BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M11

Length=406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004300651.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     129   4e-33   Fragaria vesca subsp. vesca
ref|XP_006364863.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    128   8e-33   Solanum tuberosum [potatoes]
ref|XP_009613129.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     128   9e-33   Nicotiana tomentosiformis
ref|XP_004237917.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     126   6e-32   Solanum lycopersicum
emb|CDP01065.1|  unnamed protein product                                125   7e-32   Coffea canephora [robusta coffee]
gb|KDO80979.1|  hypothetical protein CISIN_1g020846mg                   125   1e-31   Citrus sinensis [apfelsine]
gb|KDO80978.1|  hypothetical protein CISIN_1g020846mg                   125   1e-31   Citrus sinensis [apfelsine]
ref|XP_006472592.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    125   1e-31   Citrus sinensis [apfelsine]
ref|XP_007018757.1|  APR-like 4 isoform 1                               125   2e-31   
ref|XP_007018758.1|  APR-like 4 isoform 2                               124   2e-31   
ref|XP_002285788.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     124   3e-31   Vitis vinifera
ref|XP_009778518.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    123   5e-31   Nicotiana sylvestris
ref|XP_011016531.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     123   8e-31   Populus euphratica
ref|XP_009778517.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    123   9e-31   Nicotiana sylvestris
gb|ACU17922.1|  unknown                                                 117   1e-30   Glycine max [soybeans]
ref|XP_006433972.1|  hypothetical protein CICLE_v10001862mg             122   1e-30   Citrus clementina [clementine]
ref|XP_011074264.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     122   1e-30   Sesamum indicum [beniseed]
ref|XP_009334346.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     121   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_009334329.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     121   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_008383930.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     121   3e-30   Malus domestica [apple tree]
ref|XP_002302300.2|  thioredoxin-related family protein                 121   4e-30   
gb|KHN03900.1|  5'-adenylylsulfate reductase-like 4                     120   7e-30   Glycine soja [wild soybean]
ref|XP_008372920.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     119   1e-29   
ref|XP_006581537.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    120   1e-29   Glycine max [soybeans]
ref|XP_008343322.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     119   1e-29   
ref|XP_009372786.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     119   2e-29   Pyrus x bretschneideri [bai li]
gb|KJB29323.1|  hypothetical protein B456_005G094200                    116   3e-29   Gossypium raimondii
gb|KJB29322.1|  hypothetical protein B456_005G094200                    117   4e-29   Gossypium raimondii
gb|KEH34942.1|  5-adenylylsulfate reductase-like protein                117   8e-29   Medicago truncatula
gb|KHN19767.1|  5'-adenylylsulfate reductase-like 4                     115   6e-28   Glycine soja [wild soybean]
ref|XP_010089873.1|  5'-adenylylsulfate reductase-like 4                119   8e-28   
ref|XP_007136256.1|  hypothetical protein PHAVU_009G031500g             114   1e-27   Phaseolus vulgaris [French bean]
ref|XP_008219447.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     114   1e-27   Prunus mume [ume]
ref|XP_010676416.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     114   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003522795.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    114   2e-27   
gb|KJB14728.1|  hypothetical protein B456_002G140600                    113   3e-27   Gossypium raimondii
ref|XP_007222969.1|  hypothetical protein PRUPE_ppa008937mg             112   6e-27   Prunus persica
ref|NP_564452.1|  5'-adenylylsulfate reductase-like 4                   111   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KJB64265.1|  hypothetical protein B456_010G039900                    109   7e-26   Gossypium raimondii
ref|XP_010267539.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     108   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010478919.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     108   1e-25   Camelina sativa [gold-of-pleasure]
gb|KDP41389.1|  hypothetical protein JCGZ_15796                         108   2e-25   Jatropha curcas
ref|XP_010461284.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     107   3e-25   Camelina sativa [gold-of-pleasure]
gb|KHG11609.1|  5'-adenylylsulfate reductase-like 4                     107   3e-25   Gossypium arboreum [tree cotton]
ref|XP_002306572.2|  hypothetical protein POPTR_0005s17150g             107   7e-25   
ref|XP_011004793.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     106   1e-24   Populus euphratica
gb|KHG10185.1|  5'-adenylylsulfate reductase-like 4                     106   1e-24   Gossypium arboreum [tree cotton]
ref|XP_010500009.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     105   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006305413.1|  hypothetical protein CARUB_v10009812mg             105   1e-24   Capsella rubella
ref|XP_002893853.1|  hypothetical protein ARALYDRAFT_473651             105   3e-24   
ref|XP_006397424.1|  hypothetical protein EUTSA_v10001824mg             104   5e-24   Eutrema salsugineum [saltwater cress]
ref|XP_004500630.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    104   5e-24   
ref|XP_004500631.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    104   6e-24   
ref|XP_004500632.1|  PREDICTED: 5'-adenylylsulfate reductase-like...    104   6e-24   
ref|XP_010269310.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4     103   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_002513930.1|  conserved hypothetical protein                     103   2e-23   Ricinus communis
gb|KHN19769.1|  5'-adenylylsulfate reductase-like 4                     102   3e-23   Glycine soja [wild soybean]
gb|KHN08939.1|  5'-adenylylsulfate reductase-like 4                     101   8e-23   Glycine soja [wild soybean]
ref|XP_010060013.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4   99.8    2e-22   Eucalyptus grandis [rose gum]
gb|ACU23635.1|  unknown                                               99.4    3e-22   Glycine max [soybeans]
emb|CDY54942.1|  BnaCnng27720D                                        98.6    6e-22   Brassica napus [oilseed rape]
ref|XP_008782161.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4   97.4    2e-21   Phoenix dactylifera
emb|CDX91762.1|  BnaC08g06810D                                        97.1    2e-21   
ref|NP_001240132.1|  uncharacterized protein LOC100796765 precursor   97.1    2e-21   Glycine max [soybeans]
gb|KFK23381.1|  hypothetical protein AALP_AAs59400U000300             95.9    6e-21   Arabis alpina [alpine rockcress]
ref|XP_008790885.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3   95.1    1e-20   Phoenix dactylifera
gb|KCW66535.1|  hypothetical protein EUGRSUZ_F00332                   95.1    1e-20   Eucalyptus grandis [rose gum]
emb|CDY41863.1|  BnaA08g06360D                                        95.1    1e-20   Brassica napus [oilseed rape]
ref|XP_009107920.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4   94.7    2e-20   Brassica rapa
gb|EYU36495.1|  hypothetical protein MIMGU_mgv1a0105141mg             92.4    7e-20   Erythranthe guttata [common monkey flower]
ref|XP_008444841.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4   92.8    8e-20   Cucumis melo [Oriental melon]
ref|XP_010937429.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3   92.4    9e-20   Elaeis guineensis
ref|XP_010939664.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3   92.0    2e-19   
ref|XP_010538940.1|  PREDICTED: 5'-adenylylsulfate reductase-like 4   91.7    2e-19   Tarenaya hassleriana [spider flower]
emb|CDY28407.1|  BnaA05g18330D                                        90.5    4e-19   Brassica napus [oilseed rape]
ref|XP_004152636.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  89.7    9e-19   Cucumis sativus [cucumbers]
ref|XP_009391309.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3   89.4    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS62898.1|  hypothetical protein M569_11894                       88.6    2e-18   Genlisea aurea
gb|KJB29321.1|  hypothetical protein B456_005G094200                  87.8    2e-18   Gossypium raimondii
ref|XP_008811170.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3   88.6    2e-18   Phoenix dactylifera
ref|XP_010421807.1|  PREDICTED: 5'-adenylylsulfate reductase-like 6   87.8    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006397245.1|  hypothetical protein EUTSA_v10028636mg           89.4    4e-18   
ref|XP_010436141.1|  PREDICTED: 5'-adenylylsulfate reductase-like 6   86.7    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002452534.1|  hypothetical protein SORBIDRAFT_04g027510        86.7    1e-17   Sorghum bicolor [broomcorn]
gb|KFK32103.1|  hypothetical protein AALP_AA6G199200                  85.9    2e-17   Arabis alpina [alpine rockcress]
ref|XP_006288344.1|  hypothetical protein CARUB_v10001592mg           85.9    2e-17   Capsella rubella
ref|XP_004953961.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  85.1    4e-17   
ref|XP_004953962.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  85.1    4e-17   
ref|XP_003570613.2|  PREDICTED: probable pectin methyltransferase...  87.8    4e-17   
gb|EAY87573.1|  hypothetical protein OsI_08985                        84.7    6e-17   Oryza sativa Indica Group [Indian rice]
ref|NP_001048159.1|  Os02g0754900                                     84.3    8e-17   
ref|XP_010455302.1|  PREDICTED: 5'-adenylylsulfate reductase-like 6   82.4    1e-16   Camelina sativa [gold-of-pleasure]
gb|KDO80980.1|  hypothetical protein CISIN_1g020846mg                 82.8    2e-16   Citrus sinensis [apfelsine]
ref|XP_010543933.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  83.2    2e-16   
ref|XP_009417587.1|  PREDICTED: 5'-adenylylsulfate reductase-like 3   84.0    3e-16   
ref|XP_002874503.1|  hypothetical protein ARALYDRAFT_911058           82.0    4e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010455301.1|  PREDICTED: 5'-adenylylsulfate reductase-like 6   82.0    4e-16   Camelina sativa [gold-of-pleasure]
gb|ACG42026.1|  APRL3 - Zea mays adenosine 5'-phosphosulfate redu...  82.4    4e-16   Zea mays [maize]
ref|NP_001105765.1|  adenosine 5'-phosphosulfate reductase-like3 ...  82.0    5e-16   Zea mays [maize]
ref|NP_001136871.1|  hypothetical protein precursor                   80.9    6e-16   
dbj|BAK05689.1|  predicted protein                                    81.3    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAE99715.1|  protein disulfide isomerase like protein             79.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117412.1|  5'-adenylylsulfate reductase-like 4              80.5    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647922.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-adenylyls...  80.1    2e-15   Oryza brachyantha
ref|NP_192632.2|  protein APR-like 6                                  79.7    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105802.1|  adenosine 5'-phosphosulfate reductase-like4 ...  79.3    4e-15   Zea mays [maize]
gb|AAD17368.1|  contains similarity to protein disulfide isomerases   79.3    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010916845.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-adenylyls...  75.5    2e-14   
ref|XP_006853185.1|  hypothetical protein AMTR_s00038p00202780        76.6    2e-14   Amborella trichopoda
ref|XP_007222968.1|  hypothetical protein PRUPE_ppa008937mg           75.9    5e-14   
ref|XP_010543943.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  74.7    1e-13   
ref|XP_003574474.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  74.3    2e-13   Brachypodium distachyon [annual false brome]
ref|XP_006660127.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  73.6    3e-13   Oryza brachyantha
gb|ABK24398.1|  unknown                                               73.9    4e-13   Picea sitchensis
ref|XP_001762516.1|  predicted protein                                72.8    4e-13   
gb|ACF81335.1|  unknown                                               71.6    8e-13   Zea mays [maize]
sp|Q5DJV7.1|APRL4_ORYSJ  RecName: Full=5'-adenylylsulfate reducta...  71.6    2e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83570.1|  hypothetical protein OsI_29227                        71.2    2e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001105766.1|  adenosine 5'-phosphosulfate reductase-like5 ...  71.2    2e-12   Zea mays [maize]
dbj|BAC99693.1|  disulfide isomerase-like protein                     71.6    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010235118.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  70.5    3e-12   Brachypodium distachyon [annual false brome]
ref|XP_004974687.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-adenylyls...  72.0    4e-12   
ref|NP_001175575.1|  Os08g0412401                                     68.9    7e-12   
ref|XP_002444324.1|  hypothetical protein SORBIDRAFT_07g020170        70.1    7e-12   Sorghum bicolor [broomcorn]
ref|XP_006656789.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  69.3    1e-11   Oryza brachyantha
gb|EEE68672.1|  hypothetical protein OsJ_27290                        68.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EMS61645.1|  putative pectin methyltransferase QUA2                67.8    2e-10   Triticum urartu
gb|KDO55016.1|  hypothetical protein CISIN_1g0462602mg                63.9    4e-10   Citrus sinensis [apfelsine]
ref|XP_003564162.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   65.1    5e-10   Brachypodium distachyon [annual false brome]
gb|KJB46049.1|  hypothetical protein B456_007G345900                  65.1    6e-10   Gossypium raimondii
ref|NP_001057172.1|  Os06g0220800                                     63.9    1e-09   
gb|EEC80244.1|  hypothetical protein OsI_22194                        63.9    1e-09   Oryza sativa Indica Group [Indian rice]
gb|KHG08455.1|  5'-adenylylsulfate reductase-like 4                   63.5    1e-09   Gossypium arboreum [tree cotton]
gb|ACF88355.1|  unknown                                               62.0    1e-09   Zea mays [maize]
gb|KFK37812.1|  hypothetical protein AALP_AA3G032500                  65.5    2e-09   Arabis alpina [alpine rockcress]
ref|XP_006479121.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  63.9    2e-09   Citrus sinensis [apfelsine]
ref|XP_002882315.1|  hypothetical protein ARALYDRAFT_477638           63.2    3e-09   
gb|KHG25607.1|  5'-adenylylsulfate reductase-like 7                   62.8    3e-09   Gossypium arboreum [tree cotton]
ref|XP_008644294.1|  PREDICTED: adenosine 5'-phosphosulfate reduc...  62.8    4e-09   Zea mays [maize]
ref|NP_001105807.1|  adenosine 5'-phosphosulfate reductase-like9 ...  62.8    4e-09   Zea mays [maize]
ref|XP_009408458.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   62.8    5e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG25608.1|  5'-adenylylsulfate reductase-like 5                   61.6    7e-09   Gossypium arboreum [tree cotton]
ref|XP_010054630.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  61.6    1e-08   Eucalyptus grandis [rose gum]
gb|KFK37822.1|  hypothetical protein AALP_AA3G033700                  61.6    1e-08   Arabis alpina [alpine rockcress]
ref|NP_001105767.1|  adenosine 5'-phosphosulfate reductase6 precu...  61.6    1e-08   Zea mays [maize]
emb|CBI29948.3|  unnamed protein product                              60.8    1e-08   Vitis vinifera
gb|ACG34292.1|  APRL6 - Zea mays adenosine 5'-phosphosulfate redu...  61.2    1e-08   Zea mays [maize]
ref|XP_002443304.1|  hypothetical protein SORBIDRAFT_08g017260        61.2    1e-08   Sorghum bicolor [broomcorn]
ref|XP_007151851.1|  hypothetical protein PHAVU_004G080800g           61.2    2e-08   Phaseolus vulgaris [French bean]
gb|AGV54233.1|  5'-adenylylsulfate reductase-like protein             61.2    2e-08   Phaseolus vulgaris [French bean]
ref|XP_002276765.2|  PREDICTED: 5'-adenylylsulfate reductase-like 5   60.8    2e-08   Vitis vinifera
ref|XP_011021471.1|  PREDICTED: 5'-adenylylsulfate reductase-like 7   60.8    2e-08   Populus euphratica
ref|XP_002325842.1|  hypothetical protein POPTR_0019s05130g           60.5    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009396929.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   60.5    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX92054.1|  BnaC03g33560D                                        60.5    3e-08   
ref|XP_010257654.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   60.5    3e-08   Nelumbo nucifera [Indian lotus]
ref|NP_566214.1|  5'-adenylylsulfate reductase-like 5                 60.5    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010549678.1|  PREDICTED: 5'-adenylylsulfate reductase-like 7   60.1    4e-08   
gb|EYU26001.1|  hypothetical protein MIMGU_mgv1a022783mg              59.7    4e-08   Erythranthe guttata [common monkey flower]
gb|AAF00632.1|AC009540_9  unknown protein                             60.1    4e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525419.1|  conserved hypothetical protein                   59.7    4e-08   Ricinus communis
ref|XP_009134747.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   60.1    4e-08   Brassica rapa
gb|KDP39694.1|  hypothetical protein JCGZ_02714                       59.7    5e-08   Jatropha curcas
ref|XP_010515215.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   59.7    5e-08   Camelina sativa [gold-of-pleasure]
gb|EMT06163.1|  hypothetical protein F775_28438                       59.3    5e-08   
ref|XP_010485745.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   59.7    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004962823.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  59.7    6e-08   Setaria italica
ref|XP_006408248.1|  hypothetical protein EUTSA_v10021238mg           59.7    6e-08   Eutrema salsugineum [saltwater cress]
ref|XP_004981363.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  59.7    6e-08   Setaria italica
ref|XP_004981362.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  59.7    6e-08   Setaria italica
ref|XP_002871802.1|  hypothetical protein ARALYDRAFT_909820           59.3    6e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_009795826.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   59.3    7e-08   Nicotiana sylvestris
emb|CDY29967.1|  BnaC01g40410D                                        59.3    8e-08   Brassica napus [oilseed rape]
ref|XP_010463851.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   59.3    8e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006443434.1|  hypothetical protein CICLE_v100214292mg          58.2    9e-08   
ref|XP_003554021.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  58.9    9e-08   Glycine max [soybeans]
gb|ACG47677.1|  APRL6 - Zea mays adenosine 5'-phosphosulfate redu...  58.5    1e-07   Zea mays [maize]
gb|EYU39267.1|  hypothetical protein MIMGU_mgv1a011190mg              58.2    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_010923362.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   58.2    2e-07   Elaeis guineensis
gb|AEK94318.1|  disulfide isomerase-related protein                   57.8    2e-07   Pyrus x bretschneideri [bai li]
ref|NP_001051635.1|  Os03g0806500                                     57.8    2e-07   
ref|XP_008391699.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   57.8    2e-07   Malus domestica [apple tree]
ref|XP_009102086.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   57.8    2e-07   Brassica rapa
ref|XP_009353126.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   57.8    2e-07   Pyrus x bretschneideri [bai li]
gb|ADE77738.1|  unknown                                               57.8    3e-07   Picea sitchensis
ref|XP_002466254.1|  hypothetical protein SORBIDRAFT_01g004420        57.4    3e-07   Sorghum bicolor [broomcorn]
ref|XP_010054638.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  56.6    3e-07   Eucalyptus grandis [rose gum]
ref|XP_006400356.1|  hypothetical protein EUTSA_v10014257mg           57.4    4e-07   Eutrema salsugineum [saltwater cress]
ref|XP_006400357.1|  hypothetical protein EUTSA_v10014257mg           57.0    4e-07   Eutrema salsugineum [saltwater cress]
ref|XP_008804329.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   57.4    4e-07   Phoenix dactylifera
emb|CDY21158.1|  BnaA01g33890D                                        57.0    4e-07   Brassica napus [oilseed rape]
ref|XP_008813732.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   57.0    5e-07   Phoenix dactylifera
gb|EMS52111.1|  5'-adenylylsulfate reductase-like 6                   56.2    5e-07   Triticum urartu
gb|ACG38706.1|  APRL5 - Zea mays adenosine 5'-phosphosulfate redu...  56.2    6e-07   Zea mays [maize]
ref|XP_008350130.1|  PREDICTED: LOW QUALITY PROTEIN: 5'-adenylyls...  56.6    6e-07   
ref|NP_001105768.1|  adenosine 5'-phosphosulfate reductase-like8 ...  56.6    7e-07   Zea mays [maize]
ref|NP_001281246.1|  APRL5 - Zea mays adenosine 5'-phosphosulfate...  56.2    7e-07   
ref|XP_009130392.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   56.2    7e-07   Brassica rapa
tpg|DAA55323.1|  TPA: hypothetical protein ZEAMMB73_501257            54.3    9e-07   
emb|CDY50856.1|  BnaA05g37170D                                        56.2    1e-06   Brassica napus [oilseed rape]
gb|ACF82441.1|  unknown                                               53.9    1e-06   Zea mays [maize]
ref|XP_009620886.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   55.8    1e-06   Nicotiana tomentosiformis
ref|XP_010237189.1|  PREDICTED: 5'-adenylylsulfate reductase-like 6   55.8    1e-06   Brachypodium distachyon [annual false brome]
ref|XP_009366461.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   55.5    1e-06   Pyrus x bretschneideri [bai li]
gb|EYU31671.1|  hypothetical protein MIMGU_mgv1a010641mg              55.5    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_011089720.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  55.5    2e-06   Sesamum indicum [beniseed]
gb|KJB44623.1|  hypothetical protein B456_007G261900                  55.5    2e-06   Gossypium raimondii
ref|XP_006296718.1|  hypothetical protein CARUB_v10014268mg           55.5    2e-06   Capsella rubella
ref|XP_010524982.1|  PREDICTED: 5'-adenylylsulfate reductase-like 7   55.5    2e-06   Tarenaya hassleriana [spider flower]
emb|CDY25457.1|  BnaC09g39720D                                        55.1    2e-06   Brassica napus [oilseed rape]
ref|XP_011089719.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  55.1    2e-06   Sesamum indicum [beniseed]
ref|XP_003548940.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  53.5    2e-06   Glycine max [soybeans]
gb|AAM60945.1|  contains similarity to protein disulfide isomeras...  54.7    3e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDY64906.1|  BnaC05g47730D                                        54.7    3e-06   Brassica napus [oilseed rape]
ref|NP_568360.1|  5'-adenylylsulfate reductase-like 7                 54.7    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007202392.1|  hypothetical protein PRUPE_ppa009402mg           54.3    3e-06   Prunus persica
dbj|BAB09470.1|  unnamed protein product                              54.7    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002319158.2|  hypothetical protein POPTR_0013s05370g           53.9    3e-06   
ref|XP_007202391.1|  hypothetical protein PRUPE_ppa009402mg           54.3    3e-06   
ref|NP_001105806.1|  adenosine 5'-phosphosulfate reductase-like7 ...  54.3    4e-06   Zea mays [maize]
ref|XP_003548734.2|  PREDICTED: 5'-adenylylsulfate reductase-like...  54.3    4e-06   Glycine max [soybeans]
ref|XP_008673453.1|  PREDICTED: adenosine 5'-phosphosulfate reduc...  54.3    4e-06   Zea mays [maize]
ref|XP_011457634.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   53.5    4e-06   Fragaria vesca subsp. vesca
ref|XP_006354125.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  53.5    6e-06   Solanum tuberosum [potatoes]
ref|XP_008240528.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   53.5    7e-06   Prunus mume [ume]
ref|XP_010420552.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  53.5    7e-06   
ref|XP_010420551.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  53.5    8e-06   Camelina sativa [gold-of-pleasure]
ref|XP_007161953.1|  hypothetical protein PHAVU_001G1116001g          52.8    8e-06   Phaseolus vulgaris [French bean]
gb|KJB26618.1|  hypothetical protein B456_004G250500                  53.5    8e-06   Gossypium raimondii
ref|XP_010558723.1|  PREDICTED: 5'-adenylylsulfate reductase-like 7   53.1    8e-06   
ref|XP_004228686.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   53.1    9e-06   Solanum lycopersicum
ref|XP_010934707.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   53.1    9e-06   Elaeis guineensis
ref|XP_010454034.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  52.8    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_004489697.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  52.8    1e-05   Cicer arietinum [garbanzo]
ref|XP_009624667.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   52.8    1e-05   Nicotiana tomentosiformis
gb|KCW47755.1|  hypothetical protein EUGRSUZ_K01503                   52.4    1e-05   Eucalyptus grandis [rose gum]
ref|XP_010454033.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  52.8    1e-05   Camelina sativa [gold-of-pleasure]
gb|EEC69443.1|  hypothetical protein OsI_38622                        51.6    2e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_009413322.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   52.4    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420649.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   52.4    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP14309.1|  unnamed protein product                              52.0    2e-05   Coffea canephora [robusta coffee]
ref|XP_010036228.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   52.0    2e-05   Eucalyptus grandis [rose gum]
emb|CBI19166.3|  unnamed protein product                              49.7    2e-05   Vitis vinifera
emb|CDX70796.1|  BnaC03g08800D                                        51.6    3e-05   
sp|Q2QP53.1|APRL6_ORYSJ  RecName: Full=5'-adenylylsulfate reducta...  51.6    3e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009417154.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  51.2    4e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010097394.1|  5'-adenylylsulfate reductase-like 5              51.2    5e-05   
ref|XP_009797663.1|  PREDICTED: 5'-adenylylsulfate reductase-like 5   50.8    5e-05   Nicotiana sylvestris
ref|XP_008664336.1|  PREDICTED: uncharacterized protein LOC103642962  51.6    6e-05   
ref|XP_007030092.1|  APR-like 5, putative                             50.4    7e-05   
ref|XP_006664614.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  50.1    9e-05   Oryza brachyantha
ref|XP_009131639.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  49.7    1e-04   Brassica rapa
ref|XP_006288371.1|  hypothetical protein CARUB_v10001621mg           50.1    1e-04   Capsella rubella
ref|XP_009131638.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  49.7    1e-04   Brassica rapa
gb|KHN00681.1|  5'-adenylylsulfate reductase-like 5                   49.7    1e-04   Glycine soja [wild soybean]
emb|CDP14310.1|  unnamed protein product                              49.7    1e-04   Coffea canephora [robusta coffee]
ref|XP_010492807.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  49.7    2e-04   
ref|XP_010492806.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  49.3    2e-04   
emb|CDX78778.1|  BnaA03g06900D                                        49.3    2e-04   
ref|NP_001242527.1|  uncharacterized protein LOC100813728 precursor   48.9    2e-04   
gb|AES75170.2|  5-adenylylsulfate reductase-like protein              49.3    2e-04   Medicago truncatula
ref|XP_009417155.1|  PREDICTED: 5'-adenylylsulfate reductase-like...  48.1    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003618952.1|  Thioredoxin domain-containing protein            48.5    4e-04   



>ref|XP_004300651.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 85/123 (69%), Gaps = 7/123 (6%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEI-KSSCS  217
            +R W  G+ +L+I GRLT A   T+      C   SA + IF   DS C+I+ + +S  S
Sbjct  3    IRVWGFGILILLIWGRLTSAVEPTS------CPTKSAAEAIFGFRDSVCAINGVTRSVGS  56

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              VI GDE SLQRAL++VH+ SH+YVA+LFYASWCPFSR FKP FSV++SL P +PHFA 
Sbjct  57   NGVIVGDEVSLQRALNLVHKNSHEYVAVLFYASWCPFSRMFKPTFSVLASLYPSIPHFAF  116

Query  398  EES  406
            EES
Sbjct  117  EES  119



>ref|XP_006364863.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like [Solanum 
tuberosum]
Length=323

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 86/127 (68%), Gaps = 3/127 (2%)
 Frame = +2

Query  32   MARLREWRAG-MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIF-ALPDSTCSIDEIK  205
            M  L  + AG + LLM+   +    T+     ++C  K S KD +F    D TC +D I+
Sbjct  1    MGLLSAFAAGFVVLLMVFEGMASPETVNVSVRSVCPLK-SVKDSVFMGFQDLTCPLDGIQ  59

Query  206  SSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  385
            SS    VI+GDE SLQRAL+++HR +HDYVALLFYASWCPFSR F+P FS++SSL P +P
Sbjct  60   SSYVAEVIQGDELSLQRALNMIHRNTHDYVALLFYASWCPFSRSFRPKFSIMSSLYPSIP  119

Query  386  HFAIEES  406
            HFAIEES
Sbjct  120  HFAIEES  126



>ref|XP_009613129.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Nicotiana tomentosiformis]
Length=324

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = +2

Query  32   MARLREWRAGMALLMIV-GRLTCAHTLTAPFPALCCSKYSAKDWIFA--LPDSTCSIDEI  202
            M  L  W AG  +LM+    L    T T  F ++C  K S KD IF     D TC +D I
Sbjct  1    MGLLSVWAAGFVVLMMAFDGLASPETSTMSFRSVCPLK-SLKDSIFMGFHQDLTCPLDGI  59

Query  203  KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  382
            +SS    VI+GDE SLQRAL+++HR +HDYVALLFYASWCPFS  F+P FSV+SSL P +
Sbjct  60   QSSHMAGVIQGDELSLQRALNMIHRNTHDYVALLFYASWCPFSGSFRPKFSVLSSLFPSI  119

Query  383  PHFAIEES  406
            PHFAIEES
Sbjct  120  PHFAIEES  127



>ref|XP_004237917.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Solanum lycopersicum]
Length=323

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 84/127 (66%), Gaps = 3/127 (2%)
 Frame = +2

Query  32   MARLREWRAG-MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIF-ALPDSTCSIDEIK  205
            M  L  + AG + +LM+   +    T      ++C  K S KD IF    D TC +D I+
Sbjct  1    MGLLSAFAAGFVVILMVFEGMASPETANVSVRSVCPLK-SVKDSIFMGFQDLTCPLDGIQ  59

Query  206  SSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  385
            SS    VI+GDE SLQRAL ++HR +HDYVALLFYASWCPFSR F+P FS++SSL P +P
Sbjct  60   SSYVAEVIQGDELSLQRALSMIHRNTHDYVALLFYASWCPFSRSFRPKFSIMSSLYPSIP  119

Query  386  HFAIEES  406
            HFAIEES
Sbjct  120  HFAIEES  126



>emb|CDP01065.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 81/127 (64%), Gaps = 2/127 (2%)
 Frame = +2

Query  32   MARLREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPD--STCSIDEIK  205
            MA  +   AG+ LL + GR+T + T+  P  +  C   S KD I    D    C +D I+
Sbjct  1    MAIFKVLGAGLTLLFLFGRVTASDTIRVPSASSFCPLISIKDSILGSQDHADACPVDGIE  60

Query  206  SSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  385
                T VIEGDE SLQRAL+++H   HDYV LLFYASWCPFS  F+P FS+++SL P +P
Sbjct  61   PLHITGVIEGDEASLQRALNMIHGNKHDYVILLFYASWCPFSGTFRPTFSILASLFPSLP  120

Query  386  HFAIEES  406
            HFAIEES
Sbjct  121  HFAIEES  127



>gb|KDO80979.1| hypothetical protein CISIN_1g020846mg [Citrus sinensis]
Length=320

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 80/122 (66%), Gaps = 3/122 (2%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCST  220
            LR W  G+ +L++ GRLTCA  +   FP   C   S  D IF   DS C I         
Sbjct  3    LRFWETGILMLVLWGRLTCA-VVAVRFP--LCPTESVTDSIFRFQDSFCPISCNDFQDIV  59

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
             VIEGDE SLQ AL++VH+ SH+YVA+LFYASWCPFSR F+P FSV+SSL   +PHFAIE
Sbjct  60   GVIEGDEVSLQMALNMVHKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIE  119

Query  401  ES  406
            ES
Sbjct  120  ES  121



>gb|KDO80978.1| hypothetical protein CISIN_1g020846mg [Citrus sinensis]
Length=316

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 80/122 (66%), Gaps = 3/122 (2%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCST  220
            LR W  G+ +L++ GRLTCA  +   FP   C   S  D IF   DS C I         
Sbjct  3    LRFWETGILMLVLWGRLTCA-VVAVRFP--LCPTESVTDSIFRFQDSFCPISCNDFQDIV  59

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
             VIEGDE SLQ AL++VH+ SH+YVA+LFYASWCPFSR F+P FSV+SSL   +PHFAIE
Sbjct  60   GVIEGDEVSLQMALNMVHKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIE  119

Query  401  ES  406
            ES
Sbjct  120  ES  121



>ref|XP_006472592.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like [Citrus sinensis]
Length=320

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 80/122 (66%), Gaps = 3/122 (2%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCST  220
            LR W  G+ +L++ GRLTCA  +   FP   C   S  D IF   DS C I         
Sbjct  3    LRFWETGILMLVLWGRLTCA-VVAVRFP--LCPTESVTDSIFRFQDSFCPISCNDFQDIV  59

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
             VIEGDE SLQ AL++VH+ SH+YVA+LFYASWCPFSR F+P FSV+SSL   +PHFAIE
Sbjct  60   GVIEGDEVSLQMALNMVHKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIE  119

Query  401  ES  406
            ES
Sbjct  120  ES  121



>ref|XP_007018757.1| APR-like 4 isoform 1 [Theobroma cacao]
 gb|EOY15982.1| APR-like 4 isoform 1 [Theobroma cacao]
Length=320

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 84/123 (68%), Gaps = 4/123 (3%)
 Frame = +2

Query  44   REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID-EIKSSCS-  217
            + W+ G+ +L++ GRL CA  ++ P     C K+S  D IF   DS C I+ E   S   
Sbjct  4    KAWQTGILMLVLWGRLACA--VSVPVRVPLCPKHSVSDTIFDFRDSYCPINSEFSESVDF  61

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              V EGDE SLQ+AL++VH+ S +YVA+LFYASWCPFSR F+P FS++SSL P +PHFAI
Sbjct  62   VGVTEGDEVSLQKALNMVHKNSREYVAVLFYASWCPFSRSFRPSFSILSSLYPSIPHFAI  121

Query  398  EES  406
            +ES
Sbjct  122  KES  124



>ref|XP_007018758.1| APR-like 4 isoform 2 [Theobroma cacao]
 gb|EOY15983.1| APR-like 4 isoform 2 [Theobroma cacao]
Length=350

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 84/123 (68%), Gaps = 4/123 (3%)
 Frame = +2

Query  44   REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID-EIKSSCS-  217
            + W+ G+ +L++ GRL CA  ++ P     C K+S  D IF   DS C I+ E   S   
Sbjct  4    KAWQTGILMLVLWGRLACA--VSVPVRVPLCPKHSVSDTIFDFRDSYCPINSEFSESVDF  61

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              V EGDE SLQ+AL++VH+ S +YVA+LFYASWCPFSR F+P FS++SSL P +PHFAI
Sbjct  62   VGVTEGDEVSLQKALNMVHKNSREYVAVLFYASWCPFSRSFRPSFSILSSLYPSIPHFAI  121

Query  398  EES  406
            +ES
Sbjct  122  KES  124



>ref|XP_002285788.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Vitis vinifera]
Length=321

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 81/120 (68%), Gaps = 2/120 (2%)
 Frame = +2

Query  50   WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS-TAV  226
            W  G+ LL++ GRLTCA  +      +C ++ S  D I    DS C+++E   S     V
Sbjct  6    WETGIVLLLVFGRLTCAEPVRVSLSPVCPTE-SVADSISGFRDSHCTVNEGDGSLDFVGV  64

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
             EGDE SLQ+ALD+VH+ +H+YVA+LFYASWC FSR  +P FS++SSL P +PHFAIEES
Sbjct  65   TEGDEVSLQKALDMVHKNTHEYVAVLFYASWCAFSRTCRPTFSILSSLYPSMPHFAIEES  124



>ref|XP_009778518.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X2 [Nicotiana 
sylvestris]
Length=299

 Score =   123 bits (308),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = +2

Query  32   MARLREWRAG-MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFA--LPDSTCSIDEI  202
            M  L  W A  + LLM+   L    T T  F ++C  K S KD IF     D TC +D I
Sbjct  1    MGLLSVWAAVFVVLLMVFEGLASPETRTMSFRSVCPLK-SIKDSIFMGFHQDLTCPLDGI  59

Query  203  KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  382
            +SS    VI+GDE +L RAL+++HR +HDYVALLFYASWCPFS  F+P FSV+SSL P +
Sbjct  60   QSSYMAGVIQGDELALHRALNLIHRNTHDYVALLFYASWCPFSGSFRPKFSVLSSLFPSI  119

Query  383  PHFAIEES  406
            PHFAIEES
Sbjct  120  PHFAIEES  127



>ref|XP_011016531.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Populus euphratica]
Length=333

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 81/131 (62%), Gaps = 12/131 (9%)
 Frame = +2

Query  32   MARLREWRAGMAL-LMIVGRLTCA----HTLTAPFPALCCSKYSAKDWIFALPDSTCSID  196
            M + R WR  + L +MI G L CA    HT++       C   S KDWIF   D  C + 
Sbjct  10   MMQTRVWRPRILLWMMIYGSLLCATADSHTVS------ICPIESVKDWIFGFRDQNCVVS  63

Query  197  EIKSS-CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLL  373
                S C   V EGDE SLQ+AL +V + SH+YVALLFYASWCPFS  F+P FS++SSL 
Sbjct  64   GANESPCFAGVTEGDEISLQKALSLVQKNSHEYVALLFYASWCPFSGTFRPSFSILSSLY  123

Query  374  PWVPHFAIEES  406
            P +PHFAIEES
Sbjct  124  PVIPHFAIEES  134



>ref|XP_009778517.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X1 [Nicotiana 
sylvestris]
Length=324

 Score =   123 bits (308),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 84/128 (66%), Gaps = 4/128 (3%)
 Frame = +2

Query  32   MARLREWRAG-MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFA--LPDSTCSIDEI  202
            M  L  W A  + LLM+   L    T T  F ++C  K S KD IF     D TC +D I
Sbjct  1    MGLLSVWAAVFVVLLMVFEGLASPETRTMSFRSVCPLK-SIKDSIFMGFHQDLTCPLDGI  59

Query  203  KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  382
            +SS    VI+GDE +L RAL+++HR +HDYVALLFYASWCPFS  F+P FSV+SSL P +
Sbjct  60   QSSYMAGVIQGDELALHRALNLIHRNTHDYVALLFYASWCPFSGSFRPKFSVLSSLFPSI  119

Query  383  PHFAIEES  406
            PHFAIEES
Sbjct  120  PHFAIEES  127



>gb|ACU17922.1| unknown [Glycine max]
Length=129

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 84/129 (65%), Gaps = 8/129 (6%)
 Frame = +2

Query  38   RLREWRAGMAL-LMIVGRLTCA-----HTLTAPFPALCCSKYSAKDWIFALPDSTCSIDE  199
            R+R W   +   + + G L+C      + ++       C   S  D++   PDSTC +  
Sbjct  2    RMRIWVLEIVFAIFLCGTLSCTAQPHHNRVSLSTTTSICPAGSLLDFVLGFPDSTCPL--  59

Query  200  IKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPW  379
            + S  S AVIEGDE SLQ+AL++VH+ +H+YVA+LFYASWCPFSR FKPIFSV+SSL P 
Sbjct  60   LNSLGSIAVIEGDEVSLQKALNMVHKNNHEYVAVLFYASWCPFSRVFKPIFSVLSSLHPS  119

Query  380  VPHFAIEES  406
            +PHFAI ES
Sbjct  120  IPHFAIGES  128



>ref|XP_006433972.1| hypothetical protein CICLE_v10001862mg [Citrus clementina]
 gb|ESR47212.1| hypothetical protein CICLE_v10001862mg [Citrus clementina]
Length=320

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 79/122 (65%), Gaps = 3/122 (2%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCST  220
            LR W  G+ +L++ GRLTCA  +   FP   C   S  D IF   DS C I         
Sbjct  3    LRFWETGILMLVLWGRLTCA-VVAVRFP--LCPTESVTDSIFRFQDSFCPISCNDFQDIV  59

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
             VIEGDE SLQ AL++V + SH+YVA+LFYASWCPFSR F+P FSV+SSL   +PHFAIE
Sbjct  60   GVIEGDEVSLQMALNMVQKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIE  119

Query  401  ES  406
            ES
Sbjct  120  ES  121



>ref|XP_011074264.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Sesamum indicum]
Length=306

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 77/105 (73%), Gaps = 3/105 (3%)
 Frame = +2

Query  92   TCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVV  271
            TCA+T+  P   L C   S KD+IFA  D  CS+ E + + +T V EG+E +LQ+AL+++
Sbjct  19   TCAYTVRVP---LVCPVNSVKDFIFASQDDMCSLGEAEFAYTTGVTEGNEITLQKALNII  75

Query  272  HRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            H+  H YVALLFY+SWCPFS  F+P FS++SS+ P+VPHFAIEES
Sbjct  76   HKNEHAYVALLFYSSWCPFSGPFRPSFSMLSSIFPYVPHFAIEES  120



>ref|XP_009334346.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Pyrus x bretschneideri]
Length=313

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEI-KSSCS  217
            +R W +G+ +L++  RL CA       PA C ++ S  D IF    S C +D   +S  S
Sbjct  3    IRVWESGIVILVLWVRLVCAAE-----PASCPTE-SVADRIFGFRYSNCPVDGACRSVES  56

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57   MGVIVGDEVSLQRALNMVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  398  EES  406
            EES
Sbjct  117  EES  119



>ref|XP_009334329.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Pyrus x bretschneideri]
Length=313

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEI-KSSCS  217
            +R W +G+ +L++  RL CA       PA C ++ S  D IF    S C +D   +S  S
Sbjct  3    IRVWESGIVILVLWVRLVCAAE-----PASCPTE-SVADRIFGFRYSNCPVDGACRSVES  56

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57   MGVIVGDEVSLQRALNMVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  398  EES  406
            EES
Sbjct  117  EES  119



>ref|XP_008383930.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Malus domestica]
Length=313

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEI-KSSCS  217
            +R W +G+ +L++  RL CA       PA C ++ S  D IF    S C +D   +S  S
Sbjct  3    IRVWESGIVILVLWVRLVCAAE-----PASCPTE-SVADTIFGFRYSNCPVDGACRSVES  56

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57   MGVIVGDEVSLQRALNMVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  398  EES  406
            EES
Sbjct  117  EES  119



>ref|XP_002302300.2| thioredoxin-related family protein [Populus trichocarpa]
 gb|EEE81573.2| thioredoxin-related family protein [Populus trichocarpa]
Length=334

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 77/127 (61%), Gaps = 3/127 (2%)
 Frame = +2

Query  32   MARLREWRAGMAL-LMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKS  208
            M + R WR  + L +MI G L CA T         C   S  DWIF   D  C +     
Sbjct  10   MMQTRVWRPRILLSMMIYGSLMCA-TAADSHTVSICPIESVTDWIFGFRDQNCVVSGANE  68

Query  209  S-CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  385
            S C   V EGDE SLQ+AL +V + SH+YVALLFYASWCPFS  F+P FS++SSL P +P
Sbjct  69   SPCFAGVTEGDEISLQKALSLVQKNSHEYVALLFYASWCPFSGTFRPSFSILSSLYPVIP  128

Query  386  HFAIEES  406
            HFAIEES
Sbjct  129  HFAIEES  135



>gb|KHN03900.1| 5'-adenylylsulfate reductase-like 4 [Glycine soja]
Length=321

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  313
            C   S  D++   PDSTC +  + S  S AVIEGDE SLQ+AL++VH+ +H+YVA+LFYA
Sbjct  40   CHAGSLLDFVLGFPDSTCPL--LNSLGSIAVIEGDEVSLQKALNMVHKNNHEYVAVLFYA  97

Query  314  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            SWCPFSR FKPIFSV+SSL P +PHFAIEES
Sbjct  98   SWCPFSRVFKPIFSVLSSLHPSIPHFAIEES  128



>ref|XP_008372920.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Malus domestica]
Length=313

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 80/123 (65%), Gaps = 7/123 (6%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSC-S  217
            +R W +G+ +L++  RL  A   T+      C   SA D IF    S C ++    S  S
Sbjct  3    IRVWESGIVILVLWVRLISAAEPTS------CPAESAADAIFGFRYSNCPVNGASRSVES  56

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57   MGVIVGDEVSLQRALNIVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  398  EES  406
            EES
Sbjct  117  EES  119



>ref|XP_006581537.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like [Glycine 
max]
Length=321

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  313
            C   S  D++   PDSTC +  + S  S AVIEGDE SLQ+AL++VH+ +H+YVA+LFYA
Sbjct  40   CPAGSLLDFVLGFPDSTCPL--LNSLGSIAVIEGDEVSLQKALNMVHKNNHEYVAVLFYA  97

Query  314  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            SWCPFSR FKPIFSV+SSL P +PHFAIEES
Sbjct  98   SWCPFSRVFKPIFSVLSSLHPSIPHFAIEES  128



>ref|XP_008343322.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Malus domestica]
Length=313

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 80/123 (65%), Gaps = 7/123 (6%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSC-S  217
            +R W +G+ +L++  RL  A   T+      C   SA D IF    S C ++    S  S
Sbjct  3    IRVWESGIVILVLWVRLISAAEPTS------CPAESAADAIFGFRYSNCPVNGASRSVES  56

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57   MGVIVGDEVSLQRALNIVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  398  EES  406
            EES
Sbjct  117  EES  119



>ref|XP_009372786.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Pyrus x bretschneideri]
Length=313

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 80/123 (65%), Gaps = 7/123 (6%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSC-S  217
            +R W +G+ +L++  RL  A   T+      C   SA D IF    S C ++    S  S
Sbjct  3    IRVWESGIVILVLWVRLISAAEPTS------CPAESAADAIFGFRYSNCPVNGASRSVES  56

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              VI GDE SLQRAL++VH+ +HDYVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57   MGVIVGDEVSLQRALNMVHKNTHDYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  398  EES  406
            EES
Sbjct  117  EES  119



>gb|KJB29323.1| hypothetical protein B456_005G094200 [Gossypium raimondii]
Length=199

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 80/121 (66%), Gaps = 4/121 (3%)
 Frame = +2

Query  50   WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTA  223
            W   + +L +  RLTCA  +T P  A  C K S  + +F   DS CSI  D I+S  S  
Sbjct  6    WEMRILILFLWWRLTCA--VTVPVRAPLCPKNSVFEAVFDFRDSFCSIHSDFIESIDSVG  63

Query  224  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  403
            V EGDE SLQ+AL++VHR  H+YVA+LFYASWCPFSR F+P F  +SS  P +PHFAI+E
Sbjct  64   VTEGDEISLQKALNMVHRNIHEYVAVLFYASWCPFSRSFRPSFLTLSSSYPSIPHFAIKE  123

Query  404  S  406
            S
Sbjct  124  S  124



>gb|KJB29322.1| hypothetical protein B456_005G094200 [Gossypium raimondii]
Length=266

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 80/121 (66%), Gaps = 4/121 (3%)
 Frame = +2

Query  50   WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTA  223
            W   + +L +  RLTCA  +T P  A  C K S  + +F   DS CSI  D I+S  S  
Sbjct  6    WEMRILILFLWWRLTCA--VTVPVRAPLCPKNSVFEAVFDFRDSFCSIHSDFIESIDSVG  63

Query  224  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  403
            V EGDE SLQ+AL++VHR  H+YVA+LFYASWCPFSR F+P F  +SS  P +PHFAI+E
Sbjct  64   VTEGDEISLQKALNMVHRNIHEYVAVLFYASWCPFSRSFRPSFLTLSSSYPSIPHFAIKE  123

Query  404  S  406
            S
Sbjct  124  S  124



>gb|KEH34942.1| 5-adenylylsulfate reductase-like protein [Medicago truncatula]
Length=312

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 80/123 (65%), Gaps = 5/123 (4%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI-DEIKSSCS  217
            +R WR+ +   +++    C  T  +      C K S  D++    DS CS+ D + S   
Sbjct  1    MRLWRSEIVFAILL----CCGTAQSLSTTAVCPKESLSDFVLGFSDSICSLSDSLGSIHY  56

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              V +GDE SLQ+AL++VH+  H+YVA+LFYASWCPFSR F+P+FSV+SSL P +PHFAI
Sbjct  57   VGVTQGDEASLQKALNMVHKNYHEYVAVLFYASWCPFSRIFRPVFSVISSLHPTIPHFAI  116

Query  398  EES  406
            EES
Sbjct  117  EES  119



>gb|KHN19767.1| 5'-adenylylsulfate reductase-like 4 [Glycine soja]
Length=322

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 87/131 (66%), Gaps = 11/131 (8%)
 Frame = +2

Query  38   RLREWRAGMAL-LMIVGRLTCAH-------TLTAPFPALCCSKYSAKDWIFALPDSTCSI  193
            R+R W + +   L++ G L+C         +L+     +C ++ S  D+I   PDSTC +
Sbjct  2    RMRVWGSEIVFALLLCGTLSCTAQAIHNRVSLSTTTTTICPAR-SLLDFILGFPDSTCPL  60

Query  194  DEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLL  373
                S  S AV EGDE SLQ+AL++VH+ +H+YVA+LFYASWCPFSR F+ +FSV+S+L 
Sbjct  61   P--NSLGSIAVTEGDEVSLQKALNMVHKNNHEYVAVLFYASWCPFSRVFRSVFSVLSALH  118

Query  374  PWVPHFAIEES  406
            P +PHFAIEES
Sbjct  119  PSIPHFAIEES  129



>ref|XP_010089873.1| 5'-adenylylsulfate reductase-like 4 [Morus notabilis]
 gb|EXB38514.1| 5'-adenylylsulfate reductase-like 4 [Morus notabilis]
Length=1609

 Score =   119 bits (298),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 61/123 (50%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = +2

Query  41    LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI-DEIKSSCS  217
             +R W +G+  L++   L      +A  P +C S +S    IF  P+  CS+  + +S   
Sbjct  1298  VRVWISGIFTLLLWQSLN-----SAAEPNIC-SPHSLIYSIFGFPEGICSLYGDSRSFAF  1351

Query  218   TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
               VIEGDE SLQRAL++VH+ S+DYVA+LFYASWCPFSR F+P FS++SSL P +PHFAI
Sbjct  1352  NGVIEGDEVSLQRALNMVHKNSYDYVAVLFYASWCPFSRTFRPTFSILSSLYPSIPHFAI  1411

Query  398   EES  406
             +ES
Sbjct  1412  QES  1414



>ref|XP_007136256.1| hypothetical protein PHAVU_009G031500g [Phaseolus vulgaris]
 gb|ESW08250.1| hypothetical protein PHAVU_009G031500g [Phaseolus vulgaris]
Length=323

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  313
            C  +S  D++   PDS C + +  S  S AV EGDE SLQ+AL++VH+ +H+YVA+LFYA
Sbjct  43   CPVHSLLDFVLGFPDSICPLPD--SLGSVAVTEGDEVSLQKALNMVHKNNHEYVAVLFYA  100

Query  314  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            SWCPFSR F+P+FSV+S+L P +PHFAIEES
Sbjct  101  SWCPFSRVFRPVFSVLSALHPSIPHFAIEES  131



>ref|XP_008219447.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Prunus mume]
Length=313

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 7/123 (6%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDE-IKSSCS  217
            +R W+ G+ +L++  RL  A   T+      C   S  D IF    S+C  +   +S  S
Sbjct  3    IRVWQTGIVILVLWVRLISAAEPTS------CPTESVTDAIFGFRYSSCPANGGARSVDS  56

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              VI GDE SLQRAL++VH+ +H+YVA+LFYASWCPFSR FKP FS+++SL P +PHFA 
Sbjct  57   IGVIVGDEVSLQRALNMVHKNTHEYVAVLFYASWCPFSRMFKPTFSILASLYPSIPHFAF  116

Query  398  EES  406
            EES
Sbjct  117  EES  119



>ref|XP_010676416.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Beta vulgaris 
subsp. vulgaris]
Length=316

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +2

Query  62   MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDE  241
            + LL++ G +    +     P  C +  S  D I   PDS C   ++  S S AVIEGDE
Sbjct  8    LVLLVVFGEIISGDSARVSEPGYCPAA-SMTDSILGFPDSVC---DLHHSYSIAVIEGDE  63

Query  242  KSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
             SLQ+AL +V+  S DYVA+LFYASWCPFSR F+P FS +SSL P +PHFAIEES
Sbjct  64   ASLQKALHLVYSLSQDYVAVLFYASWCPFSRNFRPSFSTLSSLYPSIPHFAIEES  118



>ref|XP_003522795.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like [Glycine 
max]
Length=324

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 83/132 (63%), Gaps = 11/132 (8%)
 Frame = +2

Query  38   RLREWRAGMAL-LMIVGRLTCAHTLTAPFPAL--------CCSKYSAKDWIFALPDSTCS  190
            R+R W + +   L++ G L+C         +L         C   S  D+I   PDSTC 
Sbjct  2    RMRVWGSEIVFALLLCGTLSCTAQAIHNRVSLSTTTTTTTICPARSLLDFILGFPDSTCP  61

Query  191  IDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSL  370
            +    S  S AV EGDE SLQ+AL++VH+ +H+YVA+LFYASWCPFSR F+ +FSV+S+L
Sbjct  62   LP--NSLGSIAVTEGDEVSLQKALNMVHKNNHEYVAVLFYASWCPFSRVFRSVFSVLSAL  119

Query  371  LPWVPHFAIEES  406
             P +PHFAIEES
Sbjct  120  HPSIPHFAIEES  131



>gb|KJB14728.1| hypothetical protein B456_002G140600 [Gossypium raimondii]
Length=319

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 77/123 (63%), Gaps = 4/123 (3%)
 Frame = +2

Query  44   REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID--EIKSSCS  217
            + W+  M +L+   RLTCA  +  P     C K S  D IF   DS C I     +S   
Sbjct  4    KAWQTRMLILVFWWRLTCA--VFVPLRVPLCPKVSVSDAIFDFRDSYCPITSARTQSIVF  61

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              VIEGDE S+Q+AL++V+R  H YVA+LFYASWCPFSR F+  F+++SS  P +PHFAI
Sbjct  62   VGVIEGDEVSMQKALNMVYRNGHGYVAVLFYASWCPFSRSFRRSFNILSSSYPCIPHFAI  121

Query  398  EES  406
            EES
Sbjct  122  EES  124



>ref|XP_007222969.1| hypothetical protein PRUPE_ppa008937mg [Prunus persica]
 gb|EMJ24168.1| hypothetical protein PRUPE_ppa008937mg [Prunus persica]
Length=313

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 79/123 (64%), Gaps = 7/123 (6%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDE-IKSSCS  217
            +R W+ G+ +L++  RL  A   T+      C   S  D IF    S+C  +   +S  S
Sbjct  3    IRVWQTGIVILLLWVRLISAAEPTS------CPTESVSDAIFGFRYSSCPANGGARSVDS  56

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              VI GDE SLQRAL++VH+ +H+YVA+LFYASWCPFSR FKP FS+++S  P +PHFA 
Sbjct  57   IGVIVGDEVSLQRALNMVHKNTHEYVAVLFYASWCPFSRMFKPTFSILASSYPSIPHFAF  116

Query  398  EES  406
            EES
Sbjct  117  EES  119



>ref|NP_564452.1| 5'-adenylylsulfate reductase-like 4 [Arabidopsis thaliana]
 sp|Q9SA00.1|APRL4_ARATH RecName: Full=5'-adenylylsulfate reductase-like 4; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 4; Short=APR-like 
4; Short=AtAPRL4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD46003.1|AC007894_1 Contains similarity to gi|729436 protein disulfide isomerase-related 
protein precursor from Rattus norvegicus [Arabidopsis 
thaliana]
 gb|AAL24358.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13357.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31738.1| 5'-adenylylsulfate reductase-like 4 [Arabidopsis thaliana]
Length=310

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 3/94 (3%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVHRRSHDYVALL  304
            C+  SAKD IF L D TCS+  ++S       AV EGDE+ LQ ALD++H+   DYVALL
Sbjct  28   CATKSAKDSIFGLRDQTCSVSGVESDERPRFVAVTEGDERWLQIALDMIHKNKCDYVALL  87

Query  305  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            FYASWCPFSR F+P F V+SSL   +PHFAI+ES
Sbjct  88   FYASWCPFSRSFRPSFDVISSLYSSIPHFAIKES  121



>gb|KJB64265.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
 gb|KJB64266.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
 gb|KJB64267.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
 gb|KJB64268.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
 gb|KJB64269.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
 gb|KJB64270.1| hypothetical protein B456_010G039900 [Gossypium raimondii]
Length=321

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 68/102 (67%), Gaps = 2/102 (2%)
 Frame = +2

Query  107  LTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTAVIEGDEKSLQRALDVVHRR  280
            ++ P     C K S  D IF   DS C I  D  +S     V EGDE SLQ+ L++VH+ 
Sbjct  24   VSGPVRVPFCLKESISDAIFDFRDSYCPINSDFTESIDFVGVTEGDEVSLQKVLNMVHKN  83

Query  281  SHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            SHDYVA+LFYASWCPFSR F+P FS++SS  P +PHFAIEES
Sbjct  84   SHDYVAVLFYASWCPFSRSFRPTFSILSSSYPSIPHFAIEES  125



>ref|XP_010267539.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Nelumbo nucifera]
Length=324

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 77/125 (62%), Gaps = 5/125 (4%)
 Frame = +2

Query  44   REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS--  217
            R W  G  LL++ GRLTC+  +      +C    S  D I   PD     + + +  S  
Sbjct  4    RVWHTGFVLLLLFGRLTCSEPVRVSSSEVCPVP-SVADSILRSPDLCAHSNWLSNGDSDG  62

Query  218  --TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  391
                V EGDE SLQRAL++VH+ S++YV+L FYASWCPFSR  +P F+++SS+ P +PHF
Sbjct  63   DLVGVTEGDEVSLQRALNLVHKNSNEYVSLFFYASWCPFSRACRPTFTILSSMYPSIPHF  122

Query  392  AIEES  406
            A+EES
Sbjct  123  AVEES  127



>ref|XP_010478919.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Camelina sativa]
Length=314

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 69/104 (66%), Gaps = 7/104 (7%)
 Frame = +2

Query  104  TLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVH  274
            T+  PF    C+  S KD+IF   D TC +  ++S+       V EGDE+ LQ ALD++H
Sbjct  26   TVRVPF----CATRSTKDYIFGFRDQTCPVSGVESAERPHFVVVTEGDERWLQIALDMIH  81

Query  275  RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +   DYVALLFYASWCPFSR F+P F V+SSL   +PHFAI+ES
Sbjct  82   KNKCDYVALLFYASWCPFSRSFRPSFDVISSLFSSIPHFAIKES  125



>gb|KDP41389.1| hypothetical protein JCGZ_15796 [Jatropha curcas]
Length=323

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = +2

Query  35   ARLREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI-DEIKSS  211
            AR+   R G+  ++++     +     P   L C + S  D IF   D +C + D  +S 
Sbjct  3    ARVWLRRIGILFVLLMMWSPISAAAADPSRVLMCPRESLVDSIFGFLDRSCIVYDTAESP  62

Query  212  CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  391
                VIEGDE SLQ+AL++VH+  + Y+A+LFYASWCPFSR F+P FS++SSL P +PHF
Sbjct  63   GFVGVIEGDEVSLQKALNMVHKNGYKYLAVLFYASWCPFSRNFRPSFSLLSSLYPSIPHF  122

Query  392  AIEES  406
            AIEES
Sbjct  123  AIEES  127



>ref|XP_010461284.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Camelina sativa]
 ref|XP_010461285.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Camelina sativa]
Length=314

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 69/104 (66%), Gaps = 7/104 (7%)
 Frame = +2

Query  104  TLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVH  274
            T+  PF    C+   AKD+IF   D TC +  ++S+       V EGDE+ LQ ALD++H
Sbjct  26   TVRVPF----CATRFAKDYIFGFRDQTCPVSGVESAHRPHFVVVTEGDERWLQIALDMIH  81

Query  275  RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +   DYVALLFYASWCPFSR F+P F V+SSL   +PHFAI+ES
Sbjct  82   KNKCDYVALLFYASWCPFSRSFRPSFDVISSLFSSIPHFAIKES  125



>gb|KHG11609.1| 5'-adenylylsulfate reductase-like 4 [Gossypium arboreum]
Length=319

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = +2

Query  44   REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS--  217
            + W+  M +L+   RLTCA  +  P     C K S  D IF   DS C I   ++     
Sbjct  4    KAWQTRMLILVFWWRLTCA--VFVPLRIPLCPKVSVSDAIFDFRDSYCPIISARTQSIDF  61

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              V EGDE S+Q+AL++V++  H YVA+LFYASWCPFSR F+P  +++SS  P +PHF I
Sbjct  62   VGVTEGDEVSMQKALNMVYKNGHGYVAVLFYASWCPFSRSFRPSINILSSSYPCIPHFTI  121

Query  398  EES  406
            EES
Sbjct  122  EES  124



>ref|XP_002306572.2| hypothetical protein POPTR_0005s17150g [Populus trichocarpa]
 gb|EEE93568.2| hypothetical protein POPTR_0005s17150g [Populus trichocarpa]
Length=326

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 83/137 (61%), Gaps = 13/137 (9%)
 Frame = +2

Query  32   MARLREWRAGMAL-LMIVGRLT--CAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEI  202
            M + R W+  + + LMI G L   CA   ++   ++C  + S  D IF   D  C +  +
Sbjct  1    MMQTRVWQTRILVSLMIYGSLMLMCATAASSNTVSICPIE-SVTDSIFGFRDRNCVVSGV  59

Query  203  KSS---------CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
              S             V++GDE SLQ+AL++V + SH+YVALLFYASWCPFSR F+P FS
Sbjct  60   DESPFFPGFTEKFMFVVVKGDEVSLQKALNLVQKNSHEYVALLFYASWCPFSRTFRPSFS  119

Query  356  VVSSLLPWVPHFAIEES  406
            ++SSL P +PHFAIEES
Sbjct  120  ILSSLYPSIPHFAIEES  136



>ref|XP_011004793.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Populus euphratica]
Length=325

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = +2

Query  32   MARLREWRAGMAL-LMIVGRLT--CAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEI  202
            M + R W+  + + LMI G L   CA   ++   ++C  + S  D IF   D  C +  +
Sbjct  1    MMQTRVWQTRILVSLMIYGSLMLMCAAAASSNKVSICPIE-SVADSIFGFRDRNCVVSGV  59

Query  203  -KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPW  379
             +S       EGDE SLQ+AL++V +  H+YVALLFYASWCPFSR F+P FS++SSL P 
Sbjct  60   DESPFFPGFTEGDEVSLQKALNLVQKNRHEYVALLFYASWCPFSRTFRPSFSILSSLYPS  119

Query  380  VPHFAIEES  406
            +PHFAIEES
Sbjct  120  IPHFAIEES  128



>gb|KHG10185.1| 5'-adenylylsulfate reductase-like 4 [Gossypium arboreum]
Length=321

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = +2

Query  107  LTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTAVIEGDEKSLQRALDVVHRR  280
            +T P     C K S  D IF   DS C I  D  +S     V EGDE SLQ+ L++VH+ 
Sbjct  24   VTGPVRVPFCLKESISDAIFDFRDSYCPINSDFTESIDFVGVTEGDEVSLQKVLNMVHKN  83

Query  281  SHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            SHDYVA+LFYASWCPFSR F+  F+++SS  P +PHFAIEES
Sbjct  84   SHDYVAVLFYASWCPFSRSFRLTFAILSSSYPSIPHFAIEES  125



>ref|XP_010500009.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Camelina sativa]
Length=314

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 7/104 (7%)
 Frame = +2

Query  104  TLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVH  274
            T+  PF   C +++ AKD+IF   D TC +  ++S+       V EGDE+ LQ A D++H
Sbjct  26   TVRVPF---CATRF-AKDYIFGFRDQTCPVSGVESAHRPHFVVVTEGDERWLQIAFDMIH  81

Query  275  RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +   DYVALLFYASWCPFSR F+P F V+SSL   +PHFAI+ES
Sbjct  82   KNKCDYVALLFYASWCPFSRSFRPSFDVISSLYSSIPHFAIKES  125



>ref|XP_006305413.1| hypothetical protein CARUB_v10009812mg [Capsella rubella]
 gb|EOA38311.1| hypothetical protein CARUB_v10009812mg [Capsella rubella]
Length=312

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 72/117 (62%), Gaps = 3/117 (3%)
 Frame = +2

Query  62   MALLMIVGRLTCAHTLTAPFPALC--CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEG  235
            M L+M+   LT  +     F      C+  S KD+IF   D TC ++  +      V EG
Sbjct  8    MLLVMVFWNLTFINADADDFSVRVPFCATRSIKDYIFGFRDQTC-VESSQRPRFVVVTEG  66

Query  236  DEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            DE+ LQ ALD++H+   DYVALLFYASWCPFSR F+P F VVSSL   +PHFAI+ES
Sbjct  67   DERWLQIALDMIHKNKCDYVALLFYASWCPFSRSFRPSFDVVSSLYSSIPHFAIKES  123



>ref|XP_002893853.1| hypothetical protein ARALYDRAFT_473651 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70112.1| hypothetical protein ARALYDRAFT_473651 [Arabidopsis lyrata subsp. 
lyrata]
Length=300

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVHRRSHDYVALL  304
            C+  S KD IF   D TC +  ++S       AV EGDE+ LQ ALD++H+   DYVALL
Sbjct  18   CATRSVKDSIFGFRDQTCPVSGVESDERPHFGAVTEGDERWLQLALDMIHKNKCDYVALL  77

Query  305  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            FYASWCPFSR F+P F V++SL   +PHFAI+ES
Sbjct  78   FYASWCPFSRSFRPSFDVIASLYSSIPHFAIKES  111



>ref|XP_006397424.1| hypothetical protein EUTSA_v10001824mg [Eutrema salsugineum]
 gb|ESQ38877.1| hypothetical protein EUTSA_v10001824mg [Eutrema salsugineum]
Length=322

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 70/117 (60%), Gaps = 6/117 (5%)
 Frame = +2

Query  74   MIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI-----DEIKSSCS-TAVIEG  235
            +++G +T             C+  S KD+ F   D TC +     DE+       +V EG
Sbjct  12   IVIGNITSTTVAAFSVRVPICATRSVKDYAFGFRDQTCPVSGAVGDELDERPHFLSVTEG  71

Query  236  DEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            DE+ LQ ALD++H+   DYVALLFYASWCPFSR F+P F VVSSL   +PHFAI+ES
Sbjct  72   DERWLQTALDMIHKNKCDYVALLFYASWCPFSRSFRPSFDVVSSLYSSIPHFAIKES  128



>ref|XP_004500630.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like isoform X1 
[Cicer arietinum]
Length=319

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 85/126 (67%), Gaps = 6/126 (5%)
 Frame = +2

Query  41   LREWRAGM--ALLMIVGRLTC-AHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSS  211
            +R W + +  A+L+  G L+C A +LT       C   S  D+I   PDS+CS+ +   S
Sbjct  1    MRLWGSEIFFAILLCCGTLSCTAQSLTTA--TNVCPTESLLDFILGFPDSSCSLSDSLGS  58

Query  212  CS-TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  388
                 V EGDE SLQ+AL++VH+  H+YVA+LFYASWCPFSR F+P+FSV+SSL P +PH
Sbjct  59   IHYIGVTEGDEVSLQKALNMVHKNYHEYVAVLFYASWCPFSRIFRPVFSVLSSLYPSIPH  118

Query  389  FAIEES  406
            FAIEES
Sbjct  119  FAIEES  124



>ref|XP_004500631.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like isoform X2 
[Cicer arietinum]
Length=317

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 85/126 (67%), Gaps = 6/126 (5%)
 Frame = +2

Query  41   LREWRAGM--ALLMIVGRLTC-AHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSS  211
            +R W + +  A+L+  G L+C A +LT       C   S  D+I   PDS+CS+ +   S
Sbjct  1    MRLWGSEIFFAILLCCGTLSCTAQSLTTA--TNVCPTESLLDFILGFPDSSCSLSDSLGS  58

Query  212  CS-TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  388
                 V EGDE SLQ+AL++VH+  H+YVA+LFYASWCPFSR F+P+FSV+SSL P +PH
Sbjct  59   IHYIGVTEGDEVSLQKALNMVHKNYHEYVAVLFYASWCPFSRIFRPVFSVLSSLYPSIPH  118

Query  389  FAIEES  406
            FAIEES
Sbjct  119  FAIEES  124



>ref|XP_004500632.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like isoform X3 
[Cicer arietinum]
Length=319

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 85/126 (67%), Gaps = 6/126 (5%)
 Frame = +2

Query  41   LREWRAGM--ALLMIVGRLTC-AHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSS  211
            +R W + +  A+L+  G L+C A +LT       C   S  D+I   PDS+CS+ +   S
Sbjct  1    MRLWGSEIFFAILLCCGTLSCTAQSLTTA--TNVCPTESLLDFILGFPDSSCSLSDSLGS  58

Query  212  CS-TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  388
                 V EGDE SLQ+AL++VH+  H+YVA+LFYASWCPFSR F+P+FSV+SSL P +PH
Sbjct  59   IHYIGVTEGDEVSLQKALNMVHKNYHEYVAVLFYASWCPFSRIFRPVFSVLSSLYPSIPH  118

Query  389  FAIEES  406
            FAIEES
Sbjct  119  FAIEES  124



>ref|XP_010269310.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Nelumbo nucifera]
Length=319

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +2

Query  50   WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS--TA  223
            W+ G ALL++ GRLTCA  +        C   S  D++    D       + +       
Sbjct  6    WQTGFALLLVFGRLTCAEPVRVS-SVEVCPMPSLADYLLLSRDLCVDSSWLSNGAGDLIG  64

Query  224  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  403
            V EGDE SLQRAL++VH+  H+Y++LLF+ASWCPFSR  +P FS++SSL P + H A+EE
Sbjct  65   VTEGDEVSLQRALNLVHKNGHEYISLLFHASWCPFSRACRPTFSILSSLYPSIRHLAVEE  124

Query  404  S  406
            S
Sbjct  125  S  125



>ref|XP_002513930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48513.1| conserved hypothetical protein [Ricinus communis]
Length=326

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 77/127 (61%), Gaps = 3/127 (2%)
 Frame = +2

Query  35   ARLREWRAGM--ALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKS  208
            AR+ + R  M   L++I+G    A     P   L C + S  D IF   D +C +    +
Sbjct  3    ARVWQRRIAMFFVLIIILGSSISASAAVNPSWDLMCPRESVLDSIFGFLDRSCVVLPTPN  62

Query  209  SCST-AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  385
            S     V EGDE SLQ+AL++VH+ S  + A+LFYASWCPFSR F+P FS++SSL P + 
Sbjct  63   SPGFFGVTEGDEVSLQKALNLVHKNSQKHAAVLFYASWCPFSRSFRPSFSLLSSLYPSIA  122

Query  386  HFAIEES  406
            HFAIEES
Sbjct  123  HFAIEES  129



>gb|KHN19769.1| 5'-adenylylsulfate reductase-like 4 [Glycine soja]
Length=322

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 63/84 (75%), Gaps = 2/84 (2%)
 Frame = +2

Query  155  DWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSR  334
            D+I    DSTCS+    S  S AV EGDE  L +AL++VH+ +H+YVA+LFYASWCPFSR
Sbjct  47   DFILGFSDSTCSLP--NSLGSIAVTEGDEFFLHKALNMVHKNNHEYVAVLFYASWCPFSR  104

Query  335  KFKPIFSVVSSLLPWVPHFAIEES  406
             F+P+FS++S+L P + H AIEES
Sbjct  105  VFRPVFSILSALYPSITHLAIEES  128



>gb|KHN08939.1| 5'-adenylylsulfate reductase-like 4 [Glycine soja]
Length=314

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 80/126 (63%), Gaps = 10/126 (8%)
 Frame = +2

Query  41   LREWRAGMAL-LMIVGRLTC---AHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKS  208
            +R W + +   +++ G L+C   AH +TA      C   S  D++    D TC +    S
Sbjct  1    MRIWGSEIVFAILLCGTLSCTAQAHHITAS----TCPARSILDFVLGFSDFTCQLP--NS  54

Query  209  SCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  388
              S AV EGDE SLQ+ L++VH+ +H++VA+LFYASWCPFS+  +P+FS++S+L P + H
Sbjct  55   LGSIAVTEGDEVSLQKVLNMVHKNNHEHVAVLFYASWCPFSQVSRPVFSILSALYPSILH  114

Query  389  FAIEES  406
             AIEES
Sbjct  115  LAIEES  120



>ref|XP_010060013.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Eucalyptus grandis]
 gb|KCW66534.1| hypothetical protein EUGRSUZ_F00332 [Eucalyptus grandis]
Length=309

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = +2

Query  131  CCSKYSAKDWIFALPDSTCSIDEIKSSCS-TAVIEGDEKSLQRALDVVHRRSHDYVALLF  307
             C K +    I    DS CS+D    S     V EGDE SLQRAL +VH+ S +YVA+LF
Sbjct  26   VCEKETLAGSIVGFRDSRCSLDGRSESVEFVGVTEGDELSLQRALSMVHKNSEEYVAVLF  85

Query  308  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            YASWCPFSR  +P FS++SSL P + HFAIEES
Sbjct  86   YASWCPFSRVIRPRFSLLSSLYPSIAHFAIEES  118



>gb|ACU23635.1| unknown [Glycine max]
Length=322

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = +2

Query  155  DWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSR  334
            D+I    DSTCS+    S  S AV EGDE  L +AL++VH+ + +YVA+LFYASWCPFSR
Sbjct  47   DFILGFSDSTCSLP--NSLGSIAVTEGDEFFLHKALNMVHKNNREYVAVLFYASWCPFSR  104

Query  335  KFKPIFSVVSSLLPWVPHFAIEES  406
             F+P+FS++S+L P + H AIEES
Sbjct  105  VFRPVFSILSALYPSITHLAIEES  128



>emb|CDY54942.1| BnaCnng27720D [Brassica napus]
Length=288

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 76/128 (59%), Gaps = 18/128 (14%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCAHTLTAPFPALC-----CSKYSAKDWIFALPDSTCSI-DEI  202
            + +W   + L+++ G+LT        F A C     C+  S KD+ F L D TC + DE+
Sbjct  1    MEKWNFLLLLVIVFGKLT--------FVAFCARVPICAPRSVKDYTFELRDPTCRLSDEL  52

Query  203  KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  382
                      GDE+ LQ ALD++H+   +YVALLFYASWCPFS  F+P F V+SSL   +
Sbjct  53   HERLHF----GDERWLQTALDMIHKNKCNYVALLFYASWCPFSISFRPSFHVISSLYSSI  108

Query  383  PHFAIEES  406
            PHFAI+ES
Sbjct  109  PHFAIKES  116



>ref|XP_008782161.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Phoenix dactylifera]
Length=314

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 71/122 (58%), Gaps = 1/122 (1%)
 Frame = +2

Query  44   REWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID-EIKSSCST  220
            R W AG  LL+    L   H   AP     C + SA D I    +S  ++D    +  S+
Sbjct  4    RVWTAGFLLLLGAASLPGGHACGAPPTEGLCPRVSAGDSILGHRNSCTAVDFPAHNEHSS  63

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
            +VIEG E +L RAL +++      VA+LFYASWCPFS+ F+P F V+SSL P V HFA+E
Sbjct  64   SVIEGGEHALSRALQLIYSMQGASVAVLFYASWCPFSKIFRPSFDVLSSLYPTVRHFAVE  123

Query  401  ES  406
            ES
Sbjct  124  ES  125



>emb|CDX91762.1| BnaC08g06810D [Brassica napus]
Length=313

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSI--DEIKSSCS-TAVIEGDEKSLQRALDVVHRRSHDYVALL  304
            C+  S KD+     + TC    DE+       AV EGDE+ LQ ALD++H+   DYVALL
Sbjct  29   CAMRSVKDYALGFREQTCPFYGDELAERPHFVAVTEGDERWLQTALDMIHKNKCDYVALL  88

Query  305  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            FYASWCPFSR F P F ++SSL   +PHFAI+ES
Sbjct  89   FYASWCPFSRSFTPSFDLISSLYSSIPHFAIKES  122



>ref|NP_001240132.1| uncharacterized protein LOC100796765 precursor [Glycine max]
 gb|ACU18131.1| unknown [Glycine max]
Length=314

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 79/126 (63%), Gaps = 10/126 (8%)
 Frame = +2

Query  41   LREWRAGMAL-LMIVGRLTC---AHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKS  208
            +R W + +   +++ G L+C   AH +TA      C   S  D++    D TC +    S
Sbjct  1    MRIWGSEIVFAILLCGTLSCTAQAHHITAS----TCPARSILDFVLGFSDFTCQLP--NS  54

Query  209  SCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  388
              S AV EGDE SLQ+ L++VH+ +H++VA+LFYAS CPFS+  +P+FS++S+L P + H
Sbjct  55   LGSIAVTEGDEVSLQKVLNMVHKNNHEHVAVLFYASLCPFSQVSRPVFSILSALYPSILH  114

Query  389  FAIEES  406
             AIEES
Sbjct  115  LAIEES  120



>gb|KFK23381.1| hypothetical protein AALP_AAs59400U000300 [Arabis alpina]
Length=316

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 72/126 (57%), Gaps = 8/126 (6%)
 Frame = +2

Query  41   LREWRAGMALLMIVGRLTCA-HTLTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSS  211
            + +W   +   M+   L+    ++  PF    C   S KD+       TC +  DE+   
Sbjct  1    MEKWILLLLFFMVFSNLSFGVFSVRVPF----CPTRSVKDYTLGFRHQTCPVSGDELAQR  56

Query  212  CS-TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  388
                AV EGDE+ LQ ALD++H+   DYVALLFYASWCPFSR  +P F V++S+   +PH
Sbjct  57   PHFVAVTEGDERWLQTALDMIHKNKCDYVALLFYASWCPFSRSLRPSFDVIASIYSSIPH  116

Query  389  FAIEES  406
            FAI+ES
Sbjct  117  FAIKES  122



>ref|XP_008790885.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Phoenix dactylifera]
 ref|XP_008790886.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Phoenix dactylifera]
Length=315

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 62/102 (61%), Gaps = 1/102 (1%)
 Frame = +2

Query  104  TLTAPFPALCCSKYSAKDWIFALPDSTCSIDE-IKSSCSTAVIEGDEKSLQRALDVVHRR  280
            T+  P  A  C + SA + I   PD+   +D  +       V+EG E  L RAL++V+R 
Sbjct  17   TVVGPAAATVCPRVSAGESILGRPDACSHLDAPVLGGELIGVVEGGEAVLLRALNLVYRN  76

Query  281  SHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
              DYVA+LFYASWCPFS+  +P F V+SSL P + HFA EES
Sbjct  77   KEDYVAVLFYASWCPFSKILRPNFQVLSSLFPTIRHFAFEES  118



>gb|KCW66535.1| hypothetical protein EUGRSUZ_F00332 [Eucalyptus grandis]
Length=310

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +2

Query  131  CCSKYSAKDWIFALPDSTCSIDEIKSSCS-TAVIE-GDEKSLQRALDVVHRRSHDYVALL  304
             C K +    I    DS CS+D    S     V E GDE SLQRAL +VH+ S +YVA+L
Sbjct  26   VCEKETLAGSIVGFRDSRCSLDGRSESVEFVGVTEVGDELSLQRALSMVHKNSEEYVAVL  85

Query  305  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            FYASWCPFSR  +P FS++SSL P + HFAIEES
Sbjct  86   FYASWCPFSRVIRPRFSLLSSLYPSIAHFAIEES  119



>emb|CDY41863.1| BnaA08g06360D [Brassica napus]
Length=317

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 72/120 (60%), Gaps = 7/120 (6%)
 Frame = +2

Query  62   MALLMIVGRL--TCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTAVI  229
            + L+++ G L  T    ++   P   C+  S KD+     + +C    DE+       V+
Sbjct  8    LVLVILFGNLMFTAVDGVSVRVP--ICAMRSVKDYALGFREQSCPFYGDELADRPHFVVV  65

Query  230  -EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
             EGDE+ LQ ALD++H+   DYVALLFYASWCPFSR F P F ++SSL   +PHFAI+ES
Sbjct  66   TEGDERWLQTALDMIHKNKCDYVALLFYASWCPFSRSFTPSFDLISSLYSSIPHFAIKES  125



>ref|XP_009107920.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Brassica rapa]
Length=317

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSI--DEIKSSCSTAVI-EGDEKSLQRALDVVHRRSHDYVALL  304
            C+  S KD+     + +C    DE+       V+ EGDE+ LQ ALD++H+   DYVALL
Sbjct  32   CAMRSVKDYALGFREQSCPFYGDELADRPHFVVVTEGDERWLQTALDMIHKNKCDYVALL  91

Query  305  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            FYASWCPFSR F P F ++SSL   +PHFAI+ES
Sbjct  92   FYASWCPFSRSFTPSFDLISSLYSSIPHFAIKES  125



>gb|EYU36495.1| hypothetical protein MIMGU_mgv1a0105141mg, partial [Erythranthe 
guttata]
Length=250

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +2

Query  233  GDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            GDE +LQ+AL+++H+  HDYVALLFY+SWCPFS  F+P FS++SS+ P +PHFAIEES
Sbjct  1    GDEVTLQKALNIIHKNEHDYVALLFYSSWCPFSGPFRPSFSLLSSIFPSIPHFAIEES  58



>ref|XP_008444841.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Cucumis melo]
Length=321

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 67/106 (63%), Gaps = 3/106 (3%)
 Frame = +2

Query  98   AHTLTAPFPALCCSKYSAKDWIFALPDS--TCSI-DEIKSSCSTAVIEGDEKSLQRALDV  268
            AH++ AP     C   S  D IF   DS   C    +++      V EGDE SLQ AL++
Sbjct  23   AHSVRAPDSPPFCPAESFLDTIFRFRDSYSNCPFHGDVRHYEFIGVSEGDEASLQMALNM  82

Query  269  VHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            VH   ++YV++LFYASWCPFS+ F+P FS++SSL   +PHFAI+ES
Sbjct  83   VHSNRYEYVSVLFYASWCPFSKSFRPSFSILSSLYASIPHFAIQES  128



>ref|XP_010937429.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Elaeis guineensis]
Length=319

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 75/126 (60%), Gaps = 5/126 (4%)
 Frame = +2

Query  32   MARLREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDE-IKS  208
            M   R WRAG ALL+++  +       A      C + SA + I   PDS  +++  +  
Sbjct  1    MEGRRVWRAGAALLVLLLVVVGPAAAAASV----CPRVSASESILGRPDSCSALESPVLG  56

Query  209  SCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPH  388
                 V+EGDE  LQRAL++V+ +  DYVA+LFYASWCPFS+  +P F V+SSL P + H
Sbjct  57   GDLIGVVEGDEAILQRALNLVYSKREDYVAVLFYASWCPFSKICRPNFQVLSSLFPTIRH  116

Query  389  FAIEES  406
            FA EES
Sbjct  117  FAFEES  122



>ref|XP_010939664.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Elaeis guineensis]
Length=315

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = +2

Query  116  PFPALCCSKYSAKDWIFALPDSTCSIDE-IKSSCSTAVIEGDEKSLQRALDVVHRRSHDY  292
            P  A  C + S  + I   PD+   +D  +       V+EG E ++QRAL++V++   DY
Sbjct  21   PAAATVCPRVSVGESILGRPDACSLLDAPVLGGDLIGVVEGGEAAMQRALNLVYKNREDY  80

Query  293  VALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            VA+LFYASWCPFS+ F+P   V+SSL P + HFA EES
Sbjct  81   VAVLFYASWCPFSKVFRPNLQVLSSLFPTIRHFAFEES  118



>ref|XP_010538940.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 [Tarenaya hassleriana]
Length=323

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 71/123 (58%), Gaps = 8/123 (7%)
 Frame = +2

Query  62   MALLMIVGRLTCAHTLTAPFPALC--CSKYSAKDWIFALPDSTCSIDEIKSSCS------  217
            +  ++++G LTCA   ++        CS  SA+D+I    D   S+              
Sbjct  6    LLFVVVLGNLTCAAFSSSSSVDRFSFCSLVSAEDYILGFRDRYGSLSLDDGDELDEDPGF  65

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
             +V EGDE+SL  ALD++H +  DYVALLFYASWCPFSR F+     +SSL P +PHFAI
Sbjct  66   VSVTEGDERSLIIALDMIHTKECDYVALLFYASWCPFSRSFRLSLDALSSLYPSIPHFAI  125

Query  398  EES  406
            E+S
Sbjct  126  EDS  128



>emb|CDY28407.1| BnaA05g18330D [Brassica napus]
Length=263

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 62/93 (67%), Gaps = 4/93 (4%)
 Frame = +2

Query  134  CSKYSAKDW-IFALPDSTCSI-DEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLF  307
            C+  S KD+  F L D TC + DE+        + GDE+ LQ ALD++H+   +YVALLF
Sbjct  26   CTPRSVKDYYTFELRDPTCPLSDELHER--LPFVAGDERWLQTALDMIHKNKCNYVALLF  83

Query  308  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            YASWCPFS  F+P F V+SSL   +PHFAI+ES
Sbjct  84   YASWCPFSISFRPSFHVISSLYSSIPHFAIKES  116



>ref|XP_004152636.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like [Cucumis 
sativus]
 ref|XP_004162230.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like [Cucumis 
sativus]
 gb|KGN62696.1| hypothetical protein Csa_2G368970 [Cucumis sativus]
Length=321

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 71/122 (58%), Gaps = 5/122 (4%)
 Frame = +2

Query  50   WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI---DEIKSSCST  220
            W  G+ L  ++  L   H++        C   S  D IF   DS  +     +++     
Sbjct  9    WVIGILLFSLL--LGFTHSVRVSDSPPFCPAESFLDTIFRFRDSNSNCPFHGDVRHYEFI  66

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
             V EGDE SLQ AL++VH   ++YV++LFYASWCPFS+ F+P FS++SSL   +PHFAI+
Sbjct  67   GVSEGDEASLQMALNMVHSNRYEYVSVLFYASWCPFSKSFRPSFSILSSLYASIPHFAIQ  126

Query  401  ES  406
            ES
Sbjct  127  ES  128



>ref|XP_009391309.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKS--SCSTAVIEGDEKSLQRALDVVHRRSHDYVALLF  307
            C + SA D I   PDS   +D           V+EGDE  LQ+AL +V +   +YVALLF
Sbjct  26   CPRPSAGDSIMGRPDSCWDLDPTAELRGYQIGVVEGDEAVLQKALSIVQKNREEYVALLF  85

Query  308  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            YASWCPFS+  +P F ++S+L P + HFA EES
Sbjct  86   YASWCPFSKICRPNFQILSNLFPTIHHFAFEES  118



>gb|EPS62898.1| hypothetical protein M569_11894, partial [Genlisea aurea]
Length=286

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  313
            C   +  +++F   +  CS     +     VI+G+E +LQ+ L  +HR  ++Y ALLFY+
Sbjct  28   CPLNTVPEFVFPSKNDVCS-----AGGGGGVIQGNEITLQKTLSSIHRNEYEYAALLFYS  82

Query  314  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            SWCPFS   +PIFS++SS+ P +PHFAIEES
Sbjct  83   SWCPFSLPLRPIFSMLSSIFPSIPHFAIEES  113



>gb|KJB29321.1| hypothetical protein B456_005G094200 [Gossypium raimondii]
Length=213

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  233  GDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            GDE SLQ+AL++VHR  H+YVA+LFYASWCPFSR F+P F  +SS  P +PHFAI+ES
Sbjct  14   GDEISLQKALNMVHRNIHEYVAVLFYASWCPFSRSFRPSFLTLSSSYPSIPHFAIKES  71



>ref|XP_008811170.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Phoenix dactylifera]
Length=319

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = +2

Query  125  ALCCSKYSAKDWIFALPDSTCSI-DEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVAL  301
            A  C + SA   I   PDS   +   +       VIEGDE  LQRAL++V+R+  DY+A+
Sbjct  28   ASVCPRVSACQSILGRPDSCPRLASPVLGGNLIGVIEGDEVVLQRALNIVYRKREDYIAM  87

Query  302  LFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            LFYA WCPFSR   P F V+SSL P + HFA EES
Sbjct  88   LFYAPWCPFSRICWPNFQVLSSLFPTIRHFAFEES  122



>ref|XP_010421807.1| PREDICTED: 5'-adenylylsulfate reductase-like 6 [Camelina sativa]
Length=294

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 6/91 (7%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  313
            C + SAKD+I    D + S        S +V EGD++ LQ A D++ +   DYVALLFYA
Sbjct  28   CPRGSAKDYILGFRDRSASYR------SGSVTEGDDRWLQVASDMIDKNKCDYVALLFYA  81

Query  314  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            SWCPFSR  +P F ++S L   +PHFAIEES
Sbjct  82   SWCPFSRLLRPSFDLISLLYSSIPHFAIEES  112



>ref|XP_006397245.1| hypothetical protein EUTSA_v10028636mg [Eutrema salsugineum]
 gb|ESQ38698.1| hypothetical protein EUTSA_v10028636mg [Eutrema salsugineum]
Length=470

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 58/94 (62%), Gaps = 3/94 (3%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVHRRSHDYVALL  304
            C + SAKD+I    D  C   +  +S      +V EGD++ LQ A D++H    DYVALL
Sbjct  191  CHRGSAKDYILGFRDRNCPCSDESASRRPRFVSVTEGDDRWLQMASDMIHEDKCDYVALL  250

Query  305  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            FYASWCPFS   +P F V+S +   VPHFAIEES
Sbjct  251  FYASWCPFSGSIRPSFDVISLIYSSVPHFAIEES  284



>ref|XP_010436141.1| PREDICTED: 5'-adenylylsulfate reductase-like 6 [Camelina sativa]
Length=296

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 58/91 (64%), Gaps = 4/91 (4%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  313
            C + SAKD+I    D +     +  S   +V EGD++ LQ A D++ +   DYVALLFYA
Sbjct  28   CPRGSAKDYILGFRDRSA----LHRSGFVSVTEGDDRWLQVASDMIDKNRCDYVALLFYA  83

Query  314  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            SWCPFSR  +P F ++S L   +PHFAIEES
Sbjct  84   SWCPFSRLLRPSFDLISLLYSSIPHFAIEES  114



>ref|XP_002452534.1| hypothetical protein SORBIDRAFT_04g027510 [Sorghum bicolor]
 gb|EES05510.1| hypothetical protein SORBIDRAFT_04g027510 [Sorghum bicolor]
Length=322

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 68/123 (55%), Gaps = 19/123 (15%)
 Frame = +2

Query  86   RLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSS-------CST--------  220
            RL C   L  PF  +    Y+A +   +LP   C +  I  S       CST        
Sbjct  4    RLPCWTALLLPFLLVGVGPYAAAE---SLPHDACLVPTIVESVLGTPGTCSTLDRRPGDP  60

Query  221  -AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              VIEGDE +L RA++++H    DY+A+LFYA+WCPFS++ KP F  ++SL P + HFA 
Sbjct  61   VGVIEGDEVTLARAVNLLHANKDDYIAVLFYATWCPFSQECKPNFETLASLFPTIRHFAF  120

Query  398  EES  406
            EES
Sbjct  121  EES  123



>gb|KFK32103.1| hypothetical protein AALP_AA6G199200 [Arabis alpina]
Length=301

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 59/96 (61%), Gaps = 5/96 (5%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDS-TCSIDEIKSSCS----TAVIEGDEKSLQRALDVVHRRSHDYVA  298
            C   S KD++    D   C +   +S+       +V EGD++ LQ A D++H+   DYVA
Sbjct  24   CPTTSPKDYLLGFRDPPICPVSGDESTSLRPRFVSVTEGDDRWLQSASDMIHKNKCDYVA  83

Query  299  LLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            LLFYASWCPFSR F+P F  +S L   +PHFAIEES
Sbjct  84   LLFYASWCPFSRSFRPSFDALSLLHSSIPHFAIEES  119



>ref|XP_006288344.1| hypothetical protein CARUB_v10001592mg [Capsella rubella]
 gb|EOA21242.1| hypothetical protein CARUB_v10001592mg [Capsella rubella]
Length=297

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 58/91 (64%), Gaps = 4/91 (4%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYA  313
            C + SAKD+I    D +     +  S   +V EGD++ LQ A D++ +   DYVALLFYA
Sbjct  28   CPRGSAKDYILGFRDRSA----LHRSSFVSVTEGDDRWLQVASDMIDKNKCDYVALLFYA  83

Query  314  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            SWCPFSR  +P F ++S +   +PHFAIEES
Sbjct  84   SWCPFSRLVRPSFDLISLMYSSIPHFAIEES  114



>ref|XP_004953961.1| PREDICTED: 5'-adenylylsulfate reductase-like 3-like isoform X1 
[Setaria italica]
Length=320

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = +2

Query  62   MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDE  241
            MALL+         +  A  P   C   +  + +   P+   ++D +       VIEGDE
Sbjct  9    MALLLPFLLAGVGSSAAASVPTDACRVPTTVESVLGTPEMCSTLDRLGDPV--GVIEGDE  66

Query  242  KSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
             +L +A++++H    DY+A+LFYASWCPFS++ KP F  ++SL P + HFA EES
Sbjct  67   VTLAKAVNLLHMNKDDYIAILFYASWCPFSQECKPNFETLASLFPTIRHFAFEES  121



>ref|XP_004953962.1| PREDICTED: 5'-adenylylsulfate reductase-like 3-like isoform X2 
[Setaria italica]
Length=310

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = +2

Query  62   MALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDE  241
            MALL+         +  A  P   C   +  + +   P+   ++D +       VIEGDE
Sbjct  9    MALLLPFLLAGVGSSAAASVPTDACRVPTTVESVLGTPEMCSTLDRLGDPV--GVIEGDE  66

Query  242  KSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
             +L +A++++H    DY+A+LFYASWCPFS++ KP F  ++SL P + HFA EES
Sbjct  67   VTLAKAVNLLHMNKDDYIAILFYASWCPFSQECKPNFETLASLFPTIRHFAFEES  121



>ref|XP_003570613.2| PREDICTED: probable pectin methyltransferase QUA2 [Brachypodium 
distachyon]
Length=1014

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 73/130 (56%), Gaps = 2/130 (2%)
 Frame = +2

Query  20   FNSGMARLRE-WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID  196
             +S MAR    W A + LL+ +      H+  A  P   C   +A + I   P  TCS  
Sbjct  689  LHSPMARRSPCWPALLLLLLHISPAAVGHSSAASAPPDACPVPTAVESILG-PSYTCSPP  747

Query  197  EIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLP  376
            + +      VIEGDE +L RA++++H    DY+A+LFYASWCPFS++ KP F  ++ L P
Sbjct  748  DRRLGDPVGVIEGDEATLARAINLLHMNKDDYIAILFYASWCPFSQECKPNFEALAHLFP  807

Query  377  WVPHFAIEES  406
             + HFA EES
Sbjct  808  TIRHFAFEES  817



>gb|EAY87573.1| hypothetical protein OsI_08985 [Oryza sativa Indica Group]
Length=311

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 69/114 (61%), Gaps = 6/114 (5%)
 Frame = +2

Query  65   ALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEK  244
            ALL+ +   T A    +P P  C    +A++ +   P  TC+  + +      VIEGDE 
Sbjct  10   ALLLPIIAATAA---ASPLPEACPVPTAAEEILG--PGGTCTPLDRRGD-PVGVIEGDEV  63

Query  245  SLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +L +A+ +VH    DY+A+LFYASWCPFS++ KP F +++SL P + HFA EES
Sbjct  64   TLAKAITLVHMNKDDYIAVLFYASWCPFSQECKPNFEILASLFPSIRHFAFEES  117



>ref|NP_001048159.1| Os02g0754900 [Oryza sativa Japonica Group]
 sp|Q84P95.1|APRL3_ORYSJ RecName: Full=5'-adenylylsulfate reductase-like 3; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 3; Short=APR-like 
3; Short=OsAPRL3; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAO72589.1| disulfide isomerase-like protein [Oryza sativa Japonica Group]
 dbj|BAD17244.1| disulfide isomerase [Oryza sativa Japonica Group]
 dbj|BAF10073.1| Os02g0754900 [Oryza sativa Japonica Group]
 gb|EAZ24661.1| hypothetical protein OsJ_08430 [Oryza sativa Japonica Group]
Length=311

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 69/114 (61%), Gaps = 6/114 (5%)
 Frame = +2

Query  65   ALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEK  244
            ALL+ +   T A    +P P  C    +A++ +   P  TC+  + +      VIEGDE 
Sbjct  10   ALLLPIIAATAA---ASPLPEACPVPTAAEEILG--PGGTCTTLDRRGD-PVGVIEGDEV  63

Query  245  SLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +L +A+ ++H    DY+A+LFYASWCPFS++ KP F +++SL P + HFA EES
Sbjct  64   TLAKAITLLHMNKDDYIAVLFYASWCPFSQECKPNFEILASLFPSIRHFAFEES  117



>ref|XP_010455302.1| PREDICTED: 5'-adenylylsulfate reductase-like 6 [Camelina sativa]
Length=162

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = +2

Query  146  SAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCP  325
            SAKD+I    D +          S +V EGD++ LQ A D++ +   DYVALLFYASWCP
Sbjct  32   SAKDYILGFRDRSALYR------SGSVTEGDDRWLQVASDMIDKNKCDYVALLFYASWCP  85

Query  326  FSRKFKPIFSVVSSLLPWVPHFAIEES  406
            FSR  +P F ++S L   +PHFA+EES
Sbjct  86   FSRLLRPSFDLISLLYSSIPHFAVEES  112



>gb|KDO80980.1| hypothetical protein CISIN_1g020846mg [Citrus sinensis]
Length=250

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  257  ALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            AL++VH+ SH+YVA+LFYASWCPFSR F+P FSV+SSL   +PHFAIEES
Sbjct  2    ALNMVHKNSHEYVAVLFYASWCPFSRNFRPSFSVLSSLYSSIPHFAIEES  51



>ref|XP_010543933.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010543938.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X2 [Tarenaya 
hassleriana]
Length=297

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (59%), Gaps = 8/123 (7%)
 Frame = +2

Query  62   MALLMIVGRLTCA--HTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTA----  223
            +  ++++G LTCA   + ++      C   S+KD I    D  C +       S A    
Sbjct  6    LLFVVVLGNLTCAAVSSSSSSKRVSSCPLGSSKDHILGFRDRYCPVSWPGGEESDAHPSF  65

Query  224  --VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              V  G+E+ LQ  LD++H+R   YVA+LF+ASWCPFSR F+P FS++SSL   +PHFAI
Sbjct  66   GSVTRGNERCLQIMLDMIHKRECKYVAVLFFASWCPFSRSFRPTFSIISSLYSSIPHFAI  125

Query  398  EES  406
            EES
Sbjct  126  EES  128



>ref|XP_009417587.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417588.1| PREDICTED: 5'-adenylylsulfate reductase-like 3 [Musa acuminata 
subsp. malaccensis]
Length=450

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIK--SSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLF  307
            C + S  D I   PDS    D      +    V+EGDE +LQ+A  +V +   DYVALLF
Sbjct  154  CPRPSVVDTILGRPDSCWDSDSTLPLGAYQIGVVEGDEATLQKASSMVQKNREDYVALLF  213

Query  308  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            YASWCPFS+   P F ++S+L P + HFA EES
Sbjct  214  YASWCPFSKICHPNFQILSNLFPTIRHFAFEES  246



>ref|XP_002874503.1| hypothetical protein ARALYDRAFT_911058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50762.1| hypothetical protein ARALYDRAFT_911058 [Arabidopsis lyrata subsp. 
lyrata]
Length=296

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 57/93 (61%), Gaps = 10/93 (11%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCSTA--VIEGDEKSLQRALDVVHRRSHDYVALLF  307
            C K SAKD+I    D        KS+      V EGD++ LQ A +++ +   DYVALLF
Sbjct  30   CPKGSAKDYILGFQD--------KSALHRPAFVTEGDDQWLQMASEMIDKNKCDYVALLF  81

Query  308  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            YASWCPFSR  +P F ++S L   VPHFAIEES
Sbjct  82   YASWCPFSRLLRPSFDLMSLLYSSVPHFAIEES  114



>ref|XP_010455301.1| PREDICTED: 5'-adenylylsulfate reductase-like 6 [Camelina sativa]
Length=294

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 55/87 (63%), Gaps = 6/87 (7%)
 Frame = +2

Query  146  SAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCP  325
            SAKD+I    D +          S +V EGD++ LQ A D++ +   DYVALLFYASWCP
Sbjct  32   SAKDYILGFRDRSALYR------SGSVTEGDDRWLQVASDMIDKNKCDYVALLFYASWCP  85

Query  326  FSRKFKPIFSVVSSLLPWVPHFAIEES  406
            FSR  +P F ++S L   +PHFA+EES
Sbjct  86   FSRLLRPSFDLISLLYSSIPHFAVEES  112



>gb|ACG42026.1| APRL3 - Zea mays adenosine 5'-phosphosulfate reductase-like [Zea 
mays]
Length=324

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  161  IFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  340
            +   PD TCS  + +      VIEGDE +L RA++++H    DY+A+LFYASWCPFS++ 
Sbjct  45   VLRTPD-TCSTLDRRLGDPVGVIEGDEVTLARAVNLLHANKDDYIAVLFYASWCPFSQEC  103

Query  341  KPIFSVVSSLLPWVPHFAIEES  406
            KP F  ++ L P + HFA EES
Sbjct  104  KPNFETLAYLFPAIRHFAFEES  125



>ref|NP_001105765.1| adenosine 5'-phosphosulfate reductase-like3 precursor [Zea mays]
 gb|AAW63053.1| adenosine 5'-phosphosulfate reductase 3 [Zea mays]
 gb|ACF85092.1| unknown [Zea mays]
 gb|AFW64433.1| adenosine 5'-phosphosulfate reductase 3 [Zea mays]
Length=323

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  161  IFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  340
            +   PD TCS  + +      VIEGDE +L RA++++H    DY+A+LFYASWCPFS++ 
Sbjct  44   VLRTPD-TCSTLDRRLGDPVGVIEGDEVTLARAVNLLHANKDDYIAVLFYASWCPFSQEC  102

Query  341  KPIFSVVSSLLPWVPHFAIEES  406
            KP F  ++ L P + HFA EES
Sbjct  103  KPNFETLAYLFPAIRHFAFEES  124



>ref|NP_001136871.1| hypothetical protein precursor [Zea mays]
 gb|ACF82798.1| unknown [Zea mays]
 gb|AFW64434.1| hypothetical protein ZEAMMB73_577944 [Zea mays]
Length=188

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +2

Query  161  IFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  340
            +   PD TCS  + +      VIEGDE +L RA++++H    DY+A+LFYASWCPFS++ 
Sbjct  44   VLRTPD-TCSTLDRRLGDPVGVIEGDEVTLARAVNLLHANKDDYIAVLFYASWCPFSQEC  102

Query  341  KPIFSVVSSLLPWVPHFAIEES  406
            KP F  ++ L P + HFA EES
Sbjct  103  KPNFETLAYLFPAIRHFAFEES  124



>dbj|BAK05689.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=321

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 72/125 (58%), Gaps = 1/125 (1%)
 Frame = +2

Query  32   MARLREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSS  211
            M R   WRA  ALL+++  +    +  AP     C   +A + +   P  TCS  + +  
Sbjct  1    MGRGSPWRAAAALLLLLLLVAAGRSSAAPARPGACPVPAAAEAVLG-PPRTCSPLDRRLG  59

Query  212  CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  391
                VIEGDE +L RA+++++    +Y+A+LFYASWCPFS++ KP F  ++ L P + HF
Sbjct  60   DPVGVIEGDEATLARAVNLLYLNKDEYIAVLFYASWCPFSQECKPNFEKLAHLFPTIRHF  119

Query  392  AIEES  406
            A EES
Sbjct  120  AFEES  124



>dbj|BAE99715.1| protein disulfide isomerase like protein [Arabidopsis thaliana]
Length=176

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 58/94 (62%), Gaps = 11/94 (12%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCSTA--VIEGDEKSLQRALDVVHRRSH-DYVALL  304
            C + SAKD+I    D        KS+      V EGD++ LQ A D+V +++  DY ALL
Sbjct  29   CPRESAKDYILGFRD--------KSALHRPGFVTEGDDRWLQMAADMVDKKNKCDYAALL  80

Query  305  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            FYASWCPFSR  +P F ++S L   VPHFAIEES
Sbjct  81   FYASWCPFSRLVRPSFDLMSLLYSSVPHFAIEES  114



>ref|NP_001117412.1| 5'-adenylylsulfate reductase-like 4 [Arabidopsis thaliana]
 gb|AEE31739.1| 5'-adenylylsulfate reductase-like 4 [Arabidopsis thaliana]
Length=281

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 48/69 (70%), Gaps = 3/69 (4%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCS---TAVIEGDEKSLQRALDVVHRRSHDYVALL  304
            C+  SAKD IF L D TCS+  ++S       AV EGDE+ LQ ALD++H+   DYVALL
Sbjct  28   CATKSAKDSIFGLRDQTCSVSGVESDERPRFVAVTEGDERWLQIALDMIHKNKCDYVALL  87

Query  305  FYASWCPFS  331
            FYASWCPFS
Sbjct  88   FYASWCPFS  96



>ref|XP_006647922.1| PREDICTED: LOW QUALITY PROTEIN: 5'-adenylylsulfate reductase-like 
3-like [Oryza brachyantha]
Length=312

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 61/98 (62%), Gaps = 3/98 (3%)
 Frame = +2

Query  113  APFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDY  292
            +P P  C    +A++ +   P  TC+  + +      VIEGDE +L +A+ ++H    DY
Sbjct  22   SPLPESCPVPTAAEEVLG--PQRTCAPLDRRGD-PVGVIEGDEVTLAKAVALLHMNKDDY  78

Query  293  VALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +A+LFYASWCPFS++ KP F +++SL P + HF  EES
Sbjct  79   IAVLFYASWCPFSQECKPNFEILASLFPAIRHFTFEES  116



>ref|NP_192632.2| protein APR-like 6 [Arabidopsis thaliana]
 sp|Q9ZPE9.2|APRL6_ARATH RecName: Full=5'-adenylylsulfate reductase-like 6; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 6; Short=APR-like 
6; Short=AtAPRL6; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE82697.1| protein APR-like 6 [Arabidopsis thaliana]
Length=295

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 58/94 (62%), Gaps = 11/94 (12%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCSTA--VIEGDEKSLQRALDVVHRRSH-DYVALL  304
            C + SAKD+I    D        KS+      V EGD++ LQ A D+V +++  DY ALL
Sbjct  29   CPRESAKDYILGFRD--------KSALHRPGFVTEGDDRWLQMAADMVDKKNKCDYAALL  80

Query  305  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            FYASWCPFSR  +P F ++S L   VPHFAIEES
Sbjct  81   FYASWCPFSRLVRPSFDLMSLLYSSVPHFAIEES  114



>ref|NP_001105802.1| adenosine 5'-phosphosulfate reductase-like4 precursor [Zea mays]
 gb|AAW63054.1| adenosine 5'-phosphosulfate reductase 4 [Zea mays]
 gb|AFW73496.1| adenosine 5'-phosphosulfate reductase 4 [Zea mays]
Length=321

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 68/127 (54%), Gaps = 14/127 (11%)
 Frame = +2

Query  38   RLREWRAGMALLMIVGRLTCAHTLTA----PFPALCCSKYSAKDWIFALPDSTCSIDEIK  205
            RL  W A +   ++ G  T A         P P +  S    +D        TCS  ++ 
Sbjct  4    RLPLWTALLLPFLLTGVGTAAAASPPHDECPVPTIVESVLGTRD--------TCSTLDLG  55

Query  206  SSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVP  385
            +     V+EGDE +L  A++++H    DY+A+LFYASWCPFS++ KP F  ++SL P + 
Sbjct  56   NPV--GVVEGDEFTLATAVNLLHANKDDYIAVLFYASWCPFSQECKPNFETLASLFPTIR  113

Query  386  HFAIEES  406
            HFA EES
Sbjct  114  HFAFEES  120



>gb|AAD17368.1| contains similarity to protein disulfide isomerases [Arabidopsis 
thaliana]
 emb|CAB78017.1| putative protein disulfide isomerase [Arabidopsis thaliana]
Length=327

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 58/94 (62%), Gaps = 11/94 (12%)
 Frame = +2

Query  134  CSKYSAKDWIFALPDSTCSIDEIKSSCSTA--VIEGDEKSLQRALDVVHRRSH-DYVALL  304
            C + SAKD+I    D        KS+      V EGD++ LQ A D+V +++  DY ALL
Sbjct  29   CPRESAKDYILGFRD--------KSALHRPGFVTEGDDRWLQMAADMVDKKNKCDYAALL  80

Query  305  FYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            FYASWCPFSR  +P F ++S L   VPHFAIEES
Sbjct  81   FYASWCPFSRLVRPSFDLMSLLYSSVPHFAIEES  114



>ref|XP_010916845.1| PREDICTED: LOW QUALITY PROTEIN: 5'-adenylylsulfate reductase-like 
4 [Elaeis guineensis]
Length=148

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 67/125 (54%), Gaps = 4/125 (3%)
 Frame = +2

Query  44   REWRAGMALLMIVG--RLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSID--EIKSS  211
            R W  G  LL+ +G   L+ + TL +      C + SA D I     S  +++    +  
Sbjct  4    RAWMPGFLLLLAIGVASLSGSDTLGSVSVDGLCPRVSAGDSILGDQHSCAAVNFPPHEEQ  63

Query  212  CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  391
             S     G E +L  AL +++R+   + A+LFY S CPFS+ F+P F V+SSL P V HF
Sbjct  64   SSNVTEGGGEYALLVALQLIYRKQGPFTAVLFYDSRCPFSKAFQPSFDVLSSLXPTVLHF  123

Query  392  AIEES  406
            A+EES
Sbjct  124  AVEES  128



>ref|XP_006853185.1| hypothetical protein AMTR_s00038p00202780 [Amborella trichopoda]
 gb|ERN14652.1| hypothetical protein AMTR_s00038p00202780 [Amborella trichopoda]
Length=255

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +2

Query  176  DSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            DS C I       + AV+  +E SL+RAL+++H+ S  YVA+LFYASWCPFS+  K  F+
Sbjct  51   DSICPIASRVEVPTVAVV--NEISLERALNLIHKNSEKYVAILFYASWCPFSKICKTSFA  108

Query  356  VVSSLLPWVPHFAIEES  406
            ++ SL P + HFA+EES
Sbjct  109  ILPSLFPTIHHFAVEES  125



>ref|XP_007222968.1| hypothetical protein PRUPE_ppa008937mg [Prunus persica]
 gb|EMJ24167.1| hypothetical protein PRUPE_ppa008937mg [Prunus persica]
Length=241

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  266  VVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +VH+ +H+YVA+LFYASWCPFSR FKP FS+++S  P +PHFA EES
Sbjct  1    MVHKNTHEYVAVLFYASWCPFSRMFKPTFSILASSYPSIPHFAFEES  47



>ref|XP_010543943.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X3 [Tarenaya 
hassleriana]
Length=250

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +2

Query  230  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +G+E+ LQ  LD++H+R   YVA+LF+ASWCPFSR F+P FS++SSL   +PHFAIEES
Sbjct  23   QGNERCLQIMLDMIHKRECKYVAVLFFASWCPFSRSFRPTFSIISSLYSSIPHFAIEES  81



>ref|XP_003574474.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X1 [Brachypodium 
distachyon]
Length=257

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +2

Query  215  STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFA  394
            +  V+EGD+  LQRA+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+
Sbjct  55   NVGVVEGDDGVLQRAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFS  114

Query  395  IEES  406
             EES
Sbjct  115  FEES  118



>ref|XP_006660127.1| PREDICTED: 5'-adenylylsulfate reductase-like 4-like, partial 
[Oryza brachyantha]
Length=204

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
             V+EGD+  LQ+A+ +V +   D++A+LFYASWCPFS+ F+  F  +SSL P + HF+ E
Sbjct  4    GVVEGDDAVLQKAVTLVLQNREDFIAILFYASWCPFSKIFRTDFQKLSSLFPTIAHFSFE  63

Query  401  ES  406
            ES
Sbjct  64   ES  65



>gb|ABK24398.1| unknown [Picea sitchensis]
Length=317

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  224  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  403
            V E D  SL+ A D++ R S+ Y+A+LFYASWCPFS++ +P+F+V+SS+ P + H A+EE
Sbjct  58   VRELDAVSLEAAFDILQRSSNTYIAVLFYASWCPFSKQCRPVFNVLSSMFPTIHHVAVEE  117

Query  404  S  406
            S
Sbjct  118  S  118



>ref|XP_001762516.1| predicted protein [Physcomitrella patens]
 gb|EDQ72639.1| predicted protein, partial [Physcomitrella patens]
Length=175

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  224  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  403
            V++ +E +L++ALD+VH  +  Y+A+L YA+WCPFSR+ +P++ V+S++ P V H AIEE
Sbjct  1    VVQLNETTLEKALDLVHSSNGTYMAVLHYATWCPFSRQVRPVYDVLSTIFPTVHHVAIEE  60

Query  404  S  406
            S
Sbjct  61   S  61



>gb|ACF81335.1| unknown [Zea mays]
 tpg|DAA49110.1| TPA: hypothetical protein ZEAMMB73_397264 [Zea mays]
Length=149

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +EGD+ +LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ EES
Sbjct  69   VEGDDGALQKAVALVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEES  128



>sp|Q5DJV7.1|APRL4_ORYSJ RecName: Full=5'-adenylylsulfate reductase-like 4; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 4; Short=APR-like 
4; Short=OsAPRL4; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAX14678.1| adenosine 5'-phosphosulfate reductase-like [Oryza sativa Japonica 
Group]
Length=264

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              V+EGD+  LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ 
Sbjct  63   VGVVEGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSF  122

Query  398  EES  406
            EES
Sbjct  123  EES  125



>gb|EEC83570.1| hypothetical protein OsI_29227 [Oryza sativa Indica Group]
Length=274

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
              V+EGD+  LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ 
Sbjct  73   VGVVEGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSF  132

Query  398  EES  406
            EES
Sbjct  133  EES  135



>ref|NP_001105766.1| adenosine 5'-phosphosulfate reductase-like5 precursor [Zea mays]
 gb|AAW63055.1| adenosine 5'-phosphosulfate reductase 5 [Zea mays]
 gb|ACF84100.1| unknown [Zea mays]
 tpg|DAA49109.1| TPA: adenosine 5'-phosphosulfate reductase 5 [Zea mays]
Length=267

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +EGD+ +LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ EES
Sbjct  69   VEGDDGALQKAVALVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEES  128



>dbj|BAC99693.1| disulfide isomerase-like protein [Oryza sativa Japonica Group]
Length=287

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
             V+EGD+  LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ E
Sbjct  81   GVVEGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFE  140

Query  401  ES  406
            ES
Sbjct  141  ES  142



>ref|XP_010235118.1| PREDICTED: 5'-adenylylsulfate reductase-like 4 isoform X2 [Brachypodium 
distachyon]
Length=220

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  230  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            EGD+  LQRA+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ EES
Sbjct  23   EGDDGVLQRAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEES  81



>ref|XP_004974687.1| PREDICTED: LOW QUALITY PROTEIN: 5'-adenylylsulfate reductase-like 
4-like [Setaria italica]
Length=373

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
             V+EGD+ +LQ+A+ +V     D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ E
Sbjct  173  GVVEGDDGALQKAIALVLHNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFE  232

Query  401  ES  406
            ES
Sbjct  233  ES  234



>ref|NP_001175575.1| Os08g0412401 [Oryza sativa Japonica Group]
 dbj|BAH94303.1| Os08g0412401 [Oryza sativa Japonica Group]
Length=140

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  230  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +GD+  LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ EES
Sbjct  16   QGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEES  74



>ref|XP_002444324.1| hypothetical protein SORBIDRAFT_07g020170 [Sorghum bicolor]
 gb|EES13819.1| hypothetical protein SORBIDRAFT_07g020170 [Sorghum bicolor]
Length=272

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
             V+EGD+ +LQ+A+ +V +   D+VA+LFYASWCPFS+ F   F  +SS  P + HF+ E
Sbjct  72   GVVEGDDGALQKAVALVLQNREDFVAILFYASWCPFSKIFWTDFQKLSSFFPTIAHFSFE  131

Query  401  ES  406
            ES
Sbjct  132  ES  133



>ref|XP_006656789.1| PREDICTED: 5'-adenylylsulfate reductase-like 2-like [Oryza brachyantha]
Length=298

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 66/125 (53%), Gaps = 7/125 (6%)
 Frame = +2

Query  38   RLREWRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCS  217
            RL  W A + LL     L+ A T+ A   A  C + SA   I    D  C    ++    
Sbjct  2    RLLWWWAALPLL-----LSVAGTVVASSTAPACPRPSAAVVIVGSHDEACWPLPLRRPLG  56

Query  218  T--AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  391
                VIEGD+ +L RA+ +++    D+ A+LFYASWCPFS++ +  F  ++ + P + HF
Sbjct  57   DRLGVIEGDDATLARAVKLLNMNKEDFAAVLFYASWCPFSQECRLRFEKLAFIFPTIRHF  116

Query  392  AIEES  406
            A EES
Sbjct  117  AFEES  121



>gb|EEE68672.1| hypothetical protein OsJ_27290 [Oryza sativa Japonica Group]
Length=200

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  230  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +GD+  LQ+A+ +V +   D+VA+LFYASWCPFS+ F+  F  +SS  P + HF+ EES
Sbjct  3    QGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEES  61



>gb|EMS61645.1| putative pectin methyltransferase QUA2 [Triticum urartu]
Length=730

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  233  GDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            GDE +L RA+++++    +Y+A+LFYASWCPFS++ KP F  ++ L P + HFA EES
Sbjct  476  GDEATLARAVNLLYLNKDEYIAVLFYASWCPFSQECKPNFEKLAHLFPTIRHFAFEES  533



>gb|KDO55016.1| hypothetical protein CISIN_1g0462602mg, partial [Citrus sinensis]
Length=144

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 7/82 (9%)
 Frame = +2

Query  176  DSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  340
            DS   ++ ++S C   +      E D + L RAL    R +  Y ++LFYASWCPFSR  
Sbjct  33   DSVVFLNNLQSQCPPGISPNPPFEVDGEFLDRALTSKQRNA--YTSVLFYASWCPFSRDV  90

Query  341  KPIFSVVSSLLPWVPHFAIEES  406
            +P F  +SS+ P + H+ IE+S
Sbjct  91   RPTFEALSSMFPQMEHYTIEQS  112



>ref|XP_003564162.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Brachypodium 
distachyon]
Length=305

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 8/78 (10%)
 Frame = +2

Query  191  IDEIKSSCSTAVIEGDE------KSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIF  352
            +D + S C  A IE         ++L + L++  RRS    ++LFYA+WCPFS KF+PIF
Sbjct  46   LDALGSRCPRARIEPSPPLEVRGEALDKQLNL--RRSGASYSILFYAAWCPFSSKFRPIF  103

Query  353  SVVSSLLPWVPHFAIEES  406
              +S++ P + HFA+EES
Sbjct  104  EALSTMFPQIHHFAVEES  121



>gb|KJB46049.1| hypothetical protein B456_007G345900 [Gossypium raimondii]
Length=299

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 7/77 (9%)
 Frame = +2

Query  191  IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            I+ ++  CS ++     +E D   L RAL    R  + YV++LFYASWCPFSR+ +P F 
Sbjct  36   IENLRFQCSPSLSPIPPLEVDGNFLDRALTSKQR--NGYVSVLFYASWCPFSRRLRPKFD  93

Query  356  VVSSLLPWVPHFAIEES  406
            ++ S+ P + H A+EES
Sbjct  94   IIGSMFPQLEHLAVEES  110



>ref|NP_001057172.1| Os06g0220800 [Oryza sativa Japonica Group]
 sp|Q67VZ8.1|APRL2_ORYSJ RecName: Full=5'-adenylylsulfate reductase-like 2; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 2; Short=APR-like 
2; Short=OsAPRL2; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD37671.1| disulfide isomerase-like protein [Oryza sativa Japonica Group]
 dbj|BAD37254.1| disulfide isomerase-like protein [Oryza sativa Japonica Group]
 gb|AAX14677.1| adenosine 5'-phosphosulfate reductase-like [Oryza sativa Japonica 
Group]
 dbj|BAF19086.1| Os06g0220800 [Oryza sativa Japonica Group]
 gb|EEE65349.1| hypothetical protein OsJ_20625 [Oryza sativa Japonica Group]
Length=282

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
             V EGD+  L RA++++H    D+ A+LFYASWCPFS++ +  F  ++ + P + H AIE
Sbjct  51   GVTEGDDAILARAVNLLHANKEDFAAVLFYASWCPFSQECRLRFEKLACIFPTIRHLAIE  110

Query  401  ES  406
            ES
Sbjct  111  ES  112



>gb|EEC80244.1| hypothetical protein OsI_22194 [Oryza sativa Indica Group]
Length=282

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  221  AVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIE  400
             V EGD+  L RA++++H    D+ A+LFYASWCPFS++ +  F  ++ + P + H AIE
Sbjct  51   GVTEGDDAILARAVNLLHANKEDFAAVLFYASWCPFSQECRLRFEKLACIFPTIRHLAIE  110

Query  401  ES  406
            ES
Sbjct  111  ES  112



>gb|KHG08455.1| 5'-adenylylsulfate reductase-like 4 [Gossypium arboreum]
Length=252

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 63/121 (52%), Gaps = 18/121 (15%)
 Frame = +2

Query  50   WRAGMALLMIVGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSI--DEIKSSCSTA  223
            W   + +L +  RLTCA  ++ P     C K S  + +F   DS CSI  D I+S  S  
Sbjct  6    WEMRILILFLWWRLTCA--VSVPVRVPLCPKNSVLEAVFDFRDSFCSIHSDFIESIDSVG  63

Query  224  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  403
            V EGDE SLQ+AL++V       + +    S       F+P F  +SS  P +PHFA++E
Sbjct  64   VTEGDEISLQKALNMV-------MGIFMNMS-------FRPSFLTLSSSYPSIPHFAVKE  109

Query  404  S  406
            S
Sbjct  110  S  110



>gb|ACF88355.1| unknown [Zea mays]
 gb|AFW67289.1| hypothetical protein ZEAMMB73_867650 [Zea mays]
Length=133

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 6/77 (8%)
 Frame = +2

Query  191  IDEIKSSCSTAVIEGDEKSLQRALDV-----VHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            +D + S C    IE       R   V     + RR   Y ++LFYA+WCPFS KF+PIF 
Sbjct  39   LDAVGSRCPFVRIEPSPPLEVRGEAVDTELNLRRRGASY-SILFYAAWCPFSSKFRPIFE  97

Query  356  VVSSLLPWVPHFAIEES  406
             VS++ P V HFA+EES
Sbjct  98   TVSTMYPQVHHFAVEES  114



>gb|KFK37812.1| hypothetical protein AALP_AA3G032500 [Arabis alpina]
Length=641

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +2

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
            T  IE D  SL R +D+ H  +  Y+++LFYASWCPFSR  +P F ++SS+ P V H A+
Sbjct  52   TPPIEVDGDSLDRLVDLNHGNA--YMSVLFYASWCPFSRAVRPKFDMLSSMFPQVQHLAV  109

Query  398  EES  406
            E S
Sbjct  110  EHS  112



>ref|XP_006479121.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like [Citrus sinensis]
Length=295

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 7/82 (9%)
 Frame = +2

Query  176  DSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  340
            DS   ++ ++S C   +      E D + L RAL    R +  Y ++LFYASWCPFSR  
Sbjct  33   DSVVFLNNLQSQCPPGISPNPPFEVDGEFLDRALTSKQRNA--YTSVLFYASWCPFSRDV  90

Query  341  KPIFSVVSSLLPWVPHFAIEES  406
            +P F  +SS+ P + H+ IE+S
Sbjct  91   RPTFEALSSMFPQMEHYTIEQS  112



>ref|XP_002882315.1| hypothetical protein ARALYDRAFT_477638 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58574.1| hypothetical protein ARALYDRAFT_477638 [Arabidopsis lyrata subsp. 
lyrata]
Length=300

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            IE D  SL R +D  H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H A+E S
Sbjct  57   IEVDGDSLDRVMDSNH--GNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPHIQHLAVEHS  114



>gb|KHG25607.1| 5'-adenylylsulfate reductase-like 7 [Gossypium arboreum]
Length=299

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 7/77 (9%)
 Frame = +2

Query  191  IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            I+ ++  CST++     +E D   L RAL    R  H  V++L Y SWCPFSR+ +P F 
Sbjct  36   IENLRFQCSTSLSPIPPLEVDGNFLDRALTSKQRNGH--VSVLLYGSWCPFSRRLRPKFD  93

Query  356  VVSSLLPWVPHFAIEES  406
             + S+ P + H A+EES
Sbjct  94   FIGSMFPQLEHLAVEES  110



>ref|XP_008644294.1| PREDICTED: adenosine 5'-phosphosulfate reductase-like9 isoform 
X1 [Zea mays]
Length=296

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = +2

Query  191  IDEIKSSCSTAVIEGDEKSLQR--ALDV---VHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            +D + S C    IE       R  A+D    + RR   Y ++LFYA+WCPFS KF+PIF 
Sbjct  39   LDAVGSRCPFVRIEPSPPLEVRGEAVDTELNLRRRGASY-SILFYAAWCPFSSKFRPIFE  97

Query  356  VVSSLLPWVPHFAIEES  406
             VS++ P V HFA+EES
Sbjct  98   TVSTMYPQVHHFAVEES  114



>ref|NP_001105807.1| adenosine 5'-phosphosulfate reductase-like9 precursor [Zea mays]
 gb|AAW63059.1| adenosine 5'-phosphosulfate reductase 9 [Zea mays]
 gb|ACG46319.1| APRL5 - Zea mays adenosine 5'-phosphosulfate reductase-like [Zea 
mays]
 gb|ACN27775.1| unknown [Zea mays]
 gb|AFW67290.1| APRL5-Zea mays adenosine 5'-phosphosulfate reductase-likeAdenosine 
5'-phosphosulfate reductase 9 [Zea mays]
Length=300

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = +2

Query  191  IDEIKSSCSTAVIEGDEKSLQR--ALDV---VHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            +D + S C    IE       R  A+D    + RR   Y ++LFYA+WCPFS KF+PIF 
Sbjct  39   LDAVGSRCPFVRIEPSPPLEVRGEAVDTELNLRRRGASY-SILFYAAWCPFSSKFRPIFE  97

Query  356  VVSSLLPWVPHFAIEES  406
             VS++ P V HFA+EES
Sbjct  98   TVSTMYPQVHHFAVEES  114



>ref|XP_009408458.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +E D +SL   +++ H  S+ Y ++LFYASWCPFS   +PIF V+SS+ P   HF +EES
Sbjct  57   LEVDGESLD--IELSHGESNGYYSVLFYASWCPFSSSIRPIFDVLSSMFPQTKHFLVEES  114



>gb|KHG25608.1| 5'-adenylylsulfate reductase-like 5 [Gossypium arboreum]
Length=269

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 7/76 (9%)
 Frame = +2

Query  191  IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            I+ ++  CST++     +E D   L RAL    R  H  V++L Y SWCPFSR+ +P F 
Sbjct  36   IENLRFQCSTSLSPIPPLEVDGNFLDRALTSKQRNGH--VSVLLYGSWCPFSRRLRPKFD  93

Query  356  VVSSLLPWVPHFAIEE  403
             + S+ P + H A+EE
Sbjct  94   FIGSMFPQLEHLAVEE  109



>ref|XP_010054630.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 isoform X1 [Eucalyptus 
grandis]
 gb|KCW89877.1| hypothetical protein EUGRSUZ_A02105 [Eucalyptus grandis]
Length=304

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 59/112 (53%), Gaps = 12/112 (11%)
 Frame = +2

Query  89   LTCAHTLTAPFPALCCSKYSAKDWIFALP-DSTCSIDEIKSSCSTAV-----IEGDEKSL  250
            L C   L++P  A   S  SA     A P +    +  ++S CS ++     ++G+   L
Sbjct  12   LVCIGLLSSPLAARLVSPESAT----ACPREPPAFLIGLRSQCSGSISPSPPLQGNGNFL  67

Query  251  QRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
             R L   H     Y A+LFYASWCPFS+  +PI+  +SS+ P + H A+E+S
Sbjct  68   DRFLMSKHHS--GYTAVLFYASWCPFSQSIRPIYEALSSMFPQIDHLAVEQS  117



>gb|KFK37822.1| hypothetical protein AALP_AA3G033700 [Arabis alpina]
Length=302

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = +2

Query  203  KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  382
            +S   T  IE D  SL R +D+     + Y+++LFYASWCPFSR  +P F ++SS+ P V
Sbjct  50   RSLYPTPPIEVDGDSLDRLMDL--NLGNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQV  107

Query  383  PHFAIEES  406
             H A+E S
Sbjct  108  QHLAVEHS  115



>ref|NP_001105767.1| adenosine 5'-phosphosulfate reductase6 precursor [Zea mays]
 gb|AAW63056.1| adenosine 5'-phosphosulfate reductase 6 [Zea mays]
 gb|ACF80807.1| unknown [Zea mays]
 gb|AFW56502.1| APRL6-Zea mays adenosine 5'-phosphosulfate reductase-like protein 
[Zea mays]
Length=303

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 6/76 (8%)
 Frame = +2

Query  179  STCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  358
            ++C +     S    V+ G+E  L R LD       ++ A+LFYASWCPFS + +P+F  
Sbjct  49   ASCPVSTEGYSPPEEVVNGEE--LLRLLD----GKEEHTAVLFYASWCPFSERIRPVFDD  102

Query  359  VSSLLPWVPHFAIEES  406
            +SS+ P V H AIEES
Sbjct  103  LSSMFPRVKHLAIEES  118



>emb|CBI29948.3| unnamed protein product [Vitis vinifera]
Length=260

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (61%), Gaps = 6/84 (7%)
 Frame = +2

Query  155  DWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSR  334
            D++ A   S C +    S  S A+++ D   L RAL    ++ + + ++LF+ASWCPFS 
Sbjct  33   DFLVAFLQSQCPL----SLSSHALLDVDGNFLDRAL--TSKQGNGFTSVLFHASWCPFSC  86

Query  335  KFKPIFSVVSSLLPWVPHFAIEES  406
            K +P F V+SS+ P + H AI+ES
Sbjct  87   KMRPKFEVLSSMFPQIEHLAIKES  110



>gb|ACG34292.1| APRL6 - Zea mays adenosine 5'-phosphosulfate reductase-like [Zea 
mays]
Length=302

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 6/76 (8%)
 Frame = +2

Query  179  STCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  358
            ++C +     S    V+ G+E  L R LD       ++ A+LFYASWCPFS + +P+F  
Sbjct  49   ASCPVSTEGYSPPEEVVNGEE--LLRLLD----GKEEHTAVLFYASWCPFSERIRPVFDD  102

Query  359  VSSLLPWVPHFAIEES  406
            +SS+ P V H AIEES
Sbjct  103  LSSMFPRVKHLAIEES  118



>ref|XP_002443304.1| hypothetical protein SORBIDRAFT_08g017260 [Sorghum bicolor]
 gb|EES17142.1| hypothetical protein SORBIDRAFT_08g017260 [Sorghum bicolor]
Length=299

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = +2

Query  179  STCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  358
            ++C +     S    V+ G+E  L R LD       ++ A+LFYASWCPFS++ +P+F  
Sbjct  53   ASCPVSTEGYSPPEEVVNGEE--LLRMLD----SKEEHTAVLFYASWCPFSQRIRPVFDD  106

Query  359  VSSLLPWVPHFAIEES  406
            +SS+ P V H A+EES
Sbjct  107  LSSMFPRVKHVAVEES  122



>ref|XP_007151851.1| hypothetical protein PHAVU_004G080800g [Phaseolus vulgaris]
 ref|XP_007151852.1| hypothetical protein PHAVU_004G080800g [Phaseolus vulgaris]
 gb|ESW23845.1| hypothetical protein PHAVU_004G080800g [Phaseolus vulgaris]
 gb|ESW23846.1| hypothetical protein PHAVU_004G080800g [Phaseolus vulgaris]
Length=305

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +2

Query  197  EIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  361
             ++S C  ++     ++ D   L R L    R+S +Y+++LFYASWCPFS+K  P F +V
Sbjct  44   NLQSQCPISIPTNPPLQVDGNILDRVLS--SRKSIEYISILFYASWCPFSQKMLPQFELV  101

Query  362  SSLLPWVPHFAIEES  406
            SS+ P V H  +E+S
Sbjct  102  SSMFPQVEHLILEQS  116



>gb|AGV54233.1| 5'-adenylylsulfate reductase-like protein [Phaseolus vulgaris]
Length=305

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +2

Query  197  EIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  361
             ++S C  ++     ++ D   L R L    R+S +Y+++LFYASWCPFS+K  P F +V
Sbjct  44   NLQSQCPISIPTNPPLQVDGNILDRVLS--SRKSIEYISILFYASWCPFSQKMLPQFELV  101

Query  362  SSLLPWVPHFAIEES  406
            SS+ P V H  +E+S
Sbjct  102  SSMFPQVEHLILEQS  116



>ref|XP_002276765.2| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Vitis vinifera]
Length=298

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (61%), Gaps = 6/84 (7%)
 Frame = +2

Query  155  DWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSR  334
            D++ A   S C +    S  S A+++ D   L RAL    ++ + + ++LF+ASWCPFS 
Sbjct  33   DFLVAFLQSQCPL----SLSSHALLDVDGNFLDRAL--TSKQGNGFTSVLFHASWCPFSC  86

Query  335  KFKPIFSVVSSLLPWVPHFAIEES  406
            K +P F V+SS+ P + H AI+ES
Sbjct  87   KMRPKFEVLSSMFPQIEHLAIKES  110



>ref|XP_011021471.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Populus euphratica]
Length=296

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 50/82 (61%), Gaps = 7/82 (9%)
 Frame = +2

Query  176  DSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  340
            +S  S+  I+S C  ++     ++ D K L RAL    ++++ Y ++LFYASWCPFSR  
Sbjct  26   ESALSLHHIRSQCPVSIPPNPPLQVDGKFLDRAL--TSKQTYAYTSVLFYASWCPFSRSM  83

Query  341  KPIFSVVSSLLPWVPHFAIEES  406
               F ++SS+ P + H A+E+S
Sbjct  84   LLKFEMLSSMFPQIKHLALEQS  105



>ref|XP_002325842.1| hypothetical protein POPTR_0019s05130g [Populus trichocarpa]
 gb|EEF00224.1| hypothetical protein POPTR_0019s05130g [Populus trichocarpa]
Length=296

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 7/82 (9%)
 Frame = +2

Query  176  DSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  340
            +S  S+  I+S C  ++     ++ D K L RAL    R +  Y ++LFYASWCPFSR  
Sbjct  26   ESALSLHHIQSQCPVSIPPNPPLQVDGKFLDRALTSKQRNA--YTSVLFYASWCPFSRSM  83

Query  341  KPIFSVVSSLLPWVPHFAIEES  406
               F ++SS+ P + H A+E+S
Sbjct  84   LLKFDMLSSMFPQIKHLALEQS  105



>ref|XP_009396929.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +E D +SL R L  +H  S  Y ++LFYASWCPFS   +P F+V+SS+ P + H   +ES
Sbjct  63   LEVDGESLDREL--IHGESKGYYSVLFYASWCPFSDNIRPTFNVLSSMFPQIKHLLADES  120



>emb|CDX92054.1| BnaC03g33560D [Brassica napus]
Length=303

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            IE D  SL R + + H     Y+++LFYASWCPFSR  +  F ++SS+ P + H A+E S
Sbjct  57   IEVDGDSLDRLMALSHDDGDAYMSVLFYASWCPFSRAVRTKFDMLSSMFPQIQHLAVEHS  116



>ref|XP_010257654.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Nelumbo nucifera]
Length=296

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 7/83 (8%)
 Frame = +2

Query  173  PDSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRK  337
            P S   ++ I+  C   +     IE D  SL+RAL    R +  Y ++LFY+ WCPFS  
Sbjct  26   PQSHLFLNRIQHQCPVEISPSPAIEVDGDSLERALGSNWRNT--YASVLFYSYWCPFSHG  83

Query  338  FKPIFSVVSSLLPWVPHFAIEES  406
             +P F  +SS+ P V H A+E+S
Sbjct  84   VRPTFDTLSSMFPQVRHLAVEQS  106



>ref|NP_566214.1| 5'-adenylylsulfate reductase-like 5 [Arabidopsis thaliana]
 sp|Q93YX4.1|APRL5_ARATH RecName: Full=5'-adenylylsulfate reductase-like 5; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 5; Short=APR-like 
5; Short=AtAPRL5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL24078.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14290.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74004.1| 5'-adenylylsulfate reductase-like 5 [Arabidopsis thaliana]
Length=300

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = +2

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
            T  IE D  SL R +   H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H A+
Sbjct  54   TPPIEVDGDSLDRLMASQH--GNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQHLAV  111

Query  398  EES  406
            E S
Sbjct  112  EHS  114



>ref|XP_010549678.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Tarenaya hassleriana]
 ref|XP_010549679.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Tarenaya hassleriana]
 ref|XP_010549680.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Tarenaya hassleriana]
 ref|XP_010549681.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Tarenaya hassleriana]
 ref|XP_010549682.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Tarenaya hassleriana]
Length=296

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +E D  +L R +D  H   + Y A+LFYASWCPFSR  +P F  ++S+ P + H  +E S
Sbjct  55   LEVDGDTLDRIMDAKH--GNGYTAVLFYASWCPFSRAIRPKFDALASMFPQIQHMVLEHS  112



>gb|EYU26001.1| hypothetical protein MIMGU_mgv1a022783mg, partial [Erythranthe 
guttata]
Length=270

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 49/77 (64%), Gaps = 7/77 (9%)
 Frame = +2

Query  191  IDEIKSSC-----STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            + ++ S C     S++ I+ D +SL+RA+    +  ++Y A+LFYASWCPFS  F+  FS
Sbjct  23   LHDLNSQCPLFIPSSSPIQVDGESLERAMSSSQK--NEYTAVLFYASWCPFSSIFQSKFS  80

Query  356  VVSSLLPWVPHFAIEES  406
             +SS+ P V H  +E++
Sbjct  81   TLSSMYPQVKHLMVEQT  97



>gb|AAF00632.1|AC009540_9 unknown protein [Arabidopsis thaliana]
Length=318

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = +2

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
            T  IE D  SL R +   H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H A+
Sbjct  54   TPPIEVDGDSLDRLMASQH--GNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQHLAV  111

Query  398  EES  406
            E S
Sbjct  112  EHS  114



>ref|XP_002525419.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36909.1| conserved hypothetical protein [Ricinus communis]
Length=297

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 7/82 (9%)
 Frame = +2

Query  176  DSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKF  340
            +S+  + +++S C   +     ++ D   L RAL    R S  Y ++LFYASWCPFSR  
Sbjct  30   ESSLLLYDLQSQCPLEIFPNPPLQVDGNFLDRALASNQRNS--YTSVLFYASWCPFSRII  87

Query  341  KPIFSVVSSLLPWVPHFAIEES  406
             P F ++ S+ P + HFAIE+S
Sbjct  88   CPKFDMLGSMFPQIEHFAIEQS  109



>ref|XP_009134747.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Brassica rapa]
 emb|CDX74204.1| BnaA03g28430D [Brassica napus]
Length=303

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            IE D  SL R + + H   + YV++LFYASWCPFSR  +  F ++S + P + H A+E S
Sbjct  57   IEVDGDSLDRLMALNHDDGNAYVSVLFYASWCPFSRAVRTKFDMLSLMFPQIQHLAVEHS  116



>gb|KDP39694.1| hypothetical protein JCGZ_02714 [Jatropha curcas]
Length=298

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 48/88 (55%), Gaps = 13/88 (15%)
 Frame = +2

Query  176  DSTCSIDEIKSSCS-----------TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWC  322
            DS C  + +  SC+              +E D K L RAL    R S    ++LFYASWC
Sbjct  26   DSVCPNESVLFSCNLQSQCPLSISPNPPLEVDGKFLDRALTSKQRNS--CTSILFYASWC  83

Query  323  PFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            PFS+  +P F+++ S+ P + HF++E+S
Sbjct  84   PFSQNMRPKFNMLGSMFPQIEHFSVEQS  111



>ref|XP_010515215.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Camelina sativa]
Length=299

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = +2

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
            T  IE D  SL R + + H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H  +
Sbjct  53   TPPIEVDGDSLDRLMALNH--GNAYMSVLFYASWCPFSRVMRPKFDMLSSMFPQIQHLTV  110

Query  398  EES  406
            E S
Sbjct  111  EHS  113



>gb|EMT06163.1| hypothetical protein F775_28438 [Aegilops tauschii]
Length=274

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  296  ALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            ++LFYA+WCPFS KF+PIF  +S++ P + HFA+EES
Sbjct  54   SILFYAAWCPFSSKFRPIFEALSTMFPQIHHFAVEES  90



>ref|XP_010485745.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Camelina sativa]
Length=298

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
 Frame = +2

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
            T  I+ D  SL R + + H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H  +
Sbjct  52   TPPIQVDGDSLDRLMALNH--GNAYISVLFYASWCPFSRALRPKFDMLSSMFPQIQHLTV  109

Query  398  EES  406
            E S
Sbjct  110  EHS  112



>ref|XP_004962823.1| PREDICTED: 5'-adenylylsulfate reductase-like 6-like [Setaria 
italica]
Length=307

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 8/76 (11%)
 Frame = +2

Query  179  STCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  358
            +TC +       S   + G+E  L R LD       +Y A+LFYASWCPFS++ +P+F  
Sbjct  55   ATCPVS--AEGYSAEEVNGEE--LVRMLD----GKKEYTAVLFYASWCPFSQRMRPLFDD  106

Query  359  VSSLLPWVPHFAIEES  406
            +SS+ P + H A+EES
Sbjct  107  LSSMFPQIKHLAVEES  122



>ref|XP_006408248.1| hypothetical protein EUTSA_v10021238mg [Eutrema salsugineum]
 gb|ESQ49701.1| hypothetical protein EUTSA_v10021238mg [Eutrema salsugineum]
Length=297

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +2

Query  230  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            E D  SL R + + H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H A+E S
Sbjct  54   EVDGDSLDRLMALNH--GNAYLSVLFYASWCPFSRALRPKFDLLSSMFPQIQHLAVEHS  110



>ref|XP_004981363.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like isoform X2 
[Setaria italica]
Length=303

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  269  VHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            + RR   Y ++LFYA+WCPFS KF+PIF  +S++ P + HFA+EES
Sbjct  79   LRRRGASY-SILFYAAWCPFSSKFRPIFEALSTMYPQIHHFAVEES  123



>ref|XP_004981362.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like isoform X1 
[Setaria italica]
Length=307

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = +2

Query  269  VHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            + RR   Y ++LFYA+WCPFS KF+PIF  +S++ P + HFA+EES
Sbjct  79   LRRRGASY-SILFYAAWCPFSSKFRPIFEALSTMYPQIHHFAVEES  123



>ref|XP_002871802.1| hypothetical protein ARALYDRAFT_909820 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48061.1| hypothetical protein ARALYDRAFT_909820 [Arabidopsis lyrata subsp. 
lyrata]
Length=290

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = +2

Query  185  CSIDEI--KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  358
            C I++I  +S   +   E D   L + +D  H   + Y ++LFYASWCPFSR  +P F V
Sbjct  38   CEIEQICPRSLYPSPPFEVDGDLLDKLMDTNH--GNAYTSILFYASWCPFSRAVRPKFDV  95

Query  359  VSSLLPWVPHFAIEES  406
            +SS+ P + H  +E+S
Sbjct  96   LSSMSPHIKHLIVEQS  111



>ref|XP_009795826.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Nicotiana sylvestris]
Length=297

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 55/103 (53%), Gaps = 9/103 (9%)
 Frame = +2

Query  119  FPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAV-------IEGDEKSLQRALDVVHR  277
            +  + C  +SA  ++F+  ++   + +++S C   +       +E D +SL +AL    +
Sbjct  7    YIVILCYVFSAFGYVFSSYNTNTFLYDLRSQCPLRISFPPPLLVETDGESLDKALGSSQK  66

Query  278  RSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
               D  A+LFYASWCPFS   K  F  ++S+ P + H  +E+S
Sbjct  67   --DDVTAILFYASWCPFSTDVKSKFGALNSMFPRIRHVMVEQS  107



>emb|CDY29967.1| BnaC01g40410D [Brassica napus]
Length=298

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 6/75 (8%)
 Frame = +2

Query  197  EIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  361
            +I S C      T  IE D  SL R +   H   + Y+++LFYASWCPFSR  +P F ++
Sbjct  38   DIHSKCPPSMYPTPPIEVDGDSLDRVMAFNHD-GNAYMSVLFYASWCPFSRALRPKFDML  96

Query  362  SSLLPWVPHFAIEES  406
            SS+ P + H A++ S
Sbjct  97   SSMFPQIHHLAVDHS  111



>ref|XP_010463851.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Camelina sativa]
Length=299

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            I+ D  SL R + + H   + Y+++LFYASWCPFSR  +P F ++SS+ P + H  +E S
Sbjct  56   IQVDGDSLDRLMALNH--GNAYMSVLFYASWCPFSRALRPKFDMLSSMFPQIQHLTVEHS  113



>ref|XP_006443434.1| hypothetical protein CICLE_v100214292mg, partial [Citrus clementina]
 gb|ESR56674.1| hypothetical protein CICLE_v100214292mg, partial [Citrus clementina]
Length=239

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 2/57 (4%)
 Frame = +2

Query  236  DEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            D + L RAL    R +  Y ++LFYASWCPFSR  +P F  +SS+ P + H+ IE+S
Sbjct  2    DGEFLDRALTSKQRNA--YTSVLFYASWCPFSRDVRPTFEALSSMFPQMEHYTIEQS  56



>ref|XP_003554021.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like [Glycine 
max]
Length=281

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 7/84 (8%)
 Frame = +2

Query  170  LPDSTCSIDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSR  334
             P S   + E++S CS AV     +  D   ++  L    R+   Y+++LFYASWC FSR
Sbjct  23   FPPSASFLYELQSQCSLAVSPDPPLRVDGNFIEGVLS--GRKRVGYISILFYASWCRFSR  80

Query  335  KFKPIFSVVSSLLPWVPHFAIEES  406
            +  P F ++SS+ P V H A+E+S
Sbjct  81   RMLPEFEILSSMFPQVQHVALEQS  104



>gb|ACG47677.1| APRL6 - Zea mays adenosine 5'-phosphosulfate reductase-like [Zea 
mays]
Length=297

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 6/76 (8%)
 Frame = +2

Query  179  STCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  358
            +TC +     S    V+ G+E  L R LD       ++ A+LFYASWCPFS++ + +F  
Sbjct  45   ATCPVSTEGYSSPYEVVSGEE--LLRMLD----GKEEHTAVLFYASWCPFSQRTRSVFDD  98

Query  359  VSSLLPWVPHFAIEES  406
            +SS+ P V H A+EES
Sbjct  99   LSSMFPRVKHLAVEES  114



>gb|EYU39267.1| hypothetical protein MIMGU_mgv1a011190mg [Erythranthe guttata]
Length=289

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 44/65 (68%), Gaps = 3/65 (5%)
 Frame = +2

Query  212  CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  391
            CS+  I+ D +SL+RA+    +  ++Y A+LFYASWCPFS  F+  FS +SS+ P V H 
Sbjct  55   CSSP-IQVDGESLERAMSSSQK--NEYTAVLFYASWCPFSSIFQSKFSTLSSMYPQVKHL  111

Query  392  AIEES  406
             +E++
Sbjct  112  MVEQT  116



>ref|XP_010923362.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Elaeis guineensis]
Length=304

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 7/77 (9%)
 Frame = +2

Query  191  IDEIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            +D ++S C      ++ +E + ++L++ L   H +   Y ++ FYASWCPFS   +PIF 
Sbjct  42   LDVVRSQCPLWIEPSSPLEVNGETLEQELS--HSKRSTYYSVFFYASWCPFSSNTRPIFD  99

Query  356  VVSSLLPWVPHFAIEES  406
             +SS+ P + H A+E+S
Sbjct  100  ALSSMFPQIKHLAVEQS  116



>gb|AEK94318.1| disulfide isomerase-related protein [Pyrus x bretschneideri]
Length=297

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            ++ D   L RAL    R   DY A+LFYASWCPFSR   P F  +S + P V H AIE+S
Sbjct  52   LKVDGNFLDRALAPQQRT--DYTAVLFYASWCPFSRTMYPTFEKLSFMFPQVEHLAIEQS  109



>ref|NP_001051635.1| Os03g0806500 [Oryza sativa Japonica Group]
 sp|Q84M47.1|APRL5_ORYSJ RecName: Full=5'-adenylylsulfate reductase-like 5; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 5; Short=APR-like 
5; Short=OsAPRL5; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAP21422.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99443.1| adenosine 5'-phosphosulfate reductase 8, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13549.1| Os03g0806500 [Oryza sativa Japonica Group]
 gb|EEC76374.1| hypothetical protein OsI_13981 [Oryza sativa Indica Group]
 gb|EEE60139.1| hypothetical protein OsJ_13029 [Oryza sativa Japonica Group]
Length=301

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 50/88 (57%), Gaps = 14/88 (16%)
 Frame = +2

Query  179  STCS------IDEIKSSCSTAVIEGDE------KSLQRALDVVHRRSHDYVALLFYASWC  322
            STC+      +D + S C    IE         +++ + L++ HR      ++LFYA+WC
Sbjct  32   STCARRGPGFVDALASRCPCIRIEPSPPVEVRGEAIAKELNLRHRGVT--YSVLFYAAWC  89

Query  323  PFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            PFS KF+PIF  +S++ P + HF +EES
Sbjct  90   PFSSKFRPIFEALSTMFPQIYHFTVEES  117



>ref|XP_008391699.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Malus domestica]
Length=305

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 7/74 (9%)
 Frame = +2

Query  200  IKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVS  364
            ++S C  ++     ++ D   L RAL    R   DY A+LFYASWCPFSR   P F  +S
Sbjct  38   LQSQCPISISPHPPLKVDGNFLDRALASQQRT--DYAAVLFYASWCPFSRIMYPTFEKLS  95

Query  365  SLLPWVPHFAIEES  406
             + P V H AIE+S
Sbjct  96   FMFPQVQHLAIEQS  109



>ref|XP_009102086.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Brassica rapa]
Length=298

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 6/75 (8%)
 Frame = +2

Query  197  EIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  361
            +I S C      T  IE D  SL R L  +H   + YV++LFYASWCPFSR  +  F  +
Sbjct  38   DIHSKCPPSMYPTPPIEIDGDSLDR-LMALHHDGNAYVSVLFYASWCPFSRALRSKFDTL  96

Query  362  SSLLPWVPHFAIEES  406
            SS+ P + H A++ S
Sbjct  97   SSMFPQIHHLALDHS  111



>ref|XP_009353126.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Pyrus x bretschneideri]
Length=299

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            ++ D   L RAL    R   DY A+LFYASWCPFSR   P F  +S + P V H AIE+S
Sbjct  52   LKVDGNFLDRALASQQRT--DYTAVLFYASWCPFSRTMYPTFEKLSFMFPQVEHLAIEQS  109



>gb|ADE77738.1| unknown [Picea sitchensis]
Length=325

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +2

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
            + V E D+ SL+R LD++ R S  ++A+LF+ASWCPFS+  + +F  +SS+ P + H A+
Sbjct  64   SRVSELDDVSLERTLDIL-RYSDAHMAVLFHASWCPFSKSCRSLFDDLSSMFPKIYHVAV  122

Query  398  EES  406
            EES
Sbjct  123  EES  125



>ref|XP_002466254.1| hypothetical protein SORBIDRAFT_01g004420 [Sorghum bicolor]
 gb|EER93252.1| hypothetical protein SORBIDRAFT_01g004420 [Sorghum bicolor]
Length=298

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 44/77 (57%), Gaps = 6/77 (8%)
 Frame = +2

Query  191  IDEIKSSCSTAVIEGDEKSLQR--ALDV---VHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            +D + S C    IE       R  A+D    + RR   Y  +LFYA+WCPFS KF+P F 
Sbjct  39   LDAVGSRCPFVRIEPSPPLEVRGEAVDTELNLRRRGASYF-ILFYAAWCPFSSKFQPTFE  97

Query  356  VVSSLLPWVPHFAIEES  406
             +S++ P + HFA+EES
Sbjct  98   ALSTMYPQIHHFAVEES  114



>ref|XP_010054638.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 isoform X2 [Eucalyptus 
grandis]
Length=244

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query  233  GDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            G+   L R L   H     Y A+LFYASWCPFS+  +PI+  +SS+ P + H A+E+S
Sbjct  2    GNGNFLDRFLMSKHHSG--YTAVLFYASWCPFSQSIRPIYEALSSMFPQIDHLAVEQS  57



>ref|XP_006400356.1| hypothetical protein EUTSA_v10014257mg [Eutrema salsugineum]
 gb|ESQ41809.1| hypothetical protein EUTSA_v10014257mg [Eutrema salsugineum]
Length=287

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +E D   L R ++  H   + Y ++LFYASWCPFSR  +P F V+S++ P + H  +E+S
Sbjct  55   VEVDGDLLDRLINTNH--GNAYTSILFYASWCPFSRAVRPKFDVLSAMFPHIGHLIVEQS  112



>ref|XP_006400357.1| hypothetical protein EUTSA_v10014257mg [Eutrema salsugineum]
 gb|ESQ41810.1| hypothetical protein EUTSA_v10014257mg [Eutrema salsugineum]
Length=291

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +E D   L R ++  H   + Y ++LFYASWCPFSR  +P F V+S++ P + H  +E+S
Sbjct  55   VEVDGDLLDRLINTNH--GNAYTSILFYASWCPFSRAVRPKFDVLSAMFPHIGHLIVEQS  112



>ref|XP_008804329.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Phoenix dactylifera]
Length=304

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 7/77 (9%)
 Frame = +2

Query  191  IDEIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            +D ++S C      ++ +E + ++L++ L   H +   Y ++ FYASWCPFS   +PIF 
Sbjct  42   LDVVRSQCPLWIEPSSSLEVNGETLEQELS--HSQRSAYYSVFFYASWCPFSSNTRPIFD  99

Query  356  VVSSLLPWVPHFAIEES  406
             +SS+ P + H A+E+S
Sbjct  100  ALSSIFPQIKHLAVEQS  116



>emb|CDY21158.1| BnaA01g33890D [Brassica napus]
Length=298

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 6/75 (8%)
 Frame = +2

Query  197  EIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  361
            +I S C      T  IE D  SL R + + H   + YV++LFYASWCPFSR  +  F ++
Sbjct  38   DIHSKCPPSMYPTPPIEIDGDSLDRLMSLNHD-GNAYVSVLFYASWCPFSRALRSKFDML  96

Query  362  SSLLPWVPHFAIEES  406
            SS+ P + H A++ S
Sbjct  97   SSMFPQIHHLALDHS  111



>ref|XP_008813732.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Phoenix dactylifera]
Length=302

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (60%), Gaps = 7/77 (9%)
 Frame = +2

Query  191  IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            +D +KS C   +     +E   K+L++ L    + +  Y ++ F+ASWCPFS   +PIF+
Sbjct  40   LDVVKSQCPLWIEPLPPLEVSGKTLEQELSRSQKSA--YYSIFFFASWCPFSSNTRPIFN  97

Query  356  VVSSLLPWVPHFAIEES  406
             +SS+ P + H A+EES
Sbjct  98   ALSSMFPQIKHLAVEES  114



>gb|EMS52111.1| 5'-adenylylsulfate reductase-like 6 [Triticum urartu]
Length=263

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  287  DYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +Y A+LFYASWCPFS + +PIF  +SS+ P + H A+E+S
Sbjct  37   EYTAVLFYASWCPFSHRMRPIFDDLSSMYPHIKHLAVEQS  76



>gb|ACG38706.1| APRL5 - Zea mays adenosine 5'-phosphosulfate reductase-like [Zea 
mays]
Length=274

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  269  VHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            + RR   Y ++LFYA+WCPFS K +PIF  +S++ P + HF +EES
Sbjct  70   LRRRGASY-SILFYAAWCPFSSKLRPIFGTLSTMYPQIHHFTVEES  114



>ref|XP_008350130.1| PREDICTED: LOW QUALITY PROTEIN: 5'-adenylylsulfate reductase-like 
5 [Malus domestica]
Length=296

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 7/74 (9%)
 Frame = +2

Query  200  IKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVS  364
            ++S C  ++     ++ D   L RAL    R   DY A+LFYASWCP SR   P F  +S
Sbjct  37   LQSQCPISISPHPPLKVDGNFLDRALASQQRT--DYSAVLFYASWCPLSRTXYPTFEKLS  94

Query  365  SLLPWVPHFAIEES  406
             + P V H AIEES
Sbjct  95   FMFPQVEHLAIEES  108



>ref|NP_001105768.1| adenosine 5'-phosphosulfate reductase-like8 precursor [Zea mays]
 gb|AAW63058.1| adenosine 5'-phosphosulfate reductase 8 [Zea mays]
Length=299

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  269  VHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            + RR   Y ++LFYA+WCPFS K +PIF  +S++ P + HF +EES
Sbjct  71   LRRRGASY-SILFYAAWCPFSSKLRPIFGTLSTMYPQIHHFTVEES  115



>ref|NP_001281246.1| APRL5 - Zea mays adenosine 5'-phosphosulfate reductase-like precursor 
[Zea mays]
 gb|ACR34049.1| unknown [Zea mays]
Length=299

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +2

Query  269  VHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            + RR   Y ++LFYA+WCPFS K +PIF  +S++ P + HF +EES
Sbjct  71   LRRRGASY-SILFYAAWCPFSSKLRPIFGTLSTMYPQIHHFTVEES  115



>ref|XP_009130392.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Brassica rapa]
Length=302

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            ++ D ++L R + + +  ++ Y+++LFYASWCPFSR  +P F ++SS+ P + H A+E S
Sbjct  57   LQVDGETLDRLMGLNYD-ANGYMSVLFYASWCPFSRAVRPKFDMLSSMFPLIQHLAVEHS  115



>tpg|DAA55323.1| TPA: hypothetical protein ZEAMMB73_501257 [Zea mays]
Length=135

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 6/61 (10%)
 Frame = +2

Query  224  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  403
            V+ G+E  L R LD   +    + A+LFYASWCPFS++ + +F  +SS+ P V H A+EE
Sbjct  60   VVSGEE--LLRMLDGKEK----HTAVLFYASWCPFSQRTRSVFDDLSSMFPRVKHLAVEE  113

Query  404  S  406
            S
Sbjct  114  S  114



>emb|CDY50856.1| BnaA05g37170D [Brassica napus]
Length=302

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 48/75 (64%), Gaps = 6/75 (8%)
 Frame = +2

Query  197  EIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  361
            ++ S C +++      + D ++L R + + +  ++ Y+++LFYASWCPFSR  +P F ++
Sbjct  42   DLDSKCPSSLHPAPPFQVDGETLDRLMGLNYD-ANGYMSVLFYASWCPFSRAVRPKFDML  100

Query  362  SSLLPWVPHFAIEES  406
            SS+ P + H A+E S
Sbjct  101  SSMFPQIQHLAVEHS  115



>gb|ACF82441.1| unknown [Zea mays]
 tpg|DAA55322.1| TPA: adenosine 5'-phosphosulfate reductase 7 [Zea mays]
Length=131

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 6/76 (8%)
 Frame = +2

Query  179  STCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  358
            +TC +          V+ G+E  L R LD   +    + A+LFYASWCPFS++ + +F  
Sbjct  45   ATCPVSTEGYWPPYEVVSGEE--LLRMLDGKEK----HTAVLFYASWCPFSQRTRSVFDD  98

Query  359  VSSLLPWVPHFAIEES  406
            +SS+ P V H A+EES
Sbjct  99   LSSMFPRVKHLAVEES  114



>ref|XP_009620886.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Nicotiana tomentosiformis]
Length=297

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 51/100 (51%), Gaps = 9/100 (9%)
 Frame = +2

Query  128  LCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAV-------IEGDEKSLQRALDVVHRRSH  286
            + C  +SA   +F+  ++     +++S C   +        E D +SL +AL    +   
Sbjct  10   VLCYVFSAFGCVFSSYNTNTFFYDLRSQCPLRISFPPPLLFETDGESLDKALGSSQK--D  67

Query  287  DYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            D  A+LFYASWCPFS   K  F  +SS+ P + H  +E+S
Sbjct  68   DVTAILFYASWCPFSTDVKSKFGALSSMFPRIRHVMVEQS  107



>ref|XP_010237189.1| PREDICTED: 5'-adenylylsulfate reductase-like 6 [Brachypodium 
distachyon]
Length=305

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  284  HDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
              Y A+LFYASWCPFS++ +P+F  +SS+ P + H A+E+S
Sbjct  84   EGYTAVLFYASWCPFSQRMRPVFDDLSSMYPQIKHLAVEQS  124



>ref|XP_009366461.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Pyrus x bretschneideri]
Length=296

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 7/74 (9%)
 Frame = +2

Query  200  IKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVS  364
            ++S C  ++     ++ D   L RAL    R   DY A+ FYASWCP SR   P F  +S
Sbjct  37   LQSQCPISISPHPPLKVDGNYLDRALASQQRT--DYTAVFFYASWCPLSRTMYPTFEKLS  94

Query  365  SLLPWVPHFAIEES  406
             + P V H AIE+S
Sbjct  95   FMFPQVEHLAIEQS  108



>gb|EYU31671.1| hypothetical protein MIMGU_mgv1a010641mg [Erythranthe guttata]
Length=306

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 14/105 (13%)
 Frame = +2

Query  128  LCCSKYSAKDWIFALPDSTCSID------EIKSSCS------TAVIEGDEKSLQRALDVV  271
            +C    SA  +  A   S C +D      ++ S C       +  I+ D +S ++A+   
Sbjct  18   VCAFAESAASFRLASSSSICQLDFKTLLLDLNSQCPFSKPLPSLPIQVDGESFEKAMSSS  77

Query  272  HRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
             ++   Y A+LFYASWCPFS  F+   S +SS+ P V H  +E+S
Sbjct  78   QKKG--YTAVLFYASWCPFSTIFQSKISTLSSMYPHVKHIMVEQS  120



>ref|XP_011089720.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 isoform X2 [Sesamum 
indicum]
Length=306

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +2

Query  215  STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFA  394
            S++ I+ D  S + A++   +  ++Y A+LFYASWCPFS  F+  FS +SS+ P + H  
Sbjct  55   SSSPIQVDGDSFENAVNSGSK--NEYTAVLFYASWCPFSSVFQSKFSTLSSMYPQIKHLM  112

Query  395  IEES  406
            +E+S
Sbjct  113  VEQS  116



>gb|KJB44623.1| hypothetical protein B456_007G261900 [Gossypium raimondii]
Length=296

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            ++ D   L RAL    R  + Y ++LFYA+WCPFS    P F ++SS+ P + H A+EES
Sbjct  52   LKVDGNFLDRALSSKQR--NGYASVLFYAAWCPFSHSLYPKFDILSSMFPQIEHLAVEES  109



>ref|XP_006296718.1| hypothetical protein CARUB_v10014268mg [Capsella rubella]
 gb|EOA29616.1| hypothetical protein CARUB_v10014268mg [Capsella rubella]
Length=301

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (62%), Gaps = 2/63 (3%)
 Frame = +2

Query  218  TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAI  397
            T  IE D  SL R + +   + + Y+++LFYASWCPFS   +P F ++SS+ P + H  +
Sbjct  55   TPPIEIDGDSLDRLMAL--NQGNSYMSVLFYASWCPFSLAVRPKFDMLSSMFPQIQHLTV  112

Query  398  EES  406
            E S
Sbjct  113  EHS  115



>ref|XP_010524982.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Tarenaya hassleriana]
Length=302

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +E D   L R +D  H   + Y A+LFYASWCPFSR  +P    ++S+ P + H  +E S
Sbjct  56   LEVDGDYLDRVMDSNH--GNGYKAVLFYASWCPFSRAVRPKIDALASMFPQIEHLVVEHS  113



>emb|CDY25457.1| BnaC09g39720D [Brassica napus]
Length=277

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  272  HRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            H R + Y ++LFYAS CPFSR  +P F V+SS+ P + H  +E+S
Sbjct  54   HNRGNAYTSILFYASRCPFSRAVRPKFDVLSSMFPHIRHLVVEQS  98



>ref|XP_011089719.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 isoform X1 [Sesamum 
indicum]
Length=311

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +2

Query  215  STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFA  394
            S++ I+ D  S + A++   +  ++Y A+LFYASWCPFS  F+  FS +SS+ P + H  
Sbjct  55   SSSPIQVDGDSFENAVNSGSK--NEYTAVLFYASWCPFSSVFQSKFSTLSSMYPQIKHLM  112

Query  395  IEES  406
            +E+S
Sbjct  113  VEQS  116



>ref|XP_003548940.1| PREDICTED: 5'-adenylylsulfate reductase-like 7-like [Glycine 
max]
Length=160

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (62%), Gaps = 4/68 (6%)
 Frame = +2

Query  203  KSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWV  382
            +++ +T ++  DE  ++  L  + R   +Y ++LFYASWCPFSRK  P F ++SS    V
Sbjct  7    RTTATTVIV--DENFVEGILSDIKRI--EYTSILFYASWCPFSRKILPQFEILSSTFLQV  62

Query  383  PHFAIEES  406
             H  +E+S
Sbjct  63   EHLVLEKS  70



>gb|AAM60945.1| contains similarity to protein disulfide isomerase-related protein 
[Arabidopsis thaliana]
Length=289

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            IE D   L + +D  H   + Y+++LFY S CPFSR  +P F V+SS+ P + H  +E+S
Sbjct  53   IEVDGDLLDKLMDANH--GNAYISILFYTSRCPFSRAVRPKFDVLSSMFPHITHLIVEQS  110



>emb|CDY64906.1| BnaC05g47730D [Brassica napus]
Length=302

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 48/75 (64%), Gaps = 6/75 (8%)
 Frame = +2

Query  197  EIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  361
            ++ S C +++     I+   ++L R + + +  ++ Y+++LFYASWCPFSR  +P F ++
Sbjct  42   DLDSKCPSSLHPAPPIQVGGETLDRLMGLNYD-ANGYMSVLFYASWCPFSRAVRPKFDML  100

Query  362  SSLLPWVPHFAIEES  406
            SS+ P + H A+E S
Sbjct  101  SSMFPRIQHLAVEHS  115



>ref|NP_568360.1| 5'-adenylylsulfate reductase-like 7 [Arabidopsis thaliana]
 sp|Q84JN1.1|APRL7_ARATH RecName: Full=5'-adenylylsulfate reductase-like 7; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 7; Short=APR-like 
7; Short=AtAPRL7; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22670.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42428.1| unknown protein [Arabidopsis thaliana]
 gb|AED92509.1| 5'-adenylylsulfate reductase-like 7 [Arabidopsis thaliana]
Length=289

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            IE D   L + +D  H   + Y+++LFY S CPFSR  +P F V+SS+ P + H  +E+S
Sbjct  53   IEVDGDLLDKLMDANH--GNAYISILFYTSRCPFSRAVRPKFDVLSSMFPHITHLIVEQS  110



>ref|XP_007202392.1| hypothetical protein PRUPE_ppa009402mg [Prunus persica]
 gb|EMJ03591.1| hypothetical protein PRUPE_ppa009402mg [Prunus persica]
Length=294

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            ++ D   L+RAL    R    Y A+LFYASWCPFS    P F ++S + P V H AIE+S
Sbjct  49   LKVDGNFLERALATKQRT--GYTAVLFYASWCPFSCSMYPTFGMLSFMFPQVEHLAIEQS  106



>dbj|BAB09470.1| unnamed protein product [Arabidopsis thaliana]
Length=303

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            IE D   L + +D  H   + Y+++LFY S CPFSR  +P F V+SS+ P + H  +E+S
Sbjct  53   IEVDGDLLDKLMDANH--GNAYISILFYTSRCPFSRAVRPKFDVLSSMFPHITHLIVEQS  110



>ref|XP_002319158.2| hypothetical protein POPTR_0013s05370g [Populus trichocarpa]
 gb|EEE95081.2| hypothetical protein POPTR_0013s05370g [Populus trichocarpa]
Length=248

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 4/61 (7%)
 Frame = +2

Query  224  VIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEE  403
            +++GD   L RAL    R +  Y ++LFYASWCPFS    P F ++SS+ P + H A+E+
Sbjct  4    LVDGD--FLDRALTSKQRNA--YTSVLFYASWCPFSCSMLPKFEILSSMFPQIEHLAVEQ  59

Query  404  S  406
            S
Sbjct  60   S  60



>ref|XP_007202391.1| hypothetical protein PRUPE_ppa009402mg [Prunus persica]
 gb|EMJ03590.1| hypothetical protein PRUPE_ppa009402mg [Prunus persica]
Length=290

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            ++ D   L+RAL    R    Y A+LFYASWCPFS    P F ++S + P V H AIE+S
Sbjct  49   LKVDGNFLERALATKQRTG--YTAVLFYASWCPFSCSMYPTFGMLSFMFPQVEHLAIEQS  106



>ref|NP_001105806.1| adenosine 5'-phosphosulfate reductase-like7 precursor [Zea mays]
 gb|AAW63057.1| adenosine 5'-phosphosulfate reductase 7 [Zea mays]
Length=297

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = +2

Query  179  STCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  358
            +TC +          V+ G+E  L R LD        + A+LFYASWCPFS++ + +F  
Sbjct  45   ATCPVSTEGYWPPYEVVSGEE--LLRMLD----GKEKHTAVLFYASWCPFSQRTRSVFDD  98

Query  359  VSSLLPWVPHFAIEES  406
            +SS+ P V H A+EES
Sbjct  99   LSSMFPRVKHLAVEES  114



>ref|XP_003548734.2| PREDICTED: 5'-adenylylsulfate reductase-like 5-like [Glycine 
max]
Length=285

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +2

Query  197  EIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVV  361
            E++S CS A      ++ D   ++  L    R+   Y+++LFYASWCP S +  P F ++
Sbjct  36   ELQSQCSLATSPDPPLQVDGNFIEGVLS--GRKRVGYISILFYASWCPLSCRMLPEFEIL  93

Query  362  SSLLPWVPHFAIEES  406
            SS+ P V H A+E+S
Sbjct  94   SSMFPQVQHVALEQS  108



>ref|XP_008673453.1| PREDICTED: adenosine 5'-phosphosulfate reductase-like7 isoform 
X1 [Zea mays]
Length=297

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = +2

Query  179  STCSIDEIKSSCSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSV  358
            +TC +          V+ G+E  L R LD        + A+LFYASWCPFS++ + +F  
Sbjct  45   ATCPVSTEGYWPPYEVVSGEE--LLRMLD----GKEKHTAVLFYASWCPFSQRTRSVFDD  98

Query  359  VSSLLPWVPHFAIEES  406
            +SS+ P V H A+EES
Sbjct  99   LSSMFPRVKHLAVEES  114



>ref|XP_011457634.1| PREDICTED: 5'-adenylylsulfate reductase-like 5, partial [Fragaria 
vesca subsp. vesca]
Length=247

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  275  RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            +++  + ++LFYASWCPFSR+  P F ++S + P V H A+E+S
Sbjct  15   KQNSGFTSVLFYASWCPFSRRLNPTFEMLSFMFPQVDHLAVEQS  58



>ref|XP_006354125.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like [Solanum 
tuberosum]
Length=300

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 9/77 (12%)
 Frame = +2

Query  197  EIKSSC-------STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            ++KS C       S+ ++E D +SL + L    +   +  A+LFYASWCPFS   K  F 
Sbjct  36   DLKSQCPFGISVPSSKILETDGESLDKVLRSSQK--DEVTAILFYASWCPFSTDVKSKFG  93

Query  356  VVSSLLPWVPHFAIEES  406
             +SS+ P + H  +E+S
Sbjct  94   ALSSMFPQIRHVMVEQS  110



>ref|XP_008240528.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Prunus mume]
Length=296

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            ++ D   L+RAL    R    Y A+LFYASWCPFS    P F ++S + P V H AIE+S
Sbjct  49   LKVDGNFLERALASKQRT--GYTAVLFYASWCPFSCSMYPTFGMLSFMFPQVEHLAIEQS  106



>ref|XP_010420552.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010420553.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010420554.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
Length=289

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            IE D   L R +D  HR +  Y ++LFY   C FSR  +P F V+SS+ P + H  +E+S
Sbjct  53   IEVDGDLLDRLMDANHRNA--YTSILFYTKRCQFSRAVRPKFDVLSSMFPHIKHLVVEQS  110



>ref|XP_010420551.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X1 [Camelina 
sativa]
Length=294

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            IE D   L R +D  HR +  Y ++LFY   C FSR  +P F V+SS+ P + H  +E+S
Sbjct  58   IEVDGDLLDRLMDANHRNA--YTSILFYTKRCQFSRAVRPKFDVLSSMFPHIKHLVVEQS  115



>ref|XP_007161953.1| hypothetical protein PHAVU_001G1116001g, partial [Phaseolus vulgaris]
 gb|ESW33947.1| hypothetical protein PHAVU_001G1116001g, partial [Phaseolus vulgaris]
Length=232

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  275  RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            R+   Y ++LFYASWCPFS +  P F  +SS+ P V H A+E+S
Sbjct  13   RKRVGYASVLFYASWCPFSHRILPEFETLSSMFPQVEHVALEQS  56



>gb|KJB26618.1| hypothetical protein B456_004G250500 [Gossypium raimondii]
 gb|KJB26619.1| hypothetical protein B456_004G250500 [Gossypium raimondii]
Length=312

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 43/79 (54%), Gaps = 11/79 (14%)
 Frame = +2

Query  191  IDEIKSSCSTAV-------IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPI  349
            I  I   CS ++       + GD   L R L    ++ + Y ++LFYASWCPFS    P 
Sbjct  47   IKNIHFQCSPSISPIPPLKVNGD--FLDRQL--TSKQQNGYTSVLFYASWCPFSHGLCPK  102

Query  350  FSVVSSLLPWVPHFAIEES  406
            F ++SS+ P + H A+E+S
Sbjct  103  FDILSSMFPQIEHLAVEQS  121



>ref|XP_010558723.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Tarenaya hassleriana]
 ref|XP_010558724.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 [Tarenaya hassleriana]
Length=299

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 4/60 (7%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            ++GD   L R  D  H   + Y A+LFYASWC FSR  +P F  V+S+ P + H  +E S
Sbjct  57   VDGDY--LDRVTDAKH--GNGYTAVLFYASWCHFSRAVRPEFDAVASMFPHIKHLVVEHS  112



>ref|XP_004228686.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Solanum lycopersicum]
Length=300

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 39/64 (61%), Gaps = 2/64 (3%)
 Frame = +2

Query  215  STAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFA  394
            S+ ++E D +SL +AL    +   +  A+LFYASWCPFS   K  F  +SS+ P + H  
Sbjct  49   SSKILETDGESLDKALRSSQK--DEVTAILFYASWCPFSTDVKLKFGALSSMFPQIRHVM  106

Query  395  IEES  406
            +E+S
Sbjct  107  VEQS  110



>ref|XP_010934707.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Elaeis guineensis]
Length=302

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 46/77 (60%), Gaps = 7/77 (9%)
 Frame = +2

Query  191  IDEIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            +D +KS C      ++ +E   ++L++ L    + +  Y ++ F ASWCPFS   +P+F+
Sbjct  40   LDVVKSQCPLWIEPSSPLEVSGETLEQELSRSQKSA--YYSVFFSASWCPFSSNTRPVFN  97

Query  356  VVSSLLPWVPHFAIEES  406
             +SS+ P + H A+EES
Sbjct  98   ALSSMFPQIKHLAVEES  114



>ref|XP_010454034.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010454036.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
 ref|XP_010454037.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X2 [Camelina 
sativa]
Length=290

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            IE D   L R +D  HR +  Y ++LFY   C FSR  +P F V+SS+ P + H  +E+S
Sbjct  54   IEVDGDLLDRLMDANHRNA--YTSILFYTKRCQFSRAVRPKFDVLSSMFPHIKHLIVEQS  111



>ref|XP_004489697.1| PREDICTED: 5'-adenylylsulfate reductase-like 5-like [Cicer arietinum]
Length=293

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  275  RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            R+  + V++LFYASWCPFSR+  P F  +SS+ P + H  +E+S
Sbjct  69   RKKIECVSILFYASWCPFSRRMLPKFETLSSMFPQIEHLVLEQS  112



>ref|XP_009624667.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Nicotiana tomentosiformis]
Length=293

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 2/53 (4%)
 Frame = +2

Query  248  LQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            + RAL    R+   Y + LFYASWCPFSR+   IF  +SS+ P + H A+E+S
Sbjct  59   IDRAL--TSRQRSTYTSALFYASWCPFSRRIHFIFEALSSMYPQIEHLAVEQS  109



>gb|KCW47755.1| hypothetical protein EUGRSUZ_K01503 [Eucalyptus grandis]
Length=260

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 17/93 (18%)
 Frame = +2

Query  167  ALPDSTCSID------EIKSSCSTAVIEGDEKSLQRALD-------VVHRRSHDYVALLF  307
            A P   C ++       + S CST++      SL   +D       V  +  +  VALL 
Sbjct  29   AEPRHACPVEPFPFLYRLTSRCSTSI----PPSLPLQVDGYFLDSIVASKDKNACVALLL  84

Query  308  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            YASWCPFS++  PIF V+SS+ P + H  +E S
Sbjct  85   YASWCPFSQRLLPIFDVLSSMFPQMDHLLVEHS  117



>ref|XP_010454033.1| PREDICTED: 5'-adenylylsulfate reductase-like 7 isoform X1 [Camelina 
sativa]
Length=352

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            IE D   L R +D  HR +  Y ++LFY   C FSR  +P F V+SS+ P + H  +E+S
Sbjct  116  IEVDGDLLDRLMDANHRNA--YTSILFYTKRCQFSRAVRPKFDVLSSMFPHIKHLIVEQS  173



>gb|EEC69443.1| hypothetical protein OsI_38622 [Oryza sativa Indica Group]
Length=218

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 6/65 (9%)
 Frame = +2

Query  212  CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  391
            C    I G+E  L + L        +  A+LFYASWCPFS++ +P+F  +SS+ P + H 
Sbjct  61   CPAEEINGEE--LVKELS----GKEECTAVLFYASWCPFSQRMRPVFDDLSSMFPRIKHL  114

Query  392  AIEES  406
            A+E++
Sbjct  115  AVEQT  119



>ref|XP_009413322.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Musa acuminata 
subsp. malaccensis]
Length=302

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (56%), Gaps = 8/77 (10%)
 Frame = +2

Query  191  IDEIKSSCS-----TAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            +D I+S C      ++  E   ++ +R L     +   Y ++LFYASWCPFS   +P+F 
Sbjct  42   LDGIESQCPLWIELSSPQEVSGETFERELS---GKQSAYYSILFYASWCPFSSNTRPMFD  98

Query  356  VVSSLLPWVPHFAIEES  406
             +SS+ P + H  +EES
Sbjct  99   ALSSMFPQIKHLLVEES  115



>ref|XP_009420649.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (55%), Gaps = 9/77 (12%)
 Frame = +2

Query  191  IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFS  355
            +D++ S C   +      E   ++L+R L+        Y ++LF  SWCPFSR  +PIF 
Sbjct  40   LDDLGSQCPRWIELPLRQEVSGETLERYLNC----GDQYCSVLFGVSWCPFSRNIQPIFD  95

Query  356  VVSSLLPWVPHFAIEES  406
             +SS+ P + H  +EES
Sbjct  96   ALSSMFPQIKHLLVEES  112



>emb|CDP14309.1| unnamed protein product [Coffea canephora]
Length=309

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = +2

Query  248  LQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            L+R L    R S  Y A+LFYASWCPFS++    F V+SS+ P + H A+E+S
Sbjct  68   LERVLSSKARNS--YAAVLFYASWCPFSQRAYMTFEVLSSMYPHIEHLAVEQS  118



>ref|XP_010036228.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Eucalyptus grandis]
Length=271

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 17/93 (18%)
 Frame = +2

Query  167  ALPDSTCSID------EIKSSCSTAVIEGDEKSLQRALD-------VVHRRSHDYVALLF  307
            A P   C ++       + S CST++      SL   +D       V  +  +  VALL 
Sbjct  29   AEPRHACPVEPFPFLYRLTSRCSTSI----PPSLPLQVDGYFLDSIVASKDKNACVALLL  84

Query  308  YASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            YASWCPFS++  PIF V+SS+ P + H  +E S
Sbjct  85   YASWCPFSQRLLPIFDVLSSMFPQMDHLLVEHS  117



>emb|CBI19166.3| unnamed protein product [Vitis vinifera]
Length=119

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +3

Query  231  REMRNHCRGHWMWFIGDRMIMLLCSSTLLGALSPGSLNQYFLLYLRCFPGFLILQLKN  404
            REMR HCR HW+WF    M M L  S  LG LS   ++Q F  +L C P     QLKN
Sbjct  14   REMRFHCRRHWIWFTRTLMNMWLFCSMHLGVLSLELVDQPFPFFLPCIPPCPTSQLKN  71



>emb|CDX70796.1| BnaC03g08800D [Brassica napus]
Length=281

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 1/59 (2%)
 Frame = +2

Query  230  EGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            E D   L R +D  H   + Y ++LFY+ WCPFS   +P F  +SS+ P + H  +E+S
Sbjct  52   EVDGDLLDRLMDS-HNHGNAYTSILFYSPWCPFSSLVRPKFEALSSMFPHIGHLVVEQS  109



>sp|Q2QP53.1|APRL6_ORYSJ RecName: Full=5'-adenylylsulfate reductase-like 6; AltName: Full=Adenosine 
5'-phosphosulfate reductase-like 6; Short=APR-like 
6; Short=OsAPRL6; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|ABA99457.1| adenosine 5'-phosphosulfate reductase 6, putative, expressed 
[Oryza sativa Japonica Group]
Length=300

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 6/65 (9%)
 Frame = +2

Query  212  CSTAVIEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHF  391
            C    I G+E  L + L        +  A+LFYASWCPFS++ +P+F  +SS+ P + H 
Sbjct  60   CPAEEINGEE--LVKELS----GKEECTAVLFYASWCPFSQRMRPVFDDLSSMFPRIKHL  113

Query  392  AIEES  406
            A+E++
Sbjct  114  AVEQT  118



>ref|XP_009417154.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=300

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 48/109 (44%), Gaps = 10/109 (9%)
 Frame = +2

Query  80   VGRLTCAHTLTAPFPALCCSKYSAKDWIFALPDSTCSIDEIKSSCSTAVIEGDEKSLQRA  259
            V  LT   +L A  P LC      +  I  L D  C         S   + G+   L+R 
Sbjct  17   VASLTFPRSLAAVVPPLC-----PRSGIAFLDDLGCQCSRWIELSSPQEVSGE--MLERE  69

Query  260  LDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            L         Y ++LFYASWC FS   +PIF  +S + P + H  +EES
Sbjct  70   LS---NDQSAYYSVLFYASWCQFSSDIQPIFDALSYMFPQIKHLLVEES  115



>ref|XP_010097394.1| 5'-adenylylsulfate reductase-like 5 [Morus notabilis]
 gb|EXB67900.1| 5'-adenylylsulfate reductase-like 5 [Morus notabilis]
Length=326

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +2

Query  275  RRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            ++   Y ++LFYASWC FSR   P F  +SS+ P + H A+EES
Sbjct  96   KQRTGYTSILFYASWCEFSRSTYPKFEALSSMFPQIEHLAVEES  139



>ref|XP_009797663.1| PREDICTED: 5'-adenylylsulfate reductase-like 5 [Nicotiana sylvestris]
Length=292

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 4/60 (7%)
 Frame = +2

Query  227  IEGDEKSLQRALDVVHRRSHDYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            + GD   + RAL    R+   Y + LFYASWCPFSR+   +F  +SS+ P + H AIE+S
Sbjct  54   VSGD--FIDRAL--TSRQWSTYTSALFYASWCPFSRRIHFMFEALSSMYPQIEHLAIEQS  109



>ref|XP_008664336.1| PREDICTED: uncharacterized protein LOC103642962 [Zea mays]
Length=566

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  287  DYVALLFYASWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            ++  +LF+A WCPFS++ K +F  +SSL P V H A+EES
Sbjct  420  EHTTILFHALWCPFSQRIKLVFDDMSSLFPRVKHLAVEES  459



>ref|XP_007030092.1| APR-like 5, putative [Theobroma cacao]
 gb|EOY10594.1| APR-like 5, putative [Theobroma cacao]
Length=299

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 45/91 (49%), Gaps = 13/91 (14%)
 Frame = +2

Query  167  ALPDSTCS------IDEIKSSCSTAV-----IEGDEKSLQRALDVVHRRSHDYVALLFYA  313
             L  S CS      I  +   CS ++     ++ +   L RAL    R  + Y A+LFYA
Sbjct  23   VLGSSICSHEADVFIKSLHFQCSPSISPIPPLKVNGNFLDRALASKQR--NGYTAVLFYA  80

Query  314  SWCPFSRKFKPIFSVVSSLLPWVPHFAIEES  406
            SWCPFS    P F ++SS+ P   H  +E+S
Sbjct  81   SWCPFSCSLHPKFDILSSMFPQFEHLMVEQS  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 568922768400