BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M12

Length=550
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010320324.1|  PREDICTED: transcription factor SPATULA-like       169   6e-48   
ref|XP_006354865.1|  PREDICTED: transcription factor SPATULA-like       169   1e-47   Solanum tuberosum [potatoes]
emb|CDP01313.1|  unnamed protein product                                147   2e-39   Coffea canephora [robusta coffee]
ref|XP_009627217.1|  PREDICTED: transcription factor SPATULA-like       144   2e-38   Nicotiana tomentosiformis
ref|XP_009771084.1|  PREDICTED: transcription factor SPATULA-like       143   1e-37   Nicotiana sylvestris
gb|KDP41706.1|  hypothetical protein JCGZ_16113                         131   5e-33   Jatropha curcas
ref|XP_007017187.1|  Basic helix-loop-helix DNA-binding superfami...    125   7e-31   
ref|XP_007017188.1|  Basic helix-loop-helix DNA-binding superfami...    124   2e-30   
ref|XP_002284880.1|  PREDICTED: transcription factor SPATULA isof...    123   6e-30   Vitis vinifera
ref|XP_010664562.1|  PREDICTED: transcription factor SPATULA isof...    122   8e-30   Vitis vinifera
gb|KJB58529.1|  hypothetical protein B456_009G213800                    122   9e-30   Gossypium raimondii
ref|XP_010112171.1|  Transcription factor SPATULA                       121   2e-29   
gb|KJB58530.1|  hypothetical protein B456_009G213800                    120   3e-29   Gossypium raimondii
gb|EYU25441.1|  hypothetical protein MIMGU_mgv1a010846mg                119   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_007224914.1|  hypothetical protein PRUPE_ppa021918mg             115   4e-27   
ref|XP_011074391.1|  PREDICTED: transcription factor SPATULA-like       112   1e-26   
gb|KDO84121.1|  hypothetical protein CISIN_1g0227822mg                  109   2e-26   Citrus sinensis [apfelsine]
ref|XP_002510190.1|  conserved hypothetical protein                     112   4e-26   Ricinus communis
ref|XP_008444604.1|  PREDICTED: transcription factor SPATULA-like       111   1e-25   Cucumis melo [Oriental melon]
ref|XP_008220349.1|  PREDICTED: uncharacterized protein LOC103320445    114   1e-25   
gb|KDO84120.1|  hypothetical protein CISIN_1g0227822mg                  107   2e-25   Citrus sinensis [apfelsine]
ref|XP_006473302.1|  PREDICTED: transcription factor SPATULA-like...    109   3e-25   Citrus sinensis [apfelsine]
ref|XP_008367660.1|  PREDICTED: transcription factor SPATULA-like...    109   3e-25   Malus domestica [apple tree]
ref|XP_008367659.1|  PREDICTED: transcription factor SPATULA-like...    109   4e-25   Malus domestica [apple tree]
ref|XP_004172700.1|  PREDICTED: uncharacterized protein LOC101229339    109   4e-25   
ref|XP_009783822.1|  PREDICTED: transcription factor SPATULA-like...    109   4e-25   Nicotiana sylvestris
ref|XP_009783823.1|  PREDICTED: transcription factor SPATULA-like...    109   4e-25   Nicotiana sylvestris
ref|XP_006374908.1|  basic helix-loop-helix family protein              108   5e-25   Populus trichocarpa [western balsam poplar]
gb|ADN33721.1|  serine/threonine-protein kinase                         111   1e-24   Cucumis melo subsp. melo
ref|XP_010538109.1|  PREDICTED: transcription factor SPATULA-like       107   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_008340258.1|  PREDICTED: transcription factor SPATULA-like...    108   2e-24   Malus domestica [apple tree]
gb|EPS62617.1|  hypothetical protein M569_12173                         102   2e-24   Genlisea aurea
ref|XP_008340265.1|  PREDICTED: transcription factor SPATULA-like...    107   2e-24   Malus domestica [apple tree]
ref|XP_008340273.1|  PREDICTED: transcription factor SPATULA-like...    107   2e-24   Malus domestica [apple tree]
ref|XP_011458924.1|  PREDICTED: transcription factor SPATULA-like       107   2e-24   Fragaria vesca subsp. vesca
ref|XP_006473301.1|  PREDICTED: transcription factor SPATULA-like...    107   2e-24   Citrus sinensis [apfelsine]
ref|XP_011029586.1|  PREDICTED: transcription factor SPATULA-like...    107   3e-24   Populus euphratica
ref|XP_004142867.1|  PREDICTED: uncharacterized protein LOC101203008    110   4e-24   
ref|XP_008347614.1|  PREDICTED: transcription factor SPATULA-like...    105   4e-24   
ref|XP_008347615.1|  PREDICTED: transcription factor SPATULA-like...    105   4e-24   
ref|XP_010932049.1|  PREDICTED: transcription factor SPATULA            107   5e-24   Elaeis guineensis
ref|XP_011029580.1|  PREDICTED: transcription factor SPATULA-like...    105   8e-24   Populus euphratica
ref|XP_010093617.1|  Transcription factor SPATULA                       105   2e-23   Morus notabilis
ref|XP_010315963.1|  PREDICTED: transcription factor SPATULA isof...    105   2e-23   Solanum lycopersicum
ref|XP_010315964.1|  PREDICTED: transcription factor SPATULA isof...    104   2e-23   Solanum lycopersicum
ref|XP_008378028.1|  PREDICTED: transcription factor SPATULA-like...    104   3e-23   
ref|XP_011017183.1|  PREDICTED: transcription factor SPATULA-like...    103   3e-23   Populus euphratica
ref|XP_008378026.1|  PREDICTED: transcription factor SPATULA-like...    104   3e-23   
ref|XP_009359822.1|  PREDICTED: transcription factor SPATULA-like...    104   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_009359830.1|  PREDICTED: transcription factor SPATULA-like...    103   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_008378027.1|  PREDICTED: transcription factor SPATULA-like...    103   4e-23   
ref|XP_008440296.1|  PREDICTED: transcription factor SPATULA            103   5e-23   Cucumis melo [Oriental melon]
ref|XP_009607891.1|  PREDICTED: transcription factor SPATULA isof...    103   7e-23   
ref|XP_009607890.1|  PREDICTED: transcription factor SPATULA isof...    103   7e-23   Nicotiana tomentosiformis
ref|XP_008658092.1|  PREDICTED: putative HLH DNA-binding domain s...    102   9e-23   Zea mays [maize]
ref|XP_004142005.1|  PREDICTED: uncharacterized protein LOC101217594    103   9e-23   
ref|XP_004157205.1|  PREDICTED: uncharacterized protein LOC101227644    103   1e-22   
ref|NP_001131794.1|  putative HLH DNA-binding domain superfamily ...    102   1e-22   Zea mays [maize]
gb|KJB43772.1|  hypothetical protein B456_007G214800                    102   1e-22   Gossypium raimondii
ref|XP_011017181.1|  PREDICTED: transcription factor SPATULA-like...    102   1e-22   Populus euphratica
ref|XP_009367270.1|  PREDICTED: transcription factor SPATULA-like       102   2e-22   
gb|KJB43770.1|  hypothetical protein B456_007G214800                    102   2e-22   Gossypium raimondii
gb|KJB43767.1|  hypothetical protein B456_007G214800                    102   2e-22   Gossypium raimondii
ref|XP_007204562.1|  hypothetical protein PRUPE_ppa014897mg             101   2e-22   
gb|KJB43766.1|  hypothetical protein B456_007G214800                    101   2e-22   Gossypium raimondii
ref|XP_008338329.1|  PREDICTED: transcription factor SPATULA            102   2e-22   
gb|ACM41588.1|  bHLH transcription factor MYC5                          101   3e-22   Catharanthus roseus [chatas]
gb|KHG00584.1|  Transcription factor SPATULA -like protein              102   3e-22   Gossypium arboreum [tree cotton]
gb|KJB43768.1|  hypothetical protein B456_007G214800                    101   3e-22   Gossypium raimondii
gb|KJB43771.1|  hypothetical protein B456_007G214800                    101   3e-22   Gossypium raimondii
ref|XP_002306475.2|  hypothetical protein POPTR_0005s18280g           99.8    3e-22   
gb|ADG56590.1|  ALCATRAZ/SPATULA-like protein                           101   3e-22   Prunus persica
gb|KJB43769.1|  hypothetical protein B456_007G214800                    101   4e-22   Gossypium raimondii
ref|XP_008681257.1|  PREDICTED: putative HLH DNA-binding domain s...    100   4e-22   Zea mays [maize]
ref|XP_008681256.1|  PREDICTED: putative HLH DNA-binding domain s...    100   4e-22   
ref|NP_001136510.1|  putative HLH DNA-binding domain superfamily ...    100   4e-22   Zea mays [maize]
ref|XP_010548419.1|  PREDICTED: transcription factor SPATULA-like     99.8    5e-22   Tarenaya hassleriana [spider flower]
gb|KCW54935.1|  hypothetical protein EUGRSUZ_I00906                   98.6    5e-22   Eucalyptus grandis [rose gum]
dbj|BAD19423.1|  hypothetical protein                                 96.3    5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010030576.1|  PREDICTED: transcription factor SPATULA-like       100   6e-22   Eucalyptus grandis [rose gum]
ref|XP_006339939.1|  PREDICTED: transcription factor SPATULA-like       100   6e-22   Solanum tuberosum [potatoes]
ref|XP_008241481.1|  PREDICTED: transcription factor SPATULA isof...    100   6e-22   Prunus mume [ume]
ref|XP_007156787.1|  hypothetical protein PHAVU_002G0176001g          98.2    7e-22   Phaseolus vulgaris [French bean]
ref|XP_004954276.1|  PREDICTED: transcription factor SPATULA-like       100   8e-22   Setaria italica
ref|XP_008241480.1|  PREDICTED: transcription factor SPATULA isof...    100   8e-22   Prunus mume [ume]
ref|XP_008241478.1|  PREDICTED: transcription factor SPATULA isof...    100   1e-21   Prunus mume [ume]
ref|NP_001056902.2|  Os06g0164400                                     97.8    1e-21   
ref|XP_002523613.1|  conserved hypothetical protein                     100   1e-21   
ref|XP_010652804.1|  PREDICTED: transcription factor SPATULA          99.8    2e-21   Vitis vinifera
emb|CBI21410.3|  unnamed protein product                              99.8    2e-21   Vitis vinifera
ref|XP_007047305.1|  Homeodomain-like superfamily protein isoform 2   99.4    2e-21   
ref|XP_007047306.1|  Homeodomain-like superfamily protein, putati...  99.8    2e-21   
ref|XP_002981138.1|  hypothetical protein SELMODRAFT_114141           94.4    2e-21   
ref|XP_002984591.1|  hypothetical protein SELMODRAFT_29179            93.6    2e-21   
ref|XP_002982619.1|  hypothetical protein SELMODRAFT_116654           94.0    2e-21   
ref|XP_002978656.1|  hypothetical protein SELMODRAFT_39143            93.2    3e-21   
ref|XP_010531245.1|  PREDICTED: transcription factor SPATULA-like...  98.2    4e-21   
gb|KDP31951.1|  hypothetical protein JCGZ_12412                       98.2    4e-21   Jatropha curcas
emb|CDP02508.1|  unnamed protein product                              98.6    4e-21   Coffea canephora [robusta coffee]
ref|XP_007047304.1|  Basic helix-loop-helix DNA-binding superfami...  99.0    5e-21   
emb|CCE46185.1|  bHLH transcription factor                            99.0    5e-21   Amborella trichopoda
ref|XP_006856483.1|  hypothetical protein AMTR_s00046p00066610        99.0    5e-21   
ref|XP_011099122.1|  PREDICTED: transcription factor SPATULA-like     97.8    6e-21   Sesamum indicum [beniseed]
ref|XP_003561052.1|  PREDICTED: transcription factor SPATULA-like     97.4    7e-21   
ref|XP_010927433.1|  PREDICTED: putative transcription factor bHL...  97.8    7e-21   
ref|XP_010927432.1|  PREDICTED: putative transcription factor bHL...  97.8    7e-21   
gb|AHK05707.1|  bHLH transcription factor SPT                         97.4    8e-21   Brassica oleracea var. capitata
ref|XP_008793895.1|  PREDICTED: transcription factor SPATULA-like...  97.4    8e-21   
ref|XP_008793889.1|  PREDICTED: transcription factor SPATULA-like...  97.4    8e-21   
ref|XP_008793896.1|  PREDICTED: transcription factor SPATULA-like...  97.4    8e-21   
ref|XP_008793893.1|  PREDICTED: transcription factor SPATULA-like...  97.4    9e-21   
gb|ABK23705.1|  unknown                                               97.1    1e-20   Picea sitchensis
ref|XP_008793888.1|  PREDICTED: transcription factor SPATULA-like...  97.4    1e-20   Phoenix dactylifera
ref|XP_008793887.1|  PREDICTED: transcription factor SPATULA-like...  97.4    1e-20   Phoenix dactylifera
ref|XP_008793886.1|  PREDICTED: transcription factor SPATULA-like...  97.4    1e-20   
ref|XP_006656678.1|  PREDICTED: transcription factor SPATULA-like     95.5    1e-20   
ref|XP_008793890.1|  PREDICTED: transcription factor SPATULA-like...  97.4    1e-20   
ref|XP_003589168.1|  Transcription factor SPATULA                     96.7    1e-20   
dbj|BAD67851.1|  basic helix-loop-helix protein SPATULA-like          97.1    1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99814.1|  hypothetical protein OsI_21804                        96.7    1e-20   Oryza sativa Indica Group [Indian rice]
gb|AES59419.2|  helix loop helix DNA-binding domain protein           96.3    1e-20   Medicago truncatula
ref|XP_008793891.1|  PREDICTED: uncharacterized protein LOC103710...  97.1    1e-20   Phoenix dactylifera
ref|XP_008793892.1|  PREDICTED: uncharacterized protein LOC103710...  97.1    1e-20   Phoenix dactylifera
gb|ACG39275.1|  hypothetical protein                                  96.3    1e-20   Zea mays [maize]
emb|CDY22448.1|  BnaC03g61610D                                        97.1    1e-20   Brassica napus [oilseed rape]
ref|XP_009343287.1|  PREDICTED: transcription factor SPATULA-like...  97.1    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_009343286.1|  PREDICTED: transcription factor SPATULA-like...  97.1    1e-20   
ref|XP_009343288.1|  PREDICTED: transcription factor SPATULA-like...  97.1    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_009343285.1|  PREDICTED: transcription factor SPATULA-like...  97.1    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_009343284.1|  PREDICTED: transcription factor SPATULA-like...  97.1    2e-20   
ref|XP_002454736.1|  hypothetical protein SORBIDRAFT_04g036450        96.3    2e-20   
ref|XP_010446690.1|  PREDICTED: transcription factor SPATULA-like...  96.7    2e-20   
gb|AAK98706.1|AC069158_18  Putative SPATULA                           96.3    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|KFK30312.1|  hypothetical protein AALP_AA7G245600                  96.7    2e-20   Arabis alpina [alpine rockcress]
gb|EAY87922.1|  hypothetical protein OsI_09345                        96.3    2e-20   Oryza sativa Indica Group [Indian rice]
gb|EAZ24998.1|  hypothetical protein OsJ_08778                        96.3    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010446689.1|  PREDICTED: transcription factor SPATULA-like...  96.7    2e-20   
ref|XP_010446691.1|  PREDICTED: transcription factor SPATULA-like...  96.7    2e-20   
ref|XP_009420906.1|  PREDICTED: transcription factor SPATULA-like     96.3    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX69281.1|  BnaC01g01720D                                        96.3    2e-20   
ref|XP_009109363.1|  PREDICTED: transcription factor SPATULA-like     96.3    2e-20   Brassica rapa
ref|XP_010432082.1|  PREDICTED: transcription factor SPATULA-like...  96.3    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002983759.1|  hypothetical protein SELMODRAFT_118904           91.7    2e-20   
ref|XP_007160865.1|  hypothetical protein PHAVU_001G023200g           95.9    2e-20   Phaseolus vulgaris [French bean]
ref|XP_010432080.1|  PREDICTED: transcription factor SPATULA-like...  96.3    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010432081.1|  PREDICTED: transcription factor SPATULA-like...  96.3    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_007160864.1|  hypothetical protein PHAVU_001G023200g           95.9    2e-20   Phaseolus vulgaris [French bean]
emb|CDX75629.1|  BnaA01g00730D                                        95.9    2e-20   
ref|XP_006283961.1|  hypothetical protein CARUB_v10005083mg           96.3    3e-20   Capsella rubella
dbj|BAK05983.1|  predicted protein                                    96.3    3e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006595974.1|  PREDICTED: transcription factor SPATULA-like     95.9    3e-20   Glycine max [soybeans]
ref|XP_010667415.1|  PREDICTED: transcription factor SPATULA-like...  96.7    3e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009138272.1|  PREDICTED: transcription factor SPATULA          95.9    3e-20   
ref|XP_010667416.1|  PREDICTED: transcription factor SPATULA-like...  96.3    3e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010437251.1|  PREDICTED: transcription factor SPATULA-like     95.5    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009410364.1|  PREDICTED: transcription factor SPATULA-like...  95.5    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004963135.1|  PREDICTED: transcription factor PIF4-like is...  95.9    5e-20   Setaria italica
gb|KHG11679.1|  Transcription factor SPATULA -like protein            94.7    6e-20   Gossypium arboreum [tree cotton]
gb|KHN36240.1|  Transcription factor SPATULA                          95.1    7e-20   Glycine soja [wild soybean]
ref|XP_003516601.1|  PREDICTED: transcription factor SPATULA-like...  94.7    7e-20   Glycine max [soybeans]
gb|AHM26454.1|  PIF3                                                  90.1    9e-20   Arabidopsis lyrata subsp. petraea
gb|AHM26455.1|  PIF3                                                  90.1    1e-19   Arabidopsis lyrata subsp. petraea
gb|AHM26463.1|  PIF3                                                  90.1    1e-19   Arabidopsis lyrata subsp. petraea
gb|AHM26451.1|  PIF3                                                  90.1    1e-19   Arabidopsis lyrata subsp. petraea
gb|AHM26452.1|  PIF3                                                  90.1    1e-19   Arabidopsis lyrata subsp. petraea
ref|XP_001766358.1|  predicted protein                                89.7    1e-19   
ref|XP_010914797.1|  PREDICTED: transcription factor PIF3-like is...  96.7    1e-19   Elaeis guineensis
gb|AHM26476.1|  PIF3                                                  89.7    1e-19   Arabidopsis lyrata subsp. petraea
ref|XP_010270238.1|  PREDICTED: transcription factor SPATULA isof...  94.0    1e-19   
ref|XP_010914796.1|  PREDICTED: transcription factor PIF3-like is...  96.7    1e-19   Elaeis guineensis
gb|KJB48603.1|  hypothetical protein B456_008G077300                  93.2    1e-19   Gossypium raimondii
gb|KHG02827.1|  Transcription factor SPATULA -like protein            92.8    1e-19   Gossypium arboreum [tree cotton]
ref|XP_007207211.1|  hypothetical protein PRUPE_ppa001899mg           96.3    2e-19   
ref|XP_008370334.1|  PREDICTED: transcription factor PIF3 isoform X2  95.5    2e-19   
ref|XP_010270226.1|  PREDICTED: transcription factor SPATULA isof...  94.4    3e-19   Nelumbo nucifera [Indian lotus]
dbj|BAJ92170.1|  predicted protein                                    92.8    3e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAV33474.1|  basic helix-loop-helix protein                        92.8    3e-19   Fragaria x ananassa
ref|XP_008370333.1|  PREDICTED: transcription factor PIF3 isoform X1  95.1    4e-19   
ref|XP_006393909.1|  hypothetical protein EUTSA_v10004889mg           91.3    4e-19   Eutrema salsugineum [saltwater cress]
ref|XP_002865027.1|  hypothetical protein ARALYDRAFT_496889           90.9    4e-19   
ref|XP_004499049.1|  PREDICTED: transcription factor SPATULA-like...  91.3    5e-19   Cicer arietinum [garbanzo]
emb|CBY05403.1|  ALCATRAZ-like protein                                90.1    5e-19   Lepidium appelianum [hairy whitetop]
ref|XP_001772223.1|  predicted protein                                87.8    5e-19   
ref|XP_008388421.1|  PREDICTED: transcription factor PIF3-like        94.7    5e-19   
ref|XP_004499048.1|  PREDICTED: transcription factor SPATULA-like...  91.7    5e-19   Cicer arietinum [garbanzo]
gb|AEX32796.1|  phytochrome-interacting factor 3                      94.7    6e-19   Malus domestica [apple tree]
ref|XP_002442504.1|  hypothetical protein SORBIDRAFT_08g021000        94.0    6e-19   
ref|XP_010909460.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  94.4    8e-19   
ref|XP_010936085.1|  PREDICTED: transcription factor PIF1-like is...  92.4    8e-19   Elaeis guineensis
gb|ABA99362.2|  Helix-loop-helix DNA-binding domain containing pr...  92.8    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067246.1|  Os12g0610200                                     92.8    8e-19   
emb|CBY05409.1|  ALCATRAZ-like protein                                90.1    8e-19   Lepidium campestre [bastard cress]
gb|KHN48974.1|  Transcription factor PIF1                             90.9    1e-18   Glycine soja [wild soybean]
ref|XP_007141451.1|  hypothetical protein PHAVU_008G196800g           93.6    1e-18   Phaseolus vulgaris [French bean]
ref|XP_004511914.1|  PREDICTED: transcription factor SPATULA-like...  91.3    1e-18   
ref|XP_010936084.1|  PREDICTED: transcription factor PIF1-like is...  92.0    1e-18   Elaeis guineensis
ref|XP_004511915.1|  PREDICTED: transcription factor SPATULA-like...  91.3    1e-18   Cicer arietinum [garbanzo]
ref|XP_006282286.1|  hypothetical protein CARUB_v10028570mg           89.7    1e-18   Capsella rubella
ref|XP_010688822.1|  PREDICTED: transcription factor ALC-like         90.9    1e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC69654.1|  hypothetical protein OsI_39066                        92.4    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_009591142.1|  PREDICTED: transcription factor PIF3-like        87.8    1e-18   
gb|KDP26428.1|  hypothetical protein JCGZ_17586                       93.2    1e-18   Jatropha curcas
ref|XP_010093193.1|  hypothetical protein L484_013318                 92.8    1e-18   
ref|XP_011466211.1|  PREDICTED: transcription factor PIF3 isoform X3  93.2    1e-18   Fragaria vesca subsp. vesca
ref|XP_003611714.1|  Transcription factor SPATULA                     90.9    1e-18   Medicago truncatula
ref|XP_009335549.1|  PREDICTED: transcription factor PIF3-like is...  93.2    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_004303901.1|  PREDICTED: transcription factor PIF4-like        92.8    2e-18   Fragaria vesca subsp. vesca
ref|XP_006411917.1|  hypothetical protein EUTSA_v10025554mg           90.9    2e-18   
ref|XP_008246329.1|  PREDICTED: transcription factor PIF3             93.6    2e-18   Prunus mume [ume]
ref|XP_010271074.1|  PREDICTED: transcription factor PIF3 isoform X2  93.6    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_011466210.1|  PREDICTED: transcription factor PIF3 isoform X2  93.2    2e-18   Fragaria vesca subsp. vesca
ref|XP_004302325.1|  PREDICTED: transcription factor PIF3 isoform X1  93.2    2e-18   Fragaria vesca subsp. vesca
ref|XP_010652458.1|  PREDICTED: transcription factor PIF1 isoform X3  92.4    2e-18   Vitis vinifera
ref|XP_008382659.1|  PREDICTED: transcription factor PIF1-like        92.8    2e-18   
ref|XP_002436548.1|  hypothetical protein SORBIDRAFT_10g004500        90.5    2e-18   
ref|XP_002866965.1|  hypothetical protein ARALYDRAFT_353119           90.9    2e-18   
gb|KDO44799.1|  hypothetical protein CISIN_1g0077971mg                87.8    2e-18   Citrus sinensis [apfelsine]
ref|XP_009365453.1|  PREDICTED: transcription factor PIF3-like        93.2    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_010652457.1|  PREDICTED: transcription factor PIF1 isoform X2  92.4    2e-18   Vitis vinifera
ref|XP_010652454.1|  PREDICTED: transcription factor PIF1 isoform X1  92.4    2e-18   Vitis vinifera
emb|CBI37249.3|  unnamed protein product                              92.0    2e-18   Vitis vinifera
gb|KDO79178.1|  hypothetical protein CISIN_1g036669mg                 90.5    2e-18   Citrus sinensis [apfelsine]
ref|XP_010245663.1|  PREDICTED: transcription factor PIF1-like is...  92.4    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009407100.1|  PREDICTED: transcription factor PIF1-like        91.3    2e-18   
ref|NP_568010.1|  transcription factor SPATULA                        90.5    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811826.1|  PREDICTED: transcription factor PIF4-like is...  92.4    2e-18   
tpg|DAA54246.1|  TPA: putative HLH DNA-binding domain superfamily...  90.5    2e-18   
gb|EEC78487.1|  hypothetical protein OsI_18387                        90.1    3e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_008811817.1|  PREDICTED: transcription factor PIF4-like is...  92.4    3e-18   
ref|XP_004967640.1|  PREDICTED: transcription factor PIF3-like is...  92.4    3e-18   Setaria italica
ref|XP_010245660.1|  PREDICTED: transcription factor PIF1-like is...  92.4    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_004967645.1|  PREDICTED: transcription factor PIF3-like is...  92.4    3e-18   
ref|XP_008811825.1|  PREDICTED: transcription factor PIF4-like is...  92.4    3e-18   
ref|XP_010941465.1|  PREDICTED: transcription factor PIF3-like is...  92.4    3e-18   Elaeis guineensis
ref|XP_010245662.1|  PREDICTED: transcription factor PIF1-like is...  92.0    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008811822.1|  PREDICTED: transcription factor PIF4-like is...  92.4    3e-18   
ref|XP_004139727.1|  PREDICTED: transcription factor PIF1-like        92.0    3e-18   
ref|XP_009148251.1|  PREDICTED: transcription factor PIF3 isoform X2  92.0    3e-18   Brassica rapa
ref|XP_010245661.1|  PREDICTED: transcription factor PIF1-like is...  92.0    3e-18   Nelumbo nucifera [Indian lotus]
gb|KFK28388.1|  hypothetical protein AALP_AA8G508500                  88.6    3e-18   Arabis alpina [alpine rockcress]
ref|XP_009148249.1|  PREDICTED: transcription factor PIF3 isoform X1  92.0    3e-18   Brassica rapa
ref|XP_010941466.1|  PREDICTED: transcription factor PIF3-like is...  92.4    3e-18   Elaeis guineensis
ref|XP_008447346.1|  PREDICTED: transcription factor PIF1-like is...  90.5    3e-18   Cucumis melo [Oriental melon]
gb|EMT23685.1|  Transcription factor PIF3                             90.1    3e-18   
gb|KGN44558.1|  hypothetical protein Csa_7G333400                     92.0    3e-18   Cucumis sativus [cucumbers]
dbj|BAJ90328.1|  predicted protein                                    89.0    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY06358.1|  BnaA09g48450D                                        91.7    3e-18   
emb|CDY22636.1|  BnaC08g42700D                                        91.7    3e-18   Brassica napus [oilseed rape]
ref|XP_003539355.1|  PREDICTED: transcription factor SPATULA-like...  90.1    3e-18   Glycine max [soybeans]
ref|XP_009399053.1|  PREDICTED: transcription factor PIF4-like        91.7    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY01438.1|  BnaA07g12110D                                        89.0    3e-18   
ref|XP_009118315.1|  PREDICTED: transcription factor PIF3-like        91.7    3e-18   Brassica rapa
gb|EMT27650.1|  Transcription factor PIF3                             89.7    4e-18   
ref|XP_010475789.1|  PREDICTED: transcription factor PIF3             91.7    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002889756.1|  hypothetical protein ARALYDRAFT_471048           91.7    4e-18   
emb|CDX94963.1|  BnaC05g07080D                                        91.7    4e-18   
ref|XP_010109673.1|  hypothetical protein L484_015158                 91.7    4e-18   
ref|XP_010490103.1|  PREDICTED: transcription factor PIF3-like        91.7    4e-18   Camelina sativa [gold-of-pleasure]
dbj|BAD43719.1|  putative bHLH transcription factor (bHLH073/ALCA...  88.6    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006358519.1|  PREDICTED: transcription factor PIF3-like        92.4    4e-18   Solanum tuberosum [potatoes]
emb|CDY64745.1|  BnaA06g37850D                                        91.7    4e-18   Brassica napus [oilseed rape]
ref|XP_006600961.1|  PREDICTED: transcription factor SPATULA-like...  89.0    4e-18   Glycine max [soybeans]
dbj|BAD81566.1|  putative BP-5 protein                                91.7    4e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010458240.1|  PREDICTED: transcription factor PIF3-like        91.7    4e-18   Camelina sativa [gold-of-pleasure]
gb|ACR38655.1|  unknown                                               90.9    4e-18   Zea mays [maize]
gb|AGW52145.1|  PIL                                                   91.7    4e-18   Populus tomentosa [Chinese white poplar]
ref|NP_172424.1|  transcription factor PIF3                           91.7    4e-18   Arabidopsis thaliana [mouse-ear cress]
gb|EYU46364.1|  hypothetical protein MIMGU_mgv1a007040mg              90.5    4e-18   Erythranthe guttata [common monkey flower]
ref|XP_009589214.1|  PREDICTED: transcription factor PIF3-like        92.0    4e-18   Nicotiana tomentosiformis
tpg|DAA50359.1|  TPA: putative HLH DNA-binding domain superfamily...  91.7    4e-18   
ref|XP_006594070.1|  PREDICTED: transcription factor PIF1-like is...  91.3    4e-18   Glycine max [soybeans]
ref|NP_001147809.1|  PIL5                                             91.7    4e-18   
gb|EYU35367.1|  hypothetical protein MIMGU_mgv1a019493mg              89.0    4e-18   Erythranthe guttata [common monkey flower]
ref|XP_006600959.1|  PREDICTED: transcription factor SPATULA-like...  89.4    4e-18   Glycine max [soybeans]
emb|CAB16798.1|  putative protein                                     90.5    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288023.1|  PREDICTED: transcription factor SPATULA          90.1    4e-18   Fragaria vesca subsp. vesca
ref|XP_009774964.1|  PREDICTED: transcription factor PIF3-like is...  92.0    5e-18   Nicotiana sylvestris
ref|XP_006303172.1|  hypothetical protein CARUB_v10008815mg           91.3    5e-18   Capsella rubella
ref|XP_006417565.1|  hypothetical protein EUTSA_v10007343mg           91.3    5e-18   Eutrema salsugineum [saltwater cress]
ref|XP_003625475.1|  Transcription factor PIF1                        90.9    5e-18   
ref|XP_006645783.1|  PREDICTED: transcription factor PIF1-like        91.7    5e-18   
ref|NP_001042775.2|  Os01g0286100                                     91.7    5e-18   
ref|XP_009103456.1|  PREDICTED: transcription factor ALC              88.2    5e-18   
gb|KEH23988.1|  transcription factor                                  90.9    5e-18   
ref|XP_010313958.1|  PREDICTED: transcription factor PIF3             92.0    5e-18   
ref|XP_006605776.1|  PREDICTED: transcription factor PIF3-like        92.0    5e-18   
ref|XP_009366017.1|  PREDICTED: transcription factor PIF3-like is...  91.7    5e-18   
gb|KHN26204.1|  Transcription factor PIF3                             92.0    5e-18   
ref|XP_009774962.1|  PREDICTED: transcription factor PIF3-like is...  92.0    5e-18   
gb|AEV57494.1|  rice phytochrome-interacting factor 4                 90.1    5e-18   
gb|EEE62266.1|  hypothetical protein OsJ_17053                        90.1    6e-18   
ref|XP_006350296.1|  PREDICTED: transcription factor PIF1-like is...  91.3    6e-18   
gb|ABN08903.1|  Helix-loop-helix DNA-binding                          90.9    6e-18   
ref|XP_011024540.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  91.7    6e-18   
gb|EEC70435.1|  hypothetical protein OsI_01449                        91.7    6e-18   
ref|XP_006425918.1|  hypothetical protein CICLE_v10025735mg           89.7    6e-18   
dbj|BAL63287.1|  basic helix-loop-helix protein APG                   90.1    6e-18   
dbj|BAC19953.1|  transcription factor BHLH9-like protein              90.1    6e-18   
ref|XP_010659766.1|  PREDICTED: transcription factor PIF3-like is...  91.3    7e-18   
ref|XP_006466588.1|  PREDICTED: transcription factor SPATULA-like...  89.7    7e-18   
gb|EEE54353.1|  hypothetical protein OsJ_01348                        91.7    7e-18   
gb|KDO56397.1|  hypothetical protein CISIN_1g006040mg                 91.3    7e-18   
ref|NP_001058876.2|  Os07g0143200                                     90.1    7e-18   
gb|KDO56394.1|  hypothetical protein CISIN_1g006040mg                 91.3    7e-18   
emb|CBI39676.3|  unnamed protein product                              90.9    7e-18   
gb|EYU44414.1|  hypothetical protein MIMGU_mgv1a013085mg              88.2    7e-18   
ref|XP_006466587.1|  PREDICTED: transcription factor SPATULA-like...  89.7    7e-18   
ref|XP_006350295.1|  PREDICTED: transcription factor PIF1-like is...  90.9    7e-18   
ref|XP_008447345.1|  PREDICTED: transcription factor PIF1-like is...  90.9    7e-18   
gb|KDO56396.1|  hypothetical protein CISIN_1g006040mg                 91.3    8e-18   
ref|XP_008461998.1|  PREDICTED: transcription factor PIF1             90.9    8e-18   
ref|XP_010070105.1|  PREDICTED: transcription factor PIF3-like is...  91.3    8e-18   
ref|XP_010070104.1|  PREDICTED: transcription factor PIF3-like is...  91.3    8e-18   
ref|XP_010070103.1|  PREDICTED: transcription factor PIF3-like is...  91.3    8e-18   
gb|KDO56393.1|  hypothetical protein CISIN_1g006040mg                 91.3    8e-18   
ref|XP_009366015.1|  PREDICTED: transcription factor PIF3-like is...  91.3    8e-18   
ref|XP_002466767.1|  hypothetical protein SORBIDRAFT_01g013843        90.9    8e-18   
ref|NP_001054593.1|  Os05g0139100                                     90.5    8e-18   
gb|ACR35132.1|  unknown                                               91.3    8e-18   
emb|CAN83346.1|  hypothetical protein VITISV_042277                   90.5    9e-18   
ref|XP_010904661.1|  PREDICTED: transcription factor PIF4-like is...  90.9    9e-18   
ref|XP_007031278.1|  Phytochrome interacting factor 3, putative i...  91.3    9e-18   
tpg|DAA54248.1|  TPA: putative HLH DNA-binding domain superfamily...  90.9    9e-18   
gb|KDO44794.1|  hypothetical protein CISIN_1g0077971mg                88.2    9e-18   
ref|XP_010271069.1|  PREDICTED: transcription factor PIF3 isoform X1  91.3    9e-18   
dbj|BAJ91865.1|  predicted protein                                    88.6    9e-18   
ref|XP_010659764.1|  PREDICTED: transcription factor PIF3-like is...  91.3    9e-18   
ref|XP_010659765.1|  PREDICTED: transcription factor PIF3-like is...  91.3    9e-18   
ref|XP_011026200.1|  PREDICTED: transcription factor PIF4             90.5    9e-18   
ref|XP_010904660.1|  PREDICTED: transcription factor PIF4-like is...  90.5    9e-18   
emb|CDP16054.1|  unnamed protein product                              90.5    1e-17   
ref|XP_002303090.1|  PHYTOCHROME INTERACTING FACTOR 3-LIKE 5 fami...  90.9    1e-17   
ref|XP_010263502.1|  PREDICTED: transcription factor SPATULA-like...  89.0    1e-17   
ref|XP_008654839.1|  PREDICTED: uncharacterized protein LOC100279...  90.9    1e-17   
ref|XP_002512587.1|  conserved hypothetical protein                   91.3    1e-17   
gb|KFK43254.1|  phytochrome-interacting factor                        90.5    1e-17   
ref|XP_008453053.1|  PREDICTED: transcription factor PIF3 isoform X2  90.9    1e-17   
ref|XP_004982350.1|  PREDICTED: transcription factor PIF1-like is...  90.5    1e-17   
ref|XP_007031279.1|  Phytochrome interacting factor 3, putative i...  91.3    1e-17   
gb|KGN58326.1|  hypothetical protein Csa_3G622450                     90.5    1e-17   
ref|XP_004982352.1|  PREDICTED: transcription factor PIF1-like is...  90.5    1e-17   
ref|XP_004982351.1|  PREDICTED: transcription factor PIF1-like is...  90.5    1e-17   
ref|XP_003559649.1|  PREDICTED: transcription factor PIF1-like        89.7    1e-17   
ref|XP_011087568.1|  PREDICTED: transcription factor PIF3 isoform X2  90.9    1e-17   
ref|XP_006651623.1|  PREDICTED: transcription factor PIF5-like        88.6    1e-17   
gb|KDO44796.1|  hypothetical protein CISIN_1g0077971mg                88.2    1e-17   
gb|KDP23327.1|  hypothetical protein JCGZ_23160                       90.9    1e-17   
ref|XP_004495812.1|  PREDICTED: transcription factor PIF3-like is...  90.9    1e-17   
ref|XP_004495811.1|  PREDICTED: transcription factor PIF3-like is...  90.9    1e-17   
emb|CAN76246.1|  hypothetical protein VITISV_023382                   90.9    1e-17   
ref|XP_008776593.1|  PREDICTED: transcription factor PIF4-like is...  90.1    1e-17   
gb|KDO44791.1|  hypothetical protein CISIN_1g0077971mg                88.2    1e-17   
ref|XP_006386276.1|  hypothetical protein POPTR_0002s05630g           90.1    1e-17   
ref|XP_008453043.1|  PREDICTED: transcription factor PIF3 isoform X1  90.9    1e-17   
ref|XP_006423961.1|  hypothetical protein CICLE_v10027890mg           90.9    1e-17   
ref|XP_011087566.1|  PREDICTED: transcription factor PIF3 isoform X1  90.9    1e-17   
ref|XP_010233063.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  90.5    1e-17   
ref|XP_003591254.1|  Transcription factor PIF3                        90.9    1e-17   
gb|AAM61195.1|  unknown                                               87.0    1e-17   
emb|CDP15171.1|  unnamed protein product                              90.9    1e-17   
ref|XP_008776592.1|  PREDICTED: transcription factor PIF4-like is...  90.1    1e-17   
gb|KDO44792.1|  hypothetical protein CISIN_1g0077971mg                88.2    1e-17   
ref|XP_001764602.1|  predicted protein                                90.9    1e-17   
ref|NP_201512.1|  transcription factor ALC                            87.0    1e-17   
ref|XP_009397370.1|  PREDICTED: transcription factor PIF4-like        90.1    1e-17   
gb|KGN61033.1|  hypothetical protein Csa_2G035330                     90.9    1e-17   
gb|KDO44798.1|  hypothetical protein CISIN_1g0077971mg                88.2    1e-17   
gb|KCW50158.1|  hypothetical protein EUGRSUZ_K03592                   90.1    1e-17   
ref|XP_008235752.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  89.4    1e-17   
ref|XP_004247109.1|  PREDICTED: transcription factor PIF1-like        90.1    1e-17   
ref|XP_007201708.1|  hypothetical protein PRUPE_ppa004070mg           90.1    1e-17   
ref|XP_007049883.1|  Phytochrome interacting factor 3-like 5, put...  90.1    1e-17   
ref|XP_010038341.1|  PREDICTED: transcription factor PIF1-like is...  90.1    1e-17   
ref|XP_007049885.1|  Phytochrome interacting factor 3-like 5, put...  90.1    1e-17   
ref|XP_004144801.1|  PREDICTED: transcription factor PIF3-like        90.5    1e-17   
ref|XP_008372429.1|  PREDICTED: transcription factor PIF1-like        90.1    1e-17   
ref|XP_010038342.1|  PREDICTED: transcription factor PIF1-like is...  90.1    1e-17   
ref|XP_010464528.1|  PREDICTED: transcription factor ALC-like         86.7    2e-17   
ref|XP_010484550.1|  PREDICTED: transcription factor ALC-like         86.7    2e-17   
ref|XP_002278399.1|  PREDICTED: transcription factor PIF4             89.7    2e-17   
ref|XP_009591396.1|  PREDICTED: transcription factor PIF1-like        90.1    2e-17   
ref|XP_010906805.1|  PREDICTED: transcription factor PIF4-like is...  89.7    2e-17   
ref|XP_010674470.1|  PREDICTED: transcription factor PIF3-like        90.5    2e-17   
ref|XP_010906815.1|  PREDICTED: transcription factor PIF4-like is...  89.7    2e-17   
gb|KHN24194.1|  Transcription factor PIF3                             90.5    2e-17   
dbj|BAJ93366.1|  predicted protein                                    89.4    2e-17   
gb|EEE66551.1|  hypothetical protein OsJ_23063                        89.7    2e-17   
gb|AEK06083.1|  phytochrome-interacting factor 3.1                    89.7    2e-17   
gb|AEK06077.1|  phytochrome-interacting factor 3.1                    89.7    2e-17   
gb|AEK06076.1|  phytochrome-interacting factor 3.1                    89.7    2e-17   
ref|XP_006589101.1|  PREDICTED: transcription factor PIF3-like        90.1    2e-17   
ref|XP_010042473.1|  PREDICTED: transcription factor PIF3-like        90.1    2e-17   
gb|AEK06080.1|  phytochrome-interacting factor 3.1                    89.7    2e-17   
gb|AEK06075.1|  phytochrome-interacting factor 3.1                    89.7    2e-17   
ref|XP_006840391.1|  hypothetical protein AMTR_s00045p00141060        90.5    2e-17   
emb|CBI22065.3|  unnamed protein product                              89.7    2e-17   
gb|KJB10094.1|  hypothetical protein B456_001G183400                  88.6    2e-17   
ref|XP_008342323.1|  PREDICTED: transcription factor PIF4-like        89.7    2e-17   
ref|NP_001146943.1|  protein SPATULA                                  85.9    2e-17   
gb|EEC81506.1|  hypothetical protein OsI_24867                        89.7    2e-17   
ref|XP_009372305.1|  PREDICTED: transcription factor PIF1             89.4    2e-17   
ref|XP_007144439.1|  hypothetical protein PHAVU_007G156200g           89.4    2e-17   
gb|KJB33385.1|  hypothetical protein B456_006G008800                  87.8    2e-17   
gb|KJB08357.1|  hypothetical protein B456_001G078500                  87.8    2e-17   
ref|XP_006601285.1|  PREDICTED: transcription factor SPATULA-like...  87.0    2e-17   
ref|XP_004960433.1|  PREDICTED: transcription factor PIF3-like        89.0    2e-17   
ref|XP_009376949.1|  PREDICTED: transcription factor PIF4             89.4    2e-17   
gb|KDO65840.1|  hypothetical protein CISIN_1g014090mg                 88.2    2e-17   
ref|XP_004495025.1|  PREDICTED: transcription factor PIF1-like is...  89.4    2e-17   
ref|XP_006601284.1|  PREDICTED: transcription factor SPATULA-like...  87.0    2e-17   
ref|NP_001147257.1|  protein SPATULA                                  85.9    2e-17   
gb|KHN12794.1|  Transcription factor SPATULA                          87.0    3e-17   
ref|XP_009401971.1|  PREDICTED: transcription factor PIF3-like is...  89.7    3e-17   
ref|XP_010485325.1|  PREDICTED: transcription factor ALC-like         84.7    3e-17   
ref|XP_011039055.1|  PREDICTED: transcription factor PIF3-like is...  89.7    3e-17   
ref|XP_011039054.1|  PREDICTED: transcription factor PIF3-like is...  89.7    3e-17   
ref|XP_011039053.1|  PREDICTED: transcription factor PIF3-like is...  89.7    3e-17   
ref|XP_008667885.1|  PREDICTED: protein SPATULA isoform X2            86.3    3e-17   
ref|XP_006382253.1|  Phytochrome-interacting factor 3 family protein  89.7    3e-17   
ref|XP_007155915.1|  hypothetical protein PHAVU_003G242900g           88.2    3e-17   
gb|AAC99771.1|  phytochrome-associated protein 3                      89.4    3e-17   
ref|XP_009401973.1|  PREDICTED: transcription factor PIF3-like is...  89.4    3e-17   
ref|XP_010263501.1|  PREDICTED: transcription factor SPATULA-like...  88.6    3e-17   
ref|XP_010231744.1|  PREDICTED: transcription factor APG-like         87.0    3e-17   
ref|XP_008807924.1|  PREDICTED: transcription factor PIF3-like is...  89.4    3e-17   
ref|XP_009356576.1|  PREDICTED: transcription factor PIF4-like        89.4    3e-17   
gb|EAY91148.1|  hypothetical protein OsI_12756                        88.6    3e-17   
ref|XP_010228426.1|  PREDICTED: transcription factor PIF4-like is...  87.4    3e-17   
gb|KDO65837.1|  hypothetical protein CISIN_1g014090mg                 88.2    3e-17   
ref|XP_010240811.1|  PREDICTED: transcription factor PIF3-like is...  89.7    3e-17   
ref|XP_009417186.1|  PREDICTED: uncharacterized protein LOC103997...  87.0    3e-17   
ref|XP_010228425.1|  PREDICTED: transcription factor PIF4-like is...  87.8    3e-17   
ref|XP_008807923.1|  PREDICTED: transcription factor PIF3-like is...  89.4    3e-17   
ref|XP_008789575.1|  PREDICTED: transcription factor APG-like         87.8    3e-17   
ref|XP_002319450.2|  hypothetical protein POPTR_0013s00310g           89.7    3e-17   
ref|XP_011023895.1|  PREDICTED: transcription factor PIF3-like        89.7    3e-17   
ref|XP_009794217.1|  PREDICTED: transcription factor PIF3-like        89.4    3e-17   
ref|XP_008807920.1|  PREDICTED: transcription factor PIF3-like is...  89.4    3e-17   
gb|KHN39737.1|  Transcription factor SPATULA                          85.5    3e-17   
ref|XP_010240809.1|  PREDICTED: transcription factor PIF3-like is...  89.7    3e-17   
ref|XP_009417185.1|  PREDICTED: uncharacterized protein LOC103997...  87.0    3e-17   
gb|ABF97814.1|  Helix-loop-helix DNA-binding domain containing pr...  88.6    3e-17   
ref|XP_009794497.1|  PREDICTED: transcription factor PIF1             89.0    3e-17   
gb|KCW89801.1|  hypothetical protein EUGRSUZ_A02043                   87.8    3e-17   
ref|XP_002439246.1|  hypothetical protein SORBIDRAFT_09g003090        88.6    4e-17   
gb|ABF97813.1|  Helix-loop-helix DNA-binding domain containing pr...  88.6    4e-17   
ref|XP_011083103.1|  PREDICTED: transcription factor PIF1             88.6    4e-17   
ref|XP_006364548.1|  PREDICTED: transcription factor PIF1-like        88.6    4e-17   
gb|KHN43378.1|  Transcription factor PIF3                             89.0    4e-17   
ref|XP_006604778.1|  PREDICTED: transcription factor PIF3-like is...  89.0    4e-17   
ref|XP_009407082.1|  PREDICTED: transcription factor PIF5-like        87.0    4e-17   
ref|XP_004976829.1|  PREDICTED: transcription factor PIF1-like        85.1    4e-17   
ref|XP_010444695.1|  PREDICTED: transcription factor ALC-like         85.5    4e-17   
emb|CBY05411.1|  ALCATRAZ-like protein                                85.9    5e-17   
gb|EYU17967.1|  hypothetical protein MIMGU_mgv1a007316mg              87.4    5e-17   
ref|XP_010054152.1|  PREDICTED: transcription factor PIF5             88.2    6e-17   
gb|KJB10093.1|  hypothetical protein B456_001G183400                  88.2    6e-17   
ref|XP_006485006.1|  PREDICTED: transcription factor PIF4-like is...  88.2    6e-17   
ref|XP_008800314.1|  PREDICTED: transcription factor PIF3-like is...  88.6    6e-17   
ref|XP_006485005.1|  PREDICTED: transcription factor PIF4-like is...  88.2    6e-17   
ref|XP_006437069.1|  hypothetical protein CICLE_v10031028mg           88.2    6e-17   
ref|XP_010416208.1|  PREDICTED: transcription factor PIF1-like is...  88.2    6e-17   
ref|XP_008800313.1|  PREDICTED: transcription factor PIF3-like is...  88.6    6e-17   
ref|XP_006437068.1|  hypothetical protein CICLE_v10031028mg           88.2    6e-17   
ref|XP_004240467.1|  PREDICTED: transcription factor PIF1-like is...  88.2    6e-17   
ref|XP_006485007.1|  PREDICTED: transcription factor PIF4-like is...  88.2    6e-17   
gb|KHN09413.1|  Transcription factor PIF1                             85.9    6e-17   
ref|XP_006480179.1|  PREDICTED: transcription factor PIF1-like is...  88.2    6e-17   
ref|XP_004493863.1|  PREDICTED: transcription factor PIF1-like is...  87.8    6e-17   
gb|KJB10095.1|  hypothetical protein B456_001G183400                  88.2    6e-17   
ref|XP_001764406.1|  predicted protein                                89.0    7e-17   
ref|XP_010321805.1|  PREDICTED: transcription factor PIF1-like is...  88.2    7e-17   
gb|KJB08356.1|  hypothetical protein B456_001G078500                  87.4    7e-17   
ref|XP_006443673.1|  hypothetical protein CICLE_v10019585mg           88.2    7e-17   
ref|XP_004152073.1|  PREDICTED: transcription factor PIF1-like        88.2    7e-17   
ref|XP_004164938.1|  PREDICTED: transcription factor PIF1-like        88.2    7e-17   
ref|XP_010684995.1|  PREDICTED: transcription factor PIF1-like        88.2    7e-17   
ref|XP_006586043.1|  PREDICTED: transcription factor PIF4-like is...  87.0    7e-17   
gb|KJB10092.1|  hypothetical protein B456_001G183400                  88.2    7e-17   
ref|XP_011094525.1|  PREDICTED: transcription factor UNE10-like       87.0    7e-17   
ref|XP_006437072.1|  hypothetical protein CICLE_v10031028mg           88.2    8e-17   
ref|XP_004493862.1|  PREDICTED: transcription factor PIF1-like is...  87.8    8e-17   
ref|XP_004154488.1|  PREDICTED: transcription factor bHLH82-like      84.3    8e-17   
ref|XP_004493861.1|  PREDICTED: transcription factor PIF1-like is...  87.8    8e-17   
ref|XP_006437071.1|  hypothetical protein CICLE_v10031028mg           88.2    8e-17   
gb|KCW89798.1|  hypothetical protein EUGRSUZ_A02043                   88.2    8e-17   
ref|XP_004493860.1|  PREDICTED: transcription factor PIF1-like is...  87.8    8e-17   
ref|XP_006437070.1|  hypothetical protein CICLE_v10031028mg           88.2    8e-17   
gb|KJB10096.1|  hypothetical protein B456_001G183400                  87.8    8e-17   
dbj|BAJ90909.1|  predicted protein                                    87.4    9e-17   
ref|XP_006586042.1|  PREDICTED: transcription factor PIF4-like is...  87.8    9e-17   
gb|KJB45508.1|  hypothetical protein B456_007G309400                  88.2    9e-17   
dbj|BAJ92913.1|  predicted protein                                    87.4    9e-17   
gb|KJB10939.1|  hypothetical protein B456_001G234900                  87.8    9e-17   
gb|AFW57548.1|  putative HLH DNA-binding domain superfamily protein   87.4    9e-17   
ref|XP_002466350.1|  hypothetical protein SORBIDRAFT_01g006190        86.7    9e-17   
gb|KHG18014.1|  Transcription factor PIF1 -like protein               87.8    1e-16   
ref|XP_008662938.1|  PREDICTED: transcription factor APG-like         87.4    1e-16   
ref|NP_001146660.1|  putative HLH DNA-binding domain superfamily ...  86.7    1e-16   
ref|XP_002521150.1|  Phytochrome-interacting factor, putative         87.8    1e-16   



>ref|XP_010320324.1| PREDICTED: transcription factor SPATULA-like [Solanum lycopersicum]
Length=314

 Score =   169 bits (429),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 113/193 (59%), Gaps = 26/193 (13%)
 Frame = +2

Query  8    MADPYGTGHH---SLEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRMRD  178
            MADPY T  H   SLE EDMSSF  N L G   S+        + R              
Sbjct  1    MADPYRTNPHASSSLESEDMSSFFLNFLQGTPASSSATAAAGFYNR--------------  46

Query  179  GASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNK--  352
               AP  E S SLNFSDP  FY A+ KE   N F+SA +G+ D   S+ R EF  D+K  
Sbjct  47   SGPAPVAESSSSLNFSDPGRFYAAEFKEGVENVFASAGLGECDGMNSANRREFLEDDKVD  106

Query  353  -------GCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNK  511
                    C+  D  S+   PR SKRSRSAEVHNLSEKRRRSRINEKLKALQ LIPNSNK
Sbjct  107  NFGFSSEECDGLDMPSDPTHPRSSKRSRSAEVHNLSEKRRRSRINEKLKALQNLIPNSNK  166

Query  512  TDKASMLDEAIEY  550
            TDKASMLDEAIEY
Sbjct  167  TDKASMLDEAIEY  179



>ref|XP_006354865.1| PREDICTED: transcription factor SPATULA-like [Solanum tuberosum]
Length=314

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 113/193 (59%), Gaps = 26/193 (13%)
 Frame = +2

Query  8    MADPYGTGHH---SLEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRMRD  178
            MADPY T  H   SLE EDMSSF  N L G S SA        + R              
Sbjct  1    MADPYRTNPHAASSLESEDMSSFFLNFLQGTSASASATAAAGFYNR--------------  46

Query  179  GASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNK--  352
                P  E S SLNFSDP  FY A+ KE   N F+SA +GD D   S+ R EF  D+K  
Sbjct  47   SVPVPVAESSSSLNFSDPGRFYAAEFKEGVENVFASAGLGDCDGMNSANRREFLEDDKVD  106

Query  353  -------GCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNK  511
                    C+  D  S+   PR SKRSRSAEVHNLSEKRRRS+INEKLKALQ LIPNSNK
Sbjct  107  NFGFSSEECDGLDMPSDPTHPRSSKRSRSAEVHNLSEKRRRSKINEKLKALQNLIPNSNK  166

Query  512  TDKASMLDEAIEY  550
            TDKASMLDEAIEY
Sbjct  167  TDKASMLDEAIEY  179



>emb|CDP01313.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 109/193 (56%), Gaps = 29/193 (15%)
 Frame = +2

Query  8    MADPYGTGHHSL-----------EPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEAT  154
            M+DPYGT   S            EPEDM+ FL NL   +  +A                 
Sbjct  1    MSDPYGTDDRSSFEPDSEPGGPPEPEDMNVFLHNLFQNSPATAGSSSL------------  48

Query  155  DFMGRMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDA-TGSSKRI  331
                  R  AS      + S +FSDP  F+  +VK      FS AA  D DA T S  R 
Sbjct  49   -----YRGSASMINSSSAASFDFSDPGGFFAGEVKGRLEKTFSLAAAADCDAVTSSMDRG  103

Query  332  EFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNK  511
            EF   NKG E SDA  N AQPR +KRSRSAEVHNLSEKRRRSRINEKLKALQ LIPNSNK
Sbjct  104  EFSGANKGLEASDAAINQAQPRSTKRSRSAEVHNLSEKRRRSRINEKLKALQNLIPNSNK  163

Query  512  TDKASMLDEAIEY  550
            TDKASMLDEAIEY
Sbjct  164  TDKASMLDEAIEY  176



>ref|XP_009627217.1| PREDICTED: transcription factor SPATULA-like [Nicotiana tomentosiformis]
Length=317

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 112/197 (57%), Gaps = 31/197 (16%)
 Frame = +2

Query  8    MADPYGTGHHS-------LEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMG  166
            MADPY T  H        LE EDMSSF  N L  +S S                     G
Sbjct  1    MADPYRTNPHPHASSSSPLESEDMSSFFLNFLQNSSASTSAAAA---------------G  45

Query  167  RMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFEND  346
                 A   A + S +LNFSDP  FY A+ KE   N F+SA +GD DA  S+ R EF  D
Sbjct  46   FCHRSAPETAADSSSNLNFSDPGRFYAAEFKEGVENVFASAGLGDCDAMDSANRREFLED  105

Query  347  NK---------GCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIP  499
            +K          C+  D  +N    R SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIP
Sbjct  106  DKVDNFGFSSEECDGLDMPANQNHSRSSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIP  165

Query  500  NSNKTDKASMLDEAIEY  550
            NSNKTDKASMLDEAIEY
Sbjct  166  NSNKTDKASMLDEAIEY  182



>ref|XP_009771084.1| PREDICTED: transcription factor SPATULA-like [Nicotiana sylvestris]
Length=316

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 114/196 (58%), Gaps = 30/196 (15%)
 Frame = +2

Query  8    MADPYGTGHHS------LEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGR  169
            MADPY T  H       LE EDMSSF  N L  +S S      G  + R   E       
Sbjct  1    MADPYRTSPHPHASSSPLESEDMSSFFLNFLQNSSASTSAAAAG-FYHRSVPET------  53

Query  170  MRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDN  349
                    A + S +LNFSDP  FY A+ KE   N F+SA +GD DA  S+ R EF  D+
Sbjct  54   --------AADSSSNLNFSDPGRFYAAEFKEGVENVFASAGLGDSDAMDSANRREFLEDD  105

Query  350  K---------GCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPN  502
            K          C+  D  +N    R SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPN
Sbjct  106  KVDNLGFSSEECDGLDMPANQNHSRSSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPN  165

Query  503  SNKTDKASMLDEAIEY  550
            SNKTDKASMLDEAIEY
Sbjct  166  SNKTDKASMLDEAIEY  181



>gb|KDP41706.1| hypothetical protein JCGZ_16113 [Jatropha curcas]
Length=330

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 115/205 (56%), Gaps = 40/205 (20%)
 Frame = +2

Query  8    MADPYGTGHH-SLEPEDMSSFLQNLLHGASTSAdgddggVLFPR------------PAME  148
            MAD YGT    + EPE++SSFL +LLH +S+S+                       PA E
Sbjct  1    MADLYGTATSPAPEPEEISSFLHHLLHNSSSSSSSKFMQNALSSPPPALPPQADSSPATE  60

Query  149  ATDFMGRMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKR  328
                 GR + G  A     S  +NFSDP  ++    KES  NA SS           SKR
Sbjct  61   L--LFGRSQSGCLADG--RSSCVNFSDPGGYFA---KESTENAVSSVM---------SKR  104

Query  329  --IEFEND--------NKGCETSDALSNLAQPRPS-KRSRSAEVHNLSEKRRRSRINEKL  475
              +  END         KG E SD  S  A+PR S KRSR+AEVHNLSEKRRRSRINEK+
Sbjct  105  RGVSVENDLGDLSCDSEKGAEVSDMPSETARPRTSSKRSRAAEVHNLSEKRRRSRINEKM  164

Query  476  KALQTLIPNSNKTDKASMLDEAIEY  550
            KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  165  KALQNLIPNSNKTDKASMLDEAIEY  189



>ref|XP_007017187.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY14412.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=332

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 114/203 (56%), Gaps = 35/203 (17%)
 Frame = +2

Query  8    MADPYGTGHHS-LEPEDMSSFLQNLLHGASTSAdgddggV--------LFPRPAME----  148
            MAD YGT   S  EPE++S+FL  LLH +S S+      +         FP  A E    
Sbjct  1    MADLYGTPASSNPEPEEISTFLSQLLHNSSASSSSSSSCMQFKTKSIHTFPSHAPEFSTP  60

Query  149  --------ATDFMGRMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDF  304
                    A     + R G SA   E  P +NFSDP  ++GA VK+SA  A SSA     
Sbjct  61   AANSRAGMAIPVEDQYRLGGSAVRAESEPRVNFSDPETYFGANVKDSADIALSSAG----  116

Query  305  DATGSSKRIEFENDNKGCETSDALSNL-AQPRPSKRSRSAEVHNLSEKRRRSRINEKLKA  481
                     EF  D++  E S A SN       SKRSR+AEVHNLSEKRRRSRINEK+KA
Sbjct  117  ---------EFSYDSEVQEPSKAPSNQERPRSSSKRSRAAEVHNLSEKRRRSRINEKMKA  167

Query  482  LQTLIPNSNKTDKASMLDEAIEY  550
            LQ LIPNSNKTDKASMLDEAIEY
Sbjct  168  LQNLIPNSNKTDKASMLDEAIEY  190



>ref|XP_007017188.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY14413.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=333

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 116/203 (57%), Gaps = 34/203 (17%)
 Frame = +2

Query  8    MADPYGTGHHS-LEPEDMSSFLQNLLHGASTSAdgddggV--------LFPRPAME----  148
            MAD YGT   S  EPE++S+FL  LLH +S S+      +         FP  A E    
Sbjct  1    MADLYGTPASSNPEPEEISTFLSQLLHNSSASSSSSSSCMQFKTKSIHTFPSHAPEFSTP  60

Query  149  --------ATDFMGRMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDF  304
                    A     + R G SA   E  P +NFSDP  ++GA VK+SA  A SSA    +
Sbjct  61   AANSRAGMAIPVEDQYRLGGSAVRAESEPRVNFSDPETYFGANVKDSADIALSSAGEFSY  120

Query  305  DATGSSKRIEFENDNKGCETSDALSNL-AQPRPSKRSRSAEVHNLSEKRRRSRINEKLKA  481
            D    S++++        E S A SN       SKRSR+AEVHNLSEKRRRSRINEK+KA
Sbjct  121  D----SEKVQ--------EPSKAPSNQERPRSSSKRSRAAEVHNLSEKRRRSRINEKMKA  168

Query  482  LQTLIPNSNKTDKASMLDEAIEY  550
            LQ LIPNSNKTDKASMLDEAIEY
Sbjct  169  LQNLIPNSNKTDKASMLDEAIEY  191



>ref|XP_002284880.1| PREDICTED: transcription factor SPATULA isoform X1 [Vitis vinifera]
 emb|CBI19497.3| unnamed protein product [Vitis vinifera]
Length=369

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 122/235 (52%), Gaps = 57/235 (24%)
 Frame = +2

Query  8    MADPYGTGHHS------LEPEDMSSFLQNLLHGASTS-----------AdgddggVLFPR  136
            MAD YGT   S      LE ED+S+FL + LH  S+S           A      +L P 
Sbjct  1    MADLYGTNVSSSATALALESEDISAFLHHFLHNQSSSSTTTSTIKAKHAHSFSPALLHPE  60

Query  137  PAMEA------------------TDFMGRMRDG----ASAPAIEPSPSLNFSDPSLFYGA  250
             A  A                  +D   R+R G     S+  +E S  +NFSD   +  A
Sbjct  61   TASAAEVLSPQKDRRRFSRSAILSDSDCRVRSGLSTAGSSAVVESSTGINFSDHGAYCPA  120

Query  251  QVKESAVNAFSSAAIGDFDA-TGSSKRIEFENDN----------KGCETSDALSNLAQPR  397
             +KE+A N FSS A  D +A T S KR  F  +N          KG E SD  SN   P 
Sbjct  121  GMKETAGNTFSSIAAVDSEAITVSRKRRMFSMENSVDDFGCDSEKGPEASDVPSN---PA  177

Query  398  PSKRSR----SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            PS+ S     +AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  178  PSRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  232



>ref|XP_010664562.1| PREDICTED: transcription factor SPATULA isoform X2 [Vitis vinifera]
Length=368

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 124/234 (53%), Gaps = 56/234 (24%)
 Frame = +2

Query  8    MADPYGTGHHS------LEPEDMSSFLQNLLHGASTS-----------AdgddggVLFPR  136
            MAD YGT   S      LE ED+S+FL + LH  S+S           A      +L P 
Sbjct  1    MADLYGTNVSSSATALALESEDISAFLHHFLHNQSSSSTTTSTIKAKHAHSFSPALLHPE  60

Query  137  PAMEA------------------TDFMGRMRDG----ASAPAIEPSPSLNFSDPSLFYGA  250
             A  A                  +D   R+R G     S+  +E S  +NFSD   +  A
Sbjct  61   TASAAEVLSPQKDRRRFSRSAILSDSDCRVRSGLSTAGSSAVVESSTGINFSDHGAYCPA  120

Query  251  QVKESAVNAFSSAAIGDFDA-TGSSKRIEF--EN--DNKGC-----ETSDALSNLAQPRP  400
             +KE+A N FSS A  D +A T S KR  F  EN  D+ GC     E SD  SN   P P
Sbjct  121  GMKETAGNTFSSIAAVDSEAITVSRKRRMFSMENSVDDFGCDSEGPEASDVPSN---PAP  177

Query  401  SKRSR----SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            S+ S     +AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  178  SRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  231



>gb|KJB58529.1| hypothetical protein B456_009G213800 [Gossypium raimondii]
Length=332

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 113/203 (56%), Gaps = 35/203 (17%)
 Frame = +2

Query  8    MADPYGTGHHS-LEPEDMSSFLQNLLHGASTSAdgddggVLF----------PRPAME--  148
            MAD YG   +S  E E++S+ L  LLH +S+S+      + F          P P +   
Sbjct  1    MADLYGGAPYSNPETEEISTILNQLLHNSSSSSSSSSSCMQFKGKNIHSFPSPVPGISTP  60

Query  149  --------ATDFMGRMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDF  304
                        M R R G  A  IE  P +N SDP  ++GA VK+SA NA SSA     
Sbjct  61   AANSGAGMGIPVMDRYRLGGLAVRIESEPRVNISDPETYFGANVKDSADNALSSAC----  116

Query  305  DATGSSKRIEFENDNKGCETSDALSNL-AQPRPSKRSRSAEVHNLSEKRRRSRINEKLKA  481
                     +F  D++  + S+  SN       SKRSR+AEVHNLSEKRRRSRINEK+KA
Sbjct  117  ---------DFSYDSEVPDASEVPSNQERPRSSSKRSRAAEVHNLSEKRRRSRINEKMKA  167

Query  482  LQTLIPNSNKTDKASMLDEAIEY  550
            LQ LIPNSNKTDKASMLDEAIEY
Sbjct  168  LQNLIPNSNKTDKASMLDEAIEY  190



>ref|XP_010112171.1| Transcription factor SPATULA [Morus notabilis]
 gb|EXC32837.1| Transcription factor SPATULA [Morus notabilis]
Length=350

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 119/230 (52%), Gaps = 56/230 (24%)
 Frame = +2

Query  8    MADPYGTGHHS-----LEPEDMSSFLQNLLHGASTS------------------------  100
            M D YGT   S      E ED+++FL  LLH +S+                         
Sbjct  1    MDDLYGTTPSSGAGLASETEDITNFLNQLLHSSSSPYSSASSSSCTTFKAKYAHLLHSQA  60

Query  101  ----AdgddggVLF-----PRPAMEATDFMGRMRDGASAPAIEPSPSLNFSDPS-LFYGA  250
                       VLF     P P   A D  G    G+SA A   S   +FSDP   ++G 
Sbjct  61   PPHQTTSFSDAVLFGSENRPEPECRAID--GNSGAGSSAVADSLS-GFDFSDPCGAYFGV  117

Query  251  QVKESAVN--AFSSAAIGDFDATGSSKRIEFEND-------NKGCETSDALSNLAQPRPS  403
            +VKE A N   FSS    D +     +RI  END       ++G E S+  SN A PR S
Sbjct  118  EVKEGAENNTTFSS----DANTPSKGRRISPENDLGDFSCDSEGPEASEVPSNSAPPRSS  173

Query  404  -KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
             KRSR+AE+HNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  174  SKRSRAAEIHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  223



>gb|KJB58530.1| hypothetical protein B456_009G213800 [Gossypium raimondii]
Length=333

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 112/203 (55%), Gaps = 34/203 (17%)
 Frame = +2

Query  8    MADPYGTGHHS-LEPEDMSSFLQNLLHGASTSAdgddggVLF----------PRPAME--  148
            MAD YG   +S  E E++S+ L  LLH +S+S+      + F          P P +   
Sbjct  1    MADLYGGAPYSNPETEEISTILNQLLHNSSSSSSSSSSCMQFKGKNIHSFPSPVPGISTP  60

Query  149  --------ATDFMGRMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDF  304
                        M R R G  A  IE  P +N SDP  ++GA VK+SA NA SSA    +
Sbjct  61   AANSGAGMGIPVMDRYRLGGLAVRIESEPRVNISDPETYFGANVKDSADNALSSACDFSY  120

Query  305  DATGSSKRIEFENDNKGCETSDALSNL-AQPRPSKRSRSAEVHNLSEKRRRSRINEKLKA  481
            D+             K  + S+  SN       SKRSR+AEVHNLSEKRRRSRINEK+KA
Sbjct  121  DS------------EKVPDASEVPSNQERPRSSSKRSRAAEVHNLSEKRRRSRINEKMKA  168

Query  482  LQTLIPNSNKTDKASMLDEAIEY  550
            LQ LIPNSNKTDKASMLDEAIEY
Sbjct  169  LQNLIPNSNKTDKASMLDEAIEY  191



>gb|EYU25441.1| hypothetical protein MIMGU_mgv1a010846mg [Erythranthe guttata]
Length=300

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 101/182 (55%), Gaps = 30/182 (16%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRMRDGAS  187
            M+D YG+       ED+SSFLQ LL   S+SA                  F+     G +
Sbjct  1    MSDLYGSNESE---EDISSFLQILLQNPSSSAPPTTAP------PAAGEFFIA----GEA  47

Query  188  APAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIE-FENDNKGCET  364
             P  EPS  ++ SDPS F+G                 D+D    S  ++   + ++  E 
Sbjct  48   VPVPEPSSGIDISDPSCFFGR----------------DYDGLNPSSSVKNLASSSEEPEG  91

Query  365  SDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAI  544
            SDA  N + P  SKR R+AEVHNLSEKRRRSRINEKLKALQ LIPNSNKTDKASMLDEAI
Sbjct  92   SDAPGNPSLPHSSKRRRAAEVHNLSEKRRRSRINEKLKALQNLIPNSNKTDKASMLDEAI  151

Query  545  EY  550
            EY
Sbjct  152  EY  153



>ref|XP_007224914.1| hypothetical protein PRUPE_ppa021918mg [Prunus persica]
 gb|EMJ26113.1| hypothetical protein PRUPE_ppa021918mg [Prunus persica]
Length=330

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 89/138 (64%), Gaps = 18/138 (13%)
 Frame = +2

Query  167  RMRDGASAPAI-EPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFEN  343
            R+ DG SA A+ E S   +F+D   ++ A+VKE   +        D + +   +RI  EN
Sbjct  80   RVADGNSAAAVVESSSGFDFTDSGGYFQAEVKEGMES--------DANTSLKGRRISSEN  131

Query  344  D--------NKGCETSDALSNLAQPRP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLI  496
            D         KG + S+   N A PR  SKRSR+AEVHN+SEKRRRSRINEK+KALQ LI
Sbjct  132  DLGDFSYDSEKGHDRSEVPLNPAPPRSLSKRSRAAEVHNMSEKRRRSRINEKMKALQNLI  191

Query  497  PNSNKTDKASMLDEAIEY  550
            PNSNKTDKASMLDEAIEY
Sbjct  192  PNSNKTDKASMLDEAIEY  209



>ref|XP_011074391.1| PREDICTED: transcription factor SPATULA-like [Sesamum indicum]
Length=246

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 79/119 (66%), Gaps = 20/119 (17%)
 Frame = +2

Query  200  EPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCE--TSDA  373
            E S S+NFSDP  F+    KE+             D    S R+   N    CE   S+ 
Sbjct  3    ECSSSVNFSDPRSFFA---KEN-------------DRINPSTRVR--NLVSSCEEEASEN  44

Query  374  LSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
             +NLA PR SKR+R+AEVHNLSEKRRRSRINEKLKALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  45   PANLAPPRSSKRTRAAEVHNLSEKRRRSRINEKLKALQSLIPNSNKTDKASMLDEAIEY  103



>gb|KDO84121.1| hypothetical protein CISIN_1g0227822mg, partial [Citrus sinensis]
Length=159

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 104/188 (55%), Gaps = 45/188 (24%)
 Frame = +2

Query  8    MADPYGT-----GHHSLEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRM  172
            MAD YGT     GH   EPE++SSFL   +H +S+S+        F +P         R 
Sbjct  1    MADLYGTTPPTAGH---EPEEISSFLNQFIHNSSSSSSS----CFFAQPE-------DRH  46

Query  173  RDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNK  352
              G SA            DPS+   +    SA   FS+  +G  D+          ND++
Sbjct  47   PFGRSA------------DPSVLDSS----SAGLNFSNLVVGAVDSDT--------NDSE  82

Query  353  GCETSDALSN--LAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKAS  526
            G +  +  SN  +     SKRSR+AEVHNLSEKRRRSRINEKLKALQ LIPNSNKTDKAS
Sbjct  83   GPDALEVPSNDTVRTKTSSKRSRAAEVHNLSEKRRRSRINEKLKALQNLIPNSNKTDKAS  142

Query  527  MLDEAIEY  550
            MLDEAIEY
Sbjct  143  MLDEAIEY  150



>ref|XP_002510190.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52377.1| conserved hypothetical protein [Ricinus communis]
Length=312

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 103/193 (53%), Gaps = 35/193 (18%)
 Frame = +2

Query  8    MADPYGTGHH-SLEPEDMSSFLQNLLHGAS--------TSAdgddggVLFPRPAMEATDF  160
            MAD YGT    + E E++S FL  LLH +S                  L P  +  A  F
Sbjct  1    MADLYGTSPSPAPESEEISCFLHQLLHNSSSSTSSSKFVHHSFSSSHSLPPENSSPAELF  60

Query  161  MGRMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAA--IGDFDATGSSKRIE  334
             G    G S+       SLN+SD   ++    KESA     S    +GD           
Sbjct  61   FG---GGGSS-------SLNYSDQGGYF---AKESAERRGVSMENDLGDLSC--------  99

Query  335  FENDNKGCETSDALSNLAQPR-PSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNK  511
              +  KG E ++  S   +PR  SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNK
Sbjct  100  --DSEKGAEVAEVPSETVRPRNSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNK  157

Query  512  TDKASMLDEAIEY  550
            TDKASMLDEAIEY
Sbjct  158  TDKASMLDEAIEY  170



>ref|XP_008444604.1| PREDICTED: transcription factor SPATULA-like [Cucumis melo]
Length=379

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 80/122 (66%), Gaps = 14/122 (11%)
 Frame = +2

Query  215  LNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRI---------EFENDNKGCETS  367
            +  SDP  F    VKES+ NAFSS+   D D     KR          +F  D++G +  
Sbjct  124  VKLSDPGDF----VKESSDNAFSSSGAVDSDTNAPLKRRGLSSENDLGDFSCDSEGGDLP  179

Query  368  DALSNLAQPR-PSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAI  544
            +  S+   PR  SKRSRSAEVHN+SEKRRR RINEK+KALQ LIPNSNKTDKASMLDEAI
Sbjct  180  EVPSSTDLPRNSSKRSRSAEVHNMSEKRRRRRINEKMKALQNLIPNSNKTDKASMLDEAI  239

Query  545  EY  550
            EY
Sbjct  240  EY  241



>ref|XP_008220349.1| PREDICTED: uncharacterized protein LOC103320445 [Prunus mume]
Length=1181

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 116/220 (53%), Gaps = 50/220 (23%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGASTSAdgddggVLF-------------PRPAME  148
            MAD YGT   S   E++S+ L  LLHG  +SA      + F             P     
Sbjct  1    MADLYGTAPDS---EEISNILSQLLHGHGSSASSSSSCMPFKPTYTHLLHSSVAPHHVTT  57

Query  149  ATDFM-----------------GRMRDGASAPAI-EPSPSLNFSDPSLFYGAQVKESAVN  274
            +++ +                  R+ DG SA A+ E S   +F+D   ++ A+VKE   +
Sbjct  58   SSEVLISETRHEDYHRFARSEDRRVVDGNSAAAVVESSSGFDFTDSGGYFQAEVKEGMES  117

Query  275  AFSSAAIGDFDATGSSKRIEFEND-------NKGCETSDALSNLAQPRP-SKRSRSAEVH  430
                    D + +   +RI  END       ++G + S+   N   PR  SKRSR+AEVH
Sbjct  118  --------DANTSLKGRRISSENDLGDFSYDSEGHDRSEVPLNPVPPRSLSKRSRAAEVH  169

Query  431  NLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            N+SEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  170  NMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  209



>gb|KDO84120.1| hypothetical protein CISIN_1g0227822mg, partial [Citrus sinensis]
Length=160

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 103/188 (55%), Gaps = 44/188 (23%)
 Frame = +2

Query  8    MADPYGT-----GHHSLEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRM  172
            MAD YGT     GH   EPE++SSFL   +H +S+S+        F +P         R 
Sbjct  1    MADLYGTTPPTAGH---EPEEISSFLNQFIHNSSSSSSS----CFFAQPE-------DRH  46

Query  173  RDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNK  352
              G SA            DPS+   +    SA   FS+  +G  D+       +  +  K
Sbjct  47   PFGRSA------------DPSVLDSS----SAGLNFSNLVVGAVDS-------DTNDSEK  83

Query  353  GCETSDALSN--LAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKAS  526
            G +  +  SN  +     SKRSR+AEVHNLSEKRRRSRINEKLKALQ LIPNSNKTDKAS
Sbjct  84   GPDALEVPSNDTVRTKTSSKRSRAAEVHNLSEKRRRSRINEKLKALQNLIPNSNKTDKAS  143

Query  527  MLDEAIEY  550
            MLDEAIEY
Sbjct  144  MLDEAIEY  151



>ref|XP_006473302.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Citrus 
sinensis]
Length=291

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 104/188 (55%), Gaps = 45/188 (24%)
 Frame = +2

Query  8    MADPYGT-----GHHSLEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRM  172
            MAD YGT     GH   EPE++SSFL   +H +S+S+        F +P         R 
Sbjct  1    MADLYGTTPPTAGH---EPEEISSFLNQFIHNSSSSSSS----CFFAQPE-------DRH  46

Query  173  RDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNK  352
              G SA            DPS+   +    SA   FS+  +G  D+          ND++
Sbjct  47   PFGRSA------------DPSVLDSS----SAGLNFSNLVVGAVDSD--------TNDSE  82

Query  353  GCETSDALSN--LAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKAS  526
            G +  +  SN  +     SKRSR+AEVHNLSEKRRRSRINEKLKALQ LIPNSNKTDKAS
Sbjct  83   GPDALEVPSNDTVRTKTSSKRSRAAEVHNLSEKRRRSRINEKLKALQNLIPNSNKTDKAS  142

Query  527  MLDEAIEY  550
            MLDEAIEY
Sbjct  143  MLDEAIEY  150



>ref|XP_008367660.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Malus 
domestica]
Length=346

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 108/222 (49%), Gaps = 58/222 (26%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGASTSAdgdd--------------------ggVL  127
            MAD YGT   S   E++S+ L  L+HG  +SA                          VL
Sbjct  1    MADLYGTAPDS---EEISNILSQLIHGHGSSASSCMPFKPTYMQSSVPPPIQAATPSEVL  57

Query  128  FPRPAME------------ATDFMGRMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAV  271
             P    E             TD      +  SA  +  S + +F D   ++  +VKE   
Sbjct  58   IPEARHEDHRRFAQLVNRSGTDQRVAGGNSNSAGVLASSSAFDFYDSGGYFTEEVKEG--  115

Query  272  NAFSSAAIGDFDATGSSKRIEFENDNKG--C------ETSDALSNLAQPRPS-KRSRSAE  424
                       ++ G  +RI  END  G  C      E +DA  N A PR S KRSR+AE
Sbjct  116  ----------MESDG--RRISSENDLGGYSCDSEGLEEAADAQLNSALPRSSSKRSRAAE  163

Query  425  VHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            VHN+SEKRRRSRINEK+KALQ LIPNSNKTDKASMLDE IEY
Sbjct  164  VHNMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEVIEY  205



>ref|XP_008367659.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Malus 
domestica]
Length=347

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 89/223 (40%), Positives = 108/223 (48%), Gaps = 59/223 (26%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGASTSAdgdd--------------------ggVL  127
            MAD YGT   S   E++S+ L  L+HG  +SA                          VL
Sbjct  1    MADLYGTAPDS---EEISNILSQLIHGHGSSASSCMPFKPTYMQSSVPPPIQAATPSEVL  57

Query  128  FPRPAME------------ATDFMGRMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAV  271
             P    E             TD      +  SA  +  S + +F D   ++  +VKE   
Sbjct  58   IPEARHEDHRRFAQLVNRSGTDQRVAGGNSNSAGVLASSSAFDFYDSGGYFTEEVKEG--  115

Query  272  NAFSSAAIGDFDATGSSKRIEFENDNKG--C-------ETSDALSNLAQPRPS-KRSRSA  421
                       ++ G  +RI  END  G  C       E +DA  N A PR S KRSR+A
Sbjct  116  ----------MESDG--RRISSENDLGGYSCDSEKGLEEAADAQLNSALPRSSSKRSRAA  163

Query  422  EVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            EVHN+SEKRRRSRINEK+KALQ LIPNSNKTDKASMLDE IEY
Sbjct  164  EVHNMSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEVIEY  206



>ref|XP_004172700.1| PREDICTED: uncharacterized protein LOC101229339 [Cucumis sativus]
 gb|KGN62490.1| hypothetical protein Csa_2G356640 [Cucumis sativus]
Length=379

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 80/122 (66%), Gaps = 14/122 (11%)
 Frame = +2

Query  215  LNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRI---------EFENDNKGCETS  367
            +  SDP  F    +KES+ NAFSS+   D D     KR          +F  D++G +  
Sbjct  124  VKLSDPGDF----LKESSDNAFSSSGAVDSDTNAPLKRRGLSSENDLGDFSCDSEGGDLP  179

Query  368  DALSNLAQPR-PSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAI  544
            +  S+   PR  SKRSRSAEVHN+SEKRRR RINEK+KALQ LIPNSNKTDKASMLDEAI
Sbjct  180  EVPSSTNLPRNSSKRSRSAEVHNMSEKRRRRRINEKMKALQNLIPNSNKTDKASMLDEAI  239

Query  545  EY  550
            EY
Sbjct  240  EY  241



>ref|XP_009783822.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 104/181 (57%), Gaps = 29/181 (16%)
 Frame = +2

Query  44   EPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATD----FMGRMRDGASAPAIEPSP  211
            EP+D+S FL+++LH +S           F    M+ +      + + + G      E S 
Sbjct  19   EPDDISVFLRHILHPSSN----------FVTHEMQYSSSLPHLLPKNQHGLDISNGELSS  68

Query  212  SLNFSDPSLF---YGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSN  382
             LN S   +F   YGA    + V   SS+++G  D    ++  E+E +++G      +  
Sbjct  69   VLNSSAGGIFSSSYGAYNVPANV---SSSSVGTMD----NEPDEYECESEGGTEDLGVEA  121

Query  383  LAQPRP-----SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIE  547
              QP P     SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIE
Sbjct  122  STQPPPPSNTNSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIE  181

Query  548  Y  550
            Y
Sbjct  182  Y  182



>ref|XP_009783823.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Nicotiana 
sylvestris]
Length=368

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 104/181 (57%), Gaps = 29/181 (16%)
 Frame = +2

Query  44   EPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATD----FMGRMRDGASAPAIEPSP  211
            EP+D+S FL+++LH +S           F    M+ +      + + + G      E S 
Sbjct  19   EPDDISVFLRHILHPSSN----------FVTHEMQYSSSLPHLLPKNQHGLDISNGELSS  68

Query  212  SLNFSDPSLF---YGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSN  382
             LN S   +F   YGA    + V   SS+++G  D    ++  E+E +++G      +  
Sbjct  69   VLNSSAGGIFSSSYGAYNVPANV---SSSSVGTMD----NEPDEYECESEGGTEDLGVEA  121

Query  383  LAQPRP-----SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIE  547
              QP P     SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIE
Sbjct  122  STQPPPPSNTNSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIE  181

Query  548  Y  550
            Y
Sbjct  182  Y  182



>ref|XP_006374908.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|ERP52705.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=310

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 101/189 (53%), Gaps = 29/189 (15%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRMRDGAS  187
            M D YG    + EPE++S+FL  LLH  S+S        L   P     + + R R   +
Sbjct  1    MEDLYGAAA-ATEPEEISTFLHQLLHNNSSSPSKFMHHAL-STPVENGVELLDRHRFSET  58

Query  188  APAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAA--------IGDFDATGSSKRIEFEN  343
                E    +NFSDP  +Y    KE   NA  S          +GDF +  S K +E + 
Sbjct  59   ----ECGAGVNFSDPDGYYA---KEGVGNAVVSKRGGVSVEDDLGDF-SCDSEKGVEVQA  110

Query  344  DNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKA  523
            +                  SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKA
Sbjct  111  NTA-----------RPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKA  159

Query  524  SMLDEAIEY  550
            SMLDEAIEY
Sbjct  160  SMLDEAIEY  168



>gb|ADN33721.1| serine/threonine-protein kinase [Cucumis melo subsp. melo]
Length=842

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 80/122 (66%), Gaps = 14/122 (11%)
 Frame = +2

Query  215  LNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRI---------EFENDNKGCETS  367
            +  SDP  F    VKES+ NAFSS+   D D     KR          +F  D++G +  
Sbjct  124  VKLSDPGDF----VKESSDNAFSSSGAVDSDTNAPLKRRGLSSENDLGDFSCDSEGGDLP  179

Query  368  DALSNLAQPR-PSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAI  544
            +  S+   PR  SKRSRSAEVHN+SEKRRR RINEK+KALQ LIPNSNKTDKASMLDEAI
Sbjct  180  EVPSSTDLPRNSSKRSRSAEVHNMSEKRRRRRINEKMKALQNLIPNSNKTDKASMLDEAI  239

Query  545  EY  550
            EY
Sbjct  240  EY  241



>ref|XP_010538109.1| PREDICTED: transcription factor SPATULA-like [Tarenaya hassleriana]
Length=298

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 114/216 (53%), Gaps = 47/216 (22%)
 Frame = +2

Query  8    MADPYGTGHHSLE------PEDMSSFLQNLLHGASTSAdgddggV--LF-------PRPA  142
            MADP   G    E      PE++S+F  + LHG S+++         LF       P P 
Sbjct  1    MADPDLYGGPDTESSSPSQPEEISAFFNHFLHGPSSASSSSRVRFRPLFDHSTASPPPPP  60

Query  143  MEA-----------------TDFMGRMRDGASAPAIEPSPSLNF--SDPSLFYGAQVKES  265
             +A                 TD + R   G S    + S S  F  SD + ++G+ +K+ 
Sbjct  61   YDAVLDPVEDIGRTSGSAVRTDLVSRNAVGKSGSGADLSSSSGFDVSDHAAYFGSGLKDM  120

Query  266  AVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPS-KRSRSAEVHNLSE  442
              NA SS   GD         I +E++ +    S+  SN+ +P  S KR R+AEVHNLSE
Sbjct  121  TENATSST--GD---------ISWESEKRSG-ASEMPSNIMRPSSSSKRCRAAEVHNLSE  168

Query  443  KRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRRRSRINE+LKALQ LIPNSNKTDKASMLDEAIEY
Sbjct  169  KRRRSRINERLKALQKLIPNSNKTDKASMLDEAIEY  204



>ref|XP_008340258.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Malus 
domestica]
Length=382

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 100/176 (57%), Gaps = 33/176 (19%)
 Frame = +2

Query  50   EDMSSFLQNLLHGASTS-AdgddggVLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFS  226
            +DMS FLQ +L  +STS A G     LF                 +S+P++      N  
Sbjct  30   DDMSLFLQQILVRSSTSLASGKAPQSLF-----------------SSSPSVGALLPGNLD  72

Query  227  DP--SLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRP  400
             P  S F G  +   AV++F++     F +   ++  E E D   CE+ + L    + RP
Sbjct  73   RPCHSGFLGDGIP--AVDSFAA-----FVSGHPNEASENEADEDDCESEEGLEAFVEARP  125

Query  401  ------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
                  SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  126  GGGRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  181



>gb|EPS62617.1| hypothetical protein M569_12173, partial [Genlisea aurea]
Length=83

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/52 (96%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  395  RPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            R SKRSR+AEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY
Sbjct  8    RSSKRSRAAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  59



>ref|XP_008340265.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Malus 
domestica]
Length=380

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 98/176 (56%), Gaps = 33/176 (19%)
 Frame = +2

Query  50   EDMSSFLQNLLHGASTS-AdgddggVLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFS  226
            +DMS FLQ +L  +STS A G     LF                 +S+P++      N  
Sbjct  30   DDMSLFLQQILVRSSTSLASGKAPQSLF-----------------SSSPSVGALLPGNLD  72

Query  227  DP--SLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRP  400
             P  S F G  +   AV++F++   G  +        E E D   CE+ + L    + RP
Sbjct  73   RPCHSGFLGDGIP--AVDSFAAFVSGHPNEAS-----ENEADEDDCESEEGLEAFVEARP  125

Query  401  ------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
                  SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  126  GGGRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  181



>ref|XP_008340273.1| PREDICTED: transcription factor SPATULA-like isoform X3 [Malus 
domestica]
Length=373

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 100/176 (57%), Gaps = 33/176 (19%)
 Frame = +2

Query  50   EDMSSFLQNLLHGASTS-AdgddggVLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFS  226
            +DMS FLQ +L  +STS A G     LF                 +S+P++      N  
Sbjct  30   DDMSLFLQQILVRSSTSLASGKAPQSLF-----------------SSSPSVGALLPGNLD  72

Query  227  DP--SLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRP  400
             P  S F G  +   AV++F++     F +   ++  E E D   CE+ + L    + RP
Sbjct  73   RPCHSGFLGDGIP--AVDSFAA-----FVSGHPNEASENEADEDDCESEEGLEAFVEARP  125

Query  401  ------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
                  SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  126  GGGRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  181



>ref|XP_011458924.1| PREDICTED: transcription factor SPATULA-like [Fragaria vesca 
subsp. vesca]
Length=324

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 105/197 (53%), Gaps = 42/197 (21%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLH-GASTSAdgddggVL---FPRPAMEATDFMGRMR  175
            MAD YGT   S   E++S+ L +LLH G S         +L    P P+ E    + R  
Sbjct  1    MADLYGTPQDS---EEISNILSHLLHHGGSPFKPSSYTHLLNSSVPPPSHE---LLARSA  54

Query  176  DGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSK----RIEFEN  343
            D + +    PS   NFSD                 S     D DA  S K    R+  EN
Sbjct  55   DRSDS--DRPS-DFNFSD-----------------SGGYFVDSDANTSKKKKGRRVSSEN  94

Query  344  D-------NKGCETSDALSNLAQPRP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIP  499
            D       ++G E  +   N A PR  SKRSR+AEVHNLSEKRRRS+INEK+KALQ LIP
Sbjct  95   DLGDVSCDSEGPEAPEVPLNPAPPRSLSKRSRAAEVHNLSEKRRRSKINEKMKALQNLIP  154

Query  500  NSNKTDKASMLDEAIEY  550
            NSNKTDKASMLDEAIEY
Sbjct  155  NSNKTDKASMLDEAIEY  171



>ref|XP_006473301.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Citrus 
sinensis]
Length=292

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 103/188 (55%), Gaps = 44/188 (23%)
 Frame = +2

Query  8    MADPYGT-----GHHSLEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRM  172
            MAD YGT     GH   EPE++SSFL   +H +S+S+        F +P         R 
Sbjct  1    MADLYGTTPPTAGH---EPEEISSFLNQFIHNSSSSSSS----CFFAQPE-------DRH  46

Query  173  RDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNK  352
              G SA            DPS+   +    SA   FS+  +G  D+       +  +  K
Sbjct  47   PFGRSA------------DPSVLDSS----SAGLNFSNLVVGAVDS-------DTNDSEK  83

Query  353  GCETSDALSN--LAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKAS  526
            G +  +  SN  +     SKRSR+AEVHNLSEKRRRSRINEKLKALQ LIPNSNKTDKAS
Sbjct  84   GPDALEVPSNDTVRTKTSSKRSRAAEVHNLSEKRRRSRINEKLKALQNLIPNSNKTDKAS  143

Query  527  MLDEAIEY  550
            MLDEAIEY
Sbjct  144  MLDEAIEY  151



>ref|XP_011029586.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Populus 
euphratica]
Length=309

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 101/183 (55%), Gaps = 18/183 (10%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRMRDGAS  187
            M D YG    + EPE++S+FL  LLH  S+S        L   P     + + R R   +
Sbjct  1    MEDLYGAAA-APEPEEISTFLHQLLHNNSSSPSKFMHHAL-STPVENGVELLDRHRFSET  58

Query  188  APAIEPSPSLNFSDPSLFYGAQVKESAVNAFSS--AAIGDFDATGSSKRIEFENDNKGCE  361
                E    ++FSDP  +Y    KE   NA  S    +   D  G     +F  D++G E
Sbjct  59   ----ECGAGVHFSDPDGYYA---KEGVGNAVVSKRGGVSVEDDLG-----DFSCDSEGVE  106

Query  362  TSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEA  541
                 +       SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEA
Sbjct  107  VQ--ANTARPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEA  164

Query  542  IEY  550
            IEY
Sbjct  165  IEY  167



>ref|XP_004142867.1| PREDICTED: uncharacterized protein LOC101203008 [Cucumis sativus]
Length=842

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 80/122 (66%), Gaps = 14/122 (11%)
 Frame = +2

Query  215  LNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRI---------EFENDNKGCETS  367
            +  SDP  F    +KES+ NAFSS+   D D     KR          +F  D++G +  
Sbjct  124  VKLSDPGDF----LKESSDNAFSSSGAVDSDTNAPLKRRGLSSENDLGDFSCDSEGGDLP  179

Query  368  DALSNLAQPR-PSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAI  544
            +  S+   PR  SKRSRSAEVHN+SEKRRR RINEK+KALQ LIPNSNKTDKASMLDEAI
Sbjct  180  EVPSSTNLPRNSSKRSRSAEVHNMSEKRRRRRINEKMKALQNLIPNSNKTDKASMLDEAI  239

Query  545  EY  550
            EY
Sbjct  240  EY  241



>ref|XP_008347614.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Malus 
domestica]
Length=230

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 108/224 (48%), Gaps = 55/224 (25%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGAS--------------TSAdgddggVLFPRPAM  145
            MAD YG+   S   E++S+ +  LLHG                T        V  P  A 
Sbjct  1    MADLYGSAPDS---EEISNIISELLHGHGSSASSASSSMPFKPTYMHLLHSSVPLPLQAA  57

Query  146  EATDFM---------GRM-----RDGA----------SAPAIEPSPSLNFSDPSLFYGAQ  253
              ++F+         GR      R G           SA  +E S    FSD   ++ A+
Sbjct  58   TQSEFLIPEARHEDHGRFAQLVDRSGXDQRVVGGNSNSAGVLESSSGFYFSDSGGYFTAE  117

Query  254  VKES----AVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPS-KRSRS  418
            VKE          S   +GDF +  S K +E        E  D   N A PR S KRSR+
Sbjct  118  VKEGMGPDGRRISSENDLGDF-SCDSEKGLE--------EAPDVQLNSAPPRSSSKRSRA  168

Query  419  AEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            A+VHN+SEKRRRSRINEK+KAL  LIPNSNKTDKASMLDEAIEY
Sbjct  169  ADVHNMSEKRRRSRINEKMKALLNLIPNSNKTDKASMLDEAIEY  212



>ref|XP_008347615.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Malus 
domestica]
Length=229

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 108/225 (48%), Gaps = 58/225 (26%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGAS--------------TSAdgddggVLFPRPAM  145
            MAD YG+   S   E++S+ +  LLHG                T        V  P  A 
Sbjct  1    MADLYGSAPDS---EEISNIISELLHGHGSSASSASSSMPFKPTYMHLLHSSVPLPLQAA  57

Query  146  EATDFM---------GRM-----RDGA----------SAPAIEPSPSLNFSDPSLFYGAQ  253
              ++F+         GR      R G           SA  +E S    FSD   ++ A+
Sbjct  58   TQSEFLIPEARHEDHGRFAQLVDRSGXDQRVVGGNSNSAGVLESSSGFYFSDSGGYFTAE  117

Query  254  VKES----AVNAFSSAAIGDFDATGSSKRIEFENDNKGCETS-DALSNLAQPRPS-KRSR  415
            VKE          S   +GDF             D++G E + D   N A PR S KRSR
Sbjct  118  VKEGMGPDGRRISSENDLGDFSC-----------DSEGLEEAPDVQLNSAPPRSSSKRSR  166

Query  416  SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            +A+VHN+SEKRRRSRINEK+KAL  LIPNSNKTDKASMLDEAIEY
Sbjct  167  AADVHNMSEKRRRSRINEKMKALLNLIPNSNKTDKASMLDEAIEY  211



>ref|XP_010932049.1| PREDICTED: transcription factor SPATULA [Elaeis guineensis]
Length=384

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 9/116 (8%)
 Frame = +2

Query  230  PSLFYGAQVKESAVNA-FSSAAIGDFDATGSSKRIEFENDNKGCETSDALS---NLAQPR  397
            P+  Y +  + +AV   F  A  G     G+ K +E +++ + CE+ + +      A+P 
Sbjct  58   PACSYSSIARTTAVQMPFPPAGSGCSLLQGAGKPLEQDHEARDCESEEGVEVAEEPAKPV  117

Query  398  P-----SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            P     SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  118  PPRGSGSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  173



>ref|XP_011029580.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Populus 
euphratica]
Length=310

 Score =   105 bits (262),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 101/189 (53%), Gaps = 29/189 (15%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRMRDGAS  187
            M D YG    + EPE++S+FL  LLH  S+S        L   P     + + R R   +
Sbjct  1    MEDLYGAAA-APEPEEISTFLHQLLHNNSSSPSKFMHHAL-STPVENGVELLDRHRFSET  58

Query  188  APAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAA--------IGDFDATGSSKRIEFEN  343
                E    ++FSDP  +Y    KE   NA  S          +GDF +  S K +E + 
Sbjct  59   ----ECGAGVHFSDPDGYYA---KEGVGNAVVSKRGGVSVEDDLGDF-SCDSEKGVEVQA  110

Query  344  DNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKA  523
            +                  SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKA
Sbjct  111  NTA-----------RPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKA  159

Query  524  SMLDEAIEY  550
            SMLDEAIEY
Sbjct  160  SMLDEAIEY  168



>ref|XP_010093617.1| Transcription factor SPATULA [Morus notabilis]
 gb|EXB54378.1| Transcription factor SPATULA [Morus notabilis]
Length=377

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 96/176 (55%), Gaps = 44/176 (25%)
 Frame = +2

Query  50   EDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFSD  229
            +++S FLQ +L  +S+S   +   +  P       + +G   DG SA             
Sbjct  24   DEISLFLQQILVRSSSSVPENLSSLCRP-------ELVG---DGISA-------------  60

Query  230  PSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRP---  400
              + Y    K +AVN  SS+        G+S   E END   CE+ +    L +  P   
Sbjct  61   --VDYSVAAKATAVNVSSSS-------LGAS---ENENDEYDCESEEGHEALLEEIPTKT  108

Query  401  ------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
                  SKRSR++EVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  109  LNARTSSKRSRASEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  164



>ref|XP_010315963.1| PREDICTED: transcription factor SPATULA isoform X1 [Solanum lycopersicum]
Length=378

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 105/189 (56%), Gaps = 42/189 (22%)
 Frame = +2

Query  44   EPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMG----RMRDGASAPAIEP--  205
            EP+D+S FL+++L  +S+S+               +++FM      M+  +S P + P  
Sbjct  21   EPDDISVFLRHILLPSSSSSS-------------SSSNFMALKSNEMQYSSSLPHLMPNN  67

Query  206  ------SPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETS  367
                  S  +N S   +F  +    +     SS+++G          I+++ D   CE+ 
Sbjct  68   NQQGNLSSMMNSSACGIFSSSYGVCNGATTVSSSSVG---------TIDYDPDEYECESE  118

Query  368  DALSNL-----AQP---RPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKA  523
            D   +L      QP     SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKA
Sbjct  119  DGTEDLGAEASVQPPSRNTSKRSRAAEVHNLSEKRRRSRINEKMKALQKLIPNSNKTDKA  178

Query  524  SMLDEAIEY  550
            SMLDEAIEY
Sbjct  179  SMLDEAIEY  187



>ref|XP_010315964.1| PREDICTED: transcription factor SPATULA isoform X2 [Solanum lycopersicum]
Length=376

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 104/189 (55%), Gaps = 42/189 (22%)
 Frame = +2

Query  44   EPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMG----RMRDGASAPAIEP--  205
            EP+D+S FL+++L  +S+S+               +++FM      M+  +S P + P  
Sbjct  21   EPDDISVFLRHILLPSSSSSS-------------SSSNFMALKSNEMQYSSSLPHLMPNN  67

Query  206  ------SPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETS  367
                  S  +N S   +F  +    +     SS+++G  D         ++ D   CE+ 
Sbjct  68   NQQGNLSSMMNSSACGIFSSSYGVCNGATTVSSSSVGTID---------YDPDEYECESE  118

Query  368  DALSNL-----AQP---RPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKA  523
            D   +L      QP     SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKA
Sbjct  119  DGTEDLGAEASVQPPSRNTSKRSRAAEVHNLSEKRRRSRINEKMKALQKLIPNSNKTDKA  178

Query  524  SMLDEAIEY  550
            SMLDEAIEY
Sbjct  179  SMLDEAIEY  187



>ref|XP_008378028.1| PREDICTED: transcription factor SPATULA-like isoform X3 [Malus 
domestica]
Length=329

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 112/224 (50%), Gaps = 55/224 (25%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGASTSAdgddggVLF------------PRPAMEA  151
            MAD YG+   S   E++S+ +  LLHG  +SA      + F            P P   A
Sbjct  1    MADLYGSAPDS---EEISNIISELLHGHGSSASSASSSMPFKPTYMHLLHSSVPLPLQAA  57

Query  152  T--DFM---------GRM-----RDGA----------SAPAIEPSPSLNFSDPSLFYGAQ  253
            T  +F+         GR      R G           SA  +E S    FSD   ++ A+
Sbjct  58   TQSEFLIPEARHEDHGRFAQLVDRSGXDQRVVGGNSNSAGVLESSSGFYFSDSGGYFTAE  117

Query  254  VKES----AVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPS-KRSRS  418
            VKE          S   +GDF +  S K +E        E  D   N A PR S KRSR+
Sbjct  118  VKEGMGPDGRRISSENDLGDF-SCDSEKGLE--------EAPDVQLNSAPPRXSSKRSRA  168

Query  419  AEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            A+VHN+SEKRRRSRINEK+KAL  LIPNSNKTDKASMLDEAIEY
Sbjct  169  ADVHNMSEKRRRSRINEKMKALLNLIPNSNKTDKASMLDEAIEY  212



>ref|XP_011017183.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Populus 
euphratica]
Length=325

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 100/188 (53%), Gaps = 12/188 (6%)
 Frame = +2

Query  8    MADPYGTGHH-SLEPEDMSSFLQNLLHGASTSAdgd------dggVLFPRPAMEATDFMG  166
            MAD YG     + EPE++S+FLQ  L   S+S             +     A+E  D   
Sbjct  1    MADLYGPARSPATEPEEISTFLQQFLGNNSSSPSSKFIDHALSTQMETGSTAVELLDCQL  60

Query  167  RMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFEND  346
              +          +  +N SDP  +Y   VKE   NA SS        +      +F  D
Sbjct  61   FGQSETECGVGAGNSGVNLSDPGGYY---VKEGVDNAVSSGISKRRGVSVEDDLGDFSCD  117

Query  347  NKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKAS  526
            ++G E     + +     SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKAS
Sbjct  118  SEGAEVQ--ANAVRPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKAS  175

Query  527  MLDEAIEY  550
            MLDEAIEY
Sbjct  176  MLDEAIEY  183



>ref|XP_008378026.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Malus 
domestica]
Length=356

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 112/224 (50%), Gaps = 55/224 (25%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGASTSAdgddggVLF------------PRPAMEA  151
            MAD YG+   S   E++S+ +  LLHG  +SA      + F            P P   A
Sbjct  1    MADLYGSAPDS---EEISNIISELLHGHGSSASSASSSMPFKPTYMHLLHSSVPLPLQAA  57

Query  152  T--DFM---------GRM-----RDGA----------SAPAIEPSPSLNFSDPSLFYGAQ  253
            T  +F+         GR      R G           SA  +E S    FSD   ++ A+
Sbjct  58   TQSEFLIPEARHEDHGRFAQLVDRSGXDQRVVGGNSNSAGVLESSSGFYFSDSGGYFTAE  117

Query  254  VKES----AVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPS-KRSRS  418
            VKE          S   +GDF +  S K +E        E  D   N A PR S KRSR+
Sbjct  118  VKEGMGPDGRRISSENDLGDF-SCDSEKGLE--------EAPDVQLNSAPPRXSSKRSRA  168

Query  419  AEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            A+VHN+SEKRRRSRINEK+KAL  LIPNSNKTDKASMLDEAIEY
Sbjct  169  ADVHNMSEKRRRSRINEKMKALLNLIPNSNKTDKASMLDEAIEY  212



>ref|XP_009359822.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Pyrus 
x bretschneideri]
Length=350

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 81/132 (61%), Gaps = 24/132 (18%)
 Frame = +2

Query  185  SAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKG--C  358
            SA  ++ S + +F D   ++  +VKE              ++ G  +RI  END  G  C
Sbjct  92   SAGVLDSSTAFDFYDSGGYFTKEVKEG------------MESDG--RRISSENDLGGYSC  137

Query  359  -------ETSDALSNLAQPRPS-KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKT  514
                   E +D   N A PR S KRSR+AEVHN+SEKRRRSRINEK+KALQ LIPNSNKT
Sbjct  138  DSEKDLEEAADGQLNSAPPRSSSKRSRAAEVHNMSEKRRRSRINEKMKALQNLIPNSNKT  197

Query  515  DKASMLDEAIEY  550
            DKASMLDE IEY
Sbjct  198  DKASMLDEVIEY  209



>ref|XP_009359830.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Pyrus 
x bretschneideri]
Length=325

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 81/132 (61%), Gaps = 24/132 (18%)
 Frame = +2

Query  185  SAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKG--C  358
            SA  ++ S + +F D   ++  +VKE              ++ G  +RI  END  G  C
Sbjct  92   SAGVLDSSTAFDFYDSGGYFTKEVKEG------------MESDG--RRISSENDLGGYSC  137

Query  359  -------ETSDALSNLAQPRPS-KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKT  514
                   E +D   N A PR S KRSR+AEVHN+SEKRRRSRINEK+KALQ LIPNSNKT
Sbjct  138  DSEKDLEEAADGQLNSAPPRSSSKRSRAAEVHNMSEKRRRSRINEKMKALQNLIPNSNKT  197

Query  515  DKASMLDEAIEY  550
            DKASMLDE IEY
Sbjct  198  DKASMLDEVIEY  209



>ref|XP_008378027.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Malus 
domestica]
Length=355

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 91/225 (40%), Positives = 112/225 (50%), Gaps = 58/225 (26%)
 Frame = +2

Query  8    MADPYGTGHHSLEPEDMSSFLQNLLHGASTSAdgddggVLF------------PRPAMEA  151
            MAD YG+   S   E++S+ +  LLHG  +SA      + F            P P   A
Sbjct  1    MADLYGSAPDS---EEISNIISELLHGHGSSASSASSSMPFKPTYMHLLHSSVPLPLQAA  57

Query  152  T--DFM---------GRM-----RDGA----------SAPAIEPSPSLNFSDPSLFYGAQ  253
            T  +F+         GR      R G           SA  +E S    FSD   ++ A+
Sbjct  58   TQSEFLIPEARHEDHGRFAQLVDRSGXDQRVVGGNSNSAGVLESSSGFYFSDSGGYFTAE  117

Query  254  VKES----AVNAFSSAAIGDFDATGSSKRIEFENDNKGCETS-DALSNLAQPRPS-KRSR  415
            VKE          S   +GDF             D++G E + D   N A PR S KRSR
Sbjct  118  VKEGMGPDGRRISSENDLGDFSC-----------DSEGLEEAPDVQLNSAPPRXSSKRSR  166

Query  416  SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            +A+VHN+SEKRRRSRINEK+KAL  LIPNSNKTDKASMLDEAIEY
Sbjct  167  AADVHNMSEKRRRSRINEKMKALLNLIPNSNKTDKASMLDEAIEY  211



>ref|XP_008440296.1| PREDICTED: transcription factor SPATULA [Cucumis melo]
Length=415

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 60/79 (76%), Gaps = 8/79 (10%)
 Frame = +2

Query  338  ENDNKGCETSDALSNLAQPRP--------SKRSRSAEVHNLSEKRRRSRINEKLKALQTL  493
            END   CE+ + L  L +  P        SKRSR+AEVHNLSEKRRRSRINEK+KALQ L
Sbjct  141  ENDEFDCESEEGLEALVEELPTKPNPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNL  200

Query  494  IPNSNKTDKASMLDEAIEY  550
            IPNSNKTDKASMLDEAIEY
Sbjct  201  IPNSNKTDKASMLDEAIEY  219



>ref|XP_009607891.1| PREDICTED: transcription factor SPATULA isoform X2 [Nicotiana 
tomentosiformis]
Length=369

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 99/184 (54%), Gaps = 41/184 (22%)
 Frame = +2

Query  44   EPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGR-MRDGASAPAIEP-----  205
            EP+D+S FL+++L+ +S                    +FM    +  +S P + P     
Sbjct  23   EPDDISVFLRHILNHSS--------------------NFMTHETQYSSSLPHLLPKNQHG  62

Query  206  --SPSLNFSDPSLF---YGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSD  370
              S  LN S   +F   YGA    + V   SS+++G  D        E E    G E   
Sbjct  63   ELSSVLNSSAGGIFSSSYGAYNVPANV---SSSSVGTMDNDPDEYECESEG---GTEDLG  116

Query  371  ALSNLAQPRP----SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDE  538
               +  QP P    SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDE
Sbjct  117  VEGSAQQPPPRNTNSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDE  176

Query  539  AIEY  550
            AIEY
Sbjct  177  AIEY  180



>ref|XP_009607890.1| PREDICTED: transcription factor SPATULA isoform X1 [Nicotiana 
tomentosiformis]
Length=377

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 99/184 (54%), Gaps = 41/184 (22%)
 Frame = +2

Query  44   EPEDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGR-MRDGASAPAIEP-----  205
            EP+D+S FL+++L+ +S                    +FM    +  +S P + P     
Sbjct  23   EPDDISVFLRHILNHSS--------------------NFMTHETQYSSSLPHLLPKNQHG  62

Query  206  --SPSLNFSDPSLF---YGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSD  370
              S  LN S   +F   YGA    + V   SS+++G  D        E E    G E   
Sbjct  63   ELSSVLNSSAGGIFSSSYGAYNVPANV---SSSSVGTMDNDPDEYECESEG---GTEDLG  116

Query  371  ALSNLAQPRP----SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDE  538
               +  QP P    SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDE
Sbjct  117  VEGSAQQPPPRNTNSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDE  176

Query  539  AIEY  550
            AIEY
Sbjct  177  AIEY  180



>ref|XP_008658092.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X2 [Zea mays]
Length=287

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 11/92 (12%)
 Frame = +2

Query  308  ATGSSKRIEFENDNKGCETSDALSNLAQPRP-----------SKRSRSAEVHNLSEKRRR  454
            A G  +++++  D  G   SDA  +  +P P            KRSR+AEVHNLSEKRRR
Sbjct  59   ALGHGQQVDYGEDAGGLGDSDAGGSEPEPPPERTRGGSGGGGGKRSRAAEVHNLSEKRRR  118

Query  455  SRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            S+INEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  119  SKINEKMKALQSLIPNSNKTDKASMLDEAIEY  150



>ref|XP_004142005.1| PREDICTED: uncharacterized protein LOC101217594 [Cucumis sativus]
Length=406

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 102/198 (52%), Gaps = 44/198 (22%)
 Frame = +2

Query  50   EDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFSD  229
            +D+S FLQ +L  +S+SA      +L P P++  ++    +R      A  P P+ N   
Sbjct  35   DDISLFLQQILRRSSSSA--PHFSLLSPSPSI-FSELTCNIR------AFTP-PTHNLPP  84

Query  230  PSLFYG-----------AQVKESAVNAFSSAAIGD--------FDATGSSKRI----EFE  340
            P   YG               E   N+ SS  + D             SS  +      E
Sbjct  85   P---YGPPNAVPDEISAVDSSEQFANSPSSGVLHDPLRTFPTSIPPNASSTSVGASDHNE  141

Query  341  NDNKGCETSDALSNLAQPRP--------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLI  496
            ND   CE+ + L  L +  P        SKRSR+AEVHNLSEKRRRSRINEK+KALQ LI
Sbjct  142  NDEFDCESEEGLEALVEELPTKPNPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLI  201

Query  497  PNSNKTDKASMLDEAIEY  550
            PNSNKTDKASMLDEAIEY
Sbjct  202  PNSNKTDKASMLDEAIEY  219



>ref|XP_004157205.1| PREDICTED: uncharacterized protein LOC101227644 [Cucumis sativus]
 gb|KGN48536.1| hypothetical protein Csa_6G491000 [Cucumis sativus]
Length=415

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 102/198 (52%), Gaps = 44/198 (22%)
 Frame = +2

Query  50   EDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFSD  229
            +D+S FLQ +L  +S+SA      +L P P++  ++    +R      A  P P+ N   
Sbjct  35   DDISLFLQQILRRSSSSA--PHFSLLSPSPSI-FSELTCNIR------AFTP-PTHNLPP  84

Query  230  PSLFYG-----------AQVKESAVNAFSSAAIGD--------FDATGSSKRI----EFE  340
            P   YG               E   N+ SS  + D             SS  +      E
Sbjct  85   P---YGPPNAVPDEISAVDSSEQFANSPSSGVLHDPLRTFPTSIPPNASSTSVGASDHNE  141

Query  341  NDNKGCETSDALSNLAQPRP--------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLI  496
            ND   CE+ + L  L +  P        SKRSR+AEVHNLSEKRRRSRINEK+KALQ LI
Sbjct  142  NDEFDCESEEGLEALVEELPTKPNPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLI  201

Query  497  PNSNKTDKASMLDEAIEY  550
            PNSNKTDKASMLDEAIEY
Sbjct  202  PNSNKTDKASMLDEAIEY  219



>ref|NP_001131794.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 ref|XP_008658091.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 gb|ACF80365.1| unknown [Zea mays]
 gb|AFW85681.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04351.1| bHLH transcription factor, partial [Zea mays]
Length=312

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 11/92 (12%)
 Frame = +2

Query  308  ATGSSKRIEFENDNKGCETSDALSNLAQPRP-----------SKRSRSAEVHNLSEKRRR  454
            A G  +++++  D  G   SDA  +  +P P            KRSR+AEVHNLSEKRRR
Sbjct  59   ALGHGQQVDYGEDAGGLGDSDAGGSEPEPPPERTRGGSGGGGGKRSRAAEVHNLSEKRRR  118

Query  455  SRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            S+INEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  119  SKINEKMKALQSLIPNSNKTDKASMLDEAIEY  150



>gb|KJB43772.1| hypothetical protein B456_007G214800 [Gossypium raimondii]
Length=295

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSD---ALSNLAQPRP------SKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            E + D   CE+ +   AL + A P+P      SKRSR+AEVHNLSEKRRRSRINEK+KAL
Sbjct  99   ENDTDEYDCESEEGIEALVDEALPKPAPPRSSSKRSRAAEVHNLSEKRRRSRINEKMKAL  158

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  159  QNLIPNSNKTDKASMLDEAIEY  180



>ref|XP_011017181.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Populus 
euphratica]
Length=326

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 103/198 (52%), Gaps = 31/198 (16%)
 Frame = +2

Query  8    MADPYGTGHH-SLEPEDMSSFLQNLLHGASTSAdgd------dggVLFPRPAMEATDFMG  166
            MAD YG     + EPE++S+FLQ  L   S+S             +     A+E  D   
Sbjct  1    MADLYGPARSPATEPEEISTFLQQFLGNNSSSPSSKFIDHALSTQMETGSTAVELLDCQL  60

Query  167  RMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDFDATGSSKR--IEFE  340
              +          +  +N SDP  +Y   VKE   NA SS         G SKR  +  E
Sbjct  61   FGQSETECGVGAGNSGVNLSDPGGYY---VKEGVDNAVSS---------GISKRRGVSVE  108

Query  341  ND--------NKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLI  496
            +D         KG E     + +     SKRSR+AEVHNLSEKRRRSRINEK+KALQ LI
Sbjct  109  DDLGDFSCDSEKGAEVQ--ANAVRPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLI  166

Query  497  PNSNKTDKASMLDEAIEY  550
            PNSNKTDKASMLDEAIEY
Sbjct  167  PNSNKTDKASMLDEAIEY  184



>ref|XP_009367270.1| PREDICTED: transcription factor SPATULA-like [Pyrus x bretschneideri]
Length=381

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 59/79 (75%), Gaps = 6/79 (8%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLAQPR------PSKRSRSAEVHNLSEKRRRSRINEKLKALQTL  493
            E E D   CE+ + L    + R       SKRSR+AEVHNLSEKRRRSRINEK+KALQ L
Sbjct  103  ENEADEYDCESEEGLEAFVEARRGGGRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNL  162

Query  494  IPNSNKTDKASMLDEAIEY  550
            IPNSNKTDKASMLDEAIEY
Sbjct  163  IPNSNKTDKASMLDEAIEY  181



>gb|KJB43770.1| hypothetical protein B456_007G214800 [Gossypium raimondii]
Length=321

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSD---ALSNLAQPRP------SKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            E + D   CE+ +   AL + A P+P      SKRSR+AEVHNLSEKRRRSRINEK+KAL
Sbjct  99   ENDTDEYDCESEEGIEALVDEALPKPAPPRSSSKRSRAAEVHNLSEKRRRSRINEKMKAL  158

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  159  QNLIPNSNKTDKASMLDEAIEY  180



>gb|KJB43767.1| hypothetical protein B456_007G214800 [Gossypium raimondii]
Length=321

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSD---ALSNLAQPRP------SKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            E + D   CE+ +   AL + A P+P      SKRSR+AEVHNLSEKRRRSRINEK+KAL
Sbjct  99   ENDTDEYDCESEEGIEALVDEALPKPAPPRSSSKRSRAAEVHNLSEKRRRSRINEKMKAL  158

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  159  QNLIPNSNKTDKASMLDEAIEY  180



>ref|XP_007204562.1| hypothetical protein PRUPE_ppa014897mg, partial [Prunus persica]
 gb|EMJ05761.1| hypothetical protein PRUPE_ppa014897mg, partial [Prunus persica]
Length=283

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 91/138 (66%), Gaps = 20/138 (14%)
 Frame = +2

Query  182  ASAPAIEPSPSLNFSDP--SLFYGAQVKESAVNAFSSAAI---GDFDATGSS-KRIEFEN  343
            +S+P++   P  + S P  S+F G  +  +AV+  SSAA+   G+ + + SS    E E 
Sbjct  71   SSSPSVAALPD-HLSRPCHSMFLGDGI--TAVD--SSAALLPAGNPNVSSSSFGASENET  125

Query  344  DNKGCETSDALSNLAQP---RP------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLI  496
            D   CE+ + L  L +    +P      SKRSR+AEVHN+SEKRRRSRINEK+KALQ LI
Sbjct  126  DEYDCESEEGLEALVEEAAGKPGCGRSSSKRSRAAEVHNMSEKRRRSRINEKMKALQNLI  185

Query  497  PNSNKTDKASMLDEAIEY  550
            PNSNKTDKASMLDEAIEY
Sbjct  186  PNSNKTDKASMLDEAIEY  203



>gb|KJB43766.1| hypothetical protein B456_007G214800 [Gossypium raimondii]
Length=328

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 67/94 (71%), Gaps = 7/94 (7%)
 Frame = +2

Query  287  AAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRP------SKRSRSAEVHNLSEKR  448
             A G+ D        EFE  +K  E  +AL + A P+P      SKRSR+AEVHNLSEKR
Sbjct  95   GAPGENDTDEYDCESEFEICHKQ-EGIEALVDEALPKPAPPRSSSKRSRAAEVHNLSEKR  153

Query  449  RRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            RRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  154  RRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  187



>ref|XP_008338329.1| PREDICTED: transcription factor SPATULA [Malus domestica]
 ref|XP_008338330.1| PREDICTED: transcription factor SPATULA [Malus domestica]
 ref|XP_008361401.1| PREDICTED: transcription factor SPATULA-like [Malus domestica]
 ref|XP_008361402.1| PREDICTED: transcription factor SPATULA-like [Malus domestica]
Length=373

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 86/134 (64%), Gaps = 22/134 (16%)
 Frame = +2

Query  203  PSPSL------NFSDP--SLFYGAQVKESAVN---AFSSAAIGDFDATGSSKRI-EFEND  346
            PSPS+      N   P  S F+G ++  +A++   AF SA  G+ + + SS    E E D
Sbjct  65   PSPSVGALLPGNLEHPCHSGFFGDEI--TAIDSSXAFVSA--GNPNVSSSSLGASENEAD  120

Query  347  NKGCETSDALSNLAQPRP------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSN  508
               CE+ + L    + +       SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSN
Sbjct  121  EYDCESEEGLEAFVEAKSGGGRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSN  180

Query  509  KTDKASMLDEAIEY  550
            KTDKASMLDEAIEY
Sbjct  181  KTDKASMLDEAIEY  194



>gb|ACM41588.1| bHLH transcription factor MYC5 [Catharanthus roseus]
Length=321

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 9/74 (12%)
 Frame = +2

Query  356  CETSDALSNL-----AQP----RPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSN  508
            CE+ + L  L     A+P     PSKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSN
Sbjct  118  CESEEGLEGLILEAPAKPTTSRNPSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSN  177

Query  509  KTDKASMLDEAIEY  550
            KTDKASMLDEAIEY
Sbjct  178  KTDKASMLDEAIEY  191



>gb|KHG00584.1| Transcription factor SPATULA -like protein [Gossypium arboreum]
Length=387

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSD---ALSNLAQPRP------SKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            E + D   CE+ +   AL + A P+P      SKRSR+AEVHNLSEKRRRSRINEK+KAL
Sbjct  99   ENDTDEYDCESEEGIEALVDEAPPKPAPPRSSSKRSRAAEVHNLSEKRRRSRINEKMKAL  158

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  159  QNLIPNSNKTDKASMLDEAIEY  180



>gb|KJB43768.1| hypothetical protein B456_007G214800 [Gossypium raimondii]
Length=387

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 63/82 (77%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSD---ALSNLAQPRP------SKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            E + D   CE+ +   AL + A P+P      SKRSR+AEVHNLSEKRRRSRINEK+KAL
Sbjct  99   ENDTDEYDCESEEGIEALVDEALPKPAPPRSSSKRSRAAEVHNLSEKRRRSRINEKMKAL  158

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  159  QNLIPNSNKTDKASMLDEAIEY  180



>gb|KJB43771.1| hypothetical protein B456_007G214800 [Gossypium raimondii]
Length=375

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 67/94 (71%), Gaps = 7/94 (7%)
 Frame = +2

Query  287  AAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRP------SKRSRSAEVHNLSEKR  448
             A G+ D        EFE  +K  E  +AL + A P+P      SKRSR+AEVHNLSEKR
Sbjct  95   GAPGENDTDEYDCESEFEICHKQ-EGIEALVDEALPKPAPPRSSSKRSRAAEVHNLSEKR  153

Query  449  RRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            RRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  154  RRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  187



>ref|XP_002306475.2| hypothetical protein POPTR_0005s18280g [Populus trichocarpa]
 gb|EEE93471.2| hypothetical protein POPTR_0005s18280g [Populus trichocarpa]
Length=220

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 58/73 (79%), Gaps = 8/73 (11%)
 Frame = +2

Query  356  CETSDALSNL--------AQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNK  511
            CE+ + L  L        A PR SKR+R+AEVHNLSEKRRRSRINEK+KALQ LIPNS+K
Sbjct  111  CESEEGLEALIDEMSVKPAPPRSSKRTRAAEVHNLSEKRRRSRINEKMKALQNLIPNSSK  170

Query  512  TDKASMLDEAIEY  550
            TDKASMLDEAIEY
Sbjct  171  TDKASMLDEAIEY  183



>gb|ADG56590.1| ALCATRAZ/SPATULA-like protein [Prunus persica]
Length=386

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 91/138 (66%), Gaps = 20/138 (14%)
 Frame = +2

Query  182  ASAPAIEPSPSLNFSDP--SLFYGAQVKESAVNAFSSAAI---GDFDATGSS-KRIEFEN  343
            +S+P++   P  + S P  S+F G  +  +AV+  SSAA+   G+ + + SS    E E 
Sbjct  71   SSSPSVAALPD-HLSRPCHSMFLGDGI--TAVD--SSAALLPAGNPNVSSSSFGASENET  125

Query  344  DNKGCETSDALSNLAQP---RP------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLI  496
            D   CE+ + L  L +    +P      SKRSR+AEVHN+SEKRRRSRINEK+KALQ LI
Sbjct  126  DEYDCESEEGLEALVEEAAGKPGCGRSSSKRSRAAEVHNMSEKRRRSRINEKMKALQNLI  185

Query  497  PNSNKTDKASMLDEAIEY  550
            PNSNKTDKASMLDEAIEY
Sbjct  186  PNSNKTDKASMLDEAIEY  203



>gb|KJB43769.1| hypothetical protein B456_007G214800 [Gossypium raimondii]
Length=394

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 67/94 (71%), Gaps = 7/94 (7%)
 Frame = +2

Query  287  AAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRP------SKRSRSAEVHNLSEKR  448
             A G+ D        EFE  +K  E  +AL + A P+P      SKRSR+AEVHNLSEKR
Sbjct  95   GAPGENDTDEYDCESEFEICHKQ-EGIEALVDEALPKPAPPRSSSKRSRAAEVHNLSEKR  153

Query  449  RRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            RRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  154  RRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  187



>ref|XP_008681257.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X2 [Zea mays]
Length=278

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 6/71 (8%)
 Frame = +2

Query  356  CETSDAL----SNLAQP-RP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTD  517
            CE+ DAL    S+ A+P RP  KRSR+AEVHNLSEKRRRSRINEK+KALQTLIPNS+KTD
Sbjct  20   CESEDALGSSESDPARPARPRGKRSRAAEVHNLSEKRRRSRINEKMKALQTLIPNSSKTD  79

Query  518  KASMLDEAIEY  550
            KASMLD+AIEY
Sbjct  80   KASMLDDAIEY  90



>ref|XP_008681256.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 gb|AFW73927.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=279

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 6/71 (8%)
 Frame = +2

Query  356  CETSDAL----SNLAQP-RP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTD  517
            CE+ DAL    S+ A+P RP  KRSR+AEVHNLSEKRRRSRINEK+KALQTLIPNS+KTD
Sbjct  20   CESEDALGSSESDPARPARPRGKRSRAAEVHNLSEKRRRSRINEKMKALQTLIPNSSKTD  79

Query  518  KASMLDEAIEY  550
            KASMLD+AIEY
Sbjct  80   KASMLDDAIEY  90



>ref|NP_001136510.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|ACF78387.1| unknown [Zea mays]
 gb|ACN28753.1| unknown [Zea mays]
 gb|AFW73928.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04479.1| bHLH transcription factor, partial [Zea mays]
Length=280

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 62/71 (87%), Gaps = 6/71 (8%)
 Frame = +2

Query  356  CETSDAL----SNLAQP-RP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTD  517
            CE+ DAL    S+ A+P RP  KRSR+AEVHNLSEKRRRSRINEK+KALQTLIPNS+KTD
Sbjct  20   CESEDALGSSESDPARPARPRGKRSRAAEVHNLSEKRRRSRINEKMKALQTLIPNSSKTD  79

Query  518  KASMLDEAIEY  550
            KASMLD+AIEY
Sbjct  80   KASMLDDAIEY  90



>ref|XP_010548419.1| PREDICTED: transcription factor SPATULA-like [Tarenaya hassleriana]
 ref|XP_010548420.1| PREDICTED: transcription factor SPATULA-like [Tarenaya hassleriana]
Length=243

 Score = 99.8 bits (247),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 9/80 (11%)
 Frame = +2

Query  338  ENDNKGCETSDALSNL-----AQPRP----SKRSRSAEVHNLSEKRRRSRINEKLKALQT  490
            E D+  CE+ + +  +     A+P P     KRSR+AE+HNLSEKRRRSRINEK+KALQ 
Sbjct  117  ETDDYDCESKEGMEVVVDELPAKPAPPRSSCKRSRAAEIHNLSEKRRRSRINEKMKALQN  176

Query  491  LIPNSNKTDKASMLDEAIEY  550
            LIPNSNKTDKASMLDEAIEY
Sbjct  177  LIPNSNKTDKASMLDEAIEY  196



>gb|KCW54935.1| hypothetical protein EUGRSUZ_I00906, partial [Eucalyptus grandis]
Length=181

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 54/59 (92%), Gaps = 4/59 (7%)
 Frame = +2

Query  386  AQPRP----SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            A+P P    SKRSR+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  11   ARPNPPRGSSKRSRTAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  69



>dbj|BAD19423.1| hypothetical protein [Oryza sativa Japonica Group]
Length=110

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 7/72 (10%)
 Frame = +2

Query  356  CETSDAL--SNLAQP-RPS----KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKT  514
            CE+ +AL  S   QP RP+    KRSR+AEVHNLSEKRRRSRINEK+KALQ+LIPNS+KT
Sbjct  6    CESEEALGSSESEQPTRPARPRGKRSRAAEVHNLSEKRRRSRINEKMKALQSLIPNSSKT  65

Query  515  DKASMLDEAIEY  550
            DKASMLD+AIEY
Sbjct  66   DKASMLDDAIEY  77



>ref|XP_010030576.1| PREDICTED: transcription factor SPATULA-like [Eucalyptus grandis]
Length=383

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 64/82 (78%), Gaps = 10/82 (12%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNL-----AQPRP----SKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            E E D+  CE S+ L  L     A+P P    SKRSR+AEVHNLSEKRRRSRINEK+KAL
Sbjct  116  ENEADDYDCE-SEGLEALLEDVPARPNPPRGSSKRSRTAEVHNLSEKRRRSRINEKMKAL  174

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q+LIPNSNKTDKASMLDEAIEY
Sbjct  175  QSLIPNSNKTDKASMLDEAIEY  196



>ref|XP_006339939.1| PREDICTED: transcription factor SPATULA-like [Solanum tuberosum]
Length=376

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 71/111 (64%), Gaps = 20/111 (18%)
 Frame = +2

Query  242  YGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNL-----AQP---R  397
            YGA    + V   SS+++G  D          + D   CE+ D   +L      QP    
Sbjct  94   YGAYNGATNV---SSSSVGTMDN---------DPDEYECESEDGTEDLGAEASVQPPSRN  141

Query  398  PSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
             SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  142  TSKRSRAAEVHNLSEKRRRSRINEKMKALQKLIPNSNKTDKASMLDEAIEY  192



>ref|XP_008241481.1| PREDICTED: transcription factor SPATULA isoform X3 [Prunus mume]
Length=337

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLAQP---RP------SKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            E E D   CE+ + L  L +    +P      SKRSR+AEVHN+SEKRRRSRINEK+KAL
Sbjct  122  ENETDEYDCESEEGLEALVEEAAGKPGCGRSSSKRSRAAEVHNMSEKRRRSRINEKMKAL  181

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  182  QNLIPNSNKTDKASMLDEAIEY  203



>ref|XP_007156787.1| hypothetical protein PHAVU_002G0176001g, partial [Phaseolus vulgaris]
 gb|ESW28781.1| hypothetical protein PHAVU_002G0176001g, partial [Phaseolus vulgaris]
Length=196

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 62/82 (76%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLAQPRPSK---------RSRSAEVHNLSEKRRRSRINEKLKAL  484
            E END+  CE+ + +   A+  P+K         RSR+AEVHNLSEKRRRSRINEK+KAL
Sbjct  106  ENENDDYDCESEEGVEAFAEEVPTKPAPSRSSSKRSRAAEVHNLSEKRRRSRINEKMKAL  165

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  166  QNLIPNSNKTDKASMLDEAIEY  187



>ref|XP_004954276.1| PREDICTED: transcription factor SPATULA-like [Setaria italica]
Length=333

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 6/71 (8%)
 Frame = +2

Query  356  CETSDAL----SNLAQP-RP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTD  517
            CE+ DAL    S  A+P RP  KRSR+AEVHNLSEKRRRSRINEK+KALQTLIPNS+KTD
Sbjct  68   CESEDALGSSESEPARPARPRGKRSRAAEVHNLSEKRRRSRINEKMKALQTLIPNSSKTD  127

Query  518  KASMLDEAIEY  550
            KASMLD+AIEY
Sbjct  128  KASMLDDAIEY  138



>ref|XP_008241480.1| PREDICTED: transcription factor SPATULA isoform X2 [Prunus mume]
Length=399

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLAQP---RP------SKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            E E D   CE+ + L  L +    +P      SKRSR+AEVHN+SEKRRRSRINEK+KAL
Sbjct  122  ENETDEYDCESEEGLEALVEEAAGKPGCGRSSSKRSRAAEVHNMSEKRRRSRINEKMKAL  181

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  182  QNLIPNSNKTDKASMLDEAIEY  203



>ref|XP_008241478.1| PREDICTED: transcription factor SPATULA isoform X1 [Prunus mume]
Length=417

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLAQP---RP------SKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            E E D   CE+ + L  L +    +P      SKRSR+AEVHN+SEKRRRSRINEK+KAL
Sbjct  122  ENETDEYDCESEEGLEALVEEAAGKPGCGRSSSKRSRAAEVHNMSEKRRRSRINEKMKAL  181

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  182  QNLIPNSNKTDKASMLDEAIEY  203



>ref|NP_001056902.2| Os06g0164400 [Oryza sativa Japonica Group]
 dbj|BAF18816.2| Os06g0164400, partial [Oryza sativa Japonica Group]
Length=188

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRS+INEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  22   SKRSRAAEVHNLSEKRRRSKINEKMKALQSLIPNSNKTDKASMLDEAIEY  71



>ref|XP_002523613.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38808.1| conserved hypothetical protein [Ricinus communis]
Length=406

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 63/83 (76%), Gaps = 10/83 (12%)
 Frame = +2

Query  332  EFENDNKG-CETSDALSNL--------AQPRPS-KRSRSAEVHNLSEKRRRSRINEKLKA  481
            E E D++  CE+ + L  L        A PR S KRSR+AEVHNLSEKRRRSRINEK+KA
Sbjct  124  ENETDHECDCESEEGLEALIEEVQTKAAPPRSSSKRSRAAEVHNLSEKRRRSRINEKMKA  183

Query  482  LQTLIPNSNKTDKASMLDEAIEY  550
            LQ LIPNSNKTDKASMLDEAIEY
Sbjct  184  LQNLIPNSNKTDKASMLDEAIEY  206



>ref|XP_010652804.1| PREDICTED: transcription factor SPATULA [Vitis vinifera]
Length=385

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 63/92 (68%), Gaps = 11/92 (12%)
 Frame = +2

Query  308  ATGSSKRIEFEND--NKGCETSDALSNLAQP---------RPSKRSRSAEVHNLSEKRRR  454
             T SS    F+ND     CE+ + L  L +            SKRSR+AEVHNLSEKRRR
Sbjct  93   GTASSSAGGFDNDLDEYDCESEEGLEALVEEVATKAAPLRSSSKRSRAAEVHNLSEKRRR  152

Query  455  SRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  153  SRINEKMKALQNLIPNSNKTDKASMLDEAIEY  184



>emb|CBI21410.3| unnamed protein product [Vitis vinifera]
Length=394

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 63/92 (68%), Gaps = 11/92 (12%)
 Frame = +2

Query  308  ATGSSKRIEFEND--NKGCETSDALSNLAQP---------RPSKRSRSAEVHNLSEKRRR  454
             T SS    F+ND     CE+ + L  L +            SKRSR+AEVHNLSEKRRR
Sbjct  93   GTASSSAGGFDNDLDEYDCESEEGLEALVEEVATKAAPLRSSSKRSRAAEVHNLSEKRRR  152

Query  455  SRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  153  SRINEKMKALQNLIPNSNKTDKASMLDEAIEY  184



>ref|XP_007047305.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX91462.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao]
Length=335

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 63/78 (81%), Gaps = 5/78 (6%)
 Frame = +2

Query  332  EFENDNK--GCE--TSDALSNLAQPRPS-KRSRSAEVHNLSEKRRRSRINEKLKALQTLI  496
            EFE+ +K  G E    +A S  A PR S KRSR+AEVHNLSEKRRRSRINEK+KALQ LI
Sbjct  117  EFESCHKQEGLEALVDEAPSKPAPPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLI  176

Query  497  PNSNKTDKASMLDEAIEY  550
            PNSNKTDKASMLDEAIEY
Sbjct  177  PNSNKTDKASMLDEAIEY  194



>ref|XP_007047306.1| Homeodomain-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOX91463.1| Homeodomain-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
Length=389

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 9/74 (12%)
 Frame = +2

Query  356  CETSDALSNL-----AQPRP----SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSN  508
            CE+ + L  L     ++P P    SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSN
Sbjct  114  CESEEGLEALVDEAPSKPAPPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSN  173

Query  509  KTDKASMLDEAIEY  550
            KTDKASMLDEAIEY
Sbjct  174  KTDKASMLDEAIEY  187



>ref|XP_002981138.1| hypothetical protein SELMODRAFT_114141, partial [Selaginella 
moellendorffii]
 gb|EFJ17839.1| hypothetical protein SELMODRAFT_114141, partial [Selaginella 
moellendorffii]
Length=85

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSE+RRR RINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  16   SKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEY  65



>ref|XP_002984591.1| hypothetical protein SELMODRAFT_29179, partial [Selaginella moellendorffii]
 gb|EFJ14236.1| hypothetical protein SELMODRAFT_29179, partial [Selaginella moellendorffii]
Length=64

 Score = 93.6 bits (231),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  392  PRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            P+ SKRSR+AEVHNLSE++RR RINE++KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  1    PKGSKRSRAAEVHNLSERKRRDRINERMKALQELIPNSNKTDKASMLDEAIEY  53



>ref|XP_002982619.1| hypothetical protein SELMODRAFT_116654, partial [Selaginella 
moellendorffii]
 gb|EFJ16372.1| hypothetical protein SELMODRAFT_116654, partial [Selaginella 
moellendorffii]
Length=85

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSE+RRR RINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  16   SKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEY  65



>ref|XP_002978656.1| hypothetical protein SELMODRAFT_39143, partial [Selaginella moellendorffii]
 gb|EFJ20103.1| hypothetical protein SELMODRAFT_39143, partial [Selaginella moellendorffii]
Length=66

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  392  PRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            P+ SKRSR+AEVHNLSE++RR RINE++KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  1    PKGSKRSRAAEVHNLSERKRRDRINERMKALQELIPNSNKTDKASMLDEAIEY  53



>ref|XP_010531245.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010531246.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Tarenaya 
hassleriana]
Length=326

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 62/85 (73%), Gaps = 8/85 (9%)
 Frame = +2

Query  299  DFDATGSSKRIEFENDNKGCETSDALSNLAQPR-PSKRSRSAEVHNLSEKRRRSRINEKL  475
            D+D     + +E   D    +T       A PR  SKRSR+AEVHNLSEKRRRSRINEK+
Sbjct  127  DYDCESEQEGVEAVVDEPPAKT-------APPRGSSKRSRAAEVHNLSEKRRRSRINEKM  179

Query  476  KALQTLIPNSNKTDKASMLDEAIEY  550
            KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  180  KALQSLIPNSNKTDKASMLDEAIEY  204



>gb|KDP31951.1| hypothetical protein JCGZ_12412 [Jatropha curcas]
Length=357

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = +2

Query  386  AQPRP----SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            A+P P    SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  147  AKPAPPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  205



>emb|CDP02508.1| unnamed protein product [Coffea canephora]
Length=407

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 62/75 (83%), Gaps = 2/75 (3%)
 Frame = +2

Query  332  EFENDNKGCET-SDALSNLAQPR-PSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNS  505
            +++ +++G E   +A+     PR  SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNS
Sbjct  119  DYDCESEGLEVLEEAMVKPTAPRNASKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNS  178

Query  506  NKTDKASMLDEAIEY  550
            NKTDKASMLDEAIEY
Sbjct  179  NKTDKASMLDEAIEY  193



>ref|XP_007047304.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOX91461.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=451

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 63/78 (81%), Gaps = 5/78 (6%)
 Frame = +2

Query  332  EFENDNK--GCE--TSDALSNLAQPRPS-KRSRSAEVHNLSEKRRRSRINEKLKALQTLI  496
            EFE+ +K  G E    +A S  A PR S KRSR+AEVHNLSEKRRRSRINEK+KALQ LI
Sbjct  172  EFESCHKQEGLEALVDEAPSKPAPPRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLI  231

Query  497  PNSNKTDKASMLDEAIEY  550
            PNSNKTDKASMLDEAIEY
Sbjct  232  PNSNKTDKASMLDEAIEY  249



>emb|CCE46185.1| bHLH transcription factor [Amborella trichopoda]
Length=445

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 7/76 (9%)
 Frame = +2

Query  344  DNKGCETSDALS---NLAQPRPS----KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPN  502
            D+  CE+ +       +++P PS    KRSR+AEVHNLSEKRRRSRINEK+KALQ LIPN
Sbjct  154  DDLDCESEEGQEPSEEMSKPAPSRSSTKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPN  213

Query  503  SNKTDKASMLDEAIEY  550
            SNKTDKASMLDEAIEY
Sbjct  214  SNKTDKASMLDEAIEY  229



>ref|XP_006856483.1| hypothetical protein AMTR_s00046p00066610 [Amborella trichopoda]
 gb|ERN17950.1| hypothetical protein AMTR_s00046p00066610 [Amborella trichopoda]
Length=445

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 1/68 (1%)
 Frame = +2

Query  350  KGCETSDALSNLAQPRPS-KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKAS  526
            +G E S+ +S  A  R S KRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKAS
Sbjct  162  EGQEPSEEMSKPAPSRSSTKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKAS  221

Query  527  MLDEAIEY  550
            MLDEAIEY
Sbjct  222  MLDEAIEY  229



>ref|XP_011099122.1| PREDICTED: transcription factor SPATULA-like [Sesamum indicum]
Length=361

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  134  SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  183



>ref|XP_003561052.1| PREDICTED: transcription factor SPATULA-like [Brachypodium distachyon]
Length=331

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR+R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  102  SKRTRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  151



>ref|XP_010927433.1| PREDICTED: putative transcription factor bHLH056 isoform X2 [Elaeis 
guineensis]
Length=373

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  105  SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  154



>ref|XP_010927432.1| PREDICTED: putative transcription factor bHLH056 isoform X1 [Elaeis 
guineensis]
Length=374

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  106  SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  155



>gb|AHK05707.1| bHLH transcription factor SPT [Brassica oleracea var. capitata]
Length=353

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 64/90 (71%), Gaps = 13/90 (14%)
 Frame = +2

Query  302  FDATGSSKRIEFENDNKGCETSDALSN------LAQPRPS-KRSRSAEVHNLSEKRRRSR  460
            F A+G+      E D   CE+ + +        L + R S KR R+AEVHNLSEKRRRSR
Sbjct  134  FGASGN------ETDGYDCESEEGVEAVVDDELLCKSRTSSKRCRAAEVHNLSEKRRRSR  187

Query  461  INEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            INEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  188  INEKMKALQSLIPNSNKTDKASMLDEAIEY  217



>ref|XP_008793895.1| PREDICTED: transcription factor SPATULA-like isoform X9 [Phoenix 
dactylifera]
Length=357

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  112  SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  161



>ref|XP_008793889.1| PREDICTED: transcription factor SPATULA-like isoform X4 [Phoenix 
dactylifera]
Length=374

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  112  SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  161



>ref|XP_008793896.1| PREDICTED: transcription factor SPATULA-like isoform X10 [Phoenix 
dactylifera]
 ref|XP_008793897.1| PREDICTED: transcription factor SPATULA-like isoform X10 [Phoenix 
dactylifera]
 ref|XP_008793898.1| PREDICTED: transcription factor SPATULA-like isoform X10 [Phoenix 
dactylifera]
 ref|XP_008793899.1| PREDICTED: transcription factor SPATULA-like isoform X10 [Phoenix 
dactylifera]
Length=355

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  112  SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  161



>ref|XP_008793893.1| PREDICTED: transcription factor SPATULA-like isoform X8 [Phoenix 
dactylifera]
Length=365

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  112  SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  161



>gb|ABK23705.1| unknown [Picea sitchensis]
Length=333

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRR+RINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  152  SKRSRAAEVHNLSEKRRRNRINEKMKALQNLIPNSNKTDKASMLDEAIEY  201



>ref|XP_008793888.1| PREDICTED: transcription factor SPATULA-like isoform X3 [Phoenix 
dactylifera]
Length=378

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  111  SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  160



>ref|XP_008793887.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Phoenix 
dactylifera]
Length=379

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  111  SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  160



>ref|XP_008793886.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Phoenix 
dactylifera]
Length=380

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  112  SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  161



>ref|XP_006656678.1| PREDICTED: transcription factor SPATULA-like [Oryza brachyantha]
Length=217

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +2

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSR+AEVHNLSEKRRRS+INEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  4    KRSRAAEVHNLSEKRRRSKINEKMKALQSLIPNSNKTDKASMLDEAIEY  52



>ref|XP_008793890.1| PREDICTED: transcription factor SPATULA-like isoform X5 [Phoenix 
dactylifera]
Length=372

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  112  SKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  161



>ref|XP_003589168.1| Transcription factor SPATULA [Medicago truncatula]
Length=287

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 56/67 (84%), Gaps = 3/67 (4%)
 Frame = +2

Query  359  ETSDALSNLAQPRP---SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASM  529
            E S+  S+ A P P   SKRSR+AE HNLSEKRRRS+INEKLKALQ LIPNSNKTDKASM
Sbjct  70   EGSELPSSKAAPPPRSSSKRSRAAEFHNLSEKRRRSKINEKLKALQNLIPNSNKTDKASM  129

Query  530  LDEAIEY  550
            LDEAIEY
Sbjct  130  LDEAIEY  136



>dbj|BAD67851.1| basic helix-loop-helix protein SPATULA-like [Oryza sativa Japonica 
Group]
 gb|EAZ35937.1| hypothetical protein OsJ_20240 [Oryza sativa Japonica Group]
Length=315

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 3/58 (5%)
 Frame = +2

Query  386  AQPRP---SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            A+PR    SKRSR+AEVHNLSEKRRRS+INEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  91   ARPRGGSGSKRSRAAEVHNLSEKRRRSKINEKMKALQSLIPNSNKTDKASMLDEAIEY  148



>gb|EAY99814.1| hypothetical protein OsI_21804 [Oryza sativa Indica Group]
Length=315

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 54/58 (93%), Gaps = 3/58 (5%)
 Frame = +2

Query  386  AQPRP---SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            A+PR    SKRSR+AEVHNLSEKRRRS+INEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  91   ARPRGGSGSKRSRAAEVHNLSEKRRRSKINEKMKALQSLIPNSNKTDKASMLDEAIEY  148



>gb|AES59419.2| helix loop helix DNA-binding domain protein [Medicago truncatula]
Length=267

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 56/67 (84%), Gaps = 3/67 (4%)
 Frame = +2

Query  359  ETSDALSNLAQPRP---SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASM  529
            E S+  S+ A P P   SKRSR+AE HNLSEKRRRS+INEKLKALQ LIPNSNKTDKASM
Sbjct  70   EGSELPSSKAAPPPRSSSKRSRAAEFHNLSEKRRRSKINEKLKALQNLIPNSNKTDKASM  129

Query  530  LDEAIEY  550
            LDEAIEY
Sbjct  130  LDEAIEY  136



>ref|XP_008793891.1| PREDICTED: uncharacterized protein LOC103710074 isoform X6 [Phoenix 
dactylifera]
Length=369

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%), Gaps = 5/60 (8%)
 Frame = +2

Query  386  AQPRP-----SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            A+P P     SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  91   AKPVPPRGSGSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  150



>ref|XP_008793892.1| PREDICTED: uncharacterized protein LOC103710074 isoform X7 [Phoenix 
dactylifera]
Length=368

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%), Gaps = 5/60 (8%)
 Frame = +2

Query  386  AQPRP-----SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            A+P P     SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  91   AKPVPPRGSGSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  150



>gb|ACG39275.1| hypothetical protein [Zea mays]
Length=282

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 6/70 (9%)
 Frame = +2

Query  359  ETSDAL----SNLAQP-RP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDK  520
            E  DAL    S+ A+P RP  KRSR+AEVHNLSEKRRRSRINEK+KALQTLIPNS+KTDK
Sbjct  23   EVQDALGSSESDPARPARPRGKRSRAAEVHNLSEKRRRSRINEKMKALQTLIPNSSKTDK  82

Query  521  ASMLDEAIEY  550
            ASMLD+AIEY
Sbjct  83   ASMLDDAIEY  92



>emb|CDY22448.1| BnaC03g61610D [Brassica napus]
Length=352

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 59/78 (76%), Gaps = 7/78 (9%)
 Frame = +2

Query  338  ENDNKGCETSDALSN------LAQPRPS-KRSRSAEVHNLSEKRRRSRINEKLKALQTLI  496
            E D   CE+ + +        L + R S KR R+AEVHNLSEKRRRSRINEK+KALQ+LI
Sbjct  140  ETDEYDCESEEGVEAVVDDELLCKSRTSSKRCRAAEVHNLSEKRRRSRINEKMKALQSLI  199

Query  497  PNSNKTDKASMLDEAIEY  550
            PNSNKTDKASMLDEAIEY
Sbjct  200  PNSNKTDKASMLDEAIEY  217



>ref|XP_009343287.1| PREDICTED: transcription factor SPATULA-like isoform X4 [Pyrus 
x bretschneideri]
Length=372

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 94/175 (54%), Gaps = 31/175 (18%)
 Frame = +2

Query  50   EDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFSD  229
            +DMS FLQ +L  +S+S          P+    ++  +G +  G            N   
Sbjct  30   DDMSLFLQQILVRSSSSLASGKA----PQSLFSSSPSVGALLPG------------NLDR  73

Query  230  P--SLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPS  403
            P  S F G  +   AV++F++   G     G+S   E E D   CE+ + L    + RPS
Sbjct  74   PCHSGFLGDGIP--AVDSFAAFVSGH--PNGAS---ENEADEYDCESEEGLEAFVEARPS  126

Query  404  KRSR------SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
                      +AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  127  GGRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  181



>ref|XP_009343286.1| PREDICTED: transcription factor SPATULA-like isoform X3 [Pyrus 
x bretschneideri]
Length=374

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 94/175 (54%), Gaps = 31/175 (18%)
 Frame = +2

Query  50   EDMSSFLQNLLHGASTSAdgddggVLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFSD  229
            +DMS FLQ +L  +S+S          P+    ++  +G +  G            N   
Sbjct  30   DDMSLFLQQILVRSSSSLASGKA----PQSLFSSSPSVGALLPG------------NLDR  73

Query  230  P--SLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPS  403
            P  S F G  +   AV++F++   G     G+S   E E D   CE+ + L    + RPS
Sbjct  74   PCHSGFLGDGIP--AVDSFAAFVSGH--PNGAS---ENEADEYDCESEEGLEAFVEARPS  126

Query  404  KRSR------SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
                      +AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  127  GGRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  181



>ref|XP_009343288.1| PREDICTED: transcription factor SPATULA-like isoform X5 [Pyrus 
x bretschneideri]
Length=369

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 96/176 (55%), Gaps = 33/176 (19%)
 Frame = +2

Query  50   EDMSSFLQNLLHGASTS-AdgddggVLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFS  226
            +DMS FLQ +L  +S+S A G     LF                 +S+P++      N  
Sbjct  30   DDMSLFLQQILVRSSSSLASGKAPQSLF-----------------SSSPSVGALLPGNLD  72

Query  227  DP--SLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRP  400
             P  S F G  +   AV++F++   G     G+S   E E D   CE+ + L    + RP
Sbjct  73   RPCHSGFLGDGIP--AVDSFAAFVSGH--PNGAS---ENEADEYDCESEEGLEAFVEARP  125

Query  401  SKRSR------SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            S          +AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  126  SGGRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  181



>ref|XP_009343285.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Pyrus 
x bretschneideri]
Length=381

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 96/176 (55%), Gaps = 33/176 (19%)
 Frame = +2

Query  50   EDMSSFLQNLLHGASTS-AdgddggVLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFS  226
            +DMS FLQ +L  +S+S A G     LF                 +S+P++      N  
Sbjct  30   DDMSLFLQQILVRSSSSLASGKAPQSLF-----------------SSSPSVGALLPGNLD  72

Query  227  DP--SLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRP  400
             P  S F G  +   AV++F++   G     G+S   E E D   CE+ + L    + RP
Sbjct  73   RPCHSGFLGDGIP--AVDSFAAFVSGH--PNGAS---ENEADEYDCESEEGLEAFVEARP  125

Query  401  SKRSR------SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            S          +AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  126  SGGRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  181



>ref|XP_009343284.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Pyrus 
x bretschneideri]
Length=383

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 96/176 (55%), Gaps = 33/176 (19%)
 Frame = +2

Query  50   EDMSSFLQNLLHGASTS-AdgddggVLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFS  226
            +DMS FLQ +L  +S+S A G     LF                 +S+P++      N  
Sbjct  30   DDMSLFLQQILVRSSSSLASGKAPQSLF-----------------SSSPSVGALLPGNLD  72

Query  227  DP--SLFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRP  400
             P  S F G  +   AV++F++   G     G+S   E E D   CE+ + L    + RP
Sbjct  73   RPCHSGFLGDGIP--AVDSFAAFVSGH--PNGAS---ENEADEYDCESEEGLEAFVEARP  125

Query  401  SKRSR------SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            S          +AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  126  SGGRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  181



>ref|XP_002454736.1| hypothetical protein SORBIDRAFT_04g036450 [Sorghum bicolor]
 gb|EES07712.1| hypothetical protein SORBIDRAFT_04g036450 [Sorghum bicolor]
Length=277

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 6/70 (9%)
 Frame = +2

Query  359  ETSDAL----SNLAQP-RP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDK  520
            E+ DAL    S+ A+P RP  KRSR+AEVHNLSEKRRRSRINEK+KALQTLIPNS+KTDK
Sbjct  22   ESEDALGSSESDPARPARPRGKRSRAAEVHNLSEKRRRSRINEKMKALQTLIPNSSKTDK  81

Query  521  ASMLDEAIEY  550
            ASMLD+AIEY
Sbjct  82   ASMLDDAIEY  91



>ref|XP_010446690.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Camelina 
sativa]
Length=363

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  194  SKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  243



>gb|AAK98706.1|AC069158_18 Putative SPATULA [Oryza sativa Japonica Group]
Length=298

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 7/72 (10%)
 Frame = +2

Query  356  CETSDAL--SNLAQP-RPS----KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKT  514
            CE+ +AL  S   QP RP+    KRSR+AEVHNLSEKRRRSRINEK+KALQ+LIPNS+KT
Sbjct  6    CESEEALGSSESEQPTRPARPRGKRSRAAEVHNLSEKRRRSRINEKMKALQSLIPNSSKT  65

Query  515  DKASMLDEAIEY  550
            DKASMLD+AIEY
Sbjct  66   DKASMLDDAIEY  77



>gb|KFK30312.1| hypothetical protein AALP_AA7G245600 [Arabis alpina]
Length=351

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLA-QP--------RPSKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            E E D   CE+ + +  +  +P          SKR R+AEVHNLSEKRRRSRINEK+KAL
Sbjct  139  ENETDEYDCESEEGVEAVVDEPSSKSGPSRNSSKRCRAAEVHNLSEKRRRSRINEKMKAL  198

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q+LIPNSNKTDKASMLDEAIEY
Sbjct  199  QSLIPNSNKTDKASMLDEAIEY  220



>gb|EAY87922.1| hypothetical protein OsI_09345 [Oryza sativa Indica Group]
Length=320

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 7/72 (10%)
 Frame = +2

Query  356  CETSDAL--SNLAQP-RPS----KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKT  514
            CE+ +AL  S   QP RP+    KRSR+AEVHNLSEKRRRSRINEK+KALQ+LIPNS+KT
Sbjct  28   CESEEALGSSESEQPTRPARPRGKRSRAAEVHNLSEKRRRSRINEKMKALQSLIPNSSKT  87

Query  515  DKASMLDEAIEY  550
            DKASMLD+AIEY
Sbjct  88   DKASMLDDAIEY  99



>gb|EAZ24998.1| hypothetical protein OsJ_08778 [Oryza sativa Japonica Group]
Length=320

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 61/72 (85%), Gaps = 7/72 (10%)
 Frame = +2

Query  356  CETSDAL--SNLAQP-RPS----KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKT  514
            CE+ +AL  S   QP RP+    KRSR+AEVHNLSEKRRRSRINEK+KALQ+LIPNS+KT
Sbjct  28   CESEEALGSSESEQPTRPARPRGKRSRAAEVHNLSEKRRRSRINEKMKALQSLIPNSSKT  87

Query  515  DKASMLDEAIEY  550
            DKASMLD+AIEY
Sbjct  88   DKASMLDDAIEY  99



>ref|XP_010446689.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Camelina 
sativa]
Length=364

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  194  SKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  243



>ref|XP_010446691.1| PREDICTED: transcription factor SPATULA-like isoform X3 [Camelina 
sativa]
Length=378

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  193  SKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  242



>ref|XP_009420906.1| PREDICTED: transcription factor SPATULA-like [Musa acuminata 
subsp. malaccensis]
Length=332

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHN+SEKRRRSRINEK++ALQ LIPNSNKTDKASMLDEAIEY
Sbjct  96   SKRSRAAEVHNMSEKRRRSRINEKMRALQNLIPNSNKTDKASMLDEAIEY  145



>emb|CDX69281.1| BnaC01g01720D [Brassica napus]
Length=349

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  171  SKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  220



>ref|XP_009109363.1| PREDICTED: transcription factor SPATULA-like [Brassica rapa]
 emb|CDY44048.1| BnaA08g15580D [Brassica napus]
Length=341

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 69/98 (70%), Gaps = 16/98 (16%)
 Frame = +2

Query  278  FSSAAIGDFDATGSSKRIEFENDNKGCETSDALSN------LAQPRPS-KRSRSAEVHNL  436
             SS+A+G   A+G+      E D   CE+ + +        L + R S KR R+AEVHNL
Sbjct  122  VSSSAVG---ASGN------ETDEYDCESEEGVEVVFDDELLCKSRTSSKRCRAAEVHNL  172

Query  437  SEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SEK+RRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  173  SEKKRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  210



>ref|XP_010432082.1| PREDICTED: transcription factor SPATULA-like isoform X3 [Camelina 
sativa]
Length=369

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  189  SKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  238



>ref|XP_002983759.1| hypothetical protein SELMODRAFT_118904, partial [Selaginella 
moellendorffii]
 gb|EFJ15255.1| hypothetical protein SELMODRAFT_118904, partial [Selaginella 
moellendorffii]
Length=89

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 49/52 (94%), Gaps = 1/52 (2%)
 Frame = +2

Query  395  RPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            RP KRSR+AEVHNLSE+RRR RINEK++ALQ LIPNSNKTDKASMLDEAIEY
Sbjct  12   RP-KRSRAAEVHNLSERRRRDRINEKMRALQELIPNSNKTDKASMLDEAIEY  62



>ref|XP_007160865.1| hypothetical protein PHAVU_001G023200g [Phaseolus vulgaris]
 gb|ESW32859.1| hypothetical protein PHAVU_001G023200g [Phaseolus vulgaris]
Length=287

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 55/67 (82%), Gaps = 1/67 (1%)
 Frame = +2

Query  353  GCETSDALSNLAQPRPS-KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASM  529
              E+ +A   +  PR S KRSR+AE HNLSEKRRRSRINEK+KALQ LIPNSNKTDKASM
Sbjct  93   SAESVEARKPVPPPRSSSKRSRAAEFHNLSEKRRRSRINEKMKALQKLIPNSNKTDKASM  152

Query  530  LDEAIEY  550
            LDEAIEY
Sbjct  153  LDEAIEY  159



>ref|XP_010432080.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Camelina 
sativa]
Length=370

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  189  SKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  238



>ref|XP_010432081.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Camelina 
sativa]
Length=369

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  188  SKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  237



>ref|XP_007160864.1| hypothetical protein PHAVU_001G023200g [Phaseolus vulgaris]
 gb|ESW32858.1| hypothetical protein PHAVU_001G023200g [Phaseolus vulgaris]
Length=288

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AE HNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  111  SKRSRAAEFHNLSEKRRRSRINEKMKALQKLIPNSNKTDKASMLDEAIEY  160



>emb|CDX75629.1| BnaA01g00730D [Brassica napus]
Length=346

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  173  SKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  222



>ref|XP_006283961.1| hypothetical protein CARUB_v10005083mg [Capsella rubella]
 gb|EOA16859.1| hypothetical protein CARUB_v10005083mg [Capsella rubella]
Length=369

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  188  SKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  237



>dbj|BAK05983.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=386

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 49/49 (100%), Gaps = 0/49 (0%)
 Frame = +2

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KR+R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  159  KRTRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  207



>ref|XP_006595974.1| PREDICTED: transcription factor SPATULA-like [Glycine max]
 gb|KHN35691.1| Transcription factor SPATULA [Glycine soja]
Length=297

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AE HNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  121  SKRSRAAEFHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  170



>ref|XP_010667415.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=418

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRR RINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  170  SKRSRAAEVHNLSEKRRRCRINEKMKALQNLIPNSNKTDKASMLDEAIEY  219



>ref|XP_009138272.1| PREDICTED: transcription factor SPATULA [Brassica rapa]
Length=354

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  174  SKRCRAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  223



>ref|XP_010667416.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=414

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSEKRRR RINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  170  SKRSRAAEVHNLSEKRRRCRINEKMKALQNLIPNSNKTDKASMLDEAIEY  219



>ref|XP_010437251.1| PREDICTED: transcription factor SPATULA-like [Camelina sativa]
Length=358

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 57/83 (69%), Gaps = 12/83 (14%)
 Frame = +2

Query  338  ENDNKGCETSDALSNLAQPRPS------------KRSRSAEVHNLSEKRRRSRINEKLKA  481
            E D   CE+ +    +    PS            KR R+AEVHNLSEKRRRSRINEK+KA
Sbjct  144  ETDEYDCESEEGGEAVVDEAPSSKSGGPPSRSSSKRCRAAEVHNLSEKRRRSRINEKMKA  203

Query  482  LQTLIPNSNKTDKASMLDEAIEY  550
            LQ+LIPNSNKTDKASMLDEAIEY
Sbjct  204  LQSLIPNSNKTDKASMLDEAIEY  226



>ref|XP_009410364.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=345

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 67/93 (72%), Gaps = 10/93 (11%)
 Frame = +2

Query  302  FDATGSS------KRIEFENDNKGCE--TSDALSNLAQPRPS--KRSRSAEVHNLSEKRR  451
            F A GSS      K  + + D+  CE   S+    LA  R S  KR+R+AEVHNLSEKRR
Sbjct  53   FGAVGSSLLHSRMKSPDQDLDSLDCEIEVSEEPPKLAPARTSSSKRNRAAEVHNLSEKRR  112

Query  452  RSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            RSRINEK+KALQ+LIPNS+KTDKASMLDEAIEY
Sbjct  113  RSRINEKMKALQSLIPNSSKTDKASMLDEAIEY  145



>ref|XP_004963135.1| PREDICTED: transcription factor PIF4-like isoform X1 [Setaria 
italica]
 ref|XP_004963136.1| PREDICTED: transcription factor PIF4-like isoform X2 [Setaria 
italica]
Length=409

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 56/73 (77%), Gaps = 6/73 (8%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNK  511
            EFE+ +  CE +  L+       +KR R+AEVHNLSE+RRR RINEK+KALQ LIP+ NK
Sbjct  236  EFESADVTCEPAQKLTT------AKRRRAAEVHNLSERRRRDRINEKMKALQELIPHCNK  289

Query  512  TDKASMLDEAIEY  550
            TDKASMLDEAIEY
Sbjct  290  TDKASMLDEAIEY  302



>gb|KHG11679.1| Transcription factor SPATULA -like protein [Gossypium arboreum]
Length=311

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 102/190 (54%), Gaps = 34/190 (18%)
 Frame = +2

Query  8    MADPYGTGHHS-LEPEDMSSFLQNLLHGASTSAdgddggVLFP---------------RP  139
            MAD YG   +S  E E++S+ L  LLH +S+S+      + F                 P
Sbjct  1    MADLYGGAPYSNPETEEISTILNQLLHNSSSSSSSSSSCMQFKGKNIHSFPSQVPGISTP  60

Query  140  AMEATDFMG-----RMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGDF  304
            A  +   MG     R R G  A  IE  P +N SDP  ++GA VK+SA NA SSA    +
Sbjct  61   AANSGSGMGIPVMDRYRLGGLAVRIESEPGVNISDPETYFGANVKDSADNALSSACDFSY  120

Query  305  DATGSSKRIEFENDNKGCETSDALSNL-AQPRPSKRSRSAEVHNLSEKRRRSRINEKLKA  481
            D    S+++         + S+  SN       SKRSR+AEVHNLSEKRRRSRINEK+KA
Sbjct  121  D----SEKVP--------DASEVPSNQERPRSSSKRSRAAEVHNLSEKRRRSRINEKMKA  168

Query  482  LQTLIPNSNK  511
            LQ LIPNSNK
Sbjct  169  LQNLIPNSNK  178



>gb|KHN36240.1| Transcription factor SPATULA [Glycine soja]
Length=375

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLAQPRPSKRSRSA---------EVHNLSEKRRRSRINEKLKAL  484
            E END+  CE+ + +  LA+  P+K + S          EVHNLSEKRRRSRINEK+KAL
Sbjct  108  ENENDDYDCESEEGVEALAEEVPTKAASSRSSSKRSRAAEVHNLSEKRRRSRINEKMKAL  167

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  168  QNLIPNSNKTDKASMLDEAIEY  189



>ref|XP_003516601.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Glycine 
max]
Length=375

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 60/82 (73%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLAQPRPSKRSRSA---------EVHNLSEKRRRSRINEKLKAL  484
            E END+  CE+ + +  LA+  P+K + S          EVHNLSEKRRRSRINEK+KAL
Sbjct  108  ENENDDYDCESEEGVEALAEEVPTKAASSRSSSKRSRAAEVHNLSEKRRRSRINEKMKAL  167

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  168  QNLIPNSNKTDKASMLDEAIEY  189



>gb|AHM26454.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26473.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26474.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26485.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26486.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26488.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26490.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSRSAEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  1    KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  49



>gb|AHM26455.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26456.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSRSAEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  1    KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  49



>gb|AHM26463.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26471.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26472.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26475.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26477.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26478.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26479.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26480.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26481.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26482.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26483.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26484.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26487.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26489.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSRSAEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  1    KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  49



>gb|AHM26451.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26453.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26464.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26469.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26470.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSRSAEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  1    KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  49



>gb|AHM26452.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26457.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26458.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26459.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26460.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26461.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26462.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26465.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26466.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26467.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26468.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSRSAEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  1    KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  49



>ref|XP_001766358.1| predicted protein [Physcomitrella patens]
 gb|EDQ68686.1| predicted protein, partial [Physcomitrella patens]
Length=81

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            +KRSR+AEVHN SE+RRR RINEK++ALQ LIPNSNKTDKASMLDEAIEY
Sbjct  19   AKRSRAAEVHNQSERRRRDRINEKMRALQELIPNSNKTDKASMLDEAIEY  68



>ref|XP_010914797.1| PREDICTED: transcription factor PIF3-like isoform X2 [Elaeis 
guineensis]
Length=668

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 69/109 (63%), Gaps = 8/109 (7%)
 Frame = +2

Query  248  AQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSD------ALSNLAQPRPS--  403
            A V  S+V + +SA     DA    KR   E +  G ++ D       L   A  R +  
Sbjct  379  AVVASSSVCSANSAGAASNDAQKGEKRRSHEGEESGYQSEDFEDMSVGLRKPATGRGTSA  438

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSR+AEVHNLSE+RRR RINEK++ALQ LIPN NKTDKASMLDEAIEY
Sbjct  439  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKTDKASMLDEAIEY  487



>gb|AHM26476.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSRSAEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  1    KRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  49



>ref|XP_010270238.1| PREDICTED: transcription factor SPATULA isoform X2 [Nelumbo nucifera]
Length=340

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 77/122 (63%), Gaps = 17/122 (14%)
 Frame = +2

Query  236  LFYGAQVKESAV--NAFSSAAIGDFDATGSSKRIEFEND--NKGCETSDALSNLAQP-RP  400
            L + ++ KE A    +  +A   D  AT   ++   +ND  +  CE+ + L    +P +P
Sbjct  136  LCFPSEAKEKATITTSVGTADCDDVTATAKQRKSPLDNDLDDYECESEEGLETSEEPSKP  195

Query  401  ------------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAI  544
                        SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAI
Sbjct  196  MPPRSTSSSSSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAI  255

Query  545  EY  550
            EY
Sbjct  256  EY  257



>ref|XP_010914796.1| PREDICTED: transcription factor PIF3-like isoform X1 [Elaeis 
guineensis]
Length=674

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 69/109 (63%), Gaps = 8/109 (7%)
 Frame = +2

Query  248  AQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSD------ALSNLAQPR--PS  403
            A V  S+V + +SA     DA    KR   E +  G ++ D       L   A  R   +
Sbjct  379  AVVASSSVCSANSAGAASNDAQKGEKRRSHEGEESGYQSEDFEDMSVGLRKPATGRGTSA  438

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSR+AEVHNLSE+RRR RINEK++ALQ LIPN NKTDKASMLDEAIEY
Sbjct  439  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKTDKASMLDEAIEY  487



>gb|KJB48603.1| hypothetical protein B456_008G077300 [Gossypium raimondii]
Length=239

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR+R+AEVHNLSEKRRRSRINEK+KALQ L+PN+NKTDKASMLDE IEY
Sbjct  90   SKRNRAAEVHNLSEKRRRSRINEKMKALQNLVPNANKTDKASMLDEVIEY  139



>gb|KHG02827.1| Transcription factor SPATULA -like protein [Gossypium arboreum]
Length=239

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR+R+AEVHNLSEKRRRSRINEK+KALQ L+PN+NKTDKASMLDE IEY
Sbjct  90   SKRNRAAEVHNLSEKRRRSRINEKMKALQNLVPNANKTDKASMLDEVIEY  139



>ref|XP_007207211.1| hypothetical protein PRUPE_ppa001899mg [Prunus persica]
 gb|EMJ08410.1| hypothetical protein PRUPE_ppa001899mg [Prunus persica]
Length=744

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 68/107 (64%), Gaps = 8/107 (7%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSD------ALSNLAQPRP--SKR  409
            V  S+V + +S   G  D T + KR   + D   C + D       +  +A  R   SKR
Sbjct  396  VVASSVCSGNSVERGSDDPTHALKRKSRDTDESECHSDDVEEESVGVKKIAHARGMGSKR  455

Query  410  SRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  456  SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  502



>ref|XP_008370334.1| PREDICTED: transcription factor PIF3 isoform X2 [Malus domestica]
Length=606

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSN--------LAQPRPSKR  409
            V  S+V + +S   G  D T + KR   E D   C + D             A+ + SKR
Sbjct  285  VVASSVCSGNSVERGSDDPTHALKRKCRETDESECHSDDVEDESVGVKKGAHARGKGSKR  344

Query  410  SRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  345  SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  391



>ref|XP_010270226.1| PREDICTED: transcription factor SPATULA isoform X1 [Nelumbo nucifera]
Length=457

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 77/122 (63%), Gaps = 17/122 (14%)
 Frame = +2

Query  236  LFYGAQVKESAV--NAFSSAAIGDFDATGSSKRIEFEND--NKGCETSDALSNLAQP-RP  400
            L + ++ KE A    +  +A   D  AT   ++   +ND  +  CE+ + L    +P +P
Sbjct  136  LCFPSEAKEKATITTSVGTADCDDVTATAKQRKSPLDNDLDDYECESEEGLETSEEPSKP  195

Query  401  ------------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAI  544
                        SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAI
Sbjct  196  MPPRSTSSSSSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAI  255

Query  545  EY  550
            EY
Sbjct  256  EY  257



>dbj|BAJ92170.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=341

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 82/143 (57%), Gaps = 21/143 (15%)
 Frame = +2

Query  122  VLFPRPAMEATDFMGRMRDGASAPAIEPSPSLNFSDPSLFYGAQVKESAVNAFSSAAIGD  301
            VL P  + EA D  GR    ASA     S    +S PS   GA  ++    A S   +  
Sbjct  161  VLLPLSSKEARD--GRSYHSASATLTTSS---AWSRPS---GASKRKQCDGAESPGEVMQ  212

Query  302  FDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKA  481
             D       +E E+ +  CET+       +P  +KR R+A+VHNLSE+RRR RINEK++A
Sbjct  213  QD-------VESESADVTCETAQ------KPATAKRRRAAQVHNLSERRRRDRINEKMRA  259

Query  482  LQTLIPNSNKTDKASMLDEAIEY  550
            LQ L+P+ NKTDKASMLDEAIEY
Sbjct  260  LQELVPHCNKTDKASMLDEAIEY  282



>gb|AAV33474.1| basic helix-loop-helix protein [Fragaria x ananassa]
Length=298

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 79/133 (59%), Gaps = 11/133 (8%)
 Frame = +2

Query  182  ASAPAIEPSPSLNFSDPS--LFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKG  355
            +S+PA    P  N   PS   F G  ++   V+     A G   ++ S    E E D   
Sbjct  58   SSSPAGYALPE-NLGSPSNDSFVGGVIRGVDVSTAVVTASGPNVSSSSVGASENEADEYD  116

Query  356  CETSDALSNLAQP--------RPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNK  511
            CE+ + L  L +           SKRSR+AEVHNLSEKRRRSRINEK+KALQ LIPNSNK
Sbjct  117  CESEEGLEALVEEAAVKSGGRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQNLIPNSNK  176

Query  512  TDKASMLDEAIEY  550
            TDKASMLDEAIEY
Sbjct  177  TDKASMLDEAIEY  189



>ref|XP_008370333.1| PREDICTED: transcription factor PIF3 isoform X1 [Malus domestica]
Length=715

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSN--------LAQPRPSKR  409
            V  S+V + +S   G  D T + KR   E D   C + D             A+ + SKR
Sbjct  394  VVASSVCSGNSVERGSDDPTHALKRKCRETDESECHSDDVEDESVGVKKGAHARGKGSKR  453

Query  410  SRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  454  SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  500



>ref|XP_006393909.1| hypothetical protein EUTSA_v10004889mg [Eutrema salsugineum]
 gb|ESQ31195.1| hypothetical protein EUTSA_v10004889mg [Eutrema salsugineum]
Length=220

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 9/94 (10%)
 Frame = +2

Query  269  VNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKR  448
            V+A + ++ G   A    K+  FEN   G   S++L         KR+   + HNLSEKR
Sbjct  56   VSAGAVSSAGYAVAETGDKKYAFENKRNGARQSNSL---------KRNIDTQFHNLSEKR  106

Query  449  RRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            RRS+INEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  107  RRSKINEKMKALQKLIPNSNKTDKASMLDEAIEY  140



>ref|XP_002865027.1| hypothetical protein ARALYDRAFT_496889 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41286.1| hypothetical protein ARALYDRAFT_496889 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 63/99 (64%), Gaps = 12/99 (12%)
 Frame = +2

Query  263  SAVNAFSSAAIGDFDATG---SSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHN  433
            SA   F S + G     G   + ++  FEN   G +  ++L         KR+  A+ HN
Sbjct  45   SAETFFPSVSGGAVSIAGYGVAQEKYAFENKRNGAKQRNSL---------KRTIDAQFHN  95

Query  434  LSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            LSEKRRRS+INEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  96   LSEKRRRSKINEKMKALQKLIPNSNKTDKASMLDEAIEY  134



>ref|XP_004499049.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Cicer 
arietinum]
Length=233

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AE HNLSEKRRRS+INEK+KALQ LIPNSNKTDKASMLDEAI+Y
Sbjct  85   SKRGRAAEFHNLSEKRRRSKINEKMKALQNLIPNSNKTDKASMLDEAIDY  134



>emb|CBY05403.1| ALCATRAZ-like protein [Lepidium appelianum]
Length=173

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 59/90 (66%), Gaps = 12/90 (13%)
 Frame = +2

Query  281  SSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSR  460
            S  A+ D   TG   +  FEN   G    ++L         KR+  A+ HNLSEKRRRS+
Sbjct  60   SGYAVAD---TGHQDKNAFENKRNGGRQRNSL---------KRNIDAQFHNLSEKRRRSK  107

Query  461  INEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            INEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  108  INEKMKALQKLIPNSNKTDKASMLDEAIEY  137



>ref|XP_001772223.1| predicted protein [Physcomitrella patens]
 gb|EDQ63036.1| predicted protein, partial [Physcomitrella patens]
Length=78

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            +KRSR+AEVHN SE+RRR RINEK++ALQ LIPNSNKTDKASML+EAIEY
Sbjct  19   AKRSRAAEVHNQSERRRRDRINEKMRALQELIPNSNKTDKASMLEEAIEY  68



>ref|XP_008388421.1| PREDICTED: transcription factor PIF3-like [Malus domestica]
Length=708

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDA--------LSNLAQPRPSKR  409
            V  S+V + +S   G  D T + KR   E D   C + D           + A+   SKR
Sbjct  389  VVASSVCSGNSVERGSDDPTQALKRKFRETDESECHSDDVEEEYMGVKKGDHARGMGSKR  448

Query  410  SRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  449  SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  495



>ref|XP_004499048.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Cicer 
arietinum]
Length=261

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR R+AE HNLSEKRRRS+INEK+KALQ LIPNSNKTDKASMLDEAI+Y
Sbjct  85   SKRGRAAEFHNLSEKRRRSKINEKMKALQNLIPNSNKTDKASMLDEAIDY  134



>gb|AEX32796.1| phytochrome-interacting factor 3 [Malus domestica]
Length=713

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDA--------LSNLAQPRPSKR  409
            V  S+V + +S   G  D T + KR   E D   C + D           + A+   SKR
Sbjct  394  VVASSVCSGNSVERGSDDPTQALKRKFRETDESECHSDDVEEEYMGVKKGDHARGMGSKR  453

Query  410  SRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  454  SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  500



>ref|XP_002442504.1| hypothetical protein SORBIDRAFT_08g021000 [Sorghum bicolor]
 gb|EES16342.1| hypothetical protein SORBIDRAFT_08g021000 [Sorghum bicolor]
Length=531

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 7/83 (8%)
 Frame = +2

Query  302  FDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKA  481
             DAT  ++ +EFE+ +  CE +   +       +KR R+AEVHNLSE+RRR RINEK+KA
Sbjct  284  VDAT-DAEDVEFESADVTCEPAHKTAT------AKRRRAAEVHNLSERRRRDRINEKMKA  336

Query  482  LQTLIPNSNKTDKASMLDEAIEY  550
            LQ LIP+ NKTDKASMLDEAIEY
Sbjct  337  LQELIPHCNKTDKASMLDEAIEY  359



>ref|XP_010909460.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor PIF3-like 
[Elaeis guineensis]
Length=702

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 68/109 (62%), Gaps = 8/109 (7%)
 Frame = +2

Query  248  AQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSD------ALSNLAQPR--PS  403
            A V  S+V + + A     D    +KR  +E +  G ++ D       L   A  R   +
Sbjct  338  AAVASSSVCSGNGAGAASNDPKHRAKRKNYEGEESGNQSEDHEDESMGLKKSATVRGTST  397

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  398  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  446



>ref|XP_010936085.1| PREDICTED: transcription factor PIF1-like isoform X2 [Elaeis 
guineensis]
Length=409

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 56/83 (67%), Gaps = 7/83 (8%)
 Frame = +2

Query  323  KRIEFENDNKGC-------ETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKA  481
            KR   E DN GC       E+ D   +  +  P +RSR+AEVHNL+E+RRR RINEK+K 
Sbjct  152  KRKAREGDNSGCQNEDDEFESGDKRKDTHRSAPVRRSRAAEVHNLAERRRRDRINEKMKT  211

Query  482  LQTLIPNSNKTDKASMLDEAIEY  550
            LQ LIP  NK+DKAS LDEAIEY
Sbjct  212  LQELIPRCNKSDKASTLDEAIEY  234



>gb|ABA99362.2| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=446

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = +2

Query  320  SKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIP  499
            S+ +EFE+    C  +   +       +KR R+AEVHNLSE+RRR RINEK+KALQ LIP
Sbjct  244  SEDVEFESAAATCSPAQKTTT------AKRRRAAEVHNLSERRRRDRINEKMKALQELIP  297

Query  500  NSNKTDKASMLDEAIEY  550
            + NKTDKASMLDEAIEY
Sbjct  298  HCNKTDKASMLDEAIEY  314



>ref|NP_001067246.1| Os12g0610200 [Oryza sativa Japonica Group]
 gb|ABA99363.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|ABA99364.2| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF30265.1| Os12g0610200 [Oryza sativa Japonica Group]
 gb|EAY83844.1| hypothetical protein OsI_39060 [Oryza sativa Indica Group]
 dbj|BAG90115.1| unnamed protein product [Oryza sativa Japonica Group]
Length=445

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = +2

Query  320  SKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIP  499
            S+ +EFE+    C  +   +       +KR R+AEVHNLSE+RRR RINEK+KALQ LIP
Sbjct  244  SEDVEFESAAATCSPAQKTTT------AKRRRAAEVHNLSERRRRDRINEKMKALQELIP  297

Query  500  NSNKTDKASMLDEAIEY  550
            + NKTDKASMLDEAIEY
Sbjct  298  HCNKTDKASMLDEAIEY  314



>emb|CBY05409.1| ALCATRAZ-like protein [Lepidium campestre]
Length=197

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 62/105 (59%), Gaps = 9/105 (9%)
 Frame = +2

Query  236  LFYGAQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSR  415
            +FY  +   S      S +      TG   +  FEN   G    ++L         KR+ 
Sbjct  42   IFYSDETFPSVSGGLVSPSGYAVADTGHQDKNAFENKRNGGRQRNSL---------KRNI  92

Query  416  SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
             A+ HNLSEKRRRS+INEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  93   DAQFHNLSEKRRRSKINEKMKALQKLIPNSNKTDKASMLDEAIEY  137



>gb|KHN48974.1| Transcription factor PIF1 [Glycine soja]
Length=255

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNK  511
            EF++++   E+ +A   +     +KRSR+AEVHNLSE+RRR RINEK+KALQ LIP  NK
Sbjct  15   EFQSEDVDFESPEAKKQVHGSTSTKRSRAAEVHNLSERRRRDRINEKMKALQELIPRCNK  74

Query  512  TDKASMLDEAIEY  550
            +DKASMLDEAIEY
Sbjct  75   SDKASMLDEAIEY  87



>ref|XP_007141451.1| hypothetical protein PHAVU_008G196800g [Phaseolus vulgaris]
 ref|XP_007141452.1| hypothetical protein PHAVU_008G196800g [Phaseolus vulgaris]
 gb|ESW13445.1| hypothetical protein PHAVU_008G196800g [Phaseolus vulgaris]
 gb|ESW13446.1| hypothetical protein PHAVU_008G196800g [Phaseolus vulgaris]
Length=549

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +2

Query  395  RPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            RPS+++R+AEVHNLSE+RRR RINEK++ALQ LIPNSNKTDKASML+EAIEY
Sbjct  341  RPSRKNRAAEVHNLSERRRRDRINEKMRALQQLIPNSNKTDKASMLEEAIEY  392



>ref|XP_004511914.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Cicer 
arietinum]
Length=337

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 9/80 (11%)
 Frame = +2

Query  338  ENDNKGCETSDALSNLAQPRPSKR---------SRSAEVHNLSEKRRRSRINEKLKALQT  490
            + D+  CE+ + +  L +  P+K          SR+AEVHNLSEKRRRSRINEK+KALQ 
Sbjct  67   DTDDYDCESEEGVEALTEELPTKHVASRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQN  126

Query  491  LIPNSNKTDKASMLDEAIEY  550
            LIPNSNKTDKASMLDEAIEY
Sbjct  127  LIPNSNKTDKASMLDEAIEY  146



>ref|XP_010936084.1| PREDICTED: transcription factor PIF1-like isoform X1 [Elaeis 
guineensis]
Length=420

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 56/83 (67%), Gaps = 7/83 (8%)
 Frame = +2

Query  323  KRIEFENDNKGC-------ETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKA  481
            KR   E DN GC       E+ D   +  +  P +RSR+AEVHNL+E+RRR RINEK+K 
Sbjct  152  KRKAREGDNSGCQNEDDEFESGDKRKDTHRSAPVRRSRAAEVHNLAERRRRDRINEKMKT  211

Query  482  LQTLIPNSNKTDKASMLDEAIEY  550
            LQ LIP  NK+DKAS LDEAIEY
Sbjct  212  LQELIPRCNKSDKASTLDEAIEY  234



>ref|XP_004511915.1| PREDICTED: transcription factor SPATULA-like isoform X2 [Cicer 
arietinum]
Length=330

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 9/80 (11%)
 Frame = +2

Query  338  ENDNKGCETSDALSNLAQPRPSKR---------SRSAEVHNLSEKRRRSRINEKLKALQT  490
            + D+  CE+ + +  L +  P+K          SR+AEVHNLSEKRRRSRINEK+KALQ 
Sbjct  67   DTDDYDCESEEGVEALTEELPTKHVASRSSSKRSRAAEVHNLSEKRRRSRINEKMKALQN  126

Query  491  LIPNSNKTDKASMLDEAIEY  550
            LIPNSNKTDKASMLDEAIEY
Sbjct  127  LIPNSNKTDKASMLDEAIEY  146



>ref|XP_006282286.1| hypothetical protein CARUB_v10028570mg [Capsella rubella]
 gb|EOA15184.1| hypothetical protein CARUB_v10028570mg [Capsella rubella]
Length=200

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 9/87 (10%)
 Frame = +2

Query  290  AIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINE  469
            ++G+  A  S  +  FEN   G    ++L         KR+  A  HNLSEK+RRS+INE
Sbjct  51   SVGNGVAETSQDKYAFENKRNGGRQKNSL---------KRNMDAHFHNLSEKKRRSKINE  101

Query  470  KLKALQTLIPNSNKTDKASMLDEAIEY  550
            K+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  102  KMKALQKLIPNSNKTDKASMLDEAIEY  128



>ref|XP_010688822.1| PREDICTED: transcription factor ALC-like [Beta vulgaris subsp. 
vulgaris]
Length=281

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKR+R+AEVHN+SEKRRR RINEK+KALQ LIPNS+KTDKASMLDEAI+Y
Sbjct  107  SKRTRAAEVHNMSEKRRRQRINEKMKALQKLIPNSSKTDKASMLDEAIDY  156



>gb|EEC69654.1| hypothetical protein OsI_39066 [Oryza sativa Indica Group]
Length=469

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 56/77 (73%), Gaps = 6/77 (8%)
 Frame = +2

Query  320  SKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIP  499
            S+ +EFE+    C  +   +       +KR R+AEVHNLSE+RRR RINEK+KALQ LIP
Sbjct  253  SEDVEFESAAATCSPAQKTTT------AKRRRAAEVHNLSERRRRDRINEKMKALQELIP  306

Query  500  NSNKTDKASMLDEAIEY  550
            + NKTDKASMLDEAIEY
Sbjct  307  HCNKTDKASMLDEAIEY  323



>ref|XP_009591142.1| PREDICTED: transcription factor PIF3-like [Nicotiana tomentosiformis]
Length=118

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSR+AEVHNLSE+ RR+RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  27   SKRSRAAEVHNLSERSRRNRINEKMRALQELIPNCNKADKASMLDEAIEY  76



>gb|KDP26428.1| hypothetical protein JCGZ_17586 [Jatropha curcas]
Length=537

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  AIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINE  469
            A  D    G  +  E+ +++   E++DA   +     +KRSR+AEVHNLSE+RRR RINE
Sbjct  283  ATEDRKRKGREEETEYHSEDVEFESADAKKQVRGSTSTKRSRAAEVHNLSERRRRDRINE  342

Query  470  KLKALQTLIPNSNKTDKASMLDEAIEY  550
            K++ALQ LIP  NK+DKASMLDEAIEY
Sbjct  343  KMRALQELIPRCNKSDKASMLDEAIEY  369



>ref|XP_010093193.1| hypothetical protein L484_013318 [Morus notabilis]
 gb|EXB53681.1| hypothetical protein L484_013318 [Morus notabilis]
Length=512

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLAQPRPS--KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNS  505
            E E  +K  E   A++N +  R    ++SR+AEVHNLSE+RRR RINEK+KALQ LIP+S
Sbjct  285  ELECQSKAAELESAVANKSSQRSGTLRKSRAAEVHNLSERRRRDRINEKMKALQELIPHS  344

Query  506  NKTDKASMLDEAIEY  550
            NKTDKASMLDEAIEY
Sbjct  345  NKTDKASMLDEAIEY  359



>ref|XP_011466211.1| PREDICTED: transcription factor PIF3 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=640

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 67/108 (62%), Gaps = 9/108 (8%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDA-------LSNLAQPRP--SK  406
            V +S+V + +S      D T   KR   + D+  C + D           +A  R   SK
Sbjct  376  VVDSSVCSVNSVEKASDDPTRVLKRKSRDTDDSECHSEDVEEESVGVKKKVAHGRGTGSK  435

Query  407  RSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            RSR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  436  RSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  483



>ref|XP_003611714.1| Transcription factor SPATULA [Medicago truncatula]
 gb|AES94672.1| helix loop helix DNA-binding domain protein [Medicago truncatula]
Length=344

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 68/105 (65%), Gaps = 16/105 (15%)
 Frame = +2

Query  266  AVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPSK----------RSR  415
            A+N  SS+       +G+      + D   CE+ + +  L +  P+K          RSR
Sbjct  58   AINVTSSSVGAGGGLSGN------DTDEYDCESEEGVEALIEEVPTKSVGASRSSSKRSR  111

Query  416  SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            +AEVHNLSEKRRRSRINEK+KALQ LIPNSNKTDKASMLDEAIEY
Sbjct  112  AAEVHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEY  156



>ref|XP_009335549.1| PREDICTED: transcription factor PIF3-like isoform X2 [Pyrus x 
bretschneideri]
Length=607

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSD------ALSNLAQPRP--SKR  409
            V  S+V + +S   G  D T + KR   E D   C + D       +   A  R   SKR
Sbjct  286  VVASSVCSGNSVERGSDDPTQALKRKFRETDESECHSDDVEEEYMGVKKGAHARGMGSKR  345

Query  410  SRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SR+AEVHNLSE++RR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  346  SRAAEVHNLSERKRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  392



>ref|XP_004303901.1| PREDICTED: transcription factor PIF4-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011467621.1| PREDICTED: transcription factor PIF4-like [Fragaria vesca subsp. 
vesca]
Length=540

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +2

Query  338  ENDNKGCETSDALSNLAQPRP--SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNK  511
            E  +K  E   A  N   PR   S+R+R+AEVHNLSE+RRR RINEK++ALQ LIP+SNK
Sbjct  316  ECQSKAAEIESAAGNKPAPRSGSSRRTRAAEVHNLSERRRRDRINEKMRALQELIPHSNK  375

Query  512  TDKASMLDEAIEY  550
            TDKASMLDEAIEY
Sbjct  376  TDKASMLDEAIEY  388



>ref|XP_006411917.1| hypothetical protein EUTSA_v10025554mg [Eutrema salsugineum]
 gb|ESQ53370.1| hypothetical protein EUTSA_v10025554mg [Eutrema salsugineum]
Length=359

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +2

Query  413  RSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  179  RAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  224



>ref|XP_008246329.1| PREDICTED: transcription factor PIF3 [Prunus mume]
Length=729

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSD------ALSNLAQPRP--SKR  409
            V  S+V + +S      D T + KR   + D   C + D       +  +A  R   SKR
Sbjct  396  VVASSVCSGNSVERASDDPTHALKRKSRDTDESECHSDDVEEESVGVKKIAHARGMGSKR  455

Query  410  SRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  456  SRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  502



>ref|XP_010271074.1| PREDICTED: transcription factor PIF3 isoform X2 [Nelumbo nucifera]
Length=734

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 9/108 (8%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALS---NLAQPRP------SK  406
            V  S+V + +SA     D   + KR   + ++  C++ D      +  +P P      SK
Sbjct  417  VASSSVCSVNSAGGASNDLKQALKRKSRDAEDSECQSEDVEEESVDARKPAPPRVGTGSK  476

Query  407  RSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            RSR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  477  RSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  524



>ref|XP_011466210.1| PREDICTED: transcription factor PIF3 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=708

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 67/108 (62%), Gaps = 9/108 (8%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDA-------LSNLAQPRP--SK  406
            V +S+V + +S      D T   KR   + D+  C + D           +A  R   SK
Sbjct  376  VVDSSVCSVNSVEKASDDPTRVLKRKSRDTDDSECHSEDVEEESVGVKKKVAHGRGTGSK  435

Query  407  RSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            RSR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  436  RSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  483



>ref|XP_004302325.1| PREDICTED: transcription factor PIF3 isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466209.1| PREDICTED: transcription factor PIF3 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=710

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 67/108 (62%), Gaps = 9/108 (8%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDA-------LSNLAQPRP--SK  406
            V +S+V + +S      D T   KR   + D+  C + D           +A  R   SK
Sbjct  376  VVDSSVCSVNSVEKASDDPTRVLKRKSRDTDDSECHSEDVEEESVGVKKKVAHGRGTGSK  435

Query  407  RSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            RSR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  436  RSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  483



>ref|XP_010652458.1| PREDICTED: transcription factor PIF1 isoform X3 [Vitis vinifera]
Length=489

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 60/85 (71%), Gaps = 7/85 (8%)
 Frame = +2

Query  296  GDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKL  475
            GD  A   S+ +EFE       ++DA   +     +KRSR+AEVHNLSE+RRR RINEK+
Sbjct  276  GDDTAEYQSEDVEFE-------SADAKKQVRGSATAKRSRAAEVHNLSERRRRDRINEKM  328

Query  476  KALQTLIPNSNKTDKASMLDEAIEY  550
            KALQ LIP  NK+DKASMLDEAIEY
Sbjct  329  KALQELIPRCNKSDKASMLDEAIEY  353



>ref|XP_008382659.1| PREDICTED: transcription factor PIF1-like [Malus domestica]
Length=529

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = +2

Query  305  DATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            DA   S+ +EFE+ N   +   + S+      +KRSR+AEVHNLSE+RRR RINEK+KAL
Sbjct  287  DAEIQSEDVEFESANGKKQVRGSTSS------TKRSRAAEVHNLSERRRRDRINEKMKAL  340

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIP  NK+DKASMLDEAIEY
Sbjct  341  QELIPRCNKSDKASMLDEAIEY  362



>ref|XP_002436548.1| hypothetical protein SORBIDRAFT_10g004500 [Sorghum bicolor]
 gb|EER87915.1| hypothetical protein SORBIDRAFT_10g004500 [Sorghum bicolor]
Length=291

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 63/91 (69%), Gaps = 10/91 (11%)
 Frame = +2

Query  308  ATGSSKRIEFENDNKGCETSDALSNLAQPRPSK----------RSRSAEVHNLSEKRRRS  457
            A G   ++++  D  G   SDA  +  +  P +          RSR+AEVHNLSEKRRRS
Sbjct  38   ALGHGHQVDYGEDAGGLGDSDAGGSEPEAPPERTRGGGGSGSKRSRAAEVHNLSEKRRRS  97

Query  458  RINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            +INEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  98   KINEKMKALQSLIPNSNKTDKASMLDEAIEY  128



>ref|XP_002866965.1| hypothetical protein ARALYDRAFT_353119 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43224.1| hypothetical protein ARALYDRAFT_353119 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +2

Query  413  RSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  176  RAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  221



>gb|KDO44799.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
Length=141

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            +RSR+AEVHNLSE+RRR RINEK++ALQ LIP+ NKTDKASMLDEAIEY
Sbjct  83   RRSRAAEVHNLSERRRRDRINEKMRALQELIPHCNKTDKASMLDEAIEY  131



>ref|XP_009365453.1| PREDICTED: transcription factor PIF3-like [Pyrus x bretschneideri]
 ref|XP_009335548.1| PREDICTED: transcription factor PIF3-like isoform X1 [Pyrus x 
bretschneideri]
Length=716

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 66/107 (62%), Gaps = 8/107 (7%)
 Frame = +2

Query  254  VKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCETSDALSNL--------AQPRPSKR  409
            V  S+V + +S   G  D T + KR   E D   C + D             A+   SKR
Sbjct  395  VVASSVCSGNSVERGSDDPTQALKRKFRETDESECHSDDVEEEYMGVKKGAHARGMGSKR  454

Query  410  SRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SR+AEVHNLSE++RR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  455  SRAAEVHNLSERKRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  501



>ref|XP_010652457.1| PREDICTED: transcription factor PIF1 isoform X2 [Vitis vinifera]
Length=516

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 60/85 (71%), Gaps = 7/85 (8%)
 Frame = +2

Query  296  GDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKL  475
            GD  A   S+ +EFE       ++DA   +     +KRSR+AEVHNLSE+RRR RINEK+
Sbjct  276  GDDTAEYQSEDVEFE-------SADAKKQVRGSATAKRSRAAEVHNLSERRRRDRINEKM  328

Query  476  KALQTLIPNSNKTDKASMLDEAIEY  550
            KALQ LIP  NK+DKASMLDEAIEY
Sbjct  329  KALQELIPRCNKSDKASMLDEAIEY  353



>ref|XP_010652454.1| PREDICTED: transcription factor PIF1 isoform X1 [Vitis vinifera]
 ref|XP_002263397.3| PREDICTED: transcription factor PIF1 isoform X1 [Vitis vinifera]
 ref|XP_010652455.1| PREDICTED: transcription factor PIF1 isoform X1 [Vitis vinifera]
 ref|XP_010652456.1| PREDICTED: transcription factor PIF1 isoform X1 [Vitis vinifera]
Length=530

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 60/85 (71%), Gaps = 7/85 (8%)
 Frame = +2

Query  296  GDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKL  475
            GD  A   S+ +EFE       ++DA   +     +KRSR+AEVHNLSE+RRR RINEK+
Sbjct  276  GDDTAEYQSEDVEFE-------SADAKKQVRGSATAKRSRAAEVHNLSERRRRDRINEKM  328

Query  476  KALQTLIPNSNKTDKASMLDEAIEY  550
            KALQ LIP  NK+DKASMLDEAIEY
Sbjct  329  KALQELIPRCNKSDKASMLDEAIEY  353



>emb|CBI37249.3| unnamed protein product [Vitis vinifera]
Length=479

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 60/85 (71%), Gaps = 7/85 (8%)
 Frame = +2

Query  296  GDFDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKL  475
            GD  A   S+ +EFE       ++DA   +     +KRSR+AEVHNLSE+RRR RINEK+
Sbjct  238  GDDTAEYQSEDVEFE-------SADAKKQVRGSATAKRSRAAEVHNLSERRRRDRINEKM  290

Query  476  KALQTLIPNSNKTDKASMLDEAIEY  550
            KALQ LIP  NK+DKASMLDEAIEY
Sbjct  291  KALQELIPRCNKSDKASMLDEAIEY  315



>gb|KDO79178.1| hypothetical protein CISIN_1g036669mg, partial [Citrus sinensis]
Length=317

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +2

Query  416  SAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            +AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  160  AAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  204



>ref|XP_010245663.1| PREDICTED: transcription factor PIF1-like isoform X4 [Nelumbo 
nucifera]
 ref|XP_010245664.1| PREDICTED: transcription factor PIF1-like isoform X4 [Nelumbo 
nucifera]
Length=533

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 60/87 (69%), Gaps = 7/87 (8%)
 Frame = +2

Query  311  TGSSKRIEFENDNKGCETSDA----LSNLAQPRPS---KRSRSAEVHNLSEKRRRSRINE  469
            T   KR   E D+  C++ DA    +    Q R S   +RSR+AEVHNLSE+RRR RINE
Sbjct  269  TDDRKRKSREQDDNECQSEDAEFESVETKKQVRGSTSARRSRAAEVHNLSERRRRDRINE  328

Query  470  KLKALQTLIPNSNKTDKASMLDEAIEY  550
            K+KALQ LIP  NK+DKASMLDEAIEY
Sbjct  329  KMKALQELIPRCNKSDKASMLDEAIEY  355



>ref|XP_009407100.1| PREDICTED: transcription factor PIF1-like [Musa acuminata subsp. 
malaccensis]
Length=415

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 67/112 (60%), Gaps = 8/112 (7%)
 Frame = +2

Query  239  FYGAQVKESAVNAFSSAAIGDFDATGSSKR--------IEFENDNKGCETSDALSNLAQP  394
            F  A    S    FS    GD   +G  ++         E++++    E+ +A       
Sbjct  187  FETALASSSGGACFSFRRTGDQGGSGQCQKRKQRDVQVAEYQSEEAEFESVEAKKAAQGS  246

Query  395  RPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
              ++RSR+AEVHNLSE+RRR RINEK+KALQ LIP+ NKTDKASMLDEAIEY
Sbjct  247  ISTRRSRAAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLDEAIEY  298



>ref|NP_568010.1| transcription factor SPATULA [Arabidopsis thaliana]
 sp|Q9FUA4.1|SPT_ARATH RecName: Full=Transcription factor SPATULA; AltName: Full=Basic 
helix-loop-helix protein 24; Short=AtbHLH24; Short=bHLH 24; 
AltName: Full=Transcription factor EN 99; AltName: Full=bHLH 
transcription factor bHLH024 [Arabidopsis thaliana]
 gb|AAG33640.1|AF319540_1 SPATULA [Arabidopsis thaliana]
 dbj|BAF01131.1| putative bHLH transcription factor (AtbHLH024) / SPATULA (SPT) 
[Arabidopsis thaliana]
 gb|ABH04569.1| At4g36930 [Arabidopsis thaliana]
 gb|AEE86720.1| transcription factor SPATULA [Arabidopsis thaliana]
Length=373

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/46 (93%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +2

Query  413  RSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            R+AEVHNLSEKRRRSRINEK+KALQ+LIPNSNKTDKASMLDEAIEY
Sbjct  197  RAAEVHNLSEKRRRSRINEKMKALQSLIPNSNKTDKASMLDEAIEY  242



>ref|XP_008811826.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
 ref|XP_008811827.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
 ref|XP_008811828.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
 ref|XP_008811829.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
Length=573

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +2

Query  383  LAQPRP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            LAQ  P ++RSRSAEVHNLSE+RRR RINEK+KALQ LIP+ NKTDKASMLDEAIEY
Sbjct  336  LAQRSPFTRRSRSAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLDEAIEY  392



>tpg|DAA54246.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=377

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            +KRSR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  158  TKRSRTAEVHNLSERRRRDRINEKMRALQELIPNCNKIDKASMLDEAIEY  207



>gb|EEC78487.1| hypothetical protein OsI_18387 [Oryza sativa Indica Group]
Length=289

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  395  RPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            R SKRSR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASML+EAIEY
Sbjct  113  RSSKRSRTAEVHNLSERRRRDRINEKMRALQELIPNCNKIDKASMLEEAIEY  164



>ref|XP_008811817.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811818.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811819.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811820.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811821.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
Length=588

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +2

Query  383  LAQPRP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            LAQ  P ++RSRSAEVHNLSE+RRR RINEK+KALQ LIP+ NKTDKASMLDEAIEY
Sbjct  351  LAQRSPFTRRSRSAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLDEAIEY  407



>ref|XP_004967640.1| PREDICTED: transcription factor PIF3-like isoform X1 [Setaria 
italica]
 ref|XP_004967641.1| PREDICTED: transcription factor PIF3-like isoform X2 [Setaria 
italica]
 ref|XP_004967642.1| PREDICTED: transcription factor PIF3-like isoform X3 [Setaria 
italica]
 ref|XP_004967643.1| PREDICTED: transcription factor PIF3-like isoform X4 [Setaria 
italica]
 ref|XP_004967644.1| PREDICTED: transcription factor PIF3-like isoform X5 [Setaria 
italica]
Length=624

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 70/112 (63%), Gaps = 18/112 (16%)
 Frame = +2

Query  248  AQVKESAVNAFSSAAIGDFDATGSSKRI-----------EFENDNKGCETSDALSNLAQP  394
            A V  S+V + + A IG+ ++    KR            + E+++ G   S +       
Sbjct  312  AAVATSSVCSGNGAGIGNDESWRQHKRKSQAECSASQDDDLEDESGGARRSGS-------  364

Query  395  RPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            R +KRSR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  365  RGTKRSRTAEVHNLSERRRRDRINEKMRALQELIPNCNKIDKASMLDEAIEY  416



>ref|XP_010245660.1| PREDICTED: transcription factor PIF1-like isoform X1 [Nelumbo 
nucifera]
Length=584

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 60/87 (69%), Gaps = 7/87 (8%)
 Frame = +2

Query  311  TGSSKRIEFENDNKGCETSDA----LSNLAQPRPS---KRSRSAEVHNLSEKRRRSRINE  469
            T   KR   E D+  C++ DA    +    Q R S   +RSR+AEVHNLSE+RRR RINE
Sbjct  320  TDDRKRKSREQDDNECQSEDAEFESVETKKQVRGSTSARRSRAAEVHNLSERRRRDRINE  379

Query  470  KLKALQTLIPNSNKTDKASMLDEAIEY  550
            K+KALQ LIP  NK+DKASMLDEAIEY
Sbjct  380  KMKALQELIPRCNKSDKASMLDEAIEY  406



>ref|XP_004967645.1| PREDICTED: transcription factor PIF3-like isoform X6 [Setaria 
italica]
Length=619

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 70/112 (63%), Gaps = 18/112 (16%)
 Frame = +2

Query  248  AQVKESAVNAFSSAAIGDFDATGSSKRI-----------EFENDNKGCETSDALSNLAQP  394
            A V  S+V + + A IG+ ++    KR            + E+++ G   S +       
Sbjct  307  AAVATSSVCSGNGAGIGNDESWRQHKRKSQAECSASQDDDLEDESGGARRSGS-------  359

Query  395  RPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            R +KRSR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  360  RGTKRSRTAEVHNLSERRRRDRINEKMRALQELIPNCNKIDKASMLDEAIEY  411



>ref|XP_008811825.1| PREDICTED: transcription factor PIF4-like isoform X3 [Phoenix 
dactylifera]
Length=574

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +2

Query  383  LAQPRP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            LAQ  P ++RSRSAEVHNLSE+RRR RINEK+KALQ LIP+ NKTDKASMLDEAIEY
Sbjct  351  LAQRSPFTRRSRSAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLDEAIEY  407



>ref|XP_010941465.1| PREDICTED: transcription factor PIF3-like isoform X1 [Elaeis 
guineensis]
Length=666

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 8/109 (7%)
 Frame = +2

Query  248  AQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCET---SDALSNLAQPRP-----S  403
            A V  S+V + + A     D     KR   E +  G ++    D    L +P P     +
Sbjct  375  AVVASSSVCSANGAGAASNDPKQQEKRKSREGEESGYQSDDFEDVSVGLKKPAPGRGTST  434

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASML+EAIEY
Sbjct  435  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLEEAIEY  483



>ref|XP_010245662.1| PREDICTED: transcription factor PIF1-like isoform X3 [Nelumbo 
nucifera]
Length=566

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 60/87 (69%), Gaps = 7/87 (8%)
 Frame = +2

Query  311  TGSSKRIEFENDNKGCETSDA----LSNLAQPRPS---KRSRSAEVHNLSEKRRRSRINE  469
            T   KR   E D+  C++ DA    +    Q R S   +RSR+AEVHNLSE+RRR RINE
Sbjct  320  TDDRKRKSREQDDNECQSEDAEFESVETKKQVRGSTSARRSRAAEVHNLSERRRRDRINE  379

Query  470  KLKALQTLIPNSNKTDKASMLDEAIEY  550
            K+KALQ LIP  NK+DKASMLDEAIEY
Sbjct  380  KMKALQELIPRCNKSDKASMLDEAIEY  406



>ref|XP_008811822.1| PREDICTED: transcription factor PIF4-like isoform X2 [Phoenix 
dactylifera]
Length=575

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = +2

Query  383  LAQPRP-SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            LAQ  P ++RSRSAEVHNLSE+RRR RINEK+KALQ LIP+ NKTDKASMLDEAIEY
Sbjct  351  LAQRSPFTRRSRSAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLDEAIEY  407



>ref|XP_004139727.1| PREDICTED: transcription factor PIF1-like [Cucumis sativus]
Length=529

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 7/76 (9%)
 Frame = +2

Query  344  DNKGCETSDALSNLAQPRP-------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPN  502
            D+  C++ D     A P+        +KRSR+AEVHNLSE+RRR RINEK+KALQ LIP 
Sbjct  286  DDTECQSEDVEYESADPKKQLRGSTSTKRSRAAEVHNLSERRRRDRINEKMKALQELIPR  345

Query  503  SNKTDKASMLDEAIEY  550
             NKTDKASMLDEAIEY
Sbjct  346  CNKTDKASMLDEAIEY  361



>ref|XP_009148251.1| PREDICTED: transcription factor PIF3 isoform X2 [Brassica rapa]
Length=528

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 4/82 (5%)
 Frame = +2

Query  305  DATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            D    S+ +E E+ +   ET+ + + +     SKRSRSAEVHNLSE+RRR RINEK++AL
Sbjct  313  DIECHSEDVEGESGDGRKETAPSRTGIG----SKRSRSAEVHNLSERRRRDRINEKMRAL  368

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPN NK DKASMLDEAIEY
Sbjct  369  QELIPNCNKVDKASMLDEAIEY  390



>ref|XP_010245661.1| PREDICTED: transcription factor PIF1-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 60/87 (69%), Gaps = 7/87 (8%)
 Frame = +2

Query  311  TGSSKRIEFENDNKGCETSDA----LSNLAQPRPS---KRSRSAEVHNLSEKRRRSRINE  469
            T   KR   E D+  C++ DA    +    Q R S   +RSR+AEVHNLSE+RRR RINE
Sbjct  318  TDDRKRKSREQDDNECQSEDAEFESVETKKQVRGSTSARRSRAAEVHNLSERRRRDRINE  377

Query  470  KLKALQTLIPNSNKTDKASMLDEAIEY  550
            K+KALQ LIP  NK+DKASMLDEAIEY
Sbjct  378  KMKALQELIPRCNKSDKASMLDEAIEY  404



>gb|KFK28388.1| hypothetical protein AALP_AA8G508500 [Arabis alpina]
Length=190

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 52/72 (72%), Gaps = 9/72 (13%)
 Frame = +2

Query  335  FENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKT  514
            FEN   G    ++L         KR+  A+ HNLSEKRRRS+INEK+KALQ LIPNSNKT
Sbjct  53   FENKRNGARQRNSL---------KRNIDAQFHNLSEKRRRSKINEKMKALQKLIPNSNKT  103

Query  515  DKASMLDEAIEY  550
            DKASMLDEAIEY
Sbjct  104  DKASMLDEAIEY  115



>ref|XP_009148249.1| PREDICTED: transcription factor PIF3 isoform X1 [Brassica rapa]
Length=530

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 4/82 (5%)
 Frame = +2

Query  305  DATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKAL  484
            D    S+ +E E+ +   ET+ + + +     SKRSRSAEVHNLSE+RRR RINEK++AL
Sbjct  315  DIECHSEDVEGESGDGRKETAPSRTGIG----SKRSRSAEVHNLSERRRRDRINEKMRAL  370

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPN NK DKASMLDEAIEY
Sbjct  371  QELIPNCNKVDKASMLDEAIEY  392



>ref|XP_010941466.1| PREDICTED: transcription factor PIF3-like isoform X2 [Elaeis 
guineensis]
Length=660

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 8/109 (7%)
 Frame = +2

Query  248  AQVKESAVNAFSSAAIGDFDATGSSKRIEFENDNKGCET---SDALSNLAQPRP-----S  403
            A V  S+V + + A     D     KR   E +  G ++    D    L +P P     +
Sbjct  375  AVVASSSVCSANGAGAASNDPKQQEKRKSREGEESGYQSDDFEDVSVGLKKPAPGRGTST  434

Query  404  KRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            KRSR+AEVHNLSE+RRR RINEK++ALQ LIPN NK DKASML+EAIEY
Sbjct  435  KRSRAAEVHNLSERRRRDRINEKMRALQELIPNCNKADKASMLEEAIEY  483



>ref|XP_008447346.1| PREDICTED: transcription factor PIF1-like isoform X2 [Cucumis 
melo]
Length=379

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 57/84 (68%), Gaps = 7/84 (8%)
 Frame = +2

Query  299  DFDATGSSKRIEFENDNKGCETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLK  478
            D D    S  +EFE       ++DA   +     +KRSR+AEVHNLSE+RRR RINEK+K
Sbjct  280  DSDYLCYSTDVEFE-------STDAKKQVRGSTSTKRSRAAEVHNLSERRRRDRINEKMK  332

Query  479  ALQTLIPNSNKTDKASMLDEAIEY  550
            ALQ LIP  NK DKASMLDEAIEY
Sbjct  333  ALQELIPRCNKADKASMLDEAIEY  356



>gb|EMT23685.1| Transcription factor PIF3 [Aegilops tauschii]
Length=350

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 63/86 (73%), Gaps = 6/86 (7%)
 Frame = +2

Query  311  TGSSKRIEFENDNKGCE-----TSDALSNLAQ-PRPSKRSRSAEVHNLSEKRRRSRINEK  472
            +G+SKR + E  ++  +     ++D     AQ P  +KR R+A+VHNLSE+RRR RINEK
Sbjct  204  SGTSKRKQSEGPSEVMQDVESNSADVTCETAQKPTTAKRRRAAQVHNLSERRRRDRINEK  263

Query  473  LKALQTLIPNSNKTDKASMLDEAIEY  550
            ++ALQ L+P+ NKTDKASMLDEAIEY
Sbjct  264  MRALQELVPHCNKTDKASMLDEAIEY  289



>gb|KGN44558.1| hypothetical protein Csa_7G333400 [Cucumis sativus]
Length=532

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 7/76 (9%)
 Frame = +2

Query  344  DNKGCETSDALSNLAQPRP-------SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPN  502
            D+  C++ D     A P+        +KRSR+AEVHNLSE+RRR RINEK+KALQ LIP 
Sbjct  286  DDTECQSEDVEYESADPKKQLRGSTSTKRSRAAEVHNLSERRRRDRINEKMKALQELIPR  345

Query  503  SNKTDKASMLDEAIEY  550
             NKTDKASMLDEAIEY
Sbjct  346  CNKTDKASMLDEAIEY  361



>dbj|BAJ90328.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=209

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            ++RSR+AEVHNLSE+RRR RINEK++ALQ LIP+ NKTDKASMLDEAIEY
Sbjct  32   ARRSRAAEVHNLSERRRRDRINEKMRALQELIPHCNKTDKASMLDEAIEY  81



>emb|CDY06358.1| BnaA09g48450D [Brassica napus]
Length=491

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSRSAEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  302  SKRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  351



>emb|CDY22636.1| BnaC08g42700D [Brassica napus]
Length=491

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  401  SKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDEAIEY  550
            SKRSRSAEVHNLSE+RRR RINEK++ALQ LIPN NK DKASMLDEAIEY
Sbjct  301  SKRSRSAEVHNLSERRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEY  350



>ref|XP_003539355.1| PREDICTED: transcription factor SPATULA-like isoform X1 [Glycine 
max]
 gb|KHN42092.1| Transcription factor SPATULA [Glycine soja]
Length=381

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 58/82 (71%), Gaps = 9/82 (11%)
 Frame = +2

Query  332  EFENDNKGCETSDALSNLAQPRPSKRSRSA---------EVHNLSEKRRRSRINEKLKAL  484
            E END+  CE+ + +   A+  P+K + S          EVHNLSEKRRR RINEK+KAL
Sbjct  104  ENENDDYDCESEEGVEAPAEEVPTKAASSRSSSKRSRAAEVHNLSEKRRRGRINEKMKAL  163

Query  485  QTLIPNSNKTDKASMLDEAIEY  550
            Q LIPNSNKTDKASMLDEAIEY
Sbjct  164  QNLIPNSNKTDKASMLDEAIEY  185



>ref|XP_009399053.1| PREDICTED: transcription factor PIF4-like [Musa acuminata subsp. 
malaccensis]
Length=535

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  359  ETSDALSNLAQPRPSKRSRSAEVHNLSEKRRRSRINEKLKALQTLIPNSNKTDKASMLDE  538
            E+ D      +P   +RSR+AEVHNLSE+RRR RINEK+KALQ LIP+ NKTDKASMLDE
Sbjct  329  ESIDEKKQATRPTSKRRSRAAEVHNLSERRRRDRINEKMKALQELIPHCNKTDKASMLDE  388

Query  539  AIEY  550
            AIEY
Sbjct  389  AIEY  392



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720