max [soybeans]
gb|KHN40011.1|  Putative inactive receptor kinase                     55.8    3e-06   Glycine soja [wild soybean]
ref|XP_010683445.1|  PREDICTED: probable inactive receptor kinase...  56.2    3e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004500388.1|  PREDICTED: probable inactive receptor kinase...  56.2    3e-06   
ref|XP_010683449.1|  PREDICTED: probable inactive receptor kinase...  55.8    3e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006644911.1|  PREDICTED: probable inactive receptor kinase...  55.8    3e-06   Oryza brachyantha
gb|AAL76166.1|AF348333_1  candidate plant disease resistance protein  54.3    3e-06   Glycine max [soybeans]
ref|XP_003544853.1|  PREDICTED: probable inactive receptor kinase...  55.8    3e-06   Glycine max [soybeans]
dbj|BAK08005.1|  predicted protein                                    55.5    4e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB62593.1|  putative receptor-like protein kinase                55.5    4e-06   Oryza sativa Japonica Group [Japonica rice]
gb|ACA61611.1|  hypothetical protein AP2_E06.2                        55.5    4e-06   Arabidopsis lyrata subsp. petraea
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...  55.5    4e-06   Glycine max [soybeans]
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...  55.5    4e-06   Glycine max [soybeans]
gb|EMT17815.1|  Putative inactive receptor kinase                     55.5    4e-06   
ref|XP_004502808.1|  PREDICTED: probable inactive receptor kinase...  55.5    4e-06   Cicer arietinum [garbanzo]
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...  55.5    4e-06   Glycine max [soybeans]
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...  55.5    4e-06   Glycine max [soybeans]
ref|XP_010921193.1|  PREDICTED: probable inactive receptor kinase...  55.5    4e-06   Elaeis guineensis
ref|XP_002864562.1|  predicted protein                                55.5    4e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_006587908.1|  PREDICTED: probable inactive receptor kinase...  55.5    4e-06   Glycine max [soybeans]
ref|XP_004511531.1|  PREDICTED: probable inactive receptor kinase...  55.5    5e-06   Cicer arietinum [garbanzo]
ref|NP_001130388.1|  uncharacterized LOC100191484 precursor           55.5    5e-06   Zea mays [maize]
ref|XP_011001675.1|  PREDICTED: probable inactive receptor kinase...  55.5    5e-06   Populus euphratica
ref|XP_011001671.1|  PREDICTED: probable inactive receptor kinase...  55.5    5e-06   Populus euphratica
gb|KEH35517.1|  receptor-like kinase                                  55.5    5e-06   Medicago truncatula
ref|XP_011095165.1|  PREDICTED: probable inactive receptor kinase...  55.5    5e-06   Sesamum indicum [beniseed]
ref|XP_009362808.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  55.1    5e-06   
ref|XP_003516715.2|  PREDICTED: probable inactive receptor kinase...  55.1    5e-06   Glycine max [soybeans]
ref|XP_011001674.1|  PREDICTED: probable inactive receptor kinase...  55.1    5e-06   Populus euphratica
ref|XP_008366817.1|  PREDICTED: probable inactive receptor kinase...  55.1    5e-06   
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg           55.1    5e-06   Citrus clementina [clementine]
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                 55.1    5e-06   Citrus sinensis [apfelsine]
ref|XP_011080640.1|  PREDICTED: probable inactive receptor kinase...  55.1    6e-06   Sesamum indicum [beniseed]
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg           55.1    6e-06   Citrus clementina [clementine]
gb|KHN25793.1|  Putative inactive receptor kinase                     55.1    6e-06   Glycine soja [wild soybean]
ref|XP_003526789.1|  PREDICTED: probable inactive receptor kinase...  55.1    6e-06   
gb|KHG05843.1|  hypothetical protein F383_32232                       55.1    6e-06   Gossypium arboreum [tree cotton]
ref|XP_007136405.1|  hypothetical protein PHAVU_009G042300g           55.1    6e-06   Phaseolus vulgaris [French bean]
gb|KJB20519.1|  hypothetical protein B456_003G153000                  54.7    6e-06   Gossypium raimondii
ref|XP_009370892.1|  PREDICTED: probable inactive receptor kinase...  55.1    7e-06   Pyrus x bretschneideri [bai li]
ref|XP_010098027.1|  putative inactive receptor kinase                55.1    7e-06   
ref|XP_006580544.1|  PREDICTED: probable inactive receptor kinase...  54.7    7e-06   Glycine max [soybeans]
gb|EPS74415.1|  hypothetical protein M569_00340                       54.7    7e-06   Genlisea aurea
gb|KJB20517.1|  hypothetical protein B456_003G153000                  54.7    7e-06   Gossypium raimondii
ref|XP_010109178.1|  putative inactive receptor kinase                54.7    7e-06   
ref|XP_011011771.1|  PREDICTED: probable inactive receptor kinase...  54.7    8e-06   
ref|XP_008355739.1|  PREDICTED: probable inactive receptor kinase...  54.7    8e-06   
ref|XP_010931391.1|  PREDICTED: probable inactive receptor kinase...  54.3    9e-06   
ref|XP_002456542.1|  hypothetical protein SORBIDRAFT_03g038110        54.3    9e-06   
ref|XP_008813231.1|  PREDICTED: probable inactive receptor kinase...  54.3    1e-05   
ref|XP_010543666.1|  PREDICTED: probable leucine-rich repeat rece...  54.3    1e-05   
ref|XP_010543665.1|  PREDICTED: probable leucine-rich repeat rece...  54.3    1e-05   
emb|CDP13882.1|  unnamed protein product                              54.3    1e-05   
ref|XP_008813233.1|  PREDICTED: probable inactive receptor kinase...  54.3    1e-05   
ref|XP_007207849.1|  hypothetical protein PRUPE_ppa022997mg           54.3    1e-05   
gb|EYU36891.1|  hypothetical protein MIMGU_mgv1a0177022mg             53.9    1e-05   
ref|XP_009362770.1|  PREDICTED: probable inactive receptor kinase...  53.9    1e-05   
gb|EYU35188.1|  hypothetical protein MIMGU_mgv1a002709mg              53.9    1e-05   
ref|XP_003564492.1|  PREDICTED: probable inactive receptor kinase...  53.9    1e-05   
ref|XP_006591269.1|  PREDICTED: probable inactive receptor kinase...  53.9    1e-05   
ref|XP_003537367.2|  PREDICTED: probable inactive receptor kinase...  53.9    1e-05   
ref|XP_003523287.1|  PREDICTED: probable inactive receptor kinase...  53.9    1e-05   
ref|XP_004302522.1|  PREDICTED: probable inactive receptor kinase...  53.5    2e-05   
ref|XP_003568238.1|  PREDICTED: probable inactive receptor kinase...  53.5    2e-05   
ref|XP_009590190.1|  PREDICTED: probable inactive receptor kinase...  53.5    2e-05   
ref|XP_002441272.1|  hypothetical protein SORBIDRAFT_09g023570        53.5    2e-05   
ref|XP_004492584.1|  PREDICTED: probable inactive receptor kinase...  53.5    2e-05   
ref|XP_002513601.1|  ATP binding protein, putative                    53.5    2e-05   
ref|XP_003519295.1|  PREDICTED: probable inactive receptor kinase...  53.5    2e-05   
ref|XP_009607078.1|  PREDICTED: probable inactive receptor kinase...  53.5    2e-05   
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...  53.1    2e-05   
ref|XP_004970381.1|  PREDICTED: probable inactive receptor kinase...  53.1    2e-05   
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...  53.1    2e-05   
ref|XP_007141021.1|  hypothetical protein PHAVU_008G160700g           53.1    2e-05   
ref|XP_006654545.1|  PREDICTED: probable inactive receptor kinase...  53.1    2e-05   
ref|XP_004961732.1|  PREDICTED: probable inactive receptor kinase...  53.1    2e-05   
ref|XP_008244579.1|  PREDICTED: probable inactive receptor kinase...  53.1    3e-05   
ref|XP_004172749.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  52.8    3e-05   
ref|XP_004142674.1|  PREDICTED: probable inactive receptor kinase...  52.8    3e-05   
ref|XP_007011392.1|  Leucine-rich repeat protein kinase family pr...  52.8    3e-05   
ref|XP_010670041.1|  PREDICTED: probable inactive receptor kinase...  52.8    3e-05   
ref|XP_007011393.1|  Leucine-rich repeat protein kinase family pr...  52.8    3e-05   
ref|XP_009406050.1|  PREDICTED: probable inactive receptor kinase...  52.8    3e-05   
ref|XP_004294716.1|  PREDICTED: probable inactive receptor kinase...  52.8    3e-05   
ref|XP_010555780.1|  PREDICTED: probable inactive receptor kinase...  52.8    3e-05   
ref|XP_009798129.1|  PREDICTED: probable inactive receptor kinase...  52.4    4e-05   
ref|XP_003616055.1|  Leucine-rich repeat receptor-like protein ki...  52.4    4e-05   
ref|XP_006289209.1|  hypothetical protein CARUB_v10002657mg           52.4    4e-05   
ref|XP_008463277.1|  PREDICTED: probable inactive receptor kinase...  52.4    5e-05   
ref|XP_007141331.1|  hypothetical protein PHAVU_008G186900g           52.0    5e-05   
ref|XP_008794990.1|  PREDICTED: probable inactive receptor kinase...  52.0    5e-05   
gb|EYU42048.1|  hypothetical protein MIMGU_mgv1a003031mg              52.0    5e-05   
gb|EMT10528.1|  Putative inactive receptor kinase                     52.0    6e-05   
ref|XP_010925785.1|  PREDICTED: probable inactive receptor kinase...  51.6    7e-05   
ref|XP_002319979.1|  putative plant disease resistance family pro...  51.6    7e-05   
ref|XP_004490727.1|  PREDICTED: probable inactive receptor kinase...  51.6    8e-05   
ref|NP_001055854.1|  Os05g0480400                                     51.2    9e-05   
gb|EEE64112.1|  hypothetical protein OsJ_18944                        51.2    9e-05   
tpg|DAA57078.1|  TPA: putative leucine-rich repeat receptor-like ...  51.2    9e-05   
ref|NP_176603.1|  putative inactive receptor-like protein kinase      51.2    9e-05   
ref|XP_006842563.1|  hypothetical protein AMTR_s00077p00144650        50.8    1e-04   
ref|XP_007017100.1|  Leucine-rich repeat protein kinase family pr...  51.2    1e-04   
ref|XP_009758202.1|  PREDICTED: probable inactive receptor kinase...  50.8    1e-04   
ref|XP_009386109.1|  PREDICTED: probable inactive receptor kinase...  50.8    1e-04   
gb|KEH23299.1|  LRR receptor-like kinase                              50.4    2e-04   
ref|XP_002533837.1|  Nodulation receptor kinase precursor, putative   50.4    2e-04   
ref|XP_010915719.1|  PREDICTED: probable inactive receptor kinase...  50.4    2e-04   
gb|KEH40435.1|  LRR receptor-like kinase                              50.4    2e-04   
gb|EPS60741.1|  hypothetical protein M569_14060                       50.4    2e-04   
ref|XP_009384331.1|  PREDICTED: probable inactive receptor kinase...  50.4    2e-04   
ref|XP_008649769.1|  PREDICTED: probable inactive receptor kinase...  50.4    2e-04   
gb|KDP21848.1|  hypothetical protein JCGZ_00635                       50.4    2e-04   
ref|XP_009391668.1|  PREDICTED: probable inactive receptor kinase...  50.4    2e-04   
ref|NP_196135.1|  putative leucine-rich repeat receptor-like prot...  50.1    2e-04   
ref|XP_008388374.1|  PREDICTED: probable inactive receptor kinase...  50.1    2e-04   
ref|XP_006391655.1|  hypothetical protein EUTSA_v10024075mg           50.1    2e-04   
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative   50.1    3e-04   
ref|XP_008388375.1|  PREDICTED: probable inactive receptor kinase...  50.1    3e-04   
ref|XP_008788112.1|  PREDICTED: probable inactive receptor kinase...  49.7    3e-04   
ref|NP_001169737.1|  uncharacterized LOC100383618 precursor           49.7    3e-04   
ref|XP_003544939.1|  PREDICTED: probable inactive receptor kinase...  49.7    3e-04   
gb|KDP45679.1|  hypothetical protein JCGZ_17286                       49.7    3e-04   
ref|XP_002887913.1|  hypothetical protein ARALYDRAFT_337960           49.7    3e-04   
ref|XP_004145918.1|  PREDICTED: probable inactive receptor kinase...  49.7    3e-04   
gb|KGN49888.1|  hypothetical protein Csa_5G139660                     49.7    3e-04   
ref|XP_004308997.1|  PREDICTED: probable inactive receptor kinase...  49.7    3e-04   
ref|XP_006645650.1|  PREDICTED: probable inactive receptor kinase...  49.7    4e-04   
ref|XP_010452417.1|  PREDICTED: probable leucine-rich repeat rece...  49.3    4e-04   
gb|EMT12910.1|  Putative inactive receptor kinase                     49.3    4e-04   
ref|XP_010491047.1|  PREDICTED: probable leucine-rich repeat rece...  49.3    4e-04   
ref|XP_009363779.1|  PREDICTED: probable inactive receptor kinase...  49.3    4e-04   
ref|XP_010423497.1|  PREDICTED: probable leucine-rich repeat rece...  49.3    4e-04   
ref|XP_008376328.1|  PREDICTED: probable inactive receptor kinase...  49.3    4e-04   
ref|XP_009410507.1|  PREDICTED: probable inactive receptor kinase...  48.9    5e-04   
ref|XP_004287382.1|  PREDICTED: probable inactive receptor kinase...  48.9    6e-04   
ref|XP_006398978.1|  hypothetical protein EUTSA_v10012946mg           48.9    6e-04   
gb|KCW50324.1|  hypothetical protein EUGRSUZ_J00100                   48.5    7e-04   
ref|XP_010031063.1|  PREDICTED: probable inactive receptor kinase...  48.5    7e-04   
ref|XP_008437572.1|  PREDICTED: probable inactive receptor kinase...  48.5    7e-04   
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...  48.1    0.001   
ref|XP_008803002.1|  PREDICTED: probable inactive receptor kinase...  48.1    0.001   



>ref|XP_011073578.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +3

Query  330  SLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVAL  479
            +L+E+DK ALL+FVN L HLRSLNW+EEL VC NWTG+ CSEDGSRVV++
Sbjct  29   TLLESDKNALLDFVNKLPHLRSLNWSEELPVCRNWTGISCSEDGSRVVSV  78



>ref|XP_006343895.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Solanum 
tuberosum]
Length=642

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  330  SLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +L+ENDKQALL+FVN L HL  LNW+   SVC NWTGVGC+EDGSRV+AL L
Sbjct  31   ALLENDKQALLDFVNQLPHLHPLNWDANSSVCKNWTGVGCNEDGSRVIALRL  82



>ref|XP_004245544.1| PREDICTED: probable inactive receptor kinase At4g23740 [Solanum 
lycopersicum]
Length=642

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  330  SLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +L+ENDKQALL+FVN L HL  LNW+   SVC NWTGVGC+EDGSRV+AL L
Sbjct  31   ALLENDKQALLDFVNQLPHLHPLNWDANSSVCKNWTGVGCNEDGSRVIALRL  82



>ref|XP_009629119.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
Length=648

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  333  LVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            LVENDKQALL+FVN L HL  LNW+   SVC NWTGV C+EDGSRV+AL L
Sbjct  38   LVENDKQALLDFVNKLPHLHPLNWDANFSVCKNWTGVTCNEDGSRVIALRL  88



>ref|XP_009799943.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
Length=649

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  333  LVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            LVENDKQALL+FVN L HL  LNW+    +C NWTGV CSEDGSRV+AL L
Sbjct  39   LVENDKQALLDFVNKLPHLHPLNWDANSPICKNWTGVTCSEDGSRVIALRL  89



>gb|EYU23390.1| hypothetical protein MIMGU_mgv1a003016mg [Erythranthe guttata]
Length=615

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  330  SLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +L+E DKQALL+F  NLRH R LNWN +L VC NWTG+ CSEDGSRV ++ L
Sbjct  28   TLLETDKQALLDFSYNLRHSRPLNWNSQLPVCKNWTGITCSEDGSRVTSVRL  79



>ref|XP_011080874.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  330  SLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +L+E+DKQALL+F +   HLR LNWNE+  VC NWTGV CSEDG+RV+++ L
Sbjct  29   TLLESDKQALLDFASKFAHLRPLNWNEQYPVCKNWTGVTCSEDGNRVISVRL  80



>emb|CDP12117.1| unnamed protein product [Coffea canephora]
Length=635

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  330  SLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +LV NDKQALL+F   L HLRSLNW+E   VC NWTGV C+EDGSRV++L L
Sbjct  27   TLVGNDKQALLDFEKKLPHLRSLNWDENSPVCKNWTGVSCNEDGSRVISLRL  78



>gb|KDO76442.1| hypothetical protein CISIN_1g006922mg [Citrus sinensis]
Length=625

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL+FVNNL H RSLNWNE  SVC +WTGV CSEDG RVVA+ L
Sbjct  27   DKEALLDFVNNLPHSRSLNWNESTSVCNHWTGVKCSEDGKRVVAVRL  73



>ref|XP_006476438.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Citrus 
sinensis]
Length=625

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL+FVNNL H RSLNWNE  SVC +WTGV CSEDG RVVA+ L
Sbjct  27   DKEALLDFVNNLPHSRSLNWNESTSVCNHWTGVKCSEDGKRVVAVRL  73



>ref|XP_006439412.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
 gb|ESR52652.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
Length=625

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL+FVNNL H RSLNWNE  SVC +WTGV CSEDG RVVA+ L
Sbjct  27   DKEALLDFVNNLPHSRSLNWNESASVCNHWTGVKCSEDGKRVVAVRL  73



>ref|XP_007040424.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040425.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007040426.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24925.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24926.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24927.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=626

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FVNNLRH RSLNWNE   VC NWTGV C+ DGSR+ A+ L
Sbjct  27   DKQALLDFVNNLRHSRSLNWNETSPVCNNWTGVTCNADGSRITAVRL  73



>ref|XP_011026937.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Populus euphratica]
Length=652

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FVNNL H RSLNWNE   VC NWTGV CS DG+RV+A+ L
Sbjct  53   DKQALLDFVNNLPHSRSLNWNESSPVCNNWTGVICSGDGTRVIAVRL  99



>ref|XP_011026938.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
 ref|XP_011026939.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
Length=626

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FVNNL H RSLNWNE   VC NWTGV CS DG+RV+A+ L
Sbjct  27   DKQALLDFVNNLPHSRSLNWNESSPVCNNWTGVICSGDGTRVIAVRL  73



>ref|XP_002299495.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE84300.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FVNNL H RSLNWNE   VC NWTGV CS DG+RV+A+ L
Sbjct  27   DKQALLDFVNNLPHSRSLNWNESSPVCNNWTGVICSGDGTRVIAVRL  73



>ref|XP_002509916.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51303.1| ATP binding protein, putative [Ricinus communis]
Length=536

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FVN L H R LNWNE   VC NWTGV CS+DGSRV+AL L
Sbjct  27   DKQALLDFVNKLHHSRLLNWNESSPVCSNWTGVTCSKDGSRVIALRL  73



>ref|XP_007210296.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica]
 gb|EMJ11495.1| hypothetical protein PRUPE_ppa002579mg [Prunus persica]
Length=656

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FVNNL H RSLNWNE   VC +WTGV CSED S V+A+ L
Sbjct  54   DKQALLDFVNNLPHSRSLNWNESSPVCDHWTGVTCSEDKSYVIAVRL  100



>ref|XP_010662595.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662596.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662597.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662598.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
Length=628

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+NN+ H R+LNWNE  SVC  WTGV CS D SRV+AL L
Sbjct  27   DKQALLDFLNNINHSRTLNWNEYSSVCNTWTGVTCSGDHSRVIALHL  73



>ref|XP_011022559.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=622

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FVN L H RSLNWNE   VC NW+GV CS DG+RV+++ L
Sbjct  27   DKQALLDFVNYLPHSRSLNWNESSPVCKNWSGVICSGDGTRVISVRL  73



>emb|CBI22555.3| unnamed protein product [Vitis vinifera]
Length=660

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+NN+ H R+LNWNE  SVC  WTGV CS D SRV+AL L
Sbjct  27   DKQALLDFLNNINHSRTLNWNEYSSVCNTWTGVTCSGDHSRVIALHL  73



>ref|XP_010676354.1| PREDICTED: probable inactive receptor kinase At4g23740 [Beta 
vulgaris subsp. vulgaris]
Length=617

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  330  SLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            SL+++DK+ALL+FVNN+ HL +LNW++  S+C NWTG+ C+ D SRV+A+ L
Sbjct  26   SLLDDDKKALLDFVNNVPHLHALNWSKSSSICSNWTGITCNADLSRVIAVRL  77



>ref|XP_009760496.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760502.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760506.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++D+QALLEF N++ H+R LNWN  L +C +W GV C++DG+RV+A+ L
Sbjct  37   LDSDRQALLEFANSVPHIRKLNWNLALPICYSWAGVTCNKDGTRVIAIHL  86



>ref|XP_010053173.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010053174.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW77437.1| hypothetical protein EUGRSUZ_D01777 [Eucalyptus grandis]
Length=634

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DK+ALL+FVNNL H R+LNW+E+  VC +W GV CS DGSR+VA+ L
Sbjct  26   DDKRALLDFVNNLPHSRNLNWSEDSPVCGHWAGVTCSGDGSRIVAVRL  73



>ref|XP_009760490.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Nicotiana sylvestris]
Length=717

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++D+QALLEF N++ H+R LNWN  L +C +W GV C++DG+RV+A+ L
Sbjct  108  LDSDRQALLEFANSVPHIRKLNWNLALPICYSWAGVTCNKDGTRVIAIHL  157



>ref|XP_008392458.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=629

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+NNL H R+LNWNE   VC +WTGV CSED S V+A+ L
Sbjct  27   DKQALLDFLNNLPHSRTLNWNESGPVCDHWTGVTCSEDKSHVIAVRL  73



>ref|XP_009352353.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009352354.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=629

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+NNL H R+LNWNE   VC +WTGV CSED S V+A+ L
Sbjct  27   DKQALLDFLNNLPHSRTLNWNESGPVCDHWTGVTCSEDKSHVIAVRL  73



>ref|XP_010055829.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055830.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055831.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055832.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW72378.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72379.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72380.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
Length=634

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
             DKQALL+F +NL H R LNW E   VC NW GV C +DGSRV+AL L
Sbjct  30   GDKQALLDFADNLPHSRYLNWTESSPVCSNWVGVTCDKDGSRVIALRL  77



>ref|XP_008239079.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008239080.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
Length=629

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FVNNL H RSLNWN    VC +WTGV CSED S V+A+ L
Sbjct  27   DKQALLDFVNNLPHSRSLNWNVSSPVCDHWTGVTCSEDKSYVIAVRL  73



>ref|XP_006490586.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Citrus 
sinensis]
Length=619

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ + RSLNWNE  S+C +WTGV CS D SRVVAL L
Sbjct  32   DKQALLDFIHNIHNSRSLNWNESSSLCKSWTGVTCSADHSRVVALRL  78



>gb|KDO56147.1| hypothetical protein CISIN_1g007167mg [Citrus sinensis]
Length=615

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ + RSLNWNE  S+C +WTGV CS D SRVVAL L
Sbjct  28   DKQALLDFIHNIHNSRSLNWNESSSLCKSWTGVTCSADHSRVVALRL  74



>gb|KDP25339.1| hypothetical protein JCGZ_20495 [Jatropha curcas]
Length=627

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            D +ALL+F +NL H RSLNWNE   VC NWTG+ CSED SRV+A+ L
Sbjct  27   DMRALLDFASNLPHSRSLNWNESYPVCNNWTGITCSEDRSRVIAVRL  73



>ref|XP_006413522.1| hypothetical protein EUTSA_v10024674mg [Eutrema salsugineum]
 gb|ESQ54975.1| hypothetical protein EUTSA_v10024674mg [Eutrema salsugineum]
Length=630

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF++ +R  RSLNWNE  SVC  WTGV C++DGSRV+A+ L
Sbjct  28   DKRALLEFLSIMRPTRSLNWNESSSVCKTWTGVTCNQDGSRVIAVRL  74



>ref|XP_006422104.1| hypothetical protein CICLE_v10004549mg [Citrus clementina]
 gb|ESR35344.1| hypothetical protein CICLE_v10004549mg [Citrus clementina]
Length=626

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ + RSLNWNE  S+C +WTGV CS D SRVVAL L
Sbjct  32   DKQALLDFIHNIHNSRSLNWNESSSLCKSWTGVTCSADHSRVVALRL  78



>gb|EYU25187.1| hypothetical protein MIMGU_mgv1a002923mg [Erythranthe guttata]
Length=625

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+ N+ H R+LNW+  L VC NWTGV C+ D SRV+A+ L
Sbjct  32   DKQALLDFIANVNHTRNLNWDSRLLVCSNWTGVTCNHDNSRVIAVRL  78



>ref|XP_009607538.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607539.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607540.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607541.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=690

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++D+QALLEF N++ H+R LNWN  + +C +W G+ C++DG+RV+A+ L
Sbjct  74   LDSDRQALLEFANSVPHIRKLNWNLTIPICKSWAGITCNKDGTRVIAIHL  123



>gb|KJB19053.1| hypothetical protein B456_003G082600 [Gossypium raimondii]
 gb|KJB19054.1| hypothetical protein B456_003G082600 [Gossypium raimondii]
Length=630

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FVN + H R+LNWN+   VC NWTGV C+  GSR++A+ L
Sbjct  27   DKQALLDFVNKMPHSRALNWNQTSPVCNNWTGVTCNAGGSRIIAVRL  73



>ref|XP_009336254.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=654

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F NN  H R LNWN+  SVC +WTGV CSED S V+A+ L
Sbjct  52   DKQALLDFANNFPHSRPLNWNQSSSVCDHWTGVTCSEDKSYVIAVRL  98



>ref|XP_011001931.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001932.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001933.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL+F++N+RH   +NW+E  SVC +WTGV CS D SRV AL L
Sbjct  30   DDKQALLDFLHNIRHSHPVNWHENTSVCNSWTGVSCSNDNSRVTALRL  77



>ref|XP_011001936.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011001938.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL+F++N+RH   +NW+E  SVC +WTGV CS D SRV AL L
Sbjct  30   DDKQALLDFLHNIRHSHPVNWHENTSVCNSWTGVSCSNDNSRVTALRL  77



>ref|XP_004235218.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318222.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318223.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318224.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=635

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++D+QALL+F  ++ H+R LNWN  L +C +W G+ C+EDG+RV+A+ L
Sbjct  27   LDSDRQALLDFAESVPHIRKLNWNLALPICKSWAGIACNEDGTRVIAIHL  76



>ref|XP_006357316.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Solanum 
tuberosum]
Length=592

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DK ALL+F  ++ HLR LNWN  LS+C +W G+ C++DG+RVVA+ L
Sbjct  27   LDSDKHALLQFAASVPHLRKLNWNSALSICNSWIGITCNKDGTRVVAIHL  76



>ref|XP_010421220.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
Length=614

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            D+QALL+F+NN+ H RSL WN    VC  W GV C +DG+RV AL L
Sbjct  32   DRQALLDFLNNITHPRSLTWNASTPVCATWPGVTCDKDGTRVTALHL  78



>ref|XP_006287298.1| hypothetical protein CARUB_v10000491mg [Capsella rubella]
 gb|EOA20196.1| hypothetical protein CARUB_v10000491mg [Capsella rubella]
Length=613

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +  D+QALL+F+NN+ H RSL WN   SVC  W+GV C  DG+RV AL L
Sbjct  29   LSGDRQALLDFLNNITHPRSLAWNASSSVCATWSGVTCDRDGTRVTALHL  78



>ref|XP_010493544.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
 ref|XP_010493545.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
 ref|XP_010493546.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
 ref|XP_010493547.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
Length=613

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            D+QALL+F+NN+ H RSL WN    VC  W GV C +DG+RV AL L
Sbjct  32   DRQALLDFLNNITHPRSLTWNASTPVCATWPGVTCDKDGTRVTALHL  78



>ref|XP_010658906.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658908.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658911.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010658915.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
Length=628

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALLEFV++L HL  +NW+++  VC NWTGV CS+D S+V+++ L
Sbjct  26   DDKQALLEFVSHLPHLHPINWDKDSPVCNNWTGVTCSDDKSQVISVRL  73



>ref|XP_006280204.1| hypothetical protein CARUB_v10026109mg [Capsella rubella]
 gb|EOA13102.1| hypothetical protein CARUB_v10026109mg [Capsella rubella]
Length=604

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DK +LL+FVNN+ H  SLNW+  LS+C  WTGV CS D S VVAL L
Sbjct  23   IKEDKHSLLQFVNNVNHSHSLNWSPNLSICTQWTGVTCSSDHSSVVALRL  72



>ref|XP_009368693.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009368694.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=630

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+NN+ H RS+ WNE  SVC  W GV CS+D SRV+ L L
Sbjct  28   DKQALLDFINNISHSRSIKWNENSSVCETWNGVICSKDQSRVIELHL  74



>ref|XP_009357339.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=627

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+NN+ H RS+ WNE  SVC  W GV CS+D SRV+ L L
Sbjct  28   DKQALLDFINNISHSRSIKWNENSSVCETWNGVICSKDQSRVIELHL  74



>ref|XP_008376682.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=629

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ H RS+ WNE  SVC  W GV CSED SRV+ L L
Sbjct  27   DKQALLDFIHNISHSRSIKWNENSSVCETWNGVICSEDQSRVIELHL  73



>emb|CDY03527.1| BnaC01g15550D [Brassica napus]
Length=306

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF+  +R  RSLNWNE  SVC  WTGV C++DGSR+ A+ L
Sbjct  25   DKRALLEFLTLMRPTRSLNWNETTSVCNAWTGVTCNKDGSRITAVRL  71



>ref|XP_009137362.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brassica 
rapa]
Length=628

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF+  +R  RSLNWNE  SVC  WTGV C++DGSR+ A+ L
Sbjct  25   DKRALLEFLTLMRPTRSLNWNETTSVCNTWTGVTCNKDGSRITAVRL  71



>ref|XP_008439323.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008439324.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=631

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F +N+ H  SLNWNE  SVC  WTGV C+ D SRVVAL L
Sbjct  29   DKQALLDFFHNIPHSPSLNWNESSSVCKAWTGVFCNSDESRVVALRL  75



>ref|XP_002303623.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE78602.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FV+ L H RSLNW E   VC NW+GV CS DG+RV+++ L
Sbjct  27   DKQALLDFVHYLPHSRSLNWKESSPVCNNWSGVICSGDGTRVISVRL  73



>ref|XP_010454700.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Camelina sativa]
Length=613

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +D+QALL F+NN+ H RSL WN    VC  W GV C  DG+RV AL L
Sbjct  31   DDRQALLYFLNNITHPRSLTWNASTPVCATWPGVTCDRDGTRVTALHL  78



>ref|XP_011084477.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At4g23740 [Sesamum indicum]
Length=631

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL+F++N+ H R LNW+E+ S C NWTG+ C+ D SRV+A+ L
Sbjct  27   DKRALLDFIDNIYHSRKLNWDEKTSACNNWTGITCNHDNSRVIAVRL  73



>ref|XP_008234792.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008234793.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
 ref|XP_008234794.1| PREDICTED: probable inactive receptor kinase At4g23740 [Prunus 
mume]
Length=629

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ H  S+ WN+  SVC NWTGV CSED SR++ L L
Sbjct  27   DKQALLDFLHNISHSNSIKWNDNSSVCKNWTGVICSEDQSRIIELHL  73



>ref|XP_007220432.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 ref|XP_007220433.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 gb|EMJ21631.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
 gb|EMJ21632.1| hypothetical protein PRUPE_ppa002831mg [Prunus persica]
Length=629

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ H  S+ WN+  SVC NWTGV CSED SR++ L L
Sbjct  27   DKQALLDFLHNISHSNSIKWNDNSSVCKNWTGVICSEDQSRIIELHL  73



>ref|XP_006358156.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358157.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=635

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++D+QALL+F  ++ H+R LNWN  L +C +W G+ C++DG+RV+A+ L
Sbjct  27   LDSDRQALLDFAESVPHIRKLNWNLALPICKSWAGIACNKDGTRVIAIHL  76



>ref|XP_008456255.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008456256.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=630

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +E+DKQALL+F +++ H RSL+WN+  SVC +W GV CS DG+ V+ L L
Sbjct  26   LESDKQALLDFASSVPHRRSLDWNDTTSVCTSWVGVTCSADGTHVLTLRL  75



>gb|AAL09719.1| AT3g08680/F17O14_15 [Arabidopsis thaliana]
 gb|AAN18066.1| At3g08680/F17O14_15 [Arabidopsis thaliana]
Length=382

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVAL  479
            +E+DKQALLEF + + H R LNWN  + +C +WTG+ CS++ +RV AL
Sbjct  25   IESDKQALLEFASLVPHSRKLNWNSTIPICASWTGITCSKNNARVTAL  72



>ref|XP_004308019.1| PREDICTED: probable inactive receptor kinase At4g23740 [Fragaria 
vesca subsp. vesca]
Length=699

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ H R LNW+E  SVC NWT V C++D SR++ L L
Sbjct  28   DKQALLDFLHNVSHTRPLNWSENSSVCGNWTAVICNKDESRIIELHL  74



>emb|CDY47625.1| BnaA01g13400D [Brassica napus]
Length=662

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF+  +R  RSLNWNE  SVC  WTGV C++DGSR+ A+ L
Sbjct  59   DKRALLEFLTLMRPTRSLNWNETTSVCNAWTGVTCNKDGSRITAVRL  105



>ref|XP_010244554.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244555.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244556.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244557.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244558.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=642

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +D+QALL+FV+ + H R LNWN    +C  W GV CS+DG+RVVAL L
Sbjct  30   SDRQALLDFVDAVPHGRKLNWNSSSPICSTWVGVTCSQDGTRVVALRL  77



>ref|XP_010104998.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC02955.1| putative inactive receptor kinase [Morus notabilis]
Length=646

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+  L H R LNWNE   VC +WTG+ CS+D SRV+A+ L
Sbjct  27   DKQALLDFMTKLPHSRPLNWNETSPVCGHWTGITCSDDKSRVLAVRL  73



>ref|XP_006350601.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006350602.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006350603.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X3 [Solanum tuberosum]
Length=629

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL+F+NN+ H R+LNW+E  S C +WTGV C+ D SR++A+ L
Sbjct  31   DKEALLDFLNNVNHTRNLNWDERTSACSSWTGVTCNHDKSRIIAIRL  77



>emb|CDY35996.1| BnaA05g29540D [Brassica napus]
Length=635

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVAL  479
            +++DKQALLEF + + H+R LNWN  L +C +WTG+ CS++  RV AL
Sbjct  22   IDSDKQALLEFASLVPHVRKLNWNTTLPICTSWTGITCSKNNDRVTAL  69



>ref|XP_007038934.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY23435.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=630

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+ ++ H RS NW++E SVC +WTGV C  D SRV+AL L
Sbjct  27   DKQALLDFLEHVHHSRSFNWSKETSVCNSWTGVTCDNDHSRVIALRL  73



>ref|XP_004139930.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 ref|XP_004154555.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 gb|KGN46766.1| hypothetical protein Csa_6G133750 [Cucumis sativus]
Length=630

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +E+DKQALL+F +++ H RSLNWN+   +C +W GV CS DG+ V+ L L
Sbjct  26   LESDKQALLDFASSVPHRRSLNWNDTTPICTSWVGVTCSADGTHVLTLRL  75



>ref|XP_009146990.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=635

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVAL  479
            +E DKQALLEF + + H+R LNWN  L +C +WTG+ CS++  RV AL
Sbjct  22   LETDKQALLEFASLVPHVRKLNWNTTLPICTSWTGITCSKNNDRVTAL  69



>ref|XP_008437363.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437364.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437365.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437367.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=628

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK ALL+FV NL H RSLNWN    VC  WTG+ CS+D SRV+A+ L
Sbjct  27   DKLALLDFVKNLPHSRSLNWNAASPVCHYWTGITCSQDESRVIAVRL  73



>emb|CDY27986.1| BnaC05g43880D [Brassica napus]
Length=631

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DKQALLEF + + H+R LNWN  + +C +WTG+ CS++ +RV AL L
Sbjct  22   IDTDKQALLEFASLVPHVRKLNWNTTIPICTSWTGITCSKNNARVTALRL  71



>ref|XP_004143879.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 gb|KGN50039.1| hypothetical protein Csa_5G151550 [Cucumis sativus]
Length=628

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK ALL+FV NL H RSLNWN    VC  WTG+ CS+D SRV+A+ L
Sbjct  27   DKLALLDFVKNLPHSRSLNWNAASPVCHYWTGITCSQDESRVIAVRL  73



>ref|XP_004167870.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At4g23740-like [Cucumis sativus]
Length=628

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK ALL+FV NL H RSLNWN    VC  WTG+ CS+D SRV+A+ L
Sbjct  27   DKLALLDFVKNLPHSRSLNWNAASPVCHYWTGITCSQDESRVIAVRL  73



>ref|XP_002317741.1| hypothetical protein POPTR_0012s01230g [Populus trichocarpa]
 gb|EEE95961.1| hypothetical protein POPTR_0012s01230g [Populus trichocarpa]
Length=633

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL+F++N+ H   +NW+E  SVC +WTGV CS D SRV AL L
Sbjct  30   DDKQALLDFLHNILHSHPVNWHENTSVCNSWTGVSCSNDNSRVTALRL  77



>ref|XP_010445702.1| PREDICTED: probable inactive receptor kinase At5g53320 [Camelina 
sativa]
Length=605

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DK ALL+FVNN+ H  SLNW+ +LS+C  W GV C+ D S VVAL L
Sbjct  24   IKEDKHALLQFVNNVNHSHSLNWSPKLSICTEWAGVTCNSDRSSVVALHL  73



>gb|KDO64166.1| hypothetical protein CISIN_1g006747mg [Citrus sinensis]
Length=632

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL+F  N+ H R LNWN   SVC +W G+ C+++GSRV+A+ L
Sbjct  25   SDKQALLDFAANVPHARKLNWNSSTSVCTSWVGITCTKNGSRVLAVRL  72



>ref|NP_187480.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_974257.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9C9Y8.1|Y3868_ARATH RecName: Full=Probable inactive receptor kinase At3g08680; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51359.1|AC012562_20 putative protein kinase; 49514-51513 [Arabidopsis thaliana]
 gb|ACN59313.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE74662.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AEE74663.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=640

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +E+DKQALLEF + + H R LNWN  + +C +WTG+ CS++ +RV AL L
Sbjct  25   IESDKQALLEFASLVPHSRKLNWNSTIPICASWTGITCSKNNARVTALRL  74



>ref|XP_006429632.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
 ref|XP_006481232.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 ref|XP_006481233.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006481234.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR42872.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
Length=632

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL+F  N+ H R LNWN   SVC +W G+ C+++GSRV+A+ L
Sbjct  25   SDKQALLDFAANVPHARKLNWNSSTSVCTSWVGITCTKNGSRVLAVRL  72



>gb|ACC91242.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis 
halleri]
Length=636

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF+  +R  RSLNWNE   VC  WTGV C++DGSR++A+ L
Sbjct  27   DKRALLEFLTIMRPTRSLNWNETSQVCNIWTGVTCNQDGSRIIAVRL  73



>gb|EYU19612.1| hypothetical protein MIMGU_mgv1a026050mg, partial [Erythranthe 
guttata]
Length=560

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FV ++   R LNWNE  SVC NWTG+ C  D SRVVA+ L
Sbjct  29   DKQALLDFVADINLSRKLNWNETSSVCNNWTGITCDRDNSRVVAIRL  75



>ref|XP_002869766.1| hypothetical protein ARALYDRAFT_914223 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46025.1| hypothetical protein ARALYDRAFT_914223 [Arabidopsis lyrata subsp. 
lyrata]
Length=637

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF+  +R  RSLNWNE   VC  WTGV C++DGSR++A+ L
Sbjct  27   DKRALLEFLTIMRPTRSLNWNETSQVCNIWTGVTCNQDGSRIIAVRL  73



>ref|XP_002882579.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58838.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +E+DKQALLEF + + H R LNWN  + +C +WTG+ CS++ +RV AL L
Sbjct  24   IESDKQALLEFASLVPHSRKLNWNSTIPICGSWTGITCSKNNARVTALRL  73



>ref|XP_010463311.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At3g08680 [Camelina sativa]
Length=637

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +E+DKQALLEF + + H R LNWN  + +C +WTG+ CS++ +RV AL L
Sbjct  26   IESDKQALLEFASLVPHSRKLNWNSSIPICGSWTGITCSKNNARVTALRL  75



>gb|KEH21182.1| LRR receptor-like kinase [Medicago truncatula]
Length=639

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ LL+FVN     R+LNWN+  SVC NWTGV C+ED SRV+A+ L
Sbjct  23   DKEVLLDFVNKFPPSRTLNWNQSSSVCDNWTGVTCNEDRSRVIAIRL  69



>ref|XP_004149452.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 ref|XP_004164694.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 gb|KGN57874.1| hypothetical protein Csa_3G358620 [Cucumis sativus]
Length=630

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F +N+ H  SLNWN+  SVC  WTGV C+ D S+VVAL L
Sbjct  29   DKQALLDFFHNIPHSPSLNWNQSSSVCKAWTGVFCNSDESKVVALRL  75



>ref|XP_006297193.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 ref|XP_006297194.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30091.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30092.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
Length=633

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +E+DKQALLEF + + H R LNWN  + +C +WTG+ CS++ +RV AL L
Sbjct  25   IESDKQALLEFASLVPHSRKLNWNSSIPICNSWTGITCSKNNARVTALRL  74



>ref|XP_011076041.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076042.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076043.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
 ref|XP_011076044.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=627

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DK+ALL+F+ N+ H R+LNW+E  S C +WTGV C+ D S+++A+ L
Sbjct  26   DDKRALLDFIGNISHSRNLNWDERTSACNSWTGVTCNHDRSKIIAVRL  73



>ref|XP_010464477.1| PREDICTED: probable inactive receptor kinase At3g08680 [Camelina 
sativa]
Length=638

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +E+DKQALLEF + + H R LNWN  + +C +WTG+ CS++ +RV AL L
Sbjct  27   IESDKQALLEFASLVPHSRKLNWNSSIPICDSWTGITCSKNNARVTALRL  76



>ref|XP_010482722.1| PREDICTED: probable inactive receptor kinase At5g53320 [Camelina 
sativa]
Length=607

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DK ALL+FVN + H  SLNW+ +LS+C  W GV CS D S VVAL L
Sbjct  26   IKEDKHALLQFVNYVNHSHSLNWSPKLSICTEWAGVTCSSDRSSVVALHL  75



>gb|KCW46493.1| hypothetical protein EUGRSUZ_K00318 [Eucalyptus grandis]
Length=451

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+ N+   R LNWN++ SVC +WTGV C+ D SRVVAL L
Sbjct  28   DKQALLDFLGNVSLSRPLNWNKDSSVCRSWTGVKCNNDQSRVVALQL  74



>ref|XP_010453493.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453499.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453515.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL F +++ HLR LNWN    +C +W GV C+ DG+RV+AL L
Sbjct  43   LNSDRQALLAFASSVPHLRRLNWNSTNQICKSWVGVTCTSDGTRVLALRL  92



>ref|XP_010035197.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW46492.1| hypothetical protein EUGRSUZ_K00318 [Eucalyptus grandis]
Length=633

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +3

Query  330  SLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++   DKQALL+F+ N+   R LNWN++ SVC +WTGV C+ D SRVVAL L
Sbjct  23   AIPNEDKQALLDFLGNVSLSRPLNWNKDSSVCRSWTGVKCNNDQSRVVALQL  74



>ref|XP_006401720.1| hypothetical protein EUTSA_v10013013mg [Eutrema salsugineum]
 gb|ESQ43173.1| hypothetical protein EUTSA_v10013013mg [Eutrema salsugineum]
Length=605

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DK  LL+FV+N+ H  SLNW+  LS+C  WTGV C+ D S VVAL L
Sbjct  29   IKEDKHTLLQFVSNINHSHSLNWSPNLSICTQWTGVTCNSDHSNVVALHL  78



>ref|NP_197798.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9FL63.1|Y5410_ARATH RecName: Full=Inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB11570.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAO64924.1| At5g24100 [Arabidopsis thaliana]
 dbj|BAE99411.1| receptor like protein kinase [Arabidopsis thaliana]
 gb|ACN59373.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED93256.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=614

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            D+QALL+F+NN+ H RSL WN    VC  W GV C  DG+RV AL L
Sbjct  33   DRQALLDFLNNIIHPRSLAWNTSSPVCTTWPGVTCDIDGTRVTALHL  79



>ref|XP_002520893.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF41602.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=581

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +DKQALL+F   + H+R LNWN  +SVC +W GV C+ +G+RV+A+ L
Sbjct  27   LNSDKQALLDFAAAVPHIRKLNWNTSISVCSSWFGVTCNSNGTRVMAIHL  76



>ref|XP_009374410.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=634

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            FS + +DKQALL+F N + H R L+WN    VC +W G+ C+ +G+RV++L L
Sbjct  23   FSDLTSDKQALLDFANAVPHRRKLSWNPATPVCTSWVGITCTPNGTRVISLRL  75



>ref|XP_007160136.1| hypothetical protein PHAVU_002G295600g [Phaseolus vulgaris]
 gb|ESW32130.1| hypothetical protein PHAVU_002G295600g [Phaseolus vulgaris]
Length=637

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL+FVN     R LNWNE   +C +WTGV C+ED SRV+A+ L
Sbjct  27   DKEALLDFVNKFPPSRPLNWNESSPMCASWTGVTCNEDKSRVIAIRL  73



>ref|NP_194105.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9SUQ3.1|Y4374_ARATH RecName: Full=Probable inactive receptor kinase At4g23740; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAA23040.1| putative receptor kinase [Arabidopsis thaliana]
 emb|CAB81292.1| putative receptor kinase [Arabidopsis thaliana]
 dbj|BAC42978.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAP40406.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|ACN59347.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE84800.1| Leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=638

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF+  ++  RSLNWNE   VC  WTGV C++DGSR++A+ L
Sbjct  29   DKRALLEFLTIMQPTRSLNWNETSQVCNIWTGVTCNQDGSRIIAVRL  75



>ref|XP_010059849.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010059857.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010059865.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW90565.1| hypothetical protein EUGRSUZ_A02671 [Eucalyptus grandis]
Length=665

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = +3

Query  333  LVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            LVE DKQALL+F+ N+ H    NWN++ SVC +WTGVGC+ D SRV++L L
Sbjct  25   LVE-DKQALLDFLQNIPHAHRPNWNKD-SVCQSWTGVGCNADSSRVISLRL  73



>ref|XP_004300851.1| PREDICTED: probable inactive receptor kinase At4g23740 [Fragaria 
vesca subsp. vesca]
Length=635

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+NN  H RSLNW+    VC +WTGV CS D S V+A+ L
Sbjct  28   DKQALLDFLNNHPHSRSLNWDSNTPVCDHWTGVTCSADKSHVIAVRL  74



>ref|XP_010251541.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
 ref|XP_010251542.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
 ref|XP_010251543.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nelumbo 
nucifera]
Length=636

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+FVN++ H R LNWN+   VC  WTGV C+ D +R++A+ L
Sbjct  27   DKQALLDFVNSIPHSRYLNWNQTCPVCDCWTGVTCNSDKTRIIAVRL  73



>gb|AES72427.2| LRR receptor-like kinase [Medicago truncatula]
Length=616

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ H    NW+E  SVC  W GV C+ DGSRV+A+ L
Sbjct  25   DKQALLDFLHNINHSPHFNWDENSSVCQTWRGVTCNTDGSRVIAIRL  71



>ref|XP_002872091.1| hypothetical protein ARALYDRAFT_489266 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48350.1| hypothetical protein ARALYDRAFT_489266 [Arabidopsis lyrata subsp. 
lyrata]
Length=615

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            D+QALL+F NN+ H RSL WN    VC  W GV C  DG+RV AL L
Sbjct  32   DRQALLDFRNNIVHPRSLAWNASSPVCTTWPGVTCDRDGTRVTALHL  78



>ref|XP_006280146.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
 gb|EOA13044.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
Length=658

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL F  ++ HLR LNWN    +C +W GV C+ DG+RV+AL L
Sbjct  45   LNSDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDGTRVLALRL  94



>dbj|BAE99195.1| receptor protein kinase like protein [Arabidopsis thaliana]
Length=601

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DK  LL+FVNN+ H  SLNW+  LS+C  WTGV C+ D S V AL L
Sbjct  23   IKEDKHTLLQFVNNINHSHSLNWSPSLSICTKWTGVTCNSDHSSVDALHL  72



>ref|XP_009123870.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
 ref|XP_009123879.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=618

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQALLEF + + H R LNWN    +C +WTG+ CS++ SRV AL L
Sbjct  20   IDSDKQALLEFASLVPHARKLNWNTTNPICTSWTGITCSKNNSRVTALRL  69



>ref|NP_200144.1| putative inactive receptor kinase [Arabidopsis thaliana]
 sp|Q9FK10.1|Y5332_ARATH RecName: Full=Probable inactive receptor kinase At5g53320; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB09794.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|ACF09413.1| At5g53320 [Arabidopsis thaliana]
 gb|ACN59392.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED96339.1| putative inactive receptor kinase [Arabidopsis thaliana]
Length=601

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DK  LL+FVNN+ H  SLNW+  LS+C  WTGV C+ D S V AL L
Sbjct  23   IKEDKHTLLQFVNNINHSHSLNWSPSLSICTKWTGVTCNSDHSSVDALHL  72



>ref|XP_006394667.1| hypothetical protein EUTSA_v10003837mg [Eutrema salsugineum]
 gb|ESQ31953.1| hypothetical protein EUTSA_v10003837mg [Eutrema salsugineum]
Length=615

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
             D+QALL+F+NN+ H RSL WN    +C  W GV C  DG+RV  L L
Sbjct  31   GDRQALLDFLNNITHPRSLAWNASSPICATWPGVTCDRDGTRVTGLRL  78



>ref|XP_010483401.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483402.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483407.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483408.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL F  ++ HLR LNWN    +C +W GV C+ DG+RV+AL L
Sbjct  43   LNSDRQALLAFAASVPHLRRLNWNSTNQICKSWVGVTCTSDGTRVLALRL  92



>ref|XP_003602176.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
Length=1088

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ H    NW+E  SVC  W GV C+ DGSRV+A+ L
Sbjct  25   DKQALLDFLHNINHSPHFNWDENSSVCQTWRGVTCNTDGSRVIAIRL  71



>ref|XP_009132067.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=650

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL F  ++ HLR LNWN    +C +W GV C+ DG+RV+AL L
Sbjct  49   SDKQALLSFAASVPHLRRLNWNSTNHICKSWVGVTCTPDGTRVLALRL  96



>ref|XP_009141903.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Brassica rapa]
Length=621

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            D+QALL+F+NN+ H RSL WN    +C  W+GV C+ D +RV AL L
Sbjct  32   DRQALLDFLNNITHPRSLAWNASSPICATWSGVTCNRDSTRVTALHL  78



>emb|CDX88667.1| BnaA03g09820D [Brassica napus]
Length=625

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL F  ++ HLR LNWN    +C +W GV C+ DG+RV+AL L
Sbjct  49   SDKQALLSFAASVPHLRRLNWNSTNHICKSWVGVTCTPDGTRVLALRL  96



>ref|XP_004253440.1| PREDICTED: probable inactive receptor kinase At4g23740, partial 
[Solanum lycopersicum]
Length=435

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL+F+NN+ H R LNW+E  S C +WTGV C+ + SR++A+ L
Sbjct  27   DKEALLDFLNNVNHSRYLNWDERTSACSSWTGVTCNHEKSRIIAIRL  73



>emb|CBI15804.3| unnamed protein product [Vitis vinifera]
Length=656

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DKQALL+F + + H R LNWN    VC +W G+ C+ DGSRV AL L
Sbjct  46   LDADKQALLDFADAVPHRRKLNWNSSTPVCTSWVGINCTGDGSRVRALRL  95



>emb|CDX87143.1| BnaC09g04580D [Brassica napus]
Length=621

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            D+QALL+F+NN+ H RSL WN    +C  W+GV C+ D +RV AL L
Sbjct  32   DRQALLDFLNNITHPRSLAWNASSPICATWSGVTCNRDNTRVTALHL  78



>emb|CDY19849.1| BnaA09g05020D [Brassica napus]
Length=621

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            D+QALL+F+NN+ H RSL WN    +C  W+GV C+ D +RV AL L
Sbjct  32   DRQALLDFLNNITHPRSLAWNASSPICATWSGVTCNRDNTRVTALHL  78



>ref|XP_010442890.1| PREDICTED: probable inactive receptor kinase At5g53320 [Camelina 
sativa]
Length=605

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++  K ALL+FVNN+ H  SLNW+ +LS+C  W GV C+ D S VVAL L
Sbjct  24   IKEAKHALLQFVNNVNHSHSLNWSPKLSICTEWAGVTCNSDHSSVVALHL  73



>ref|XP_002276162.3| PREDICTED: probable inactive receptor kinase At5g58300 [Vitis 
vinifera]
Length=666

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DKQALL+F + + H R LNWN    VC +W G+ C+ DGSRV AL L
Sbjct  56   LDADKQALLDFADAVPHRRKLNWNSSTPVCTSWVGINCTGDGSRVRALRL  105



>ref|XP_006407752.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
 gb|ESQ49205.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
Length=639

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQALLEF + + H R LNWN    +C +WTG+ CS++ +RV+AL L
Sbjct  24   IDSDKQALLEFASLVPHSRKLNWNTTNPICTSWTGITCSKNNARVIALRL  73



>ref|XP_008380496.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008380504.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008362797.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
 ref|XP_008362798.1| PREDICTED: probable inactive receptor kinase At4g23740 [Malus 
domestica]
Length=624

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQAL +F++N+ H  S+ WNE  SVC  WTGV CS+D S V+ L L
Sbjct  26   DDKQALFDFIHNISHSTSIKWNESSSVCKTWTGVVCSKDQSGVIELHL  73



>ref|XP_006283317.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
 gb|EOA16215.1| hypothetical protein CARUB_v10004355mg [Capsella rubella]
Length=635

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF+  +R  RSLNWN    VC  WTGV C++DGSR++A+ L
Sbjct  27   DKRALLEFLTIMRPTRSLNWNATSPVCNIWTGVTCNKDGSRIIAVRL  73



>gb|KHN35064.1| Putative inactive receptor kinase [Glycine soja]
Length=540

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL+FV  L   RSLNWN   S C +WTGV C+ D SRV+A+ L
Sbjct  11   SDKQALLDFVEKLAPSRSLNWNASSSPCTSWTGVTCNGDKSRVIAIHL  58



>ref|XP_010443551.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443552.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443553.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=661

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL F  ++ HLR LNWN    +C +W GV C+ DG+RV+AL L
Sbjct  48   LNSDRQALLAFAASVPHLRRLNWNSTNQICKSWFGVTCTSDGTRVLALRL  97



>ref|XP_010550530.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Tarenaya hassleriana]
 ref|XP_010550531.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g24100 [Tarenaya hassleriana]
Length=625

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVV  473
            D+QALL+F+NN+ H RSL WN    VC  W GV C  DGSRVV
Sbjct  31   DRQALLDFLNNITHSRSLVWNATTPVCATWQGVVCDRDGSRVV  73



>ref|XP_008810859.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Phoenix dactylifera]
Length=644

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQ LL FV+ + H R LNWN   SVC +W GV C+ D +RV+AL L
Sbjct  31   LKSDKQLLLAFVDAVHHGRKLNWNSNTSVCSSWIGVTCTADQTRVLALRL  80



>ref|XP_009375580.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
 ref|XP_009375581.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=624

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQAL +F++N+ H  S+ WNE  SVC  WTGV CS+D S V+ L L
Sbjct  26   DDKQALFDFIHNISHSTSIKWNENSSVCKTWTGVVCSKDQSGVIELHL  73



>ref|XP_006590496.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=589

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL+FV  L   RSLNWN   S C +WTGV C+ D SRV+A+ L
Sbjct  24   SDKQALLDFVEKLAPSRSLNWNASSSPCTSWTGVTCNGDKSRVIAIHL  71



>ref|XP_009352112.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=623

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQAL +F++N+ H  S+ WNE  SVC  WTGV CS+D S V+ L L
Sbjct  26   DDKQALFDFIHNISHSTSIKWNENSSVCKTWTGVVCSKDQSGVIELHL  73



>emb|CDP05105.1| unnamed protein product [Coffea canephora]
Length=630

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F NN+ H R LNW+   S C  WTGV C+ D SR++A+ L
Sbjct  27   DKQALLDFANNMYHSRPLNWDVRTSACNLWTGVTCNHDKSRIIAVRL  73



>emb|CDY10963.1| BnaA03g46220D [Brassica napus]
Length=424

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF+   R  RSLNWNE   +C NWTGV C+ + SR++AL L
Sbjct  28   DKRALLEFLTITRPTRSLNWNETTPLCKNWTGVTCNHNESRIIALRL  74



>ref|XP_009137388.1| PREDICTED: probable inactive receptor kinase At4g23740 [Brassica 
rapa]
Length=616

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
             DK+ALLEF+   R  RSLNWNE   +C NWTGV C+ + SR++AL L
Sbjct  27   QDKRALLEFLTITRPTRSLNWNETTPLCKNWTGVTCNHNESRIIALRL  74



>emb|CDX94213.1| BnaC07g38470D [Brassica napus]
Length=615

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
             DK+ALLEF+   R  RSLNWNE   +C NWTGV C+ + SR++AL L
Sbjct  26   QDKRALLEFLTITRPTRSLNWNETTPLCKNWTGVTCNRNESRIIALRL  73



>emb|CDY54343.1| BnaC03g14930D [Brassica napus]
Length=597

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +  DK ALL+FV+N+ H  SLNW+  LS+C  WTGV C  + S VV L L
Sbjct  22   IREDKHALLQFVSNITHSHSLNWSPTLSICTKWTGVTCDSNHSYVVGLHL  71



>emb|CDY58565.1| BnaC03g12450D [Brassica napus]
Length=653

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +D+QALL F  ++ HLR LNWN    +C +W GV C+ DG+RV+AL L
Sbjct  47   SDRQALLSFAASVPHLRRLNWNSTNHICKSWVGVTCTPDGTRVLALRL  94



>ref|XP_011007941.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
 ref|XP_011007942.1| PREDICTED: probable inactive receptor kinase At4g23740 [Populus 
euphratica]
Length=634

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL F++N+   R +NW E  SVC NWTGV CS D SRV AL L
Sbjct  31   DKEALLYFLHNIHLSRPVNWKESTSVCNNWTGVSCSNDHSRVTALVL  77



>gb|KJB52635.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
Length=442

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+ ++ H RSL W+++ SVC  W GV C+ D SRV+ L L
Sbjct  29   DKQALLDFIQHIHHSRSLKWSKQDSVCNTWVGVACNNDHSRVIGLHL  75



>ref|XP_002865969.1| hypothetical protein ARALYDRAFT_357577 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42228.1| hypothetical protein ARALYDRAFT_357577 [Arabidopsis lyrata subsp. 
lyrata]
Length=604

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DK  LL+FV+N+ H  SLNW+  LS+C  WTGV C+ D S V AL L
Sbjct  23   IKEDKHTLLQFVSNINHSHSLNWSPSLSICTKWTGVTCNSDHSSVDALHL  72



>gb|KJB52637.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
Length=620

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+ ++ H RSL W+++ SVC  W GV C+ D SRV+ L L
Sbjct  29   DKQALLDFIQHIHHSRSLKWSKQDSVCNTWVGVACNNDHSRVIGLHL  75



>gb|KJB52632.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52633.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52634.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52638.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
 gb|KJB52639.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
Length=634

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+ ++ H RSL W+++ SVC  W GV C+ D SRV+ L L
Sbjct  29   DKQALLDFIQHIHHSRSLKWSKQDSVCNTWVGVACNNDHSRVIGLHL  75



>ref|XP_004241083.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Solanum lycopersicum]
Length=593

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DK ALL+F  ++ HL  LNWN  LS+C +W G+ C++D +RVVA+ L
Sbjct  27   LDSDKHALLQFAVSIPHLSKLNWNSALSICNSWIGITCNKDKTRVVAIHL  76



>ref|XP_010322111.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Solanum lycopersicum]
Length=594

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DK ALL+F  ++ HL  LNWN  LS+C +W G+ C++D +RVVA+ L
Sbjct  27   LDSDKHALLQFAVSIPHLSKLNWNSALSICNSWIGITCNKDKTRVVAIHL  76



>ref|XP_006374322.1| hypothetical protein POPTR_0015s06040g [Populus trichocarpa]
 gb|ERP52119.1| hypothetical protein POPTR_0015s06040g [Populus trichocarpa]
Length=634

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL F++N+   R +NW E  SVC NWTGV CS D SRV AL L
Sbjct  31   DKKALLYFLHNIHLSRPVNWKESTSVCNNWTGVSCSNDHSRVTALVL  77



>gb|KJB29842.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
 gb|KJB29843.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
Length=660

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            D+QALL+F   + H R LNW+    VC +W G+ C++DGSRV+AL L
Sbjct  54   DEQALLQFSATVPHGRKLNWSPATPVCTSWVGINCTKDGSRVIALHL  100



>emb|CDY47068.1| BnaA03g12300D [Brassica napus]
Length=598

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DK ALL+F++N+ H  SLNW+  L +C  WTGV C  + S V+AL L
Sbjct  22   IKEDKHALLQFISNISHSHSLNWSPTLPICTKWTGVTCDSNHSSVIALHL  71



>gb|KHF99691.1| hypothetical protein F383_18108 [Gossypium arboreum]
Length=609

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQALLEF N + H++ LNWN    VC +W G+ C+ +G+ V+A+ L
Sbjct  27   LDSDKQALLEFANGVPHVKKLNWNLATPVCTSWVGITCNTNGTDVIAVRL  76



>gb|KHG27491.1| hypothetical protein F383_14041 [Gossypium arboreum]
Length=634

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+ ++ H RSL W+++ SVC  W GV C+ D SRV+ L L
Sbjct  29   DKQALLDFIQHIHHSRSLKWSKQDSVCNTWVGVACNNDHSRVIGLHL  75



>ref|XP_009380537.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=639

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVAL  479
            DKQALL+F+    H R LNW+   +VC  WTG+ CS DGSRVVA+
Sbjct  30   DKQALLDFLAAAPHGRGLNWSRATTVCGLWTGITCSADGSRVVAV  74



>ref|XP_009132484.1| PREDICTED: probable inactive receptor kinase At5g53320 [Brassica 
rapa]
Length=598

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +  DK ALL+FV+N+ H  SLNW+  L +C  WTGV C  + S V+AL L
Sbjct  22   IREDKHALLQFVSNISHSHSLNWSPTLPICTKWTGVTCDSNHSSVIALHL  71



>ref|XP_009628885.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
 ref|XP_009628886.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
Length=625

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL+F++N+ H R LNW+ + S C +WTGV C+ D SR++A+ L
Sbjct  27   DKEALLDFLDNINHSRYLNWDVQTSACNSWTGVTCNHDNSRIIAVRL  73



>gb|KJB52636.1| hypothetical protein B456_008G271600 [Gossypium raimondii]
Length=468

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+ ++ H RSL W+++ SVC  W GV C+ D SRV+ L L
Sbjct  29   DKQALLDFIQHIHHSRSLKWSKQDSVCNTWVGVACNNDHSRVIGLHL  75



>ref|XP_009796898.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
 ref|XP_009796899.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
 ref|XP_009796900.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
Length=625

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL+F++N+ H R LNW+ + S C +WTGV C+ D SR++A+ L
Sbjct  27   DKEALLDFLDNINHSRYLNWDVQTSACNSWTGVTCNHDNSRIIAVRL  73



>gb|KEH34523.1| LRR receptor-like kinase [Medicago truncatula]
Length=650

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVV  473
            +DKQALL+F+N + H ++L WN   S+C +W G+ C++DG+RVV
Sbjct  40   SDKQALLDFINVVPHRKNLMWNPSTSICTSWVGITCNQDGTRVV  83



>ref|XP_010938046.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Elaeis guineensis]
Length=641

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQ LL FV+ + H R LNWN   SVC  W GV C+ D +RV+AL L
Sbjct  31   LKSDKQLLLAFVDAVHHGRKLNWNSNTSVCSFWVGVTCTTDQTRVLALRL  80



>ref|XP_004502606.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Cicer arietinum]
Length=597

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+N++ H   LNW+E  SVC  W GV C+ D SRV+A+ L
Sbjct  25   DKQALLDFLNSMNHSPHLNWDENSSVCQTWRGVTCNTDESRVIAIRL  71



>ref|XP_004502605.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Cicer arietinum]
Length=621

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+N++ H   LNW+E  SVC  W GV C+ D SRV+A+ L
Sbjct  25   DKQALLDFLNSMNHSPHLNWDENSSVCQTWRGVTCNTDESRVIAIRL  71



>ref|XP_010938045.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Elaeis guineensis]
Length=682

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQ LL FV+ + H R LNWN   SVC  W GV C+ D +RV+AL L
Sbjct  72   LKSDKQLLLAFVDAVHHGRKLNWNSNTSVCSFWVGVTCTTDQTRVLALRL  121



>ref|XP_003600547.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES70798.1| LRR receptor-like kinase [Medicago truncatula]
Length=660

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVV  473
            +DKQALL+F+N + H ++L WN   S+C +W G+ C++DG+RVV
Sbjct  50   SDKQALLDFINVVPHRKNLMWNPSTSICTSWVGITCNQDGTRVV  93



>ref|XP_004503646.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cicer 
arietinum]
Length=645

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ LLEFV      R+LNWNE  SVC  WTGV C+ED SRV+A+ L
Sbjct  29   DKEVLLEFVKKFPPSRTLNWNESSSVCDFWTGVTCNEDRSRVIAIRL  75



>ref|XP_010433865.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
 ref|XP_010433866.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=639

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF+  +R  RSLNWNE   VC  WTGV C++D SR++A+ L
Sbjct  30   DKRALLEFLTIMRPTRSLNWNETSQVCNIWTGVTCNKDRSRIIAVRL  76



>ref|XP_007158557.1| hypothetical protein PHAVU_002G162400g [Phaseolus vulgaris]
 gb|ESW30551.1| hypothetical protein PHAVU_002G162400g [Phaseolus vulgaris]
Length=590

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL  V  L  LR LNWN+  S C +WTGV C+ D SRV+A+ L
Sbjct  28   DKQALLHLVEKLAPLRPLNWNQTSSPCTSWTGVTCNSDHSRVIAIHL  74



>ref|XP_010448663.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
 ref|XP_010448664.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=641

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF+  +R  RSLNWNE   VC  WTGV C++D SR++A+ L
Sbjct  31   DKRALLEFLTIMRPTRSLNWNETSQVCNIWTGVTCNKDRSRIIAVRL  77



>ref|XP_010445167.1| PREDICTED: probable inactive receptor kinase At4g23740 [Camelina 
sativa]
Length=739

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF+  +R  RSLNWNE   VC  WTGV C++D SR++A+ L
Sbjct  30   DKRALLEFLTIMRPTRSLNWNETSQVCNIWTGVTCNKDRSRIIAVRL  76



>gb|KDP22183.1| hypothetical protein JCGZ_26014 [Jatropha curcas]
Length=632

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQ LL+F++ + H  +LNWN+  SVC  WTGV C+ D SRV+ L L
Sbjct  29   DKQVLLDFLHKIHHSHTLNWNKNFSVCSEWTGVTCNNDRSRVITLRL  75



>ref|XP_006356869.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006356870.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=653

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL+F + + HLR+  WN   S+C  W GV CS DG+RVVAL L
Sbjct  29   LSSDRQALLDFASAVPHLRNFKWNTNSSIC-TWHGVSCSSDGTRVVALRL  77



>ref|XP_010541406.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
Length=621

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF   +   R+LNWNE   VC  WTGV CS+DGS+++A+ L
Sbjct  30   DKRALLEFQTIMNPTRTLNWNESSPVCNIWTGVTCSQDGSQIIAVRL  76



>gb|KHG17391.1| hypothetical protein F383_22576 [Gossypium arboreum]
Length=661

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            D+QALL+F   + H R +NW+    VC +W G+ C++DGSRV+AL L
Sbjct  55   DEQALLQFSATVPHGRKINWSPATPVCTSWVGINCTKDGSRVIALHL  101



>ref|XP_004246956.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=633

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +D+QALL+F + + HLR+  WN   S+C  W GV CS DG+RVVAL L
Sbjct  30   SDRQALLDFASAVAHLRNFKWNTNSSIC-TWHGVSCSSDGTRVVALRL  76



>ref|XP_009399834.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=666

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +3

Query  330  SLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            SLVE DKQALL+F+ +  H RSL+W+    VC  W GV CS DGSRV+ + L
Sbjct  26   SLVE-DKQALLDFLASTVHTRSLDWSPITDVCSRWYGVTCSADGSRVITVRL  76



>ref|XP_009399835.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009399836.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=651

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +3

Query  330  SLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            SLVE DKQALL+F+ +  H RSL+W+    VC  W GV CS DGSRV+ + L
Sbjct  26   SLVE-DKQALLDFLASTVHTRSLDWSPITDVCSRWYGVTCSADGSRVITVRL  76



>ref|XP_010671535.1| PREDICTED: probable inactive receptor kinase At4g23740 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010671536.1| PREDICTED: probable inactive receptor kinase At4g23740 [Beta 
vulgaris subsp. vulgaris]
Length=633

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+ N  H R LNW+    +C NWTGV C++  +RV+AL L
Sbjct  29   DKQALLDFIQNTSHSRFLNWDPNSPLCTNWTGVTCNDRQTRVIALRL  75



>ref|XP_006401105.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
 gb|ESQ42558.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
Length=650

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +D+QALL F  +  HLR LNWN    +C +W GV C+ DG+RV+AL L
Sbjct  41   SDRQALLAFAASAPHLRRLNWNSTNHICKSWVGVTCTSDGTRVLALRL  88



>ref|XP_010653700.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Vitis vinifera]
 emb|CBI32886.3| unnamed protein product [Vitis vinifera]
Length=634

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +E+DKQALLEF   + H+R++NW+   ++C++W G+ C  DG+RVVAL L
Sbjct  24   LESDKQALLEFAFVVPHVRTINWSPATAICISWVGIKC--DGNRVVALRL  71



>ref|XP_010653698.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
 ref|XP_010653699.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
Length=667

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +E+DKQALLEF   + H+R++NW+   ++C++W G+ C  DG+RVVAL L
Sbjct  57   LESDKQALLEFAFVVPHVRTINWSPATAICISWVGIKC--DGNRVVALRL  104



>ref|XP_010043603.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW88397.1| hypothetical protein EUGRSUZ_A00785 [Eucalyptus grandis]
Length=613

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQALL+F N + H R LNW     +C +W G+ CS++ +RV+AL L
Sbjct  25   LDSDKQALLQFANAIPHGRKLNWTASSPICTSWVGITCSKNPTRVIALRL  74



>ref|XP_007142022.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 ref|XP_007142023.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14016.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14017.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
Length=655

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            F+ + +DKQALL+F   + H R L WN   S+C +W GV C+ +G+RVV++ L
Sbjct  44   FADLSSDKQALLDFAAAVPHRRDLKWNPATSICTSWVGVTCNPNGTRVVSVRL  96



>emb|CDY02807.1| BnaC02g10820D [Brassica napus]
Length=103

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +D+QALL F  ++ HLR LNWN    +C +W GV C+ DG+ V+ L L
Sbjct  40   SDRQALLSFAASVPHLRKLNWNSTNHICKSWVGVTCTSDGTGVLTLRL  87



>gb|EPS58213.1| hypothetical protein M569_16602, partial [Genlisea aurea]
Length=493

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVAL  479
            DKQALL+F + + H R LNW+    VC NW GV CS DG RVV L
Sbjct  25   DKQALLDFSSAVPHGRKLNWDPFSGVCSNWVGVICSSDGGRVVGL  69



>ref|XP_010541472.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010541473.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
Length=628

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +D+QALL FV  + H R LNWN    VC +W GV C+ DG+RV+AL L
Sbjct  33   SDQQALLAFVAAVPHRRRLNWNSTNHVCKSWVGVTCTPDGARVLALRL  80



>ref|XP_008384658.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=634

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            FS + +D+QALL+F + + H R L+WN    VC +W G+ C+ +G+RV +L L
Sbjct  23   FSDLTSDRQALLDFADAVPHRRKLSWNPATPVCTSWVGITCTPNGTRVTSLRL  75



>gb|EPS73425.1| hypothetical protein M569_01324, partial [Genlisea aurea]
Length=583

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEE--LSVCMNWTGVGCSEDGSRVVALGL  485
            D+QALL+F++   H R LNW+E    +VC NWTG+ C+ D SRV+A+ L
Sbjct  25   DEQALLDFIHTFPHSRKLNWDESSAAAVCTNWTGITCNHDNSRVIAVRL  73



>ref|XP_006374053.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP51850.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +D+QALLEF + + H   LNWN    +C +W G+ C+ +GSRVVA+ L
Sbjct  27   SDRQALLEFASAVPHSPKLNWNSSTPICTSWVGIACNTEGSRVVAVHL  74



>ref|XP_006371315.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|ERP49112.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=630

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL+F   + H+R LNWN   SVC +W G+ C+ +G+ VVA+ L
Sbjct  27   LNSDRQALLDFAAAVPHIRKLNWNASTSVCTSWVGITCNTNGTGVVAVHL  76



>ref|XP_010094441.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB56022.1| putative inactive receptor kinase [Morus notabilis]
Length=634

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQALL+F   + HLR+L W+    VC +W GV C+ED +RV++L L
Sbjct  26   LDSDKQALLKFAAAVPHLRNLKWDPATPVCTSWIGVNCTEDHTRVLSLRL  75



>ref|XP_010541471.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Tarenaya hassleriana]
Length=652

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +D+QALL FV  + H R LNWN    VC +W GV C+ DG+RV+AL L
Sbjct  57   SDQQALLAFVAAVPHRRRLNWNSTNHVCKSWVGVTCTPDGARVLALRL  104



>ref|XP_008810858.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Phoenix dactylifera]
Length=685

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQ LL FV+ + H R LNWN   SVC +W GV C+ D +RV+AL L
Sbjct  72   LKSDKQLLLAFVDAVHHGRKLNWNSNTSVCSSWIGVTCTADQTRVLALRL  121



>ref|XP_009409433.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409434.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409435.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=644

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+    H R LNW     VC +WTGV CS D SRV+A+ L
Sbjct  36   DKQALLDFLTATPHGRGLNWRRATDVCSSWTGVTCSADDSRVIAVRL  82



>ref|XP_006371316.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
 gb|ERP49113.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
Length=655

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL+F   + H+R LNWN   SVC +W G+ C+ +G+ VVA+ L
Sbjct  52   LNSDRQALLDFAAAVPHIRKLNWNASTSVCTSWVGITCNTNGTGVVAVHL  101



>ref|XP_010538821.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
 ref|XP_010538822.1| PREDICTED: probable inactive receptor kinase At4g23740 [Tarenaya 
hassleriana]
Length=616

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEF++ +   R+LNWNE  SVC  WTG+ CS+D S+V+A+ L
Sbjct  27   DKRALLEFLSIMNPTRTLNWNESSSVCNIWTGITCSQDESQVIAVRL  73



>gb|EPS62971.1| hypothetical protein M569_11816, partial [Genlisea aurea]
Length=566

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL+F     H+R LNWNE   VC NWTG+ C   GSRVV++ L
Sbjct  1    DKEALLKFAAAHAHVRRLNWNENGDVCGNWTGISCDGGGSRVVSVRL  47



>ref|XP_003518282.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=648

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = +3

Query  327  FSLVE----NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            F L+E    +DKQALLEF +N+ H   LNW+E   +C +W GV C+++G+ V+ + L
Sbjct  20   FGLIEADLNSDKQALLEFFSNVPHAPRLNWSESTPICTSWAGVTCNQNGTSVIEIHL  76



>ref|XP_009413825.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=632

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQAL++F+  +   R LNW+   +VC  WTGV CS DGSRVVA+ L
Sbjct  30   DKQALIDFLAAIPLTRGLNWSPSTAVCGRWTGVTCSIDGSRVVAVRL  76



>gb|KDP21623.1| hypothetical protein JCGZ_03294 [Jatropha curcas]
Length=632

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D QAL++F   + H+R LNWN   S+C +W G+ C  +G+RVVA+ L
Sbjct  29   LNSDTQALVDFAAAVPHIRKLNWNSGTSICASWFGISCDSNGTRVVAVHL  78



>ref|XP_007033487.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007033488.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04413.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04414.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +D+QALL+F   + H R LNW+    VC +W G+ C++DGSRV+A+ L
Sbjct  27   SDEQALLQFSATVPHGRKLNWSPATPVCASWVGINCTKDGSRVLAVHL  74



>ref|XP_010252005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252007.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252008.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252009.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252010.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=676

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++ DKQALL+F   + H R LNWN    +C  W GV CS+DG+ VV L L
Sbjct  63   LDTDKQALLDFSAAVPHGRKLNWNSTSPICSTWVGVTCSQDGNHVVMLRL  112



>ref|XP_007146903.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
 gb|ESW18897.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
Length=657

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +3

Query  246  RNNLEMKRLSvlfvavllgvfvaarggFSLVENDKQALLEFVNNLRHLRSLNWNEELSVC  425
            R  L MK LS    + L  + +        + +DKQALL+F N + H R+L WN   SVC
Sbjct  19   RKQLSMKFLSTSVTSFLFVIVILFPLVIGDLSSDKQALLDFANAIPHRRNLMWNPSTSVC  78

Query  426  MNWTGVGCSEDGSRVVALGL  485
             +W G+ C+E+ +RVV + L
Sbjct  79   ESWVGITCNENRTRVVNVRL  98



>ref|XP_009355011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009355020.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=623

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            FS + +DKQALL+F + + H R+ +WN    VC +W GV C+ +G RV +L L
Sbjct  23   FSDLTSDKQALLDFADAVPHRRNFSWNPATPVCTSWVGVNCTPNGIRVTSLRL  75



>ref|XP_010999642.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=630

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL F   + H+R LNWN   SVC +W G+ C+ +G+ VVA+ L
Sbjct  27   LNSDRQALLNFAAAVPHIRKLNWNASTSVCTSWVGITCNTNGTGVVAVHL  76



>ref|XP_008239856.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=634

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            FS + +DKQALL+F   + H R+L WN    VC +W G+ C+ +G+RV AL L
Sbjct  23   FSDLNSDKQALLDFAAAVPHRRNLTWNPASPVCTSWVGITCNRNGTRVTALRL  75



>ref|NP_200638.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_001119458.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9LVM0.1|Y5830_ARATH RecName: Full=Probable inactive receptor kinase At5g58300; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAA96921.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL57654.1| unknown protein [Arabidopsis thaliana]
 gb|AAN64529.1| At5g58299/At5g58299 [Arabidopsis thaliana]
 gb|ACN59396.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97030.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AED97031.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=654

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL F  ++ HLR LNWN    +C +W GV C+ DG+ V AL L
Sbjct  45   LNSDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDGTSVHALRL  94



>ref|XP_007140053.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
 gb|ESW12047.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
Length=607

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + ++KQALL+F   L H   LNWN   S+C +W GV CS DGS V+++ L
Sbjct  26   LHSEKQALLDFAAALHHAPRLNWNSSTSICTSWMGVACSHDGSHVLSVRL  75



>gb|AFK45382.1| unknown [Medicago truncatula]
Length=610

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEFV  L   + LNWN   S+C +W GV CSED S+++A+ L
Sbjct  30   DKKALLEFVQKLPPFKPLNWNVNSSICTSWNGVICSEDRSQIIAIRL  76



>ref|XP_003611028.1| Probably inactive receptor-like protein kinase [Medicago truncatula]
 gb|AES93986.1| LRR receptor-like kinase [Medicago truncatula]
Length=610

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALLEFV  L   + LNWN   S+C +W GV CSED S+++A+ L
Sbjct  30   DKKALLEFVQKLPPFKPLNWNVNSSICTSWNGVICSEDRSQIIAIRL  76



>ref|XP_008793397.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008793471.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Phoenix dactylifera]
Length=637

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++ +   R+LNW+   SVC NW GV CS D +RVVA+ L
Sbjct  32   DKQALLDFISRVPPRRALNWSPYTSVCDNWRGVACSGDRARVVAVRL  78



>ref|XP_010999639.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999640.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999641.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=655

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL F   + H+R LNWN   SVC +W G+ C+ +G+ VVA+ L
Sbjct  52   LNSDRQALLNFAAAVPHIRKLNWNASTSVCTSWVGITCNTNGTGVVAVHL  101



>ref|XP_010999638.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=656

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL F   + H+R LNWN   SVC +W G+ C+ +G+ VVA+ L
Sbjct  53   LNSDRQALLNFAAAVPHIRKLNWNASTSVCTSWVGITCNTNGTGVVAVHL  102



>ref|XP_008793541.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Phoenix dactylifera]
Length=626

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++ +   R+LNW+   SVC NW GV CS D +RVVA+ L
Sbjct  32   DKQALLDFISRVPPRRALNWSPYTSVCDNWRGVACSGDRARVVAVRL  78



>emb|CDY32713.1| BnaA02g07750D [Brassica napus]
Length=651

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL F  ++ HLR LNWN    +C +W GV C+ DG+ V+ L L
Sbjct  38   LNSDRQALLSFAASVPHLRKLNWNSTNHICKSWVGVTCTSDGTGVLTLRL  87



>gb|KHN44239.1| Putative inactive receptor kinase [Glycine soja]
Length=633

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ H   +NW+E  SVC +W GV C+ D SRV+ L L
Sbjct  32   DKQALLDFLDNMSHSPHVNWDENTSVCQSWRGVICNSDESRVIELRL  78



>ref|XP_003522551.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=633

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ H   +NW+E  SVC +W GV C+ D SRV+ L L
Sbjct  32   DKQALLDFLDNMSHSPHVNWDENTSVCQSWRGVICNSDESRVIELRL  78



>ref|XP_009772876.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=648

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL+F + + HLR   WN   S+C  W GV C+ DG+RVVAL L
Sbjct  26   LSSDRQALLDFASAVPHLRKFTWNTNSSIC-TWHGVSCNSDGTRVVALRL  74



>ref|XP_010097875.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB72472.1| putative inactive receptor kinase [Morus notabilis]
Length=640

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +E DK ALL+F++N  H   LNW+++ SVC  WTG+ C+ D +RVV L L
Sbjct  26   LEEDKHALLDFLHNTSHSHRLNWDKDSSVCKTWTGIICNSDHTRVVELHL  75



>gb|KHN23405.1| Putative inactive receptor kinase [Glycine soja]
Length=633

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ H   +NW+E  SVC +W GV C+ D SRV+ L L
Sbjct  32   DKQALLDFLDNMSHSPHVNWDENSSVCQSWRGVICNSDKSRVIELRL  78



>ref|XP_003526687.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Glycine 
max]
Length=633

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ H   +NW+E  SVC +W GV C+ D SRV+ L L
Sbjct  32   DKQALLDFLDNMSHSPHVNWDENSSVCQSWRGVICNSDKSRVIELRL  78



>ref|XP_006584744.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Glycine max]
 ref|XP_006584745.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Glycine max]
 ref|XP_006584746.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X3 [Glycine max]
 ref|XP_006584747.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X4 [Glycine max]
 ref|XP_006584748.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X5 [Glycine max]
 ref|XP_006584749.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X6 [Glycine max]
 ref|XP_006584750.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X7 [Glycine max]
 ref|XP_006584751.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X8 [Glycine max]
Length=638

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DK+ALL+FVN     R LNWNE   +C +WTGV C+ D S+V+A+ L
Sbjct  28   DKEALLDFVNKFPPSRPLNWNESSPLCDSWTGVTCNVDKSKVIAIRL  74



>ref|XP_011041759.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041760.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041761.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041762.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=636

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            F+ +++DKQALL+F   + HLR LNWN   SVC +W GV C+ + +RV  L L
Sbjct  23   FADLKSDKQALLDFATAVPHLRKLNWNPASSVCNSWVGVTCNSNRTRVSQLRL  75



>ref|XP_002325632.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEF00014.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=636

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            F+ +++DKQALL+F   + HLR LNWN   SVC +W GV C+ + +RV  L L
Sbjct  23   FADLKSDKQALLDFATAVPHLRKLNWNPASSVCNSWVGVTCNSNRTRVSQLRL  75



>ref|XP_009126766.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=651

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL F  ++ HLR LNWN    +C +W GV C+ DG+ V+ L L
Sbjct  38   LNSDRQALLSFAASVPHLRKLNWNSTNHICKSWVGVTCTSDGTGVLTLRL  87



>ref|XP_006432052.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464957.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006464958.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR45292.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=635

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            F+ + +D+QALL+F + + HLR LNW+    +C +W G+ C++D +RV  L L
Sbjct  24   FADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTRVFGLRL  76



>ref|XP_004498388.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cicer 
arietinum]
Length=627

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++N+ H   LNW++  SVC  WT V C+ + SRV+AL L
Sbjct  32   DKQALLDFIHNINHSTHLNWDKTSSVCKKWTTVICNTEKSRVIALQL  78



>gb|KDO54914.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
 gb|KDO54915.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=635

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            F+ + +D+QALL+F + + HLR LNW+    +C +W G+ C++D +RV  L L
Sbjct  24   FADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTRVFGLRL  76



>ref|XP_006432053.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464956.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR45293.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=672

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            F+ + +D+QALL+F + + HLR LNW+    +C +W G+ C++D +RV  L L
Sbjct  61   FADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTRVFGLRL  113



>ref|XP_007208318.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
 gb|EMJ09517.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
Length=634

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            FS + +DKQALL+F   + H R+L WN    VC +W G+ C+ +G+RV AL L
Sbjct  23   FSDLHSDKQALLDFAAAVPHRRNLTWNPASPVCTSWVGITCNLNGTRVTALRL  75



>ref|XP_010558411.1| PREDICTED: probable inactive receptor kinase At3g08680 [Tarenaya 
hassleriana]
Length=603

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++D +ALLEF + + H R LNWN    +C +WTGV CS++ +RVVA+ L
Sbjct  21   IQSDSEALLEFASLVPHGRKLNWNPSNPICDSWTGVTCSQNKTRVVAVHL  70



>ref|XP_007137558.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 ref|XP_007137559.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 ref|XP_007137560.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09552.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09553.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
 gb|ESW09554.1| hypothetical protein PHAVU_009G136800g [Phaseolus vulgaris]
Length=626

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F++++ H   +NW+   SVC +W GV C+ D SRV+AL L
Sbjct  25   DKQALLDFLDSINHSPHVNWDANTSVCQSWRGVTCNSDKSRVIALRL  71



>gb|KDO54912.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=672

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            F+ + +D+QALL+F + + HLR LNW+    +C +W G+ C++D +RV  L L
Sbjct  61   FADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTRVFGLRL  113



>gb|KDO54913.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=682

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  327  FSLVENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            F+ + +D+QALL+F + + HLR LNW+    +C +W G+ C++D +RV  L L
Sbjct  71   FADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTRVFGLRL  123



>gb|KJB67957.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67958.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67959.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
Length=609

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQALLEF N + H++ LNWN    VC +W G+ C+ + + V+A+ L
Sbjct  27   LDSDKQALLEFANGVPHVKKLNWNLATPVCTSWVGITCNTNRTDVIAVRL  76



>ref|XP_009337799.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=636

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQALL+F++++ H R +NW+    VC +W G+ C+ DG+RV+++ L
Sbjct  23   IDSDKQALLDFISSVPHGRRVNWDPANPVCKSWVGITCTLDGTRVLSVRL  72



>gb|KJB71491.1| hypothetical protein B456_011G125200 [Gossypium raimondii]
Length=628

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQALL F   + H R LNW+    VC +W G+ C++D SRV+AL L
Sbjct  30   LDSDKQALLRFSARVPHGRKLNWSSATPVCTSWVGINCTKDQSRVMALHL  79



>ref|XP_009592168.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=652

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +++DKQALL F + + H   +NW+    +C +W G+ CSEDG+ VVA+ L
Sbjct  48   LDSDKQALLAFASAVPHGPKINWSPATPICSSWVGITCSEDGAHVVAVRL  97



>ref|XP_006602721.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_003551618.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
Length=607

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++++KQALL+F   L H   +NWN   S+C +W GV CS DGS V+++ L
Sbjct  26   LQSEKQALLDFAAALHHGPKVNWNSSTSICTSWVGVTCSHDGSHVLSVRL  75



>gb|KHN08297.1| Putative inactive receptor kinase [Glycine soja]
Length=610

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+ ++ H   LNWN+  SVC  W GV C+ D S+V+AL L
Sbjct  12   DKQALLDFLQSINHSHYLNWNKSTSVCKRWIGVICNNDQSQVIALHL  58



>gb|KHN40609.1| Putative inactive receptor kinase [Glycine soja]
Length=607

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            ++++KQALL+F   L H   +NWN   S+C +W GV CS DGS V+++ L
Sbjct  26   LQSEKQALLDFAAALHHGPKVNWNSSTSICTSWVGVTCSHDGSHVLSVRL  75



>ref|XP_006596280.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Glycine max]
 ref|XP_006596281.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Glycine max]
Length=623

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  345  DKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            DKQALL+F+ ++ H   LNWN+  SVC  W GV C+ D S+V+AL L
Sbjct  25   DKQALLDFLQSINHSHYLNWNKSTSVCKRWIGVICNNDQSQVIALHL  71



>gb|KHN40011.1| Putative inactive receptor kinase [Glycine soja]
Length=449

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = +3

Query  327  FSLVE----NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            F L+E    +D+QALLEF +N+ H   LNW++   +C +W GV C+++G+ V+ + L
Sbjct  20   FGLIEADLNSDRQALLEFFSNVPHAPRLNWSDSTPICTSWAGVTCNQNGTSVIEIHL  76



>ref|XP_010683445.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683446.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683447.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683448.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=643

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVAL  479
            +ENDKQALL+F   + H R +NWN    VC  W G+ CS D + V+A+
Sbjct  24   LENDKQALLQFSALIPHGRKVNWNSTTPVCTAWVGITCSSDNNSVIAV  71



>ref|XP_004500388.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=647

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVV  473
            +DKQALL+F N + H R+L W+   S+C +W G+ C+++G+RVV
Sbjct  37   SDKQALLDFANAVPHRRNLMWDPSTSICTSWIGITCNQNGTRVV  80



>ref|XP_010683449.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=641

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVAL  479
            +ENDKQALL+F   + H R +NWN    VC  W G+ CS D + V+A+
Sbjct  24   LENDKQALLQFSALIPHGRKVNWNSTTPVCTAWVGITCSSDNNSVIAV  71



>ref|XP_006644911.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=630

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL F  +L H R LNW+    VC +W GV C+ D SRV  L L
Sbjct  29   SDKQALLAFAASLPHGRKLNWSSSAPVCTSWVGVTCTPDNSRVQTLRL  76



>gb|AAL76166.1|AF348333_1 candidate plant disease resistance protein [Glycine max]
Length=228

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVV  473
            + +DKQALL F N + H R+L WN   SVC +W G+ C+E+ +RVV
Sbjct  58   LSSDKQALLNFANAVPHRRNLMWNPSTSVCSSWVGITCNENRTRVV  103



>ref|XP_003544853.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=650

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 38/57 (67%), Gaps = 4/57 (7%)
 Frame = +3

Query  327  FSLVE----NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            F L+E    +D+QALLEF +N+ H   LNW++   +C +W GV C+++G+ V+ + L
Sbjct  20   FGLIEADLNSDRQALLEFFSNVPHAPRLNWSDSTPICTSWAGVTCNQNGTSVIEIHL  76



>dbj|BAK08005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=451

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL F  +L H R LNW+    VC +W GV C+ D SRV  L L
Sbjct  29   SDKQALLAFAASLPHGRKLNWSSTTPVCTSWVGVTCTPDNSRVHTLRL  76



>dbj|BAB62593.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB93368.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAY76289.1| hypothetical protein OsI_04221 [Oryza sativa Indica Group]
Length=637

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +DKQALL F  +L H R LNW+    VC +W GV C+ D SRV  L L
Sbjct  27   LNSDKQALLAFAASLPHGRKLNWSSAAPVCTSWVGVTCTPDNSRVQTLRL  76



>gb|ACA61611.1| hypothetical protein AP2_E06.2 [Arabidopsis lyrata subsp. petraea]
Length=658

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALL F  ++ HLR LNWN    +C +W GV C+ DG  V AL L
Sbjct  45   LNSDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDGLSVHALRL  94



>ref|XP_006602050.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=667

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +DKQALL+F N + H R+L WN   SVC +W G+ C+E+ +RVV + L
Sbjct  62   LSSDKQALLDFANAVPHRRNLMWNPSTSVCTSWVGITCNENRTRVVKVRL  111



>ref|XP_006602049.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=668

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +DKQALL+F N + H R+L WN   SVC +W G+ C+E+ +RVV + L
Sbjct  63   LSSDKQALLDFANAVPHRRNLMWNPSTSVCTSWVGITCNENRTRVVKVRL  112



>gb|EMT17815.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=634

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  342  NDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            +DKQALL F  +L H R LNW+    VC +W GV C+ D SRV  L L
Sbjct  29   SDKQALLAFAASLPHGRKLNWSSTTPVCTSWVGVTCTPDNSRVHTLRL  76



>ref|XP_004502808.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502809.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
 ref|XP_004502810.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Cicer arietinum]
Length=644

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +D+QALLEF + + H   LNWN+   +C +W GV C+ + +RVV L L
Sbjct  29   LNSDRQALLEFASAVPHAPRLNWNDSFPICTSWVGVTCNSNQTRVVGLHL  78



>ref|XP_006602052.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  336  VENDKQALLEFVNNLRHLRSLNWNEELSVCMNWTGVGCSEDGSRVVALGL  485
            + +DKQALL+F N + H R+L WN   SVC +W G+ C+E+ +RVV + L
Sbjct  35   LSSDKQALLDFANAVPHRRNLMWNPSTSVCTSWVGITCNENRTRVVKVRL  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559954506960