BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M10

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13862.1|  unnamed protein product                                172   6e-50   Coffea canephora [robusta coffee]
ref|XP_009773810.1|  PREDICTED: superoxide dismutase [Fe], chloro...    172   1e-49   Nicotiana sylvestris
ref|XP_004235206.1|  PREDICTED: superoxide dismutase [Fe], chloro...    171   4e-49   Solanum lycopersicum
ref|XP_010322099.1|  PREDICTED: iron superoxide dismutase isoform X1    168   2e-48   
ref|XP_006358179.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    169   3e-48   Solanum tuberosum [potatoes]
gb|AEP14527.1|  Fe-superoxide dismutase                                 167   7e-48   Phytolacca acinosa [food pokeberry]
ref|XP_006358178.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    167   1e-47   Solanum tuberosum [potatoes]
gb|ADC95630.1|  Fe-superoxide dismutase                                 166   1e-47   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_010676714.1|  PREDICTED: superoxide dismutase [Fe], chloro...    167   1e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009586624.1|  PREDICTED: superoxide dismutase [Fe], chloro...    165   2e-47   Nicotiana tomentosiformis
ref|XP_009599436.1|  PREDICTED: superoxide dismutase [Fe], chloro...    166   2e-47   Nicotiana tomentosiformis
ref|XP_009791482.1|  PREDICTED: superoxide dismutase [Fe], chloro...    165   3e-47   Nicotiana sylvestris
gb|AEY78486.2|  iron superoxide dismutase                               166   4e-47   Litchi chinensis [litchi]
gb|KHG24725.1|  Superoxide dismutase [Fe], chloroplastic                165   7e-47   Gossypium arboreum [tree cotton]
gb|KDO57694.1|  hypothetical protein CISIN_1g026199mg                   161   8e-47   Citrus sinensis [apfelsine]
gb|EPS69428.1|  superoxide dismutase                                    164   8e-47   Genlisea aurea
emb|CAE22480.1|  superoxide dismutase [Fe]                              163   9e-47   Solanum lycopersicum
ref|XP_002280522.1|  PREDICTED: superoxide dismutase [Fe], chloro...    165   1e-46   Vitis vinifera
ref|XP_006437023.1|  hypothetical protein CICLE_v10032406mg             164   1e-46   
ref|XP_006437022.1|  hypothetical protein CICLE_v10032406mg             164   1e-46   Citrus clementina [clementine]
ref|XP_002511050.1|  superoxide dismutase [fe], putative                164   1e-46   Ricinus communis
gb|KDO57696.1|  hypothetical protein CISIN_1g026199mg                   162   1e-46   Citrus sinensis [apfelsine]
ref|XP_006485042.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    164   1e-46   Citrus sinensis [apfelsine]
gb|ADX36104.1|  Fe-superoxide dismutase                                 164   2e-46   Haberlea rhodopensis
ref|XP_006437021.1|  hypothetical protein CICLE_v10032406mg             162   2e-46   
gb|AHG12637.1|  iron superoxide dismutase                               162   2e-46   Nicotiana tabacum [American tobacco]
ref|XP_010109152.1|  Protein Fe superoxide dismutase 1                  164   2e-46   Morus notabilis
gb|KDO57695.1|  hypothetical protein CISIN_1g026199mg                   162   2e-46   Citrus sinensis [apfelsine]
ref|XP_006485043.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    164   2e-46   Citrus sinensis [apfelsine]
gb|KDO57691.1|  hypothetical protein CISIN_1g026199mg                   161   4e-46   Citrus sinensis [apfelsine]
ref|XP_009586625.1|  PREDICTED: superoxide dismutase [Fe], chloro...    162   5e-46   Nicotiana tomentosiformis
ref|NP_001233789.1|  iron superoxide dismutase                          162   5e-46   
dbj|BAQ21273.1|  superoxide dismutase                                   161   5e-46   Citrus tamurana
gb|KCW90917.1|  hypothetical protein EUGRSUZ_A02950                     160   5e-46   Eucalyptus grandis [rose gum]
gb|KDO57692.1|  hypothetical protein CISIN_1g026199mg                   160   5e-46   Citrus sinensis [apfelsine]
ref|XP_011076548.1|  PREDICTED: superoxide dismutase [Fe], chloro...    162   6e-46   Sesamum indicum [beniseed]
gb|KJB06968.1|  hypothetical protein B456_001G052700                    160   6e-46   Gossypium raimondii
ref|XP_006437025.1|  hypothetical protein CICLE_v10032233mg             162   8e-46   Citrus clementina [clementine]
ref|XP_006357312.1|  PREDICTED: superoxide dismutase [Fe], chloro...    161   9e-46   Solanum tuberosum [potatoes]
gb|AFD34189.1|  Fe superoxide dismutase                                 161   2e-45   Jatropha curcas
gb|KJB06969.1|  hypothetical protein B456_001G052700                    161   3e-45   Gossypium raimondii
ref|XP_010063017.1|  PREDICTED: superoxide dismutase [Fe], chloro...    161   3e-45   Eucalyptus grandis [rose gum]
gb|ADR01110.1|  Fe superoxide dismutase 2                               160   3e-45   Brassica rapa
gb|KJB06965.1|  hypothetical protein B456_001G052700                    161   4e-45   Gossypium raimondii
pir||A39267  superoxide dismutase (EC 1.15.1.1) (Fe) - curled-lea...    159   4e-45
gb|KCW90916.1|  hypothetical protein EUGRSUZ_A02950                     159   5e-45   Eucalyptus grandis [rose gum]
emb|CDY38848.1|  BnaA03g13310D                                          160   5e-45   Brassica napus [oilseed rape]
gb|EPS68741.1|  superoxide dismutase                                    158   5e-45   Genlisea aurea
ref|XP_006574831.1|  PREDICTED: superoxide dismutase [Fe], chloro...    160   7e-45   Glycine max [soybeans]
sp|P22302.1|SODF_NICPL  RecName: Full=Superoxide dismutase [Fe], ...    157   7e-45   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006574833.1|  PREDICTED: superoxide dismutase [Fe], chloro...    160   8e-45   Glycine max [soybeans]
ref|XP_006574834.1|  PREDICTED: superoxide dismutase [Fe], chloro...    160   8e-45   Glycine max [soybeans]
ref|XP_003518624.1|  PREDICTED: superoxide dismutase [Fe], chloro...    160   8e-45   Glycine max [soybeans]
ref|XP_004508271.1|  PREDICTED: superoxide dismutase [Fe], chloro...    160   8e-45   Cicer arietinum [garbanzo]
gb|KCW90915.1|  hypothetical protein EUGRSUZ_A02950                     160   8e-45   Eucalyptus grandis [rose gum]
ref|XP_007038205.1|  Fe superoxide dismutase 2 isoform 1                160   9e-45   
emb|CDY32644.1|  BnaC03g16120D                                          160   1e-44   Brassica napus [oilseed rape]
ref|XP_002322315.2|  hypothetical protein POPTR_0015s12190g             160   1e-44   Populus trichocarpa [western balsam poplar]
gb|AAL32441.1|AF377344_1  Fe-superoxide dismutase precursor             160   1e-44   Medicago sativa [alfalfa]
ref|XP_011470027.1|  PREDICTED: superoxide dismutase [Fe], chloro...    159   2e-44   Fragaria vesca subsp. vesca
ref|XP_010426309.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    159   2e-44   Camelina sativa [gold-of-pleasure]
gb|KDP22500.1|  hypothetical protein JCGZ_26331                         159   2e-44   Jatropha curcas
ref|XP_007038206.1|  Fe superoxide dismutase 2 isoform 2                159   3e-44   
gb|ACU20819.1|  unknown                                                 155   3e-44   Glycine max [soybeans]
ref|XP_009132630.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    158   3e-44   Brassica rapa
gb|AFH08834.1|  iron superoxide dismutase 4                             155   4e-44   Diospyros oleifera [oily persimmon]
gb|AFJ66231.1|  hypothetical protein 34G24.21                           157   4e-44   Capsella rubella
ref|XP_009132629.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    158   4e-44   Brassica rapa
gb|AAS92464.1|  Fe-superoxide dismutase 1 precursor                     158   5e-44   Lotus japonicus
ref|XP_009363743.1|  PREDICTED: superoxide dismutase [Fe], chloro...    158   5e-44   Pyrus x bretschneideri [bai li]
ref|XP_006357313.1|  PREDICTED: superoxide dismutase [Fe], chloro...    156   5e-44   Solanum tuberosum [potatoes]
ref|XP_009363744.1|  PREDICTED: superoxide dismutase [Fe], chloro...    158   5e-44   Pyrus x bretschneideri [bai li]
ref|XP_011040320.1|  PREDICTED: superoxide dismutase [Fe], chloro...    157   5e-44   Populus euphratica
gb|AFH08833.1|  iron superoxide dismutase 3                             154   5e-44   Diospyros oleifera [oily persimmon]
gb|AAC63378.1|  iron superoxide dismutase                               158   6e-44   Zantedeschia aethiopica [arum-lily]
ref|XP_010442589.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    158   6e-44   Camelina sativa [gold-of-pleasure]
ref|XP_011040319.1|  PREDICTED: superoxide dismutase [Fe], chloro...    157   6e-44   Populus euphratica
gb|KIY96455.1|  superoxide dismutase                                    153   7e-44   Monoraphidium neglectum
ref|XP_010442588.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    157   8e-44   Camelina sativa [gold-of-pleasure]
gb|AFK34552.1|  unknown                                                 155   8e-44   Medicago truncatula
gb|KEH41343.1|  superoxide dismutase                                    155   8e-44   Medicago truncatula
gb|AGI65620.1|  chloroplast Fe-superoxide dismutase 1                   157   9e-44   Fragaria x ananassa
ref|XP_011040318.1|  PREDICTED: superoxide dismutase [Fe], chloro...    157   9e-44   Populus euphratica
gb|KCW46222.1|  hypothetical protein EUGRSUZ_K00110                     155   1e-43   Eucalyptus grandis [rose gum]
ref|XP_006279672.1|  hypothetical protein CARUB_v10026846mg             157   1e-43   Capsella rubella
gb|AFH08832.1|  iron superoxide dismutase 2                             155   1e-43   Diospyros oleifera [oily persimmon]
ref|XP_011040317.1|  PREDICTED: superoxide dismutase [Fe], chloro...    157   1e-43   Populus euphratica
ref|XP_010269875.1|  PREDICTED: superoxide dismutase [Fe], chloro...    157   1e-43   Nelumbo nucifera [Indian lotus]
gb|ACU18268.1|  unknown                                                 154   1e-43   Glycine max [soybeans]
ref|XP_010269873.1|  PREDICTED: superoxide dismutase [Fe], chloro...    157   1e-43   Nelumbo nucifera [Indian lotus]
gb|KCW46219.1|  hypothetical protein EUGRSUZ_K00110                     155   1e-43   Eucalyptus grandis [rose gum]
ref|XP_006402024.1|  hypothetical protein EUTSA_v10014192mg             157   1e-43   Eutrema salsugineum [saltwater cress]
ref|XP_006402022.1|  hypothetical protein EUTSA_v10014192mg             157   1e-43   Eutrema salsugineum [saltwater cress]
gb|KCW46221.1|  hypothetical protein EUGRSUZ_K00110                     154   2e-43   Eucalyptus grandis [rose gum]
gb|AHX36943.1|  Fe superoxide dismutase                                 158   2e-43   Betula platyphylla [Asian white birch]
gb|AFJ66174.1|  hypothetical protein 11M19.17                           155   2e-43   Arabidopsis halleri
gb|KFK36754.1|  hypothetical protein AALP_AA4G165500                    156   2e-43   Arabis alpina [alpine rockcress]
gb|KFK36755.1|  hypothetical protein AALP_AA4G165500                    156   2e-43   Arabis alpina [alpine rockcress]
gb|ABY48757.4|  chloroplast iron superoxide dismutase                   155   2e-43   Dimocarpus longan [longan]
emb|CAD42655.1|  iron-superoxide dismutase precursor                    154   2e-43   Pisum sativum [garden pea]
ref|XP_001690591.1|  superoxide dismutase [Fe]                          154   2e-43   Chlamydomonas reinhardtii
ref|XP_010536568.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    156   2e-43   Tarenaya hassleriana [spider flower]
gb|AAB04944.1|  superoxide dismutase precursor                          154   2e-43   Chlamydomonas reinhardtii
ref|XP_006589023.1|  PREDICTED: superoxide dismutase [Fe], chloro...    156   2e-43   Glycine max [soybeans]
ref|XP_003535933.1|  PREDICTED: superoxide dismutase [Fe], chloro...    156   2e-43   Glycine max [soybeans]
gb|AFG19618.1|  iron superoxide dismutase 2                             155   3e-43   Litchi chinensis [litchi]
gb|KCW46213.1|  hypothetical protein EUGRSUZ_K00110                     155   3e-43   Eucalyptus grandis [rose gum]
gb|KEH41344.1|  superoxide dismutase                                    156   3e-43   Medicago truncatula
ref|XP_007218693.1|  hypothetical protein PRUPE_ppa008765mg             156   4e-43   Prunus persica
ref|XP_007218694.1|  hypothetical protein PRUPE_ppa008765mg             156   4e-43   Prunus persica
ref|XP_008368041.1|  PREDICTED: superoxide dismutase [Fe], chloro...    155   5e-43   
ref|NP_199923.1|  Fe superoxide dismutase 2                             155   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865842.1|  hypothetical protein ARALYDRAFT_918143             155   6e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_008368040.1|  PREDICTED: superoxide dismutase [Fe], chloro...    155   7e-43   
gb|KCW46218.1|  hypothetical protein EUGRSUZ_K00110                     150   8e-43   Eucalyptus grandis [rose gum]
gb|KCW46220.1|  hypothetical protein EUGRSUZ_K00110                     150   1e-42   Eucalyptus grandis [rose gum]
gb|KCW46217.1|  hypothetical protein EUGRSUZ_K00110                     150   1e-42   Eucalyptus grandis [rose gum]
gb|KHN47222.1|  Superoxide dismutase [Fe], chloroplastic                154   1e-42   Glycine soja [wild soybean]
ref|XP_002946030.1|  superoxide dismutase [Fe]                          152   2e-42   Volvox carteri f. nagariensis
gb|EYU20151.1|  hypothetical protein MIMGU_mgv1a010591mg                154   2e-42   Erythranthe guttata [common monkey flower]
gb|AEY78522.2|  chloroplast Fe superoxide dismutase                     154   2e-42   Prunus persica
ref|XP_008234026.1|  PREDICTED: superoxide dismutase [Fe], chloro...    154   2e-42   Prunus mume [ume]
ref|XP_008234025.1|  PREDICTED: superoxide dismutase [Fe], chloro...    154   2e-42   Prunus mume [ume]
gb|AFG22595.1|  chloroplast Fe-superoxide dismutase 1B-a                154   2e-42   Prunus persica
ref|XP_010034971.1|  PREDICTED: superoxide dismutase [Fe], chloro...    151   2e-42   Eucalyptus grandis [rose gum]
ref|XP_009362730.1|  PREDICTED: superoxide dismutase [Fe], chloro...    154   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_007144183.1|  hypothetical protein PHAVU_007G1354001g            150   4e-42   Phaseolus vulgaris [French bean]
ref|XP_010482438.1|  PREDICTED: LOW QUALITY PROTEIN: superoxide d...    153   4e-42   Camelina sativa [gold-of-pleasure]
gb|AAF28773.1|AF077224_1  iron-superoxide dismutase precursor           151   4e-42   Vigna unguiculata
pdb|1UNF|X  Chain X, The Crystal Structure Of The Eukaryotic Feso...    151   4e-42   Vigna unguiculata
gb|AFH08803.1|  chloroplast Fe-superoxide dismutase 2A-a                153   5e-42   Prunus persica
gb|AFH08806.1|  chloroplast Fe-superoxide dismutase 2D-a                153   6e-42   Prunus persica
ref|XP_006413341.1|  hypothetical protein EUTSA_v10026218mg             150   6e-42   Eutrema salsugineum [saltwater cress]
ref|XP_008364852.1|  PREDICTED: superoxide dismutase [Fe], chloro...    153   6e-42   
ref|XP_008364851.1|  PREDICTED: superoxide dismutase [Fe], chloro...    153   7e-42   
ref|NP_001237901.1|  iron-superoxide dismutase                          150   7e-42   
ref|XP_007145453.1|  hypothetical protein PHAVU_007G240600g             152   7e-42   Phaseolus vulgaris [French bean]
ref|XP_007144184.1|  hypothetical protein PHAVU_007G1354001g            150   8e-42   Phaseolus vulgaris [French bean]
ref|XP_008357013.1|  PREDICTED: superoxide dismutase [Fe], chloro...    152   1e-41   
gb|AGV54680.1|  iron-superoxide dismutase                               150   1e-41   Phaseolus vulgaris [French bean]
ref|XP_010433685.1|  PREDICTED: superoxide dismutase [Fe] 1, chlo...    149   1e-41   
ref|NP_001238486.1|  superoxide dismutase [Fe], chloroplastic pre...    150   1e-41   Glycine max [soybeans]
ref|XP_010438938.1|  PREDICTED: superoxide dismutase [Fe] 1, chlo...    150   1e-41   
gb|ACU23782.1|  unknown                                                 150   1e-41   Glycine max [soybeans]
ref|XP_004166617.1|  PREDICTED: superoxide dismutase [Fe], chloro...    152   1e-41   
ref|XP_006838440.1|  hypothetical protein AMTR_s00002p00128010          150   2e-41   
gb|AEG89520.1|  Fe superoxide dismutase                                 148   2e-41   Brassica oleracea var. botrytis [cauliflower]
gb|AAA32791.1|  Fe-superoxide dismutase                                 148   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KHN05550.1|  Superoxide dismutase [Fe], chloroplastic                150   4e-41   Glycine soja [wild soybean]
ref|XP_008453838.1|  PREDICTED: superoxide dismutase [Fe], chloro...    150   4e-41   Cucumis melo [Oriental melon]
gb|ACL81495.1|  FeSOD                                                   148   5e-41   Ginkgo biloba [ginkgo]
ref|XP_010536565.1|  PREDICTED: superoxide dismutase [Fe] 1, chlo...    147   5e-41   Tarenaya hassleriana [spider flower]
gb|AAC15842.1|  superoxide dismutase                                    147   6e-41   Raphanus sativus
ref|NP_194240.1|  superoxide dismutase [Fe]                             147   9e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448479.1|  PREDICTED: superoxide dismutase [Fe] 1, chlo...    147   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010448478.1|  PREDICTED: superoxide dismutase [Fe] 1, chlo...    147   1e-40   Camelina sativa [gold-of-pleasure]
gb|AFH08835.1|  iron superoxide dismutase 5                             144   2e-40   Diospyros oleifera [oily persimmon]
emb|CDY11055.1|  BnaA03g47140D                                          146   2e-40   Brassica napus [oilseed rape]
emb|CDY34342.1|  BnaA01g14450D                                          146   2e-40   Brassica napus [oilseed rape]
ref|NP_001288905.1|  fibronectin type III and SPRY domain-contain...    146   2e-40   Brassica rapa
ref|XP_009138864.1|  PREDICTED: superoxide dismutase [Fe] 1, chlo...    146   2e-40   Brassica rapa
gb|KGN53188.1|  hypothetical protein Csa_4G025180                       149   2e-40   Cucumis sativus [cucumbers]
emb|CAB36752.1|  superoxide dismutase (EC 1.15.1.1) (Fe)(fragment)      147   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146889.1|  PREDICTED: superoxide dismutase [Fe], chloro...    148   3e-40   Cucumis sativus [cucumbers]
gb|KHN30686.1|  Superoxide dismutase [Fe], chloroplastic                146   3e-40   Glycine soja [wild soybean]
ref|XP_002867626.1|  hypothetical protein ARALYDRAFT_492324             144   1e-39   
ref|XP_009599437.1|  PREDICTED: superoxide dismutase [Fe], chloro...    144   2e-39   Nicotiana tomentosiformis
emb|CDX92676.1|  BnaC07g39340D                                          144   2e-39   
emb|CDY03380.1|  BnaC01g17020D                                          143   2e-39   
gb|AAS92466.1|  Fe-superoxide dismutase 2 precursor                     143   6e-39   Lotus japonicus
ref|XP_006282692.1|  hypothetical protein CARUB_v10005448mg             142   4e-38   
gb|AFH08836.1|  iron superoxide dismutase 6                             139   8e-38   Diospyros oleifera [oily persimmon]
ref|XP_006437024.1|  hypothetical protein CICLE_v10032233mg             140   1e-37   
gb|KDO57700.1|  hypothetical protein CISIN_1g0220782mg                  136   3e-37   Citrus sinensis [apfelsine]
dbj|BAC66946.1|  chloroplastic iron superoxide dismutase                137   5e-37   Barbula unguiculata
gb|KDO57697.1|  hypothetical protein CISIN_1g0220782mg                  138   9e-37   Citrus sinensis [apfelsine]
gb|KDO57698.1|  hypothetical protein CISIN_1g0220782mg                  137   9e-37   Citrus sinensis [apfelsine]
gb|ABR23159.1|  iron-superoxide dismutase 1                             137   9e-37   Ulva fasciata
gb|ACB30317.1|  iron superoxide dismutase                               134   1e-36   Solanum tuberosum [potatoes]
gb|AAS47494.1|  iron superoxide dismutase                               137   1e-36   Pinus pinaster [cluster pine]
ref|XP_010063026.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    137   2e-36   
gb|ADR01109.1|  Fe superoxide dismutase 1                               134   4e-36   Brassica rapa
dbj|BAO18397.1|  cytosolic Fe-superoxide dismutase                      133   1e-35   Pogonatum inflexum
gb|ADE77392.1|  unknown                                                 134   2e-35   Picea sitchensis
gb|ABR23160.1|  iron-superoxide dismutase 2                             132   3e-35   Ulva fasciata
ref|XP_010432693.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    132   3e-35   Camelina sativa [gold-of-pleasure]
emb|CDY70727.1|  BnaCnng69530D                                          133   1e-34   Brassica napus [oilseed rape]
gb|KHN00993.1|  Superoxide dismutase [Fe], chloroplastic                132   2e-34   Glycine soja [wild soybean]
dbj|BAO18766.1|  chloroplastic Fe-superoxide dismutase                  132   3e-34   Equisetum arvense [common horsetail]
ref|XP_010493451.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    131   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006376943.1|  hypothetical protein POPTR_0012s11400g             127   4e-34   
gb|AFV66768.1|  iron superoxide dismutase                               132   4e-34   Musa acuminata AAA Group [Cavendish banana]
ref|XP_009384755.1|  PREDICTED: superoxide dismutase [Fe], chloro...    132   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFJ66200.1|  hypothetical protein 7G9.19                             131   5e-34   Boechera stricta
gb|AFX61787.2|  iron superoxide dismutase                               131   6e-34   Musa acuminata [banana]
ref|XP_002946031.1|  superoxide dismutase [Fe]                          129   1e-33   Volvox carteri f. nagariensis
ref|XP_002872050.1|  hypothetical protein ARALYDRAFT_489192             130   1e-33   
gb|ADR01298.1|  iron-superoxide dismutase                               130   1e-33   Ceratopteris thalictroides
gb|AAX92665.1|  chloroplast iron superoxide dismutase                   128   2e-33   Dunaliella salina
ref|XP_010454614.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    129   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002982004.1|  hypothetical protein SELMODRAFT_115358             127   3e-33   
ref|XP_010421131.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    128   4e-33   Camelina sativa [gold-of-pleasure]
emb|CDY45763.1|  BnaC02g42190D                                          128   4e-33   Brassica napus [oilseed rape]
ref|XP_009150862.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    128   5e-33   Brassica rapa
emb|CDX88013.1|  BnaA06g26040D                                          128   5e-33   
ref|XP_006394599.1|  hypothetical protein EUTSA_v10004781mg             128   5e-33   Eutrema salsugineum [saltwater cress]
gb|ABR24272.1|  iron-containing superoxide dismutase                    128   5e-33   Brassica napus [oilseed rape]
emb|CDY16845.1|  BnaA09g05370D                                          128   5e-33   Brassica napus [oilseed rape]
dbj|BAC66948.1|  chloroplastic iron superoxide dismutase                128   6e-33   Marchantia paleacea subsp. diptera
emb|CDX87176.1|  BnaC09g04910D                                          128   6e-33   
gb|KDO57693.1|  hypothetical protein CISIN_1g026199mg                   125   6e-33   Citrus sinensis [apfelsine]
ref|XP_006437026.1|  hypothetical protein CICLE_v10032233mg             127   7e-33   
ref|XP_002986085.1|  hypothetical protein SELMODRAFT_123324             126   7e-33   
gb|AAO16563.1|  iron superoxide dismutase                               125   8e-33   Solanum tuberosum [potatoes]
ref|XP_010942991.1|  PREDICTED: superoxide dismutase [Fe], chloro...    128   9e-33   Elaeis guineensis
gb|KFK39196.1|  hypothetical protein AALP_AA3G212200                    127   9e-33   Arabis alpina [alpine rockcress]
ref|XP_009141488.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    127   1e-32   Brassica rapa
ref|NP_197722.1|  Fe superoxide dismutase 3                             126   3e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAC24834.1|  iron superoxide dismutase 3                             126   3e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63713.1|  iron superoxide dismutase 3                             126   3e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AGH25521.1|  Fe superoxide dismutase                                 120   3e-32   Mentha x piperita
gb|AFM43802.1|  iron superoxide dismutase Fe-SOD6                       125   4e-32   Litchi chinensis [litchi]
gb|KJB06967.1|  hypothetical protein B456_001G052700                    125   4e-32   Gossypium raimondii
gb|KDO57699.1|  hypothetical protein CISIN_1g0220782mg                  125   4e-32   Citrus sinensis [apfelsine]
gb|AFV96148.1|  iron superoxide dismutase                               123   7e-32   Brassica oleracea
ref|NP_001031710.1|  superoxide dismutase [Fe]                          122   2e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AET75833.1|  iron-superoxide dismutase                               121   3e-31   Diospyros oleifera [oily persimmon]
ref|XP_002267399.2|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    125   3e-31   Vitis vinifera
gb|AJP77020.1|  Fe superoxide dismutase                                 122   6e-31   Isoetes sinensis
ref|XP_010915011.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    122   8e-31   Elaeis guineensis
ref|XP_001751975.1|  predicted protein                                  120   1e-30   
ref|XP_010915008.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    122   1e-30   Elaeis guineensis
gb|ABR24273.1|  iron-containing superoxide dismutase                    122   1e-30   Brassica napus [oilseed rape]
ref|XP_010521891.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    122   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_002436456.1|  hypothetical protein SORBIDRAFT_10g002970          120   1e-30   
ref|XP_002520915.1|  superoxide dismutase [fe], putative                122   1e-30   Ricinus communis
ref|XP_010915005.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    122   2e-30   Elaeis guineensis
ref|XP_010915004.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    122   2e-30   Elaeis guineensis
gb|KCW46214.1|  hypothetical protein EUGRSUZ_K00110                     119   2e-30   Eucalyptus grandis [rose gum]
dbj|BAO18396.1|  chloroplastic Fe-superoxide dismutase-1                120   3e-30   Pogonatum inflexum
gb|ABI26730.1|  putative iron superoxide dismutase                      118   3e-30   Fagus sylvatica
ref|XP_008809006.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    120   3e-30   Phoenix dactylifera
ref|XP_008648270.1|  PREDICTED: chloroplastic iron-superoxide dis...    120   4e-30   
gb|ACG32380.1|  superoxide dismutase, chloroplast                       120   5e-30   Zea mays [maize]
ref|XP_008376353.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    119   6e-30   
ref|XP_006376942.1|  hypothetical protein POPTR_0012s11400g             116   7e-30   
gb|AEN71832.1|  chloroplast iron superoxide dismutase variant 1         118   1e-29   Dimocarpus longan [longan]
gb|AEN71833.1|  chloroplast iron superoxide dismutase variant 2         118   1e-29   Dimocarpus longan [longan]
gb|AEN71834.1|  chloroplast iron superoxide dismutase variant 3         118   2e-29   Dimocarpus longan [longan]
ref|XP_006855573.1|  hypothetical protein AMTR_s00044p00032580          119   2e-29   
gb|ADK70231.1|  chloroplast iron superoxide dismutase                   118   2e-29   Dimocarpus longan [longan]
gb|ADK70232.2|  chloroplast iron superoxide dismutase                   118   2e-29   Dimocarpus longan [longan]
gb|ACG49262.1|  iron superoxide dismutase                               116   2e-29   Citrus maxima [buntan]
ref|XP_008450699.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    118   4e-29   Cucumis melo [Oriental melon]
ref|NP_001104871.1|  chloroplastic iron-superoxide dismutase            117   4e-29   
gb|ADK70235.2|  chloroplast iron superoxide dismutase                   117   5e-29   Dimocarpus longan [longan]
gb|ABA71697.1|  iron-superoxide dismutase                               116   5e-29   Auxenochlorella pyrenoidosa
ref|XP_010270759.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    117   9e-29   Nelumbo nucifera [Indian lotus]
ref|XP_010270760.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    117   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_004157264.1|  PREDICTED: superoxide dismutase [Fe], chloro...    117   1e-28   
gb|AGN88923.1|  chloroplast iron superoxide dismutase 7a                116   1e-28   Litchi chinensis [litchi]
gb|AGI65621.1|  chloroplast Fe-superoxide dismutase 2                   116   1e-28   Fragaria x ananassa
dbj|BAD13298.1|  iron-superoxide dismutase                              117   1e-28   Matteuccia struthiopteris
gb|KDP42564.1|  hypothetical protein JCGZ_24338                         117   1e-28   Jatropha curcas
ref|XP_009786437.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    117   1e-28   Nicotiana sylvestris
ref|XP_009786440.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    117   1e-28   Nicotiana sylvestris
ref|XP_009786442.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    116   1e-28   Nicotiana sylvestris
ref|XP_007225899.1|  hypothetical protein PRUPE_ppa011882mg             114   2e-28   
ref|XP_011086546.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    116   2e-28   Sesamum indicum [beniseed]
ref|XP_009624955.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    116   2e-28   Nicotiana tomentosiformis
ref|XP_004297728.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    115   3e-28   Fragaria vesca subsp. vesca
ref|XP_009381140.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    115   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP10730.1|  unnamed protein product                                115   3e-28   Coffea canephora [robusta coffee]
ref|XP_009624954.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    116   3e-28   Nicotiana tomentosiformis
gb|AAX09664.1|  iron-superoxide dismutase                               114   4e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_009351722.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    115   4e-28   Pyrus x bretschneideri [bai li]
gb|AII02151.1|  iron superoxide dismutase variant 1                     114   4e-28   Musa acuminata [banana]
ref|XP_008221055.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    115   5e-28   Prunus mume [ume]
ref|XP_005851580.1|  hypothetical protein CHLNCDRAFT_33910              114   6e-28   Chlorella variabilis
gb|ABF68752.1|  Fe-superoxide dismutase                                 115   7e-28   
gb|AIT56203.1|  iron superoxide dismutase 1B                            114   8e-28   
dbj|BAA37131.1|  iron-superoxide dismutase                              114   1e-27   
ref|XP_010915010.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    114   1e-27   
gb|AAZ93364.1|  superoxide dismutase                                    110   1e-27   
ref|XP_004964518.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    114   1e-27   
gb|AII02149.1|  iron superoxide dismutase                               114   1e-27   
ref|NP_001056774.1|  Os06g0143000                                       114   1e-27   
gb|AJF34887.1|  chloroplast superoxide dismutase                        113   1e-27   
ref|XP_010915007.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    114   1e-27   
ref|XP_010915006.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    114   1e-27   
ref|XP_009351721.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    113   2e-27   
gb|AAO20086.1|  iron superoxide dismutase                               110   2e-27   
ref|XP_008361911.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    113   2e-27   
ref|XP_010915003.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    114   2e-27   
gb|EPS72986.1|  superoxide dismutase                                    112   2e-27   
gb|AIF32071.1|  iron superoxide dismutase                               113   2e-27   
ref|XP_010915001.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    114   2e-27   
ref|XP_009381137.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    113   2e-27   
gb|EYU31281.1|  hypothetical protein MIMGU_mgv1a011604mg                113   2e-27   
gb|KJB79829.1|  hypothetical protein B456_013G068400                    112   2e-27   
ref|XP_004506461.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    112   4e-27   
ref|XP_001756362.1|  predicted protein                                  112   4e-27   
ref|XP_004506460.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    112   4e-27   
gb|AFC35159.1|  chloroplast iron superoxide dismutase                   111   5e-27   
ref|WP_007098523.1|  superoxide dismutase                               110   6e-27   
gb|KCW65076.1|  hypothetical protein EUGRSUZ_G02584                     111   6e-27   
ref|XP_007043239.1|  Superoxide dismutase isoform 1                     110   7e-27   
gb|KHG28218.1|  Superoxide dismutase [Fe], chloroplastic                112   7e-27   
gb|ABL85055.1|  superoxide dismutase                                    110   7e-27   
gb|KJB79827.1|  hypothetical protein B456_013G068400                    112   8e-27   
ref|WP_035829630.1|  superoxide dismutase                               110   1e-26   
ref|XP_006656625.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    110   1e-26   
ref|XP_007043240.1|  Superoxide dismutase isoform 2                     110   1e-26   
ref|XP_004501984.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    112   1e-26   
ref|XP_004501983.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    112   1e-26   
ref|XP_004501982.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    112   1e-26   
ref|XP_006437632.1|  hypothetical protein CICLE_v10032493mg             111   1e-26   
gb|ADW66152.1|  chloroplast [Fe] superoxide dismutase                   111   1e-26   
gb|AGJ71758.1|  iron superoxide dismutase                               110   2e-26   
gb|ACJ84354.1|  unknown                                                 109   2e-26   
ref|WP_023459148.1|  superoxide dismutase                               109   2e-26   
gb|AFK35380.1|  unknown                                                 109   2e-26   
ref|XP_010067009.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    110   2e-26   
ref|XP_010067012.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    110   2e-26   
gb|KDO69878.1|  hypothetical protein CISIN_1g025006mg                   109   3e-26   
ref|XP_003557205.1|  PREDICTED: superoxide dismutase [Fe] 2, chlo...    110   3e-26   
ref|WP_015108916.1|  superoxide dismutase                               108   3e-26   
ref|WP_006909411.1|  superoxide dismutase                               108   3e-26   
ref|XP_004231531.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    110   3e-26   
ref|XP_008805924.1|  PREDICTED: superoxide dismutase [Fe], chloro...    110   4e-26   
ref|XP_010685606.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    110   4e-26   
ref|XP_010685604.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    110   4e-26   
ref|WP_011431628.1|  superoxide dismutase                               108   5e-26   
ref|XP_005647238.1|  superoxide dismutase [Fe], chloroplastic           108   5e-26   
ref|WP_011936207.1|  superoxide dismutase                               108   6e-26   
gb|AEB71566.1|  chloroplast iron superoxide dismutase 3                 109   6e-26   
ref|XP_008805923.1|  PREDICTED: superoxide dismutase [Fe], chloro...    110   7e-26   
ref|WP_035224608.1|  hypothetical protein                               107   8e-26   
ref|XP_006484503.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    108   8e-26   
ref|XP_002307154.2|  hypothetical protein POPTR_0005s09190g             109   9e-26   
gb|AFV08636.1|  iron-superoxide dismutase                               108   9e-26   
ref|WP_007100397.1|  superoxide dismutase                               107   9e-26   
gb|KEH35113.1|  superoxide dismutase                                    108   9e-26   
ref|XP_008805922.1|  PREDICTED: superoxide dismutase [Fe], chloro...    110   1e-25   
ref|XP_006484502.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    108   1e-25   
ref|WP_011434074.1|  superoxide dismutase                               107   1e-25   
ref|XP_011022012.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    108   1e-25   
ref|WP_022195321.1|  superoxide dismutase                               107   1e-25   
gb|ABH11031.1|  iron superoxide dismutase, isoform 1                    105   2e-25   
ref|XP_006350369.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    108   2e-25   
ref|WP_015202326.1|  Superoxide dismutase                               107   2e-25   
ref|XP_002969568.1|  hypothetical protein SELMODRAFT_91586              107   2e-25   
ref|WP_006041934.1|  superoxide dismutase                               106   2e-25   
gb|ABR01632.1|  superoxide dismutase                                    106   2e-25   
ref|WP_008212937.1|  superoxide dismutase                               106   3e-25   
ref|WP_010310721.1|  superoxide dismutase                               106   3e-25   
ref|XP_010270762.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    107   3e-25   
ref|XP_008389078.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    107   3e-25   
ref|WP_036541851.1|  superoxide dismutase                               103   4e-25   
ref|WP_011933640.1|  superoxide dismutase                               106   4e-25   
gb|ABA00456.1|  FeSOD                                                   107   5e-25   
gb|AHD25899.1|  Fe-superoxide dismutase                                 106   5e-25   
ref|WP_036236374.1|  MULTISPECIES: superoxide dismutase                 105   5e-25   
ref|XP_007146078.1|  hypothetical protein PHAVU_006G010800g             107   5e-25   
ref|WP_011830069.1|  superoxide dismutase                               105   5e-25   
ref|WP_006171887.1|  superoxide dismutase                               105   5e-25   
ref|WP_017323315.1|  superoxide dismutase                               105   5e-25   
ref|WP_017462660.1|  superoxide dismutase                               105   7e-25   
ref|WP_039718749.1|  superoxide dismutase                               105   7e-25   
ref|XP_003555663.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    106   8e-25   
ref|WP_010315495.1|  superoxide dismutase                               105   8e-25   
gb|AAR05657.1|  iron superoxide dismutase                               104   8e-25   
ref|WP_008868394.1|  superoxide dismutase                               105   8e-25   
ref|WP_017651104.1|  superoxide dismutase                               105   8e-25   
ref|WP_014745067.1|  superoxide dismutase                               105   9e-25   
ref|XP_006605648.1|  PREDICTED: superoxide dismutase [Fe] 3, chlo...    107   9e-25   
ref|WP_028460469.1|  superoxide dismutase                               105   1e-24   
ref|WP_025040471.1|  superoxide dismutase                               104   1e-24   
gb|AAL25194.1|  superoxide dismutase                                    104   1e-24   
ref|WP_015209340.1|  superoxide dismutase                               104   1e-24   
ref|WP_009556707.1|  superoxide dismutase                               104   2e-24   
ref|WP_023453742.1|  superoxide dismutase                               103   3e-24   
ref|WP_023449573.1|  superoxide dismutase                               103   3e-24   
ref|WP_007082228.1|  superoxide dismutase                               103   3e-24   
ref|WP_005877638.1|  superoxide dismutase                               103   3e-24   
ref|WP_015126849.1|  Superoxide dismutase                               103   3e-24   
ref|WP_027492060.1|  superoxide dismutase                               103   3e-24   
ref|WP_006274361.1|  superoxide dismutase                               103   4e-24   
gb|AAF25009.1|AF177945_1  superoxide dismutase                          103   4e-24   
ref|WP_035878663.1|  superoxide dismutase                               103   5e-24   
ref|XP_011400728.1|  Superoxide dismutase [Fe]                          102   5e-24   
gb|ADG26763.1|  chloroplast iron superoxide dismutase                   103   6e-24   
ref|WP_022975532.1|  superoxide dismutase                               102   6e-24   
gb|KIE06852.1|  superoxide dismutase                                    102   7e-24   
ref|WP_029890369.1|  superoxide dismutase                               102   8e-24   
emb|CDM24755.1|  Superoxide dismutase [Fe]                              102   9e-24   
dbj|BAK07178.1|  predicted protein                                      103   9e-24   
ref|WP_036315131.1|  superoxide dismutase                               102   9e-24   
ref|WP_011634279.1|  superoxide dismutase                               102   9e-24   
gb|EEF78628.1|  superoxide dismutase (Mn/Fe family), C-terminal d...    102   9e-24   
gb|EKD27751.1|  hypothetical protein ACD_79C00592G0003                  103   9e-24   
ref|WP_026633450.1|  superoxide dismutase                               102   1e-23   
ref|WP_018026957.1|  superoxide dismutase                               102   1e-23   
emb|CEG59065.1|  superoxide dismutase, Fe                               102   1e-23   
ref|WP_043683013.1|  superoxide dismutase                               102   1e-23   
ref|WP_026635147.1|  superoxide dismutase                               101   2e-23   
dbj|BAF03057.1|  iron-cofactored superoxide dismutase                   100   2e-23   
ref|WP_035034147.1|  superoxide dismutase                               101   2e-23   
ref|WP_029632933.1|  superoxide dismutase [                             101   2e-23   
ref|WP_026879327.1|  superoxide dismutase                               101   2e-23   
ref|WP_011111481.1|  superoxide dismutase                               101   2e-23   
ref|WP_008435747.1|  superoxide dismutase                               101   2e-23   
ref|WP_013480369.1|  superoxide dismutase                               101   2e-23   
ref|WP_026611706.1|  superoxide dismutase                               101   3e-23   
ref|WP_028382888.1|  superoxide dismutase                               101   3e-23   
ref|WP_039802791.1|  superoxide dismutase                               100   3e-23   
ref|WP_022186125.1|  superoxide dismutase                               100   3e-23   
ref|WP_022006559.1|  superoxide dismutase                               100   3e-23   
ref|WP_004274034.1|  superoxide dismutase                               100   3e-23   
ref|WP_044562216.1|  superoxide dismutase                               100   4e-23   
ref|WP_015046992.1|  superoxide dismutase                               100   4e-23   
gb|AAV84021.1|  iron superoxide dismutase                               100   4e-23   
ref|WP_036195355.1|  superoxide dismutase                               100   4e-23   
gb|EEE65068.1|  hypothetical protein OsJ_20091                          101   4e-23   
ref|WP_018573477.1|  superoxide dismutase                               100   4e-23   
emb|CEK12121.1|  Superoxide dismutase [Fe]                              100   5e-23   
dbj|BAF03055.1|  iron-cofactored superoxide dismutase                 99.8    5e-23   
ref|WP_016873389.1|  superoxide dismutase                               100   5e-23   
ref|WP_003801491.1|  superoxide dismutase                               100   5e-23   
ref|WP_007507484.1|  MULTISPECIES: superoxide dismutase                 100   5e-23   
ref|WP_041512323.1|  superoxide dismutase                               100   5e-23   
ref|WP_028769878.1|  superoxide dismutase                               100   6e-23   
ref|WP_004174973.1|  Superoxide dismutase [Fe]                          100   6e-23   
gb|EMS63773.1|  Superoxide dismutase [Fe], chloroplastic                100   6e-23   
ref|WP_023463237.1|  superoxide dismutase                               100   6e-23   
ref|WP_038615722.1|  superoxide dismutase                               100   7e-23   
ref|WP_035153660.1|  superoxide dismutase                               100   7e-23   
dbj|BAF03052.1|  iron-cofactored superoxide dismutase                 99.4    7e-23   
dbj|BAF03038.1|  iron-cofactored superoxide dismutase                 99.4    7e-23   
ref|WP_026063694.1|  superoxide dismutase                               100   7e-23   
ref|WP_019492946.1|  superoxide dismutase                               100   7e-23   
ref|WP_027312605.1|  superoxide dismutase                               100   7e-23   
ref|WP_015212429.1|  Superoxide dismutase                               100   8e-23   
ref|WP_020399037.1|  hypothetical protein                               100   8e-23   
ref|WP_036169960.1|  superoxide dismutase                             99.8    9e-23   
ref|XP_005850533.1|  hypothetical protein CHLNCDRAFT_140393           99.8    1e-22   
ref|WP_028372829.1|  superoxide dismutase                             99.8    1e-22   
ref|WP_015871416.1|  superoxide dismutase                             99.8    1e-22   
ref|WP_036114975.1|  MULTISPECIES: superoxide dismutase               99.8    1e-22   
ref|WP_011903224.1|  superoxide dismutase                             99.8    1e-22   
ref|WP_010297066.1|  superoxide dismutase                             99.8    1e-22   
dbj|BAA84487.1|  iron-containing superoxide disumutase                98.6    1e-22   
ref|WP_012702301.1|  superoxide dismutase                             99.4    1e-22   
gb|AIA12765.1|  Iron/manganese superoxide dismutases, C-terminal ...  99.8    1e-22   
ref|WP_010997089.1|  superoxide dismutase                             99.8    1e-22   
ref|WP_040810597.1|  superoxide dismutase                             99.4    1e-22   
ref|WP_015162496.1|  superoxide dismutase                             99.4    1e-22   
ref|WP_006277967.1|  superoxide dismutase                             99.4    1e-22   
ref|WP_011398372.1|  superoxide dismutase                             99.4    1e-22   
gb|EED31028.1|  superoxide dismutase (Fe)                             99.4    1e-22   
ref|WP_009455685.1|  MULTISPECIES: hypothetical protein               99.4    1e-22   
ref|WP_031596964.1|  superoxide dismutase                             99.4    1e-22   
ref|WP_024298628.1|  superoxide dismutase                             99.4    1e-22   
ref|WP_036245956.1|  superoxide dismutase                             99.8    1e-22   
ref|WP_011389513.1|  superoxide dismutase                             99.8    2e-22   
ref|WP_027714790.1|  superoxide dismutase                             99.0    2e-22   
gb|AFD03259.1|  superoxide dismutase                                  99.4    2e-22   
ref|WP_020406636.1|  superoxide dismutase                             99.0    2e-22   
ref|WP_019467356.1|  superoxide dismutase                             99.0    2e-22   
ref|WP_016865190.1|  superoxide dismutase                             99.0    2e-22   
ref|WP_011379863.1|  superoxide dismutase                             99.4    2e-22   
gb|EKD77905.1|  superoxide dismutase (Fe)                             99.0    2e-22   
ref|WP_013192659.1|  superoxide dismutase                             99.0    2e-22   
ref|WP_009460274.1|  MULTISPECIES: superoxide dismutase               99.0    2e-22   
ref|WP_007187524.1|  superoxide dismutase                             99.0    2e-22   
ref|WP_040098145.1|  superoxide dismutase                             99.0    2e-22   
emb|CDI01641.1|  superoxide dismutase, iron                           99.0    2e-22   
ref|WP_021207355.1|  superoxide dismutase                             99.0    2e-22   
dbj|GAJ68823.1|  superoxide dismutase, Fe                             99.0    2e-22   
ref|WP_016210921.1|  superoxide dismutase                             99.0    2e-22   
gb|EKE10108.1|  superoxide dismutase                                  99.0    2e-22   
ref|WP_009726055.1|  superoxide dismutase (Fe)                        99.0    2e-22   
ref|WP_012848518.1|  MULTISPECIES: superoxide dismutase               99.0    2e-22   
ref|WP_014853754.1|  superoxide dismutase                             98.6    2e-22   
ref|WP_010961311.1|  superoxide dismutase                             99.0    2e-22   
ref|WP_037023489.1|  superoxide dismutase                             98.6    2e-22   
ref|WP_028386212.1|  superoxide dismutase                             98.6    2e-22   
ref|WP_018692808.1|  superoxide dismutase                             98.6    2e-22   
ref|WP_041036004.1|  superoxide dismutase                             99.0    2e-22   
ref|WP_018576679.1|  superoxide dismutase                             98.6    2e-22   
ref|WP_024544846.1|  superoxide dismutase                             98.6    3e-22   
ref|WP_004925742.1|  MULTISPECIES: superoxide dismutase               99.0    3e-22   
gb|AJP49279.1|  superoxide dismutase                                  98.6    3e-22   
ref|WP_038464864.1|  superoxide dismutase                             98.6    3e-22   
ref|WP_015956466.1|  superoxide dismutase                             98.6    3e-22   
dbj|BAA84483.1|  iron-containing superoxide dismutase                 97.4    3e-22   
dbj|GAM53321.1|  superoxide dismutase                                 98.6    3e-22   
dbj|BAA84484.1|  iron-containing superoxide dismutase                 97.4    3e-22   
ref|WP_044873627.1|  superoxide dismutase                             95.9    3e-22   
ref|WP_026921584.1|  superoxide dismutase                             98.2    3e-22   



>emb|CDP13862.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   172 bits (437),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S   F+  KIE+K  R  G PKI A  +LKPPPYP++ALEP MSR T EYHWGKHHRAYV
Sbjct  24   STRGFQWKKIERKCLRKAGPPKITAKFDLKPPPYPLDALEPDMSRNTMEYHWGKHHRAYV  83

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            +NLNKQIVGTELDG++LEDI+  TYNNGDLLP FNNAAQAWNH FFWES+K
Sbjct  84   ENLNKQIVGTELDGMTLEDIIRVTYNNGDLLPPFNNAAQAWNHDFFWESIK  134



>ref|XP_009773810.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Nicotiana 
sylvestris]
Length=303

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = +1

Query  157  EKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGT  333
            +K+F R  G  K+ A  EL PPPYPMNALEPHMS  TFEYHWGKHHRAYVDNLNKQI GT
Sbjct  33   KKQFARKAGLVKVTAKFELMPPPYPMNALEPHMSHTTFEYHWGKHHRAYVDNLNKQIDGT  92

Query  334  ELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            ELDG++LEDI+L TYN GDLLP FNNAAQAWNH FFWESMKP
Sbjct  93   ELDGMTLEDIILITYNRGDLLPPFNNAAQAWNHQFFWESMKP  134



>ref|XP_004235206.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Solanum 
lycopersicum]
Length=303

 Score =   171 bits (433),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGV  348
            ++ G  K+ A  EL PPPYPMNALEPHMSR TFEYHWGKHHRAYVDNLNKQIVGTELD +
Sbjct  38   SKAGTVKVTAKFELNPPPYPMNALEPHMSRTTFEYHWGKHHRAYVDNLNKQIVGTELDEL  97

Query  349  SLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            +LEDI+L TYN G+LLP FNNAAQAWNH FFWESMKP
Sbjct  98   TLEDIILVTYNQGNLLPPFNNAAQAWNHQFFWESMKP  134



>ref|XP_010322099.1| PREDICTED: iron superoxide dismutase isoform X1 [Solanum lycopersicum]
Length=251

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +1

Query  124  SSNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAY  300
            S +  ++  K++K+F R  G   I A  +L PPPYPM+ALEPHMS +TFE+HWGKHHRAY
Sbjct  24   SKSLQWRTQKLQKQFGRKAGSATITAKFDLIPPPYPMDALEPHMSSRTFEFHWGKHHRAY  83

Query  301  VDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            VDNLNKQI GTELDG +LEDI+L TYNNG  LPAFNNAAQAWNH FFWESMKP
Sbjct  84   VDNLNKQIDGTELDGKTLEDIILVTYNNGAPLPAFNNAAQAWNHQFFWESMKP  136



>ref|XP_006358179.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic-like isoform 
X2 [Solanum tuberosum]
Length=302

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +1

Query  151  KIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            +I K   + G  K+ A  EL PPPYPMNALEPHMSR TFEYHWGKHHRAYVDNLNKQIVG
Sbjct  31   RIHKLARKAGPVKVTAKFELNPPPYPMNALEPHMSRTTFEYHWGKHHRAYVDNLNKQIVG  90

Query  331  TELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            TELD ++LEDI+L TYN G+LLP FNNAAQAWNH FFWESMK
Sbjct  91   TELDELTLEDIILITYNQGNLLPPFNNAAQAWNHQFFWESMK  132



>gb|AEP14527.1| Fe-superoxide dismutase [Phytolacca acinosa]
Length=282

 Score =   167 bits (423),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  145  CGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQI  324
            C   +++  R G   + A  +LKPPPY  +ALEPHM++QTFEYHWGKHHRAYVDNLNKQI
Sbjct  31   CRYKQRQVRRAGAAVVTAKFDLKPPPYAFDALEPHMTKQTFEYHWGKHHRAYVDNLNKQI  90

Query  325  VGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            VGTELDG++LED+V  TYN GD  PAFNNAAQAWNH FFWESMKP
Sbjct  91   VGTELDGLALEDVVRITYNKGDPFPAFNNAAQAWNHEFFWESMKP  135



>ref|XP_006358178.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=304

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +1

Query  157  EKKFTRGGFP-KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGT  333
            +K+  R   P K+ A  EL PPPYPMNALEPHMSR TFEYHWGKHHRAYVDNLNKQIVGT
Sbjct  34   KKQLARKAGPVKVTAKFELNPPPYPMNALEPHMSRTTFEYHWGKHHRAYVDNLNKQIVGT  93

Query  334  ELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            ELD ++LEDI+L TYN G+LLP FNNAAQAWNH FFWESMK
Sbjct  94   ELDELTLEDIILITYNQGNLLPPFNNAAQAWNHQFFWESMK  134



>gb|ADC95630.1| Fe-superoxide dismutase [Bruguiera gymnorhiza]
Length=261

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGV  348
            T+ G  K+ A  ELKPPPYPMN LEPHMS+ T E+HWGKHHRAYVDNLN+QI GTELDG+
Sbjct  26   TKSGAGKVSAKFELKPPPYPMNGLEPHMSKDTLEFHWGKHHRAYVDNLNRQINGTELDGL  85

Query  349  SLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            SLED+++A YN GD LPAFNNAAQAWNH FFWESMK
Sbjct  86   SLEDVIVAAYNKGDTLPAFNNAAQAWNHEFFWESMK  121



>ref|XP_010676714.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=324

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +1

Query  157  EKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE  336
            + +  R G   + A  +LKPPPYP +ALEPHMS+QTF+YHWGKHHRAYVDNLNKQIVGTE
Sbjct  82   QTRVGRAGAAVVTAKFDLKPPPYPFDALEPHMSKQTFDYHWGKHHRAYVDNLNKQIVGTE  141

Query  337  LDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            LDG+ LE++V  TYN GD+LP+FNNAAQAWNH FFWESMKP
Sbjct  142  LDGLPLEEVVRITYNKGDVLPSFNNAAQAWNHEFFWESMKP  182



>ref|XP_009586624.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X1 
[Nicotiana tomentosiformis]
Length=253

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  106  RQSFPVSSNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWG  282
            R  F  SS+ + +    +K+F R  G   I A  EL+ PPYPM+ALEPHMS +TFE+HWG
Sbjct  20   RLGFHGSSHKSLQLRTQKKQFARKAGSGTITAKFELQSPPYPMDALEPHMSSRTFEFHWG  79

Query  283  KHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            KHHRAYVDNLNKQI GTELDG +LEDI+L TYN G  LPAFNNAAQAWNH FFWESMKP
Sbjct  80   KHHRAYVDNLNKQIDGTELDGKTLEDIILVTYNKGAPLPAFNNAAQAWNHQFFWESMKP  138



>ref|XP_009599436.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X1 
[Nicotiana tomentosiformis]
Length=303

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +1

Query  157  EKKFTRGGFP-KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGT  333
            +K+  R   P K+ A  EL PPPYPMNALEPHMS  TFEYHWGKHHRAYVDNLNKQI GT
Sbjct  33   KKQLARKAGPVKVTAKFELTPPPYPMNALEPHMSHTTFEYHWGKHHRAYVDNLNKQIDGT  92

Query  334  ELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            +LDG++LEDI+L TYN GDLLP FNNAAQAWNH FFW+SMKP
Sbjct  93   KLDGMTLEDIILITYNRGDLLPPFNNAAQAWNHQFFWDSMKP  134



>ref|XP_009791482.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Nicotiana 
sylvestris]
Length=251

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +1

Query  106  RQSFPVSSNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGK  285
            R  F  SS+ + +  + +K   + G   I A  EL+PPPYPM+ALEPHMS +TFE+HWGK
Sbjct  20   RLGFHGSSHQSLQL-RTQKFARKAGSGTITAKFELQPPPYPMDALEPHMSSRTFEFHWGK  78

Query  286  HHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            HHRAYVDNLNKQI GTELDG +LEDI+L TYN G  LPAFNNAAQAWNH FFWESMKP
Sbjct  79   HHRAYVDNLNKQIDGTELDGKTLEDIILVTYNKGAPLPAFNNAAQAWNHQFFWESMKP  136



>gb|AEY78486.2| iron superoxide dismutase, partial [Litchi chinensis]
Length=309

 Score =   166 bits (420),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +1

Query  139  FKCGKIEKKFTRGGFPK-IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLN  315
            F  GK E + TR   P  I A  ELKPPPYP+NALEPHMS+ T EYHWGKHHR+YV+NLN
Sbjct  31   FHWGKKEGRCTRKSGPTTISAKFELKPPPYPLNALEPHMSQDTLEYHWGKHHRSYVENLN  90

Query  316  KQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            KQI GTELDG+SLED+V+ TYN GD LP+FNNAAQAWNH FFWESM
Sbjct  91   KQIAGTELDGMSLEDVVVVTYNRGDFLPSFNNAAQAWNHDFFWESM  136



>gb|KHG24725.1| Superoxide dismutase [Fe], chloroplastic [Gossypium arboreum]
Length=309

 Score =   165 bits (418),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +1

Query  130  NHNFKCGKIEKKFTRGGFPK-IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
              ++ C K +++F R      I A  ELK PPYP+NALEPHMSR+T EYHWGKHHR YV+
Sbjct  24   TRSYPCVKPQRRFVRKAASNVITATYELKAPPYPLNALEPHMSRETLEYHWGKHHRTYVE  83

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            NLNKQ+VGT+L+G+SLEDI++ TYN GD+LPAFNNAAQAWNH FFWESM
Sbjct  84   NLNKQVVGTDLEGLSLEDIIIVTYNKGDILPAFNNAAQAWNHDFFWESM  132



>gb|KDO57694.1| hypothetical protein CISIN_1g026199mg [Citrus sinensis]
Length=185

 Score =   161 bits (408),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 4/102 (4%)
 Frame = +1

Query  151  KIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            K+E++ T G   +I A  +LKPPPYP+NALEPHMS+ T E+HWGKHHRAYVDNLNKQIVG
Sbjct  36   KMEQRKTGG---RISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVG  92

Query  331  TEL-DGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            TEL DG SLED+V+A+YN GDLLPAFNNAAQAWNH FFWESM
Sbjct  93   TELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESM  134



>gb|EPS69428.1| superoxide dismutase, partial [Genlisea aurea]
Length=271

 Score =   164 bits (415),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
            S  +F+C +  K+  + G   I+A++ELKPPPY ++ALEP MSR+TFEYHWGKHHRAYVD
Sbjct  1    STRSFQCRRSRKRDLKKGV--IKASVELKPPPYALDALEPVMSRETFEYHWGKHHRAYVD  58

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            NLNKQI GTELD  +LE+I+L TYN GD LP FNNAAQAWNH FFWES+KP
Sbjct  59   NLNKQIAGTELDTKTLEEIILLTYNKGDFLPPFNNAAQAWNHEFFWESLKP  109



>emb|CAE22480.1| superoxide dismutase [Fe] [Solanum lycopersicum]
Length=249

 Score =   163 bits (413),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S+ + +    +K+F R  G   I A  +L PPPYPM+ALEPHMS +TFE+HWGKHHRAYV
Sbjct  23   SSKSLQWRTQKKQFGRKAGSATITAKFDLIPPPYPMDALEPHMSSRTFEFHWGKHHRAYV  82

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            DNLNKQI GTELDG +LEDI+L TYNNG  LPAFNNAAQAWNH FFWESMKP
Sbjct  83   DNLNKQIDGTELDGKTLEDIILVTYNNGAPLPAFNNAAQAWNHQFFWESMKP  134



>ref|XP_002280522.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Vitis vinifera]
 ref|XP_010662223.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Vitis vinifera]
 emb|CBI38556.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  148  GKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIV  327
            GK      +G    I A  ELKPPPYP++ALEPHMSR+T EYHWGKHHR YVDNLN+QIV
Sbjct  30   GKRRTCSRKGNSSLIIAKFELKPPPYPLSALEPHMSRETLEYHWGKHHRGYVDNLNRQIV  89

Query  328  GTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            GTELDG++LEDI+  TYN GDLLPAFNNAAQ WNH  FWESMKP
Sbjct  90   GTELDGMTLEDIITITYNKGDLLPAFNNAAQVWNHTSFWESMKP  133



>ref|XP_006437023.1| hypothetical protein CICLE_v10032406mg [Citrus clementina]
 gb|ESR50263.1| hypothetical protein CICLE_v10032406mg [Citrus clementina]
Length=267

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 90/106 (85%), Gaps = 4/106 (4%)
 Frame = +1

Query  139  FKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNK  318
            ++  K+E++ T G   +I A  ELKPPPYP+NALEPHMS+ T E+HWGKHHRAYVDNLNK
Sbjct  32   WRNKKMEQRKTGG---RISAKFELKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNK  88

Query  319  QIVGTEL-DGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            QIVGTEL DG SLED+V+A+YN GDLLPAFNNAAQAWNH FFWESM
Sbjct  89   QIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESM  134



>ref|XP_006437022.1| hypothetical protein CICLE_v10032406mg [Citrus clementina]
 gb|ESR50262.1| hypothetical protein CICLE_v10032406mg [Citrus clementina]
Length=270

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 90/106 (85%), Gaps = 4/106 (4%)
 Frame = +1

Query  139  FKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNK  318
            ++  K+E++ T G   +I A  ELKPPPYP+NALEPHMS+ T E+HWGKHHRAYVDNLNK
Sbjct  32   WRNKKMEQRKTGG---RISAKFELKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNK  88

Query  319  QIVGTEL-DGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            QIVGTEL DG SLED+V+A+YN GDLLPAFNNAAQAWNH FFWESM
Sbjct  89   QIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESM  134



>ref|XP_002511050.1| superoxide dismutase [fe], putative [Ricinus communis]
 gb|EEF51652.1| superoxide dismutase [fe], putative [Ricinus communis]
Length=305

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +1

Query  160  KKFTRGGFP-KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE  336
            +K TR   P +I A  ELKPPPYP++ALEP MS+ T EYHWGKHHRAYVDNLNKQIVGTE
Sbjct  35   RKCTRKTTPARITAIFELKPPPYPLDALEPLMSKDTLEYHWGKHHRAYVDNLNKQIVGTE  94

Query  337  LDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LDG+SLED+VL TYN GD+LPAFNNAAQAWNH FFW  M
Sbjct  95   LDGMSLEDVVLVTYNKGDMLPAFNNAAQAWNHEFFWGCM  133



>gb|KDO57696.1| hypothetical protein CISIN_1g026199mg [Citrus sinensis]
Length=228

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 4/102 (4%)
 Frame = +1

Query  151  KIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            K+E++ T G   +I A  +LKPPPYP+NALEPHMS+ T E+HWGKHHRAYVDNLNKQIVG
Sbjct  36   KMEQRKTGG---RISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVG  92

Query  331  TEL-DGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            TEL DG SLED+V+A+YN GDLLPAFNNAAQAWNH FFWESM
Sbjct  93   TELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESM  134



>ref|XP_006485042.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=303

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = +1

Query  151  KIEKKFT-RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIV  327
            K+++K+T +  + +I A  ELKPPPYP NALEPHMS+ T EYHWGKHHRAYV+NLNKQIV
Sbjct  32   KLQRKYTGKAVYGQISAKFELKPPPYPPNALEPHMSKDTLEYHWGKHHRAYVENLNKQIV  91

Query  328  GTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            GTELDG+SLED+++ +YN GD+LP FNNAAQAWNH FFWESM
Sbjct  92   GTELDGMSLEDVIIVSYNKGDMLPPFNNAAQAWNHEFFWESM  133



>gb|ADX36104.1| Fe-superoxide dismutase [Haberlea rhodopensis]
Length=307

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 89/113 (79%), Gaps = 5/113 (4%)
 Frame = +1

Query  127  SNHNFKCGKIEK---KFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRA  297
            S   F+  K EK   K   GG   I+A +ELKPPPYP++AL+PHMSR+TFEYHWGKHHRA
Sbjct  26   STRGFQTRKSEKMNVKRVAGGV--IKAVIELKPPPYPLDALQPHMSRETFEYHWGKHHRA  83

Query  298  YVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            YVDNLNKQIVGTELDG  LE+I++ TYN GD LP FNNAAQAWNH FFW SMK
Sbjct  84   YVDNLNKQIVGTELDGKPLEEIIIDTYNKGDFLPPFNNAAQAWNHEFFWGSMK  136



>ref|XP_006437021.1| hypothetical protein CICLE_v10032406mg [Citrus clementina]
 gb|ESR50261.1| hypothetical protein CICLE_v10032406mg [Citrus clementina]
Length=234

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 87/101 (86%), Gaps = 4/101 (4%)
 Frame = +1

Query  154  IEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGT  333
            +E++ T G   +I A  ELKPPPYP+NALEPHMS+ T E+HWGKHHRAYVDNLNKQIVGT
Sbjct  1    MEQRKTGG---RISAKFELKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGT  57

Query  334  EL-DGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            EL DG SLED+V+A+YN GDLLPAFNNAAQAWNH FFWESM
Sbjct  58   ELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESM  98



>gb|AHG12637.1| iron superoxide dismutase [Nicotiana tabacum]
Length=253

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  106  RQSFPVSSNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWG  282
            R  F  SS+ + +    +K+F R  G   I A  EL+ PPYPM+AL PHMS +TFE+HWG
Sbjct  20   RLGFHGSSHKSLQLRTQKKQFARKAGSGTITAKFELQSPPYPMDALGPHMSSRTFEFHWG  79

Query  283  KHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            KHHRAYVDNLNKQI GTELDG +LEDI+L TYN G  LPAFNNAAQAWNH FFWESMKP
Sbjct  80   KHHRAYVDNLNKQIDGTELDGKTLEDIILVTYNKGAPLPAFNNAAQAWNHQFFWESMKP  138



>ref|XP_010109152.1| Protein Fe superoxide dismutase 1 [Morus notabilis]
 gb|EXC21081.1| Protein Fe superoxide dismutase 1 [Morus notabilis]
Length=311

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +1

Query  151  KIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            K+ +   + G  K+ A  ELKPPPYP+NALEPHMS++TFEYHWGKHHR YV+NLNKQI G
Sbjct  41   KMRQCTRKDGPTKVSAKFELKPPPYPLNALEPHMSKETFEYHWGKHHRTYVENLNKQIAG  100

Query  331  TELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            TELDG+SLE IV+ATYN GDLLP FNNAAQ WNH FFWESM
Sbjct  101  TELDGLSLEKIVVATYNKGDLLPPFNNAAQVWNHDFFWESM  141



>gb|KDO57695.1| hypothetical protein CISIN_1g026199mg [Citrus sinensis]
Length=227

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 4/102 (4%)
 Frame = +1

Query  151  KIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            K+E++ T G   +I A  +LKPPPYP+NALEPHMS+ T E+HWGKHHRAYVDNLNKQIVG
Sbjct  36   KMEQRKTGG---RISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVG  92

Query  331  TEL-DGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            TEL DG SLED+V+A+YN GDLLPAFNNAAQAWNH FFWESM
Sbjct  93   TELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESM  134



>ref|XP_006485043.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=302

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  139  FKCGKIEKKFT-RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLN  315
            ++  ++++K+T +  + +I A  ELKPPPYP NALEPHMS+ T EYHWGKHHRAYV+NLN
Sbjct  27   WRSKELQRKYTGKAVYGQISAKFELKPPPYPPNALEPHMSKDTLEYHWGKHHRAYVENLN  86

Query  316  KQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            KQIVGTELDG+SLED+++ +YN GD+LP FNNAAQAWNH FFWESM
Sbjct  87   KQIVGTELDGMSLEDVIIVSYNKGDMLPPFNNAAQAWNHEFFWESM  132



>gb|KDO57691.1| hypothetical protein CISIN_1g026199mg [Citrus sinensis]
Length=242

 Score =   161 bits (408),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 88/102 (86%), Gaps = 4/102 (4%)
 Frame = +1

Query  151  KIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            K+E++ T G   +I A  +LKPPPYP+NALEPHMS+ T E+HWGKHHRAYVDNLNKQIVG
Sbjct  36   KMEQRKTGG---RISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVG  92

Query  331  TEL-DGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            TEL DG SLED+V+A+YN GDLLPAFNNAAQAWNH FFWESM
Sbjct  93   TELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESM  134



>ref|XP_009586625.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X2 
[Nicotiana tomentosiformis]
Length=251

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +1

Query  106  RQSFPVSSNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGK  285
            R  F  SS+ + +  + +K   + G   I A  EL+ PPYPM+ALEPHMS +TFE+HWGK
Sbjct  20   RLGFHGSSHKSLQL-RTQKFARKAGSGTITAKFELQSPPYPMDALEPHMSSRTFEFHWGK  78

Query  286  HHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            HHRAYVDNLNKQI GTELDG +LEDI+L TYN G  LPAFNNAAQAWNH FFWESMKP
Sbjct  79   HHRAYVDNLNKQIDGTELDGKTLEDIILVTYNKGAPLPAFNNAAQAWNHQFFWESMKP  136



>ref|NP_001233789.1| iron superoxide dismutase [Solanum lycopersicum]
 gb|AAQ18699.1| iron superoxide dismutase [Solanum lycopersicum]
Length=249

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S+ + +    +K+F R  G   I A  +L PPPYPM+ALEPHMS +TFE+HWGK+HRAYV
Sbjct  23   SSKSLQWRTQKKQFGRKAGSATITAKFDLIPPPYPMDALEPHMSSRTFEFHWGKYHRAYV  82

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            DNLNKQI GTELDG +LEDI+L TYNNG  LPAFNNAAQAWNH FFWESMKP
Sbjct  83   DNLNKQIDGTELDGKTLEDIILVTYNNGAPLPAFNNAAQAWNHQFFWESMKP  134



>dbj|BAQ21273.1| superoxide dismutase [Citrus tamurana]
Length=234

 Score =   161 bits (407),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 87/101 (86%), Gaps = 4/101 (4%)
 Frame = +1

Query  154  IEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGT  333
            +E++ T G   +I A  +LKPPPYP+NALEPHMS+ T E+HWGKHHRAYVDNLNKQIVGT
Sbjct  1    MEQRKTGG---RISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGT  57

Query  334  EL-DGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            EL DG SLED+V+A+YN GDLLPAFNNAAQAWNH FFWESM
Sbjct  58   ELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESM  98



>gb|KCW90917.1| hypothetical protein EUGRSUZ_A02950 [Eucalyptus grandis]
Length=197

 Score =   160 bits (404),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +1

Query  121  VSSNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAY  300
            + S   F+  K +++  R     I A  +LKPPPYP++ALEPHMSR T  YHWGKHHR Y
Sbjct  53   LVSTRTFQSAKNQRQCGRAVAAPISAKFDLKPPPYPLDALEPHMSRDTISYHWGKHHRGY  112

Query  301  VDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            V+NLN QIVGT+LDG+SLEDI++ +YN GD+LP+FNNAAQ WNH FFWESM P
Sbjct  113  VENLNMQIVGTDLDGMSLEDIIILSYNKGDILPSFNNAAQIWNHDFFWESMVP  165



>gb|KDO57692.1| hypothetical protein CISIN_1g026199mg [Citrus sinensis]
Length=206

 Score =   160 bits (405),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 87/101 (86%), Gaps = 4/101 (4%)
 Frame = +1

Query  154  IEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGT  333
            +E++ T G   +I A  +LKPPPYP+NALEPHMS+ T E+HWGKHHRAYVDNLNKQIVGT
Sbjct  1    MEQRKTGG---RISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGT  57

Query  334  EL-DGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            EL DG SLED+V+A+YN GDLLPAFNNAAQAWNH FFWESM
Sbjct  58   ELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESM  98



>ref|XP_011076548.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Sesamum 
indicum]
Length=271

 Score =   162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 86/110 (78%), Gaps = 1/110 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTRGGFPK-IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S  +    K EK+  R      I+A +EL PPPY ++ LEPHMSR+TFEYHWGKHHRAYV
Sbjct  26   STRSLLWRKTEKRNVRKAVKGVIKAKIELSPPPYSLDGLEPHMSRETFEYHWGKHHRAYV  85

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            DNLNKQIVGTELD  +LE+I+LATYNNGDLLP FNNAAQ WNH FFWESM
Sbjct  86   DNLNKQIVGTELDTKTLEEIILATYNNGDLLPPFNNAAQVWNHDFFWESM  135



>gb|KJB06968.1| hypothetical protein B456_001G052700 [Gossypium raimondii]
Length=231

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +1

Query  130  NHNFKCGKIEKKFTRGGFPK-IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
              ++ C K +++  R      I A  ELK PPYP+NALEPHMSR+T  YHWGKHHR YV+
Sbjct  24   TRSYPCLKPQRRLVRKAASNVITATYELKAPPYPLNALEPHMSRETLAYHWGKHHRTYVE  83

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            NLNKQ+VGT+L+G+SLEDI++ TYN GD+LPAFNNAAQAWNH FFWESM
Sbjct  84   NLNKQVVGTDLEGLSLEDIIIVTYNKGDILPAFNNAAQAWNHDFFWESM  132



>ref|XP_006437025.1| hypothetical protein CICLE_v10032233mg [Citrus clementina]
 gb|ESR50265.1| hypothetical protein CICLE_v10032233mg [Citrus clementina]
Length=303

 Score =   162 bits (411),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = +1

Query  151  KIEKKFT-RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIV  327
            K+++K+  +  + +I A  ELKPPPYP NALEPHMS+ T EYHWGKHHRAYV+NLNKQIV
Sbjct  32   KLQRKYAGKAVYGQISAKFELKPPPYPPNALEPHMSKDTLEYHWGKHHRAYVENLNKQIV  91

Query  328  GTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            GTELDG+SLED+++ +YN GD+LP FNNAAQAWNH FFWESM
Sbjct  92   GTELDGMSLEDVIIVSYNKGDMLPPFNNAAQAWNHEFFWESM  133



>ref|XP_006357312.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X1 
[Solanum tuberosum]
Length=252

 Score =   161 bits (407),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +1

Query  124  SSNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAY  300
            S +  ++  K++K+F R      I A  +L  PPYPM+ALEPHMS +TFE+HWGKHHRAY
Sbjct  24   SKSLQWRTQKLQKQFGRKSDSATITAKFDLNSPPYPMDALEPHMSSRTFEFHWGKHHRAY  83

Query  301  VDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            VDNLNKQI GTELDG +LEDI+L TYN G  LPAFNNAAQAWNH FFWESMKP
Sbjct  84   VDNLNKQIEGTELDGKTLEDIILVTYNKGAPLPAFNNAAQAWNHQFFWESMKP  136



>gb|AFD34189.1| Fe superoxide dismutase [Jatropha curcas]
Length=305

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A  ELKPPPYP+NALEPHMS+ T EYHWGKHHR+YVDNLNKQIVGTELD + LED+V+
Sbjct  46   VTAKFELKPPPYPLNALEPHMSKDTLEYHWGKHHRSYVDNLNKQIVGTELDSLPLEDVVI  105

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             TYN GD+LPAFNNAAQAWNH FFW  MKP
Sbjct  106  VTYNKGDVLPAFNNAAQAWNHEFFWGCMKP  135



>gb|KJB06969.1| hypothetical protein B456_001G052700 [Gossypium raimondii]
Length=301

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +1

Query  130  NHNFKCGKIEKKFTRGGFPK-IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
              ++ C K +++  R      I A  ELK PPYP+NALEPHMSR+T  YHWGKHHR YV+
Sbjct  24   TRSYPCLKPQRRLVRKAASNVITATYELKAPPYPLNALEPHMSRETLAYHWGKHHRTYVE  83

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            NLNKQ+VGT+L+G+SLEDI++ TYN GD+LPAFNNAAQAWNH FFWESM
Sbjct  84   NLNKQVVGTDLEGLSLEDIIIVTYNKGDILPAFNNAAQAWNHDFFWESM  132



>ref|XP_010063017.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X1 
[Eucalyptus grandis]
Length=305

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
            S   F+  K +++  R     I A  +LKPPPYP++ALEPHMSR T  YHWGKHHR YV+
Sbjct  25   STRTFQSAKNQRQCGRAVAAPISAKFDLKPPPYPLDALEPHMSRDTISYHWGKHHRGYVE  84

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            NLN QIVGT+LDG+SLEDI++ +YN GD+LP+FNNAAQ WNH FFWESM P
Sbjct  85   NLNMQIVGTDLDGMSLEDIIILSYNKGDILPSFNNAAQIWNHDFFWESMVP  135



>gb|ADR01110.1| Fe superoxide dismutase 2 [Brassica rapa]
Length=278

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 88/103 (85%), Gaps = 2/103 (2%)
 Frame = +1

Query  151  KIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            ++ +K    G   +RA  ELKPPPYP++ALEPHMSR+T +YHWGKHHR YV+NLNKQI+G
Sbjct  13   QLSRKVAVSGV--VRAGFELKPPPYPLDALEPHMSRETMDYHWGKHHRTYVENLNKQILG  70

Query  331  TELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            T+LDG+SLE++VL +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  71   TDLDGLSLEEVVLLSYNRGNMLPAFNNAAQAWNHEFFWESIQP  113



>gb|KJB06965.1| hypothetical protein B456_001G052700 [Gossypium raimondii]
 gb|KJB06966.1| hypothetical protein B456_001G052700 [Gossypium raimondii]
 gb|KJB06970.1| hypothetical protein B456_001G052700 [Gossypium raimondii]
Length=309

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +1

Query  130  NHNFKCGKIEKKFTRGGFPK-IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
              ++ C K +++  R      I A  ELK PPYP+NALEPHMSR+T  YHWGKHHR YV+
Sbjct  24   TRSYPCLKPQRRLVRKAASNVITATYELKAPPYPLNALEPHMSRETLAYHWGKHHRTYVE  83

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            NLNKQ+VGT+L+G+SLEDI++ TYN GD+LPAFNNAAQAWNH FFWESM
Sbjct  84   NLNKQVVGTDLEGLSLEDIIIVTYNKGDILPAFNNAAQAWNHDFFWESM  132



>pir||A39267 superoxide dismutase (EC 1.15.1.1) (Fe) - curled-leaved tobacco
Length=227

 Score =   159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  196  AALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLAT  375
            A  EL+PPPYPM+ALEPHMS +TFE+HWGKHHRAYVDNLNKQI GTELDG +LEDI+L T
Sbjct  25   AKFELQPPPYPMDALEPHMSSRTFEFHWGKHHRAYVDNLNKQIDGTELDGKTLEDIILVT  84

Query  376  YNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            YN G  LPAFNNAAQAWNH FFWESMKP
Sbjct  85   YNKGAPLPAFNNAAQAWNHQFFWESMKP  112



>gb|KCW90916.1| hypothetical protein EUGRSUZ_A02950 [Eucalyptus grandis]
Length=269

 Score =   159 bits (403),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
            S   F+  K +++  R     I A  +LKPPPYP++ALEPHMSR T  YHWGKHHR YV+
Sbjct  55   STRTFQSAKNQRQCGRAVAAPISAKFDLKPPPYPLDALEPHMSRDTISYHWGKHHRGYVE  114

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            NLN QIVGT+LDG+SLEDI++ +YN GD+LP+FNNAAQ WNH FFWESM P
Sbjct  115  NLNMQIVGTDLDGMSLEDIIILSYNKGDILPSFNNAAQIWNHDFFWESMVP  165



>emb|CDY38848.1| BnaA03g13310D [Brassica napus]
Length=299

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            +RA  ELKPPPYP++ALEPHMSR+T +YHWGKHHR YV+NLNKQI+GT+LDG+SLE++VL
Sbjct  45   VRAGFELKPPPYPLDALEPHMSRETMDYHWGKHHRTYVENLNKQILGTDLDGLSLEEVVL  104

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  105  LSYNRGNMLPAFNNAAQAWNHEFFWESIQP  134



>gb|EPS68741.1| superoxide dismutase, partial [Genlisea aurea]
Length=218

 Score =   158 bits (399),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   I A++ELKPPPY ++ALEP MSRQTFE+HWGKHHRAYVDNLNKQI GTELD  +
Sbjct  1    KAGRGVITASVELKPPPYALDALEPLMSRQTFEFHWGKHHRAYVDNLNKQIAGTELDSKT  60

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            LE+I+L TYN GD LP FNNAAQAWNH FFWES+KP
Sbjct  61   LEEIILVTYNKGDFLPPFNNAAQAWNHQFFWESLKP  96



>ref|XP_006574831.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X2 
[Glycine max]
 ref|XP_006574832.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X3 
[Glycine max]
Length=314

 Score =   160 bits (406),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S+  FK  K E +  R  G  KI A  ELKPPPYP++ALEP MS++T EYHWGKHHR YV
Sbjct  32   SSGTFKFLKKESRCLRKAGRTKITAKFELKPPPYPLSALEPIMSQETLEYHWGKHHRTYV  91

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            DNLN+QI GT+LDG SLE+ ++ TYN GD+LPAFNNAAQAWNH FFWESMKP
Sbjct  92   DNLNRQIDGTDLDGNSLENTIVITYNKGDILPAFNNAAQAWNHDFFWESMKP  143



>sp|P22302.1|SODF_NICPL RecName: Full=Superoxide dismutase [Fe], chloroplastic, partial 
[Nicotiana plumbaginifolia]
 gb|AAA34074.1| Fe-superoxide dismutase, partial [Nicotiana plumbaginifolia]
Length=202

 Score =   157 bits (397),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  202  LELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYN  381
             EL+PPPYPM+ALEPHMS +TFE+HWGKHHRAYVDNLNKQI GTELDG +LEDI+L TYN
Sbjct  2    FELQPPPYPMDALEPHMSSRTFEFHWGKHHRAYVDNLNKQIDGTELDGKTLEDIILVTYN  61

Query  382  NGDLLPAFNNAAQAWNHAFFWESMKP  459
             G  LPAFNNAAQAWNH FFWESMKP
Sbjct  62   KGAPLPAFNNAAQAWNHQFFWESMKP  87



>ref|XP_006574833.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X4 
[Glycine max]
Length=311

 Score =   160 bits (405),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S+  FK  K E +  R  G  KI A  ELKPPPYP++ALEP MS++T EYHWGKHHR YV
Sbjct  29   SSGTFKFLKKESRCLRKAGRTKITAKFELKPPPYPLSALEPIMSQETLEYHWGKHHRTYV  88

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            DNLN+QI GT+LDG SLE+ ++ TYN GD+LPAFNNAAQAWNH FFWESMKP
Sbjct  89   DNLNRQIDGTDLDGNSLENTIVITYNKGDILPAFNNAAQAWNHDFFWESMKP  140



>ref|XP_006574834.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X5 
[Glycine max]
Length=310

 Score =   160 bits (405),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S+  FK  K E +  R  G  KI A  ELKPPPYP++ALEP MS++T EYHWGKHHR YV
Sbjct  28   SSGTFKFLKKESRCLRKAGRTKITAKFELKPPPYPLSALEPIMSQETLEYHWGKHHRTYV  87

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            DNLN+QI GT+LDG SLE+ ++ TYN GD+LPAFNNAAQAWNH FFWESMKP
Sbjct  88   DNLNRQIDGTDLDGNSLENTIVITYNKGDILPAFNNAAQAWNHDFFWESMKP  139



>ref|XP_003518624.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X1 
[Glycine max]
Length=313

 Score =   160 bits (405),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S+  FK  K E +  R  G  KI A  ELKPPPYP++ALEP MS++T EYHWGKHHR YV
Sbjct  31   SSGTFKFLKKESRCLRKAGRTKITAKFELKPPPYPLSALEPIMSQETLEYHWGKHHRTYV  90

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            DNLN+QI GT+LDG SLE+ ++ TYN GD+LPAFNNAAQAWNH FFWESMKP
Sbjct  91   DNLNRQIDGTDLDGNSLENTIVITYNKGDILPAFNNAAQAWNHDFFWESMKP  142



>ref|XP_004508271.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Cicer 
arietinum]
Length=312

 Score =   160 bits (405),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 6/109 (6%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
            SN+  +C +      + G  K+ A  ELKPPPYP+NALEP MS++TFEYHWGKHHRAYVD
Sbjct  39   SNNQARCIR------KAGATKVTAKFELKPPPYPLNALEPIMSQETFEYHWGKHHRAYVD  92

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            NLNKQI GT+LDG SLE+ ++  YNNGD+LPAFNNAAQ WNH FFWESM
Sbjct  93   NLNKQIEGTDLDGKSLEETIVIAYNNGDILPAFNNAAQVWNHDFFWESM  141



>gb|KCW90915.1| hypothetical protein EUGRSUZ_A02950 [Eucalyptus grandis]
Length=335

 Score =   160 bits (406),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
            S   F+  K +++  R     I A  +LKPPPYP++ALEPHMSR T  YHWGKHHR YV+
Sbjct  55   STRTFQSAKNQRQCGRAVAAPISAKFDLKPPPYPLDALEPHMSRDTISYHWGKHHRGYVE  114

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            NLN QIVGT+LDG+SLEDI++ +YN GD+LP+FNNAAQ WNH FFWESM P
Sbjct  115  NLNMQIVGTDLDGMSLEDIIILSYNKGDILPSFNNAAQIWNHDFFWESMVP  165



>ref|XP_007038205.1| Fe superoxide dismutase 2 isoform 1 [Theobroma cacao]
 gb|EOY22706.1| Fe superoxide dismutase 2 isoform 1 [Theobroma cacao]
Length=306

 Score =   160 bits (404),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  CGKIEKKFTRG-GFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQ  321
            C   +++F R      I A  ELKPPPY +NALEPHMSRQT EYHWGKHHR YV+NLNKQ
Sbjct  31   CTIPQRRFWRKVATNLITAKFELKPPPYTLNALEPHMSRQTLEYHWGKHHRTYVENLNKQ  90

Query  322  IVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            I GTEL+G+ LEDI++ +YNNGD+LPAFNNAAQAWNH FFWESM
Sbjct  91   IAGTELEGLPLEDIIIVSYNNGDILPAFNNAAQAWNHDFFWESM  134



>emb|CDY32644.1| BnaC03g16120D [Brassica napus]
Length=300

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            +RA  ELKPPPYP++ALEPHMSR+T +YHWGKHH+ YV+NLNKQI+GT+LDG+SLE++VL
Sbjct  46   VRAGFELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQILGTDLDGLSLEEVVL  105

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  106  LSYNRGNMLPAFNNAAQAWNHEFFWESIQP  135



>ref|XP_002322315.2| hypothetical protein POPTR_0015s12190g [Populus trichocarpa]
 gb|EEF06442.2| hypothetical protein POPTR_0015s12190g [Populus trichocarpa]
Length=307

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A  ELKPPPYPMNALEPHMS+ TFEYHWGKHHRAYV+NLNKQI GTELD +SL+D+VL
Sbjct  47   VTAKFELKPPPYPMNALEPHMSKDTFEYHWGKHHRAYVNNLNKQIEGTELDDMSLDDVVL  106

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYN GD LPAFNNAAQAWNH FFWESM
Sbjct  107  ITYNKGDPLPAFNNAAQAWNHEFFWESM  134



>gb|AAL32441.1|AF377344_1 Fe-superoxide dismutase precursor [Medicago sativa]
Length=313

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 88/116 (76%), Gaps = 1/116 (1%)
 Frame = +1

Query  109  QSFPVSSNHNFKCGKIEKK-FTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGK  285
            Q+   SS   FK  K + +   R G  +I A  ELKPPPYP+NA EP MS+ TFEYHWGK
Sbjct  27   QNLGSSSVTTFKFSKKQGRCIRRAGGTQITAKFELKPPPYPLNASEPIMSQNTFEYHWGK  86

Query  286  HHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            HHRAYVDNLNKQI GT+LDG SLE+ ++ +YNNGD+LPAFNNAAQ WNH FFWESM
Sbjct  87   HHRAYVDNLNKQIEGTDLDGKSLEETIIMSYNNGDILPAFNNAAQVWNHDFFWESM  142



>ref|XP_011470027.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Fragaria 
vesca subsp. vesca]
Length=318

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = +1

Query  112  SFPVSSNHNFKCGKIEKKFTRGGFPK-IRAALELKPPPYPMNALEPHMSRQTFEYHWGKH  288
            S  ++S    +  K +++  R   P  I A  ELKPPPYP++ALEP+MS++T EYHWGKH
Sbjct  32   SGSLASPSTLQRSKKQRQCKRKAGPSSICAKFELKPPPYPLDALEPYMSKETLEYHWGKH  91

Query  289  HRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            HR YVDNLNKQI GTELD +SLED++LAT+N GDLLP FNNAAQ WNH FFWESMKP
Sbjct  92   HRGYVDNLNKQIEGTELDELSLEDVILATHNKGDLLPPFNNAAQIWNHDFFWESMKP  148



>ref|XP_010426309.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010426310.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=307

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 3/110 (3%)
 Frame = +1

Query  139  FKCGKIEKK---FTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDN  309
             +C + EK+       G   I A  ELKPPPYP++ALEPHMSR+T +YHWGKHHR YV+N
Sbjct  31   LQCERNEKRRLATKVAGSGVITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHRTYVEN  90

Query  310  LNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            LNKQIVGT+LD +SLE++VL +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  91   LNKQIVGTDLDTLSLEEVVLLSYNRGNMLPAFNNAAQAWNHEFFWESIQP  140



>gb|KDP22500.1| hypothetical protein JCGZ_26331 [Jatropha curcas]
Length=305

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  139  FKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNK  318
            FK  K      + G   + A  ELKPPPYP+NALEPHMS+ T EYHWGKHHRAYVDNLNK
Sbjct  29   FKWRKERHVRRQTGSAIVTAKFELKPPPYPLNALEPHMSKDTLEYHWGKHHRAYVDNLNK  88

Query  319  QIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            QIVGTELD + LED+V+ TYN GD+LPAFNNAAQAWNH FFW  M
Sbjct  89   QIVGTELDSLPLEDVVIVTYNKGDVLPAFNNAAQAWNHEFFWGCM  133



>ref|XP_007038206.1| Fe superoxide dismutase 2 isoform 2, partial [Theobroma cacao]
 gb|EOY22707.1| Fe superoxide dismutase 2 isoform 2, partial [Theobroma cacao]
Length=308

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A  ELKPPPY +NALEPHMSRQT EYHWGKHHR YV+NLNKQI GTEL+G+ LEDI++
Sbjct  49   ITAKFELKPPPYTLNALEPHMSRQTLEYHWGKHHRTYVENLNKQIAGTELEGLPLEDIII  108

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             +YNNGD+LPAFNNAAQAWNH FFWESM
Sbjct  109  VSYNNGDILPAFNNAAQAWNHDFFWESM  136



>gb|ACU20819.1| unknown [Glycine max]
Length=180

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
            S+  FK  K E +  R     I A  ELKPPPYP+N+LEP MS +T EYHWGKHHR YVD
Sbjct  30   SSGTFKFSKKESRCIRKA-GSITAKFELKPPPYPLNSLEPIMSEETIEYHWGKHHRTYVD  88

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            NLN+QI GT+LDG SLED ++  YN GD+LPAFNNAAQAWNH FFWESMKP
Sbjct  89   NLNRQIDGTDLDGNSLEDTMVILYNKGDILPAFNNAAQAWNHDFFWESMKP  139



>ref|XP_009132630.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic isoform 
X2 [Brassica rapa]
Length=297

 Score =   158 bits (400),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 86/103 (83%), Gaps = 2/103 (2%)
 Frame = +1

Query  151  KIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            K  +K    G   +RA  ELKPPPYP++ALEPHMSR+T +YHWGKHH+ YV+NLNKQI+G
Sbjct  32   KFSRKVAVSGV--VRAGFELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQILG  89

Query  331  TELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            T+LDG+SLE++VL +YN G++LP FNNAAQAWNH FFWES++P
Sbjct  90   TDLDGLSLEEVVLLSYNRGNMLPVFNNAAQAWNHEFFWESIQP  132



>gb|AFH08834.1| iron superoxide dismutase 4, partial [Diospyros oleifera]
Length=193

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +S
Sbjct  54   KAGGTSVTAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELDELS  113

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  114  LEDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  147



>gb|AFJ66231.1| hypothetical protein 34G24.21 [Capsella rubella]
Length=280

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A  ELKPPPYP++ALEPHMSR+T +YHWGKHHR YV+NLNKQIVGT+LD +SLE++VL
Sbjct  41   ITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHRTYVENLNKQIVGTDLDTLSLEEVVL  100

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  101  LSYNRGNMLPAFNNAAQAWNHEFFWESIQP  130



>ref|XP_009132629.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic isoform 
X1 [Brassica rapa]
Length=299

 Score =   158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            +RA  ELKPPPYP++ALEPHMSR+T +YHWGKHH+ YV+NLNKQI+GT+LDG+SLE++VL
Sbjct  45   VRAGFELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQILGTDLDGLSLEEVVL  104

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             +YN G++LP FNNAAQAWNH FFWES++P
Sbjct  105  LSYNRGNMLPVFNNAAQAWNHEFFWESIQP  134



>gb|AAS92464.1| Fe-superoxide dismutase 1 precursor [Lotus japonicus]
 gb|AAS92465.1| Fe-superoxide dismutase 1 precursor [Lotus japonicus]
Length=311

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  121  VSSNHNFKCGKIEKKFTRGGFP-KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRA  297
            + S   FK  K +++  R   P +I A  ELKPPPYPMNALEP MS++TF YHWGKHHRA
Sbjct  32   LGSAGTFKFSKKQRRCVRKAGPTEISAKFELKPPPYPMNALEPIMSQETFNYHWGKHHRA  91

Query  298  YVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            YVDNLNKQI GT+LDG SLE++++  YN GD+LP+FNNAAQAWNH FFW+SM
Sbjct  92   YVDNLNKQIEGTDLDGKSLEELIVIAYNKGDMLPSFNNAAQAWNHEFFWDSM  143



>ref|XP_009363743.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X1 
[Pyrus x bretschneideri]
Length=320

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            IRA  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +SLEDI+L
Sbjct  61   IRAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKMIAGTELDELSLEDIIL  120

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            ATYN GDLLP FN AAQ WNH FFWESM
Sbjct  121  ATYNRGDLLPPFNQAAQTWNHDFFWESM  148



>ref|XP_006357313.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X2 
[Solanum tuberosum]
Length=250

 Score =   156 bits (395),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A  +L  PPYPM+ALEPHMS +TFE+HWGKHHRAYVDNLNKQI GTELDG +LEDI+L
Sbjct  45   ITAKFDLNSPPYPMDALEPHMSSRTFEFHWGKHHRAYVDNLNKQIEGTELDGKTLEDIIL  104

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             TYN G  LPAFNNAAQAWNH FFWESMKP
Sbjct  105  VTYNKGAPLPAFNNAAQAWNHQFFWESMKP  134



>ref|XP_009363744.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X2 
[Pyrus x bretschneideri]
Length=319

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            IRA  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +SLEDI+L
Sbjct  60   IRAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKMIAGTELDELSLEDIIL  119

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            ATYN GDLLP FN AAQ WNH FFWESM
Sbjct  120  ATYNRGDLLPPFNQAAQTWNHDFFWESM  147



>ref|XP_011040320.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X4 
[Populus euphratica]
Length=298

 Score =   157 bits (398),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A  ELKPPPYPMNALEP MS+ TFEYHWGKHHRAYV+NLNKQI GTELD +SL+D+VL
Sbjct  47   VTAKFELKPPPYPMNALEPQMSKDTFEYHWGKHHRAYVNNLNKQIEGTELDDMSLDDVVL  106

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYN GD LPAFNNAAQAWNH FFWESM
Sbjct  107  ITYNKGDPLPAFNNAAQAWNHEFFWESM  134



>gb|AFH08833.1| iron superoxide dismutase 3, partial [Diospyros oleifera]
Length=193

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +S
Sbjct  54   KAGGTSVTAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELDELS  113

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  114  LEDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  147



>gb|AAC63378.1| iron superoxide dismutase [Zantedeschia aethiopica]
Length=309

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  115  FPVSSNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHR  294
            FP  S       +I  K  R G   I A LELKPPPY +NALEP+MS++T E+HWGKHHR
Sbjct  17   FPGCSRRAGSLRRIAPKVGRSGPLTIVAQLELKPPPYSLNALEPYMSQETLEFHWGKHHR  76

Query  295  AYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             YVD LN+QI+GTEL G+SLE+IV+ +YN GDLLP FNNAAQ WNH FFW+SMKP
Sbjct  77   GYVDGLNRQILGTELAGLSLEEIVIKSYNEGDLLPTFNNAAQIWNHDFFWQSMKP  131



>ref|XP_010442589.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=308

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  175  GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSL  354
             G   I A  ELKPPPYP++ALEPHMSR+T +YHWGKHHR YV+NLNKQIVGT+LD +SL
Sbjct  47   AGSGVITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHRTYVENLNKQIVGTDLDTLSL  106

Query  355  EDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            E++VL +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  107  EEVVLLSYNRGNMLPAFNNAAQAWNHEFFWESIQP  141



>ref|XP_011040319.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X3 
[Populus euphratica]
Length=302

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A  ELKPPPYPMNALEP MS+ TFEYHWGKHHRAYV+NLNKQI GTELD +SL+D+VL
Sbjct  47   VTAKFELKPPPYPMNALEPQMSKDTFEYHWGKHHRAYVNNLNKQIEGTELDDMSLDDVVL  106

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYN GD LPAFNNAAQAWNH FFWESM
Sbjct  107  ITYNKGDPLPAFNNAAQAWNHEFFWESM  134



>gb|KIY96455.1| superoxide dismutase [Monoraphidium neglectum]
Length=147

 Score =   153 bits (386),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            +RAALELKPPPY ++ALEPH+S+ T E+HWGKHHRAYVDNLNKQI GT+L+G +LEDIVL
Sbjct  25   VRAALELKPPPYALDALEPHLSKSTLEFHWGKHHRAYVDNLNKQIAGTDLEGKTLEDIVL  84

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            A++N G   PAFNNAAQ WNH F+WES+KP
Sbjct  85   ASWNGGSPTPAFNNAAQIWNHTFYWESLKP  114



>ref|XP_010442588.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=312

 Score =   157 bits (398),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +1

Query  175  GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSL  354
             G   I A  ELKPPPYP++ALEPHMSR+T +YHWGKHHR YV+NLNKQIVGT+LD +SL
Sbjct  47   AGSGVITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHRTYVENLNKQIVGTDLDTLSL  106

Query  355  EDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            E++VL +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  107  EEVVLLSYNRGNMLPAFNNAAQAWNHEFFWESIQP  141



>gb|AFK34552.1| unknown [Medicago truncatula]
Length=238

 Score =   155 bits (393),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  187  KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIV  366
            +I A  ELKPPPYP+NALEP MS+ TFEYHWGKHHRAYVDNLNKQI GT+LDG SLE+ +
Sbjct  52   QITAKFELKPPPYPLNALEPIMSQNTFEYHWGKHHRAYVDNLNKQIEGTDLDGKSLEETI  111

Query  367  LATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            + +YNNGD+LPAFNNAAQ WNH FFWESM
Sbjct  112  IMSYNNGDILPAFNNAAQVWNHDFFWESM  140



>gb|KEH41343.1| superoxide dismutase [Medicago truncatula]
Length=238

 Score =   155 bits (393),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  187  KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIV  366
            +I A  ELKPPPYP+NALEP MS+ TFEYHWGKHHRAYVDNLNKQI GT+LDG SLE+ +
Sbjct  52   QITAKFELKPPPYPLNALEPIMSQNTFEYHWGKHHRAYVDNLNKQIEGTDLDGKSLEETI  111

Query  367  LATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            + +YNNGD+LPAFNNAAQ WNH FFWESM
Sbjct  112  IMSYNNGDILPAFNNAAQVWNHDFFWESM  140



>gb|AGI65620.1| chloroplast Fe-superoxide dismutase 1, partial [Fragaria x ananassa]
Length=287

 Score =   157 bits (396),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 89/116 (77%), Gaps = 1/116 (1%)
 Frame = +1

Query  112  SFPVSSNHNFKCGKIEKKFTRGGFPK-IRAALELKPPPYPMNALEPHMSRQTFEYHWGKH  288
            S  ++S    +  K +++  R   P  I A  ELKPPPYP++ALEP+MS++T EYHWGKH
Sbjct  14   SGSLASPSTLQRSKKQRQCKRKAGPSSICAKFELKPPPYPLDALEPYMSKETLEYHWGKH  73

Query  289  HRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            HR YVDNLNKQI GTELD +SLED++LAT+N GDLLP FNNAAQ WNH FFWESMK
Sbjct  74   HRGYVDNLNKQIEGTELDELSLEDVILATHNKGDLLPPFNNAAQIWNHDFFWESMK  129



>ref|XP_011040318.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X2 
[Populus euphratica]
Length=307

 Score =   157 bits (397),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A  ELKPPPYPMNALEP MS+ TFEYHWGKHHRAYV+NLNKQI GTELD +SL+D+VL
Sbjct  47   VTAKFELKPPPYPMNALEPQMSKDTFEYHWGKHHRAYVNNLNKQIEGTELDDMSLDDVVL  106

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYN GD LPAFNNAAQAWNH FFWESM
Sbjct  107  ITYNKGDPLPAFNNAAQAWNHEFFWESM  134



>gb|KCW46222.1| hypothetical protein EUGRSUZ_K00110 [Eucalyptus grandis]
Length=222

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            R G   I A  +LKPPPYP+NALEPHMS  T  +HWGKHHRAYVDNLNKQIVGTEL+  S
Sbjct  46   RFGAAVITAKFDLKPPPYPLNALEPHMSANTLSFHWGKHHRAYVDNLNKQIVGTELEAKS  105

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDIV+ TYN+GDLLP FNNAAQ WNH FFWESM
Sbjct  106  LEDIVIQTYNDGDLLPPFNNAAQIWNHDFFWESM  139



>ref|XP_006279672.1| hypothetical protein CARUB_v10026846mg [Capsella rubella]
 gb|EOA12570.1| hypothetical protein CARUB_v10026846mg [Capsella rubella]
Length=304

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A  ELKPPPYP++ALEPHMSR+T +YHWGKHHR YV+NLNKQIVGT+LD +SLE++VL
Sbjct  48   ITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHRTYVENLNKQIVGTDLDTLSLEEVVL  107

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  108  LSYNRGNMLPAFNNAAQAWNHEFFWESIQP  137



>gb|AFH08832.1| iron superoxide dismutase 2, partial [Diospyros oleifera]
Length=228

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +S
Sbjct  54   KAGGTSVTAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELDELS  113

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  114  LEDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  147



>ref|XP_011040317.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X1 
[Populus euphratica]
Length=311

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A  ELKPPPYPMNALEP MS+ TFEYHWGKHHRAYV+NLNKQI GTELD +SL+D+VL
Sbjct  47   VTAKFELKPPPYPMNALEPQMSKDTFEYHWGKHHRAYVNNLNKQIEGTELDDMSLDDVVL  106

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYN GD LPAFNNAAQAWNH FFWESM
Sbjct  107  ITYNKGDPLPAFNNAAQAWNHEFFWESM  134



>ref|XP_010269875.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X2 
[Nelumbo nucifera]
Length=302

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A +ELKPPPY +N+LEPHMSR+  EYHWGKHHR YV+NLN+QIVGTELDG++LEDI++
Sbjct  42   ITAQIELKPPPYSLNSLEPHMSREILEYHWGKHHRGYVENLNRQIVGTELDGMTLEDIII  101

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            A+YN GD LP+FNNAAQ WNH FFWESM
Sbjct  102  ASYNKGDFLPSFNNAAQVWNHEFFWESM  129



>gb|ACU18268.1| unknown [Glycine max]
Length=217

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S+  FK  K E +  R  G  KI A  ELK PPYP++A EP MS++T EYHWGKHHR YV
Sbjct  31   SSGTFKFLKKESRCLRKAGRTKITAKFELKSPPYPLSASEPIMSQETLEYHWGKHHRTYV  90

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            DNLN+QI GT+LDG SLE+ ++ TYN GD+LPAFNNAAQAWNH FFWESMKP
Sbjct  91   DNLNRQIDGTDLDGNSLENTIVITYNKGDILPAFNNAAQAWNHDFFWESMKP  142



>ref|XP_010269873.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X1 
[Nelumbo nucifera]
Length=303

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A +ELKPPPY +N+LEPHMSR+  EYHWGKHHR YV+NLN+QIVGTELDG++LEDI++
Sbjct  43   ITAQIELKPPPYSLNSLEPHMSREILEYHWGKHHRGYVENLNRQIVGTELDGMTLEDIII  102

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            A+YN GD LP+FNNAAQ WNH FFWESM
Sbjct  103  ASYNKGDFLPSFNNAAQVWNHEFFWESM  130



>gb|KCW46219.1| hypothetical protein EUGRSUZ_K00110 [Eucalyptus grandis]
Length=224

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            R G   I A  +LKPPPYP+NALEPHMS  T  +HWGKHHRAYVDNLNKQIVGTEL+  S
Sbjct  46   RFGAAVITAKFDLKPPPYPLNALEPHMSANTLSFHWGKHHRAYVDNLNKQIVGTELEAKS  105

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDIV+ TYN+GDLLP FNNAAQ WNH FFWESM
Sbjct  106  LEDIVIQTYNDGDLLPPFNNAAQIWNHDFFWESM  139



>ref|XP_006402024.1| hypothetical protein EUTSA_v10014192mg [Eutrema salsugineum]
 dbj|BAJ34521.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43477.1| hypothetical protein EUTSA_v10014192mg [Eutrema salsugineum]
Length=306

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +1

Query  151  KIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            ++ +K    G   I A  ELKPPPYP++ALEPHMSR+T +YHWGKHH+ YV+NLNKQIVG
Sbjct  39   RLSRKMAVSGV--ITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQIVG  96

Query  331  TELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            T+LDG+SLE++VL +YN G++LPAFNNAAQAWNH FFWES+
Sbjct  97   TDLDGMSLEEVVLLSYNKGNMLPAFNNAAQAWNHEFFWESI  137



>ref|XP_006402022.1| hypothetical protein EUTSA_v10014192mg [Eutrema salsugineum]
 ref|XP_006402023.1| hypothetical protein EUTSA_v10014192mg [Eutrema salsugineum]
 gb|ESQ43475.1| hypothetical protein EUTSA_v10014192mg [Eutrema salsugineum]
 gb|ESQ43476.1| hypothetical protein EUTSA_v10014192mg [Eutrema salsugineum]
Length=304

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 85/101 (84%), Gaps = 2/101 (2%)
 Frame = +1

Query  151  KIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            ++ +K    G   I A  ELKPPPYP++ALEPHMSR+T +YHWGKHH+ YV+NLNKQIVG
Sbjct  37   RLSRKMAVSGV--ITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQIVG  94

Query  331  TELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            T+LDG+SLE++VL +YN G++LPAFNNAAQAWNH FFWES+
Sbjct  95   TDLDGMSLEEVVLLSYNKGNMLPAFNNAAQAWNHEFFWESI  135



>gb|KCW46221.1| hypothetical protein EUGRSUZ_K00110 [Eucalyptus grandis]
Length=226

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            R G   I A  +LKPPPYP+NALEPHMS  T  +HWGKHHRAYVDNLNKQIVGTEL+  S
Sbjct  46   RFGAAVITAKFDLKPPPYPLNALEPHMSANTLSFHWGKHHRAYVDNLNKQIVGTELEAKS  105

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDIV+ TYN+GDLLP FNNAAQ WNH FFWESM
Sbjct  106  LEDIVIQTYNDGDLLPPFNNAAQIWNHDFFWESM  139



>gb|AHX36943.1| Fe superoxide dismutase, partial [Betula platyphylla]
Length=367

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = +1

Query  157  EKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE  336
            E++  R   P I A  +LKPPPYP++ALEP MS++T EYHWGKHHR YV+NLNKQIVGTE
Sbjct  97   ERRCKRKSGPAITAKFDLKPPPYPLDALEPIMSKETLEYHWGKHHRGYVENLNKQIVGTE  156

Query  337  LDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LDG+SLED+++ +YN GD+LP FNNAAQ WNH FFWESM
Sbjct  157  LDGMSLEDVIVISYNKGDILPTFNNAAQIWNHDFFWESM  195



>gb|AFJ66174.1| hypothetical protein 11M19.17 [Arabidopsis halleri]
Length=264

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A  ELKPPPYP++ALEPHMSR+T +YHWGKHHR YV+NLNKQIVGT+LD + LE++VL
Sbjct  25   ITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHRTYVENLNKQIVGTDLDTLPLEEVVL  84

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  85   LSYNRGNMLPAFNNAAQAWNHEFFWESIQP  114



>gb|KFK36754.1| hypothetical protein AALP_AA4G165500 [Arabis alpina]
Length=303

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A  ELKPPPYP++ALEPHMSR+T +YHWGKHH+ YV+NLNKQIVGT+LDG+SLE++VL
Sbjct  47   ITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQIVGTDLDGLSLEEVVL  106

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             +YN G++LPAFNNAAQAWNH FFWES+
Sbjct  107  LSYNKGNMLPAFNNAAQAWNHEFFWESI  134



>gb|KFK36755.1| hypothetical protein AALP_AA4G165500 [Arabis alpina]
Length=305

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A  ELKPPPYP++ALEPHMSR+T +YHWGKHH+ YV+NLNKQIVGT+LDG+SLE++VL
Sbjct  49   ITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQIVGTDLDGLSLEEVVL  108

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             +YN G++LPAFNNAAQAWNH FFWES+
Sbjct  109  LSYNKGNMLPAFNNAAQAWNHEFFWESI  136



>gb|ABY48757.4| chloroplast iron superoxide dismutase [Dimocarpus longan]
 gb|ACJ07160.1| chloroplast iron superoxide dismutase [Dimocarpus longan]
Length=275

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +1

Query  154  IEKKFTRGGFPK-IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            ++++ TR   P  + A  ELKPPPYP+NALEPHMSR T EYHWGKHHR YV+NLNKQ  G
Sbjct  2    VQRRCTRKSRPTTLSAKFELKPPPYPLNALEPHMSRDTLEYHWGKHHRTYVENLNKQTAG  61

Query  331  TELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            TELDG+SLE++V+ +YN G  LP+FNNAAQAWNH FFWESM
Sbjct  62   TELDGMSLEEVVVVSYNRGYFLPSFNNAAQAWNHDFFWESM  102



>emb|CAD42655.1| iron-superoxide dismutase precursor [Pisum sativum]
Length=243

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S+  FK  K + +  R  G   I A  ELKPPPYP++ALEP MSR TFEYHWGKHHRAYV
Sbjct  33   SSATFKFSKNKGRCIRKAGSTNITAKFELKPPPYPLDALEPIMSRDTFEYHWGKHHRAYV  92

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            DNLNKQI  T+LDG SLE+ ++  YNNGD+LPAFNNAAQ WNH FFWESM
Sbjct  93   DNLNKQIDETDLDGKSLEETIVIAYNNGDILPAFNNAAQVWNHDFFWESM  142



>ref|XP_001690591.1| superoxide dismutase [Fe] [Chlamydomonas reinhardtii]
 gb|EDP05850.1| superoxide dismutase [Fe] [Chlamydomonas reinhardtii]
 gb|ACV41089.1| chloroplast Fe superoxide dismutase 1 precursor [Chlamydomonas 
reinhardtii]
Length=234

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  193  RAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLA  372
            RAALELK PPY ++ALEPHMS+QT E+HWGKHHRAYVDN+NKQ+ GT LDG SLE+IVLA
Sbjct  32   RAALELKSPPYALDALEPHMSKQTLEFHWGKHHRAYVDNMNKQVAGTPLDGKSLEEIVLA  91

Query  373  TYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            ++NNG   P FNNAAQ WNH FFWESMKP
Sbjct  92   SWNNGQPTPVFNNAAQVWNHTFFWESMKP  120



>ref|XP_010536568.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic [Tarenaya 
hassleriana]
Length=310

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A  ELKPPPYP++ +EPHMSR+T EYHWG+HHR YV+NLNKQI GT+LDG+SLED+VL
Sbjct  52   VTAKFELKPPPYPLDGMEPHMSRETLEYHWGRHHRTYVENLNKQIAGTDLDGLSLEDVVL  111

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             +YNNG +LPAFNNAAQAWNH FFWES+
Sbjct  112  VSYNNGSMLPAFNNAAQAWNHEFFWESI  139



>gb|AAB04944.1| superoxide dismutase precursor [Chlamydomonas reinhardtii]
Length=234

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  193  RAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLA  372
            RAALELK PPY ++ALEPHMS+QT E+HWGKHHRAYVDN+NKQ+ GT LDG SLE+IVLA
Sbjct  32   RAALELKSPPYALDALEPHMSKQTLEFHWGKHHRAYVDNMNKQVAGTPLDGKSLEEIVLA  91

Query  373  TYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            ++NNG   P FNNAAQ WNH FFWESMKP
Sbjct  92   SWNNGQPTPVFNNAAQVWNHTFFWESMKP  120



>ref|XP_006589023.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X2 
[Glycine max]
 ref|XP_006589024.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X3 
[Glycine max]
Length=310

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
            S+  FK  K E +  R     I A  ELKPPPYP+N+LEP MS +T EYHWGKHHR YVD
Sbjct  31   SSGTFKFSKKESRCIRKA-GSITAKFELKPPPYPLNSLEPIMSEETIEYHWGKHHRTYVD  89

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            NLN+QI GT+LDG SLED ++  YN GD+LPAFNNAAQAWNH FFWESMKP
Sbjct  90   NLNRQIDGTDLDGNSLEDTMVILYNKGDILPAFNNAAQAWNHDFFWESMKP  140



>ref|XP_003535933.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X1 
[Glycine max]
Length=309

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
            S+  FK  K E +  R     I A  ELKPPPYP+N+LEP MS +T EYHWGKHHR YVD
Sbjct  30   SSGTFKFSKKESRCIRKA-GSITAKFELKPPPYPLNSLEPIMSEETIEYHWGKHHRTYVD  88

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            NLN+QI GT+LDG SLED ++  YN GD+LPAFNNAAQAWNH FFWESMKP
Sbjct  89   NLNRQIDGTDLDGNSLEDTMVILYNKGDILPAFNNAAQAWNHDFFWESMKP  139



>gb|AFG19618.1| iron superoxide dismutase 2, partial [Litchi chinensis]
Length=285

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +S
Sbjct  54   KAGGTSVTAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELDELS  113

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  114  LEDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  147



>gb|KCW46213.1| hypothetical protein EUGRSUZ_K00110 [Eucalyptus grandis]
Length=262

 Score =   155 bits (391),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/94 (76%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            R G   I A  +LKPPPYP+NALEPHMS  T  +HWGKHHRAYVDNLNKQIVGTEL+  S
Sbjct  46   RFGAAVITAKFDLKPPPYPLNALEPHMSANTLSFHWGKHHRAYVDNLNKQIVGTELEAKS  105

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDIV+ TYN+GDLLP FNNAAQ WNH FFWESM
Sbjct  106  LEDIVIQTYNDGDLLPPFNNAAQIWNHDFFWESM  139



>gb|KEH41344.1| superoxide dismutase [Medicago truncatula]
Length=311

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +1

Query  187  KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIV  366
            +I A  ELKPPPYP+NALEP MS+ TFEYHWGKHHRAYVDNLNKQI GT+LDG SLE+ +
Sbjct  52   QITAKFELKPPPYPLNALEPIMSQNTFEYHWGKHHRAYVDNLNKQIEGTDLDGKSLEETI  111

Query  367  LATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            + +YNNGD+LPAFNNAAQ WNH FFWESM
Sbjct  112  IMSYNNGDILPAFNNAAQVWNHDFFWESM  140



>ref|XP_007218693.1| hypothetical protein PRUPE_ppa008765mg [Prunus persica]
 gb|EMJ19892.1| hypothetical protein PRUPE_ppa008765mg [Prunus persica]
Length=319

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +S
Sbjct  54   KAGGTSVTAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELDELS  113

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  114  LEDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  147



>ref|XP_007218694.1| hypothetical protein PRUPE_ppa008765mg [Prunus persica]
 gb|EMJ19893.1| hypothetical protein PRUPE_ppa008765mg [Prunus persica]
Length=320

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +S
Sbjct  55   KAGGTSVTAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELDELS  114

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  115  LEDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  148



>ref|XP_008368041.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like isoform 
X2 [Malus domestica]
Length=319

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +1

Query  151  KIEKKFTRG-GFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIV  327
            K ++K  R  G   IRA  ELKPPPYP++ALEPHM ++T EYHWGKHHR YVDNLNK I 
Sbjct  46   KKQRKCRRKVGAIDIRAQFELKPPPYPLDALEPHMGKETLEYHWGKHHRGYVDNLNKLIA  105

Query  328  GTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            GTELD +SLED++LATYN GDLLP FN AAQ WNH FFWESM
Sbjct  106  GTELDELSLEDVILATYNKGDLLPPFNQAAQIWNHDFFWESM  147



>ref|NP_199923.1| Fe superoxide dismutase 2 [Arabidopsis thaliana]
 sp|Q9LU64.1|SODF2_ARATH RecName: Full=Superoxide dismutase [Fe] 2, chloroplastic; AltName: 
Full=Protein ALBINO OR PALE GREEN 8; AltName: Full=Protein 
FE SUPEROXIDE DISMUTASE 2; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAA97372.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM61633.1| Fe-superoxide dismutase precursor [Arabidopsis thaliana]
 gb|AAO42100.1| putative iron superoxide dismutase [Arabidopsis thaliana]
 gb|AAO50649.1| putative iron superoxide dismutase [Arabidopsis thaliana]
 dbj|BAF00460.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96034.1| Fe superoxide dismutase 2 [Arabidopsis thaliana]
Length=305

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A  ELKPPPYP++ALEPHMSR+T +YHWGKHH+ YV+NLNKQI+GT+LD +SLE++VL
Sbjct  49   ITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHKTYVENLNKQILGTDLDALSLEEVVL  108

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  109  LSYNKGNMLPAFNNAAQAWNHEFFWESIQP  138



>ref|XP_002865842.1| hypothetical protein ARALYDRAFT_918143 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42101.1| hypothetical protein ARALYDRAFT_918143 [Arabidopsis lyrata subsp. 
lyrata]
Length=305

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A  ELKPPPYP++ALEPHMSR+T +YHWGKHHR YV+NLNKQIVGT+LD + LE++VL
Sbjct  49   ITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHRTYVENLNKQIVGTDLDTLPLEEVVL  108

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  109  LSYNRGNMLPAFNNAAQAWNHEFFWESIQP  138



>ref|XP_008368040.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like isoform 
X1 [Malus domestica]
Length=320

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  178  GFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLE  357
            G   IRA  ELKPPPYP++ALEPHM ++T EYHWGKHHR YVDNLNK I GTELD +SLE
Sbjct  57   GAIDIRAQFELKPPPYPLDALEPHMGKETLEYHWGKHHRGYVDNLNKLIAGTELDELSLE  116

Query  358  DIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            D++LATYN GDLLP FN AAQ WNH FFWESM
Sbjct  117  DVILATYNKGDLLPPFNQAAQIWNHDFFWESM  148



>gb|KCW46218.1| hypothetical protein EUGRSUZ_K00110 [Eucalyptus grandis]
Length=144

 Score =   150 bits (379),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  196  AALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLAT  375
            A LELKPPPYP++ALEPHMS  T  YHWGKHHR+YVDNLNKQI+GTEL G SLED+++ T
Sbjct  8    AKLELKPPPYPLDALEPHMSANTMSYHWGKHHRSYVDNLNKQILGTELQGKSLEDVIVQT  67

Query  376  YNNGDLLPAFNNAAQAWNHAFFWESM  453
            YNNGDL PAFNNAAQ WNH FFW+SM
Sbjct  68   YNNGDLHPAFNNAAQVWNHDFFWDSM  93



>gb|KCW46220.1| hypothetical protein EUGRSUZ_K00110 [Eucalyptus grandis]
Length=178

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  196  AALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLAT  375
            A LELKPPPYP++ALEPHMS  T  YHWGKHHR+YVDNLNKQI+GTEL G SLED+++ T
Sbjct  8    AKLELKPPPYPLDALEPHMSANTMSYHWGKHHRSYVDNLNKQILGTELQGKSLEDVIVQT  67

Query  376  YNNGDLLPAFNNAAQAWNHAFFWESM  453
            YNNGDL PAFNNAAQ WNH FFW+SM
Sbjct  68   YNNGDLHPAFNNAAQVWNHDFFWDSM  93



>gb|KCW46217.1| hypothetical protein EUGRSUZ_K00110 [Eucalyptus grandis]
Length=180

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  196  AALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLAT  375
            A LELKPPPYP++ALEPHMS  T  YHWGKHHR+YVDNLNKQI+GTEL G SLED+++ T
Sbjct  8    AKLELKPPPYPLDALEPHMSANTMSYHWGKHHRSYVDNLNKQILGTELQGKSLEDVIVQT  67

Query  376  YNNGDLLPAFNNAAQAWNHAFFWESM  453
            YNNGDL PAFNNAAQ WNH FFW+SM
Sbjct  68   YNNGDLHPAFNNAAQVWNHDFFWDSM  93



>gb|KHN47222.1| Superoxide dismutase [Fe], chloroplastic [Glycine soja]
Length=318

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 88/116 (76%), Gaps = 5/116 (4%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S+  FK  K E +  R  G  KI A  ELKPPPYP++ALEP MS++T EYHWGKHHR YV
Sbjct  32   SSGTFKFLKKESRCLRKAGRTKITAKFELKPPPYPLSALEPIMSQETLEYHWGKHHRTYV  91

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQ----AWNHAFFWESMKP  459
            DNLN+QI GT+LDG SLE+ ++ TYN GD+LPAFNNAAQ    AWNH FFWESMKP
Sbjct  92   DNLNRQIDGTDLDGNSLENTIVITYNKGDILPAFNNAAQACMLAWNHDFFWESMKP  147



>ref|XP_002946030.1| superoxide dismutase [Fe] [Volvox carteri f. nagariensis]
 gb|ABM47310.1| superoxide dismutase [Volvox carteri f. nagariensis]
 gb|EFJ53025.1| superoxide dismutase [Fe] [Volvox carteri f. nagariensis]
Length=233

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +1

Query  193  RAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLA  372
            +AALELK PPYP++ALEPHMS+QT E+HWGKHHRAYVDN+NKQI GT LDG SLE+IVLA
Sbjct  31   KAALELKAPPYPLDALEPHMSKQTLEFHWGKHHRAYVDNMNKQIAGTPLDGKSLEEIVLA  90

Query  373  TYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            ++N G+  P FNNAAQ WNH FFWESMK
Sbjct  91   SWNGGNPTPVFNNAAQVWNHTFFWESMK  118



>gb|EYU20151.1| hypothetical protein MIMGU_mgv1a010591mg [Erythranthe guttata]
Length=307

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTRGGFPK-IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYV  303
            S    +  K EK+  R      I A ++L PPPY ++ALEPHMSR+TFEYHWGKHHRAYV
Sbjct  26   STRILQLKKNEKRSVRKACRGLITAKIDLSPPPYSLDALEPHMSRETFEYHWGKHHRAYV  85

Query  304  DNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            DNLNKQIVGTELD   LE+I++ATYN GDLLP FNNAAQ WNH FFW SMK
Sbjct  86   DNLNKQIVGTELDLKPLEEIIVATYNKGDLLPPFNNAAQVWNHDFFWGSMK  136



>gb|AEY78522.2| chloroplast Fe superoxide dismutase [Prunus persica]
 gb|AFH08802.1| chloroplast Fe-superoxide dismutase 1A-a [Prunus persica]
 gb|AFH08804.1| chloroplast Fe-superoxide dismutase 2B-a [Prunus persica]
Length=319

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  +LKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +S
Sbjct  54   KAGGTSVTAQFKLKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELDELS  113

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  114  LEDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  147



>ref|XP_008234026.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X2 
[Prunus mume]
Length=319

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK   GTELD +S
Sbjct  54   KAGGTSVTAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLTAGTELDELS  113

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  114  LEDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  147



>ref|XP_008234025.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X1 
[Prunus mume]
Length=320

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK   GTELD +S
Sbjct  55   KAGGTSVTAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLTAGTELDELS  114

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  115  LEDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  148



>gb|AFG22595.1| chloroplast Fe-superoxide dismutase 1B-a [Prunus persica]
 gb|AFH08807.1| chloroplast Fe-superoxide dismutase 1B-b [Prunus persica]
Length=319

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  +LKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +S
Sbjct  54   KAGGTSVTAQFKLKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELDELS  113

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            LEDI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  114  LEDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  147



>ref|XP_010034971.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010042491.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW46216.1| hypothetical protein EUGRSUZ_K00110 [Eucalyptus grandis]
Length=216

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  196  AALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLAT  375
            A LELKPPPYP++ALEPHMS  T  YHWGKHHR+YVDNLNKQI+GTEL G SLED+++ T
Sbjct  8    AKLELKPPPYPLDALEPHMSANTMSYHWGKHHRSYVDNLNKQILGTELQGKSLEDVIVQT  67

Query  376  YNNGDLLPAFNNAAQAWNHAFFWESM  453
            YNNGDL PAFNNAAQ WNH FFW+SM
Sbjct  68   YNNGDLHPAFNNAAQVWNHDFFWDSM  93



>ref|XP_009362730.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Pyrus 
x bretschneideri]
Length=319

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +1

Query  151  KIEKKFTRG-GFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIV  327
            K ++K  R  G   IRA  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I 
Sbjct  46   KKQRKCRRKVGAIDIRAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIA  105

Query  328  GTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            GTEL  +SLED++LATYN GD+LP FN AAQ WNH FFWESM
Sbjct  106  GTELGELSLEDVILATYNKGDMLPPFNQAAQIWNHDFFWESM  147



>ref|XP_007144183.1| hypothetical protein PHAVU_007G1354001g, partial [Phaseolus vulgaris]
 gb|ESW16177.1| hypothetical protein PHAVU_007G1354001g, partial [Phaseolus vulgaris]
Length=213

 Score =   150 bits (380),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            PK+ A  ELKPPPYP+N LEP MS+QT E+HWGKHH+ YV+NL KQ+VGTELDG SLE+I
Sbjct  2    PKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHKTYVENLKKQVVGTELDGKSLEEI  61

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            ++ +YN GD+LPAFNNAAQ WNH FFWE M
Sbjct  62   IVTSYNKGDILPAFNNAAQVWNHDFFWECM  91



>ref|XP_010482438.1| PREDICTED: LOW QUALITY PROTEIN: superoxide dismutase [Fe] 2, 
chloroplastic-like [Camelina sativa]
Length=301

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = +1

Query  175  GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSL  354
             G   I A  ELKPPPY ++ALEPHMSR+T +YHWGKH+R Y++NLNKQIVGT+LD +SL
Sbjct  40   AGSGVITAGFELKPPPYSLDALEPHMSRETLDYHWGKHYRTYIENLNKQIVGTDLDALSL  99

Query  355  EDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            E++VL +YN G++LPAFNNAAQAWNH FFWES++P
Sbjct  100  EEVVLLSYNRGNMLPAFNNAAQAWNHEFFWESIQP  134



>gb|AAF28773.1|AF077224_1 iron-superoxide dismutase precursor [Vigna unguiculata]
Length=245

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            PK+ A  ELKPPPYP+N LEP MS+QT E+HWGKHHR YV+NL KQ+VGTELDG SLE+I
Sbjct  20   PKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTELDGKSLEEI  79

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            ++  YN GD+LPAFNNAAQ WNH FFWE M
Sbjct  80   IVTAYNKGDILPAFNNAAQVWNHDFFWECM  109



>pdb|1UNF|X Chain X, The Crystal Structure Of The Eukaryotic Fesod From Vigna 
Unguiculata Suggests A New Enzymatic Mechanism
Length=238

 Score =   151 bits (381),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            PK+ A  ELKPPPYP+N LEP MS+QT E+HWGKHHR YV+NL KQ+VGTELDG SLE+I
Sbjct  13   PKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHRTYVENLKKQVVGTELDGKSLEEI  72

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            ++  YN GD+LPAFNNAAQ WNH FFWE M
Sbjct  73   IVTAYNKGDILPAFNNAAQVWNHDFFWECM  102



>gb|AFH08803.1| chloroplast Fe-superoxide dismutase 2A-a [Prunus persica]
 gb|AFH08805.1| chloroplast Fe-superoxide dismutase 2C-a [Prunus persica]
Length=320

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +S
Sbjct  55   KAGGTSVTAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELDELS  114

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            L DI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  115  LGDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  148



>gb|AFH08806.1| chloroplast Fe-superoxide dismutase 2D-a [Prunus persica]
 gb|AFH08808.1| chloroplast Fe-superoxide dismutase 2D-b [Prunus persica]
Length=320

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +S
Sbjct  55   KAGGTSVTAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELDELS  114

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            L DI+LATYN GDLLP FN+AAQ WNH FFWESM
Sbjct  115  LGDIILATYNKGDLLPPFNHAAQIWNHDFFWESM  148



>ref|XP_006413341.1| hypothetical protein EUTSA_v10026218mg [Eutrema salsugineum]
 ref|XP_006413342.1| hypothetical protein EUTSA_v10026218mg [Eutrema salsugineum]
 dbj|BAJ34361.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ54794.1| hypothetical protein EUTSA_v10026218mg [Eutrema salsugineum]
 gb|ESQ54795.1| hypothetical protein EUTSA_v10026218mg [Eutrema salsugineum]
Length=215

 Score =   150 bits (378),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPY ++ALEPHMSRQT E+HWGKHHRAYVDNL KQ++GTEL+G  L+ I+L
Sbjct  7    VTANYVLKPPPYSLDALEPHMSRQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLDHIIL  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYNNGDLLPAFNNAAQAWNH FFWESM
Sbjct  67   KTYNNGDLLPAFNNAAQAWNHEFFWESM  94



>ref|XP_008364852.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like isoform 
X2 [Malus domestica]
Length=319

 Score =   153 bits (386),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  178  GFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLE  357
            G   IRA  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTEL+ +SLE
Sbjct  56   GAINIRAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELNELSLE  115

Query  358  DIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             I+LATYN GDLLP FN AAQ WNH FFWESM
Sbjct  116  XIILATYNKGDLLPPFNQAAQIWNHDFFWESM  147



>ref|XP_008364851.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like isoform 
X1 [Malus domestica]
Length=320

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  178  GFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLE  357
            G   IRA  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTEL+ +SLE
Sbjct  57   GAINIRAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELNELSLE  116

Query  358  DIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             I+LATYN GDLLP FN AAQ WNH FFWESM
Sbjct  117  XIILATYNKGDLLPPFNQAAQIWNHDFFWESM  148



>ref|NP_001237901.1| iron-superoxide dismutase [Glycine max]
 gb|AAQ13492.1| iron-superoxide dismutase [Glycine max]
Length=244

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            PK+ A  ELKPPPYP+N LEP MS+QT E+HWGKHH+ YV+NL KQIVGTELDG SLE+I
Sbjct  22   PKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHKTYVENLKKQIVGTELDGKSLEEI  81

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            ++ +YN GD+LPAFNNAAQ WNH FFWE M
Sbjct  82   IVTSYNKGDILPAFNNAAQVWNHDFFWECM  111



>ref|XP_007145453.1| hypothetical protein PHAVU_007G240600g [Phaseolus vulgaris]
 gb|ESW17447.1| hypothetical protein PHAVU_007G240600g [Phaseolus vulgaris]
Length=312

 Score =   152 bits (385),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  136  NFKCGKIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNL  312
             FK  K E +  R  G  +I A  ELKPPPYP+NALEP MS++T EYHWGKHHR YVDNL
Sbjct  32   TFKLWKKESRCIRKAGRIEITAKFELKPPPYPLNALEPIMSQETLEYHWGKHHRTYVDNL  91

Query  313  NKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            N+QI GT+L+  SLE++V+++YN GD LPAFNNAAQAWNH FFWESM
Sbjct  92   NRQIDGTDLEEKSLENVVVSSYNKGDFLPAFNNAAQAWNHDFFWESM  138



>ref|XP_007144184.1| hypothetical protein PHAVU_007G1354001g, partial [Phaseolus vulgaris]
 gb|ESW16178.1| hypothetical protein PHAVU_007G1354001g, partial [Phaseolus vulgaris]
Length=225

 Score =   150 bits (378),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            PK+ A  ELKPPPYP+N LEP MS+QT E+HWGKHH+ YV+NL KQ+VGTELDG SLE+I
Sbjct  2    PKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHKTYVENLKKQVVGTELDGKSLEEI  61

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            ++ +YN GD+LPAFNNAAQ WNH FFWE M
Sbjct  62   IVTSYNKGDILPAFNNAAQVWNHDFFWECM  91



>ref|XP_008357013.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Malus 
domestica]
Length=320

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  178  GFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLE  357
            G   IRA  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTEL+ +SLE
Sbjct  57   GAIXIRAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELNELSLE  116

Query  358  DIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             I+LATYN GDLLP FN AAQ WNH FFWESM
Sbjct  117  XIILATYNKGDLLPPFNQAAQIWNHDFFWESM  148



>gb|AGV54680.1| iron-superoxide dismutase [Phaseolus vulgaris]
Length=244

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            PK+ A  ELKPPPYP+N LEP MS+QT E+HWGKHH+ YV+NL KQ+VGTELDG SLE+I
Sbjct  21   PKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHKTYVENLKKQVVGTELDGKSLEEI  80

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            ++ +YN GD+LPAFNNAAQ WNH FFWE M
Sbjct  81   IVTSYNKGDILPAFNNAAQVWNHDFFWECM  110



>ref|XP_010433685.1| PREDICTED: superoxide dismutase [Fe] 1, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010433686.1| PREDICTED: superoxide dismutase [Fe] 1, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010433687.1| PREDICTED: superoxide dismutase [Fe] 1, chloroplastic isoform 
X2 [Camelina sativa]
 ref|XP_010433688.1| PREDICTED: superoxide dismutase [Fe] 1, chloroplastic isoform 
X2 [Camelina sativa]
Length=215

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPY ++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++GTEL+G  L+ I+ 
Sbjct  7    VTANYVLKPPPYALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLDHIIN  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             TYNNGDLLPAFNNAAQAWNH FFWESMKP
Sbjct  67   KTYNNGDLLPAFNNAAQAWNHEFFWESMKP  96



>ref|NP_001238486.1| superoxide dismutase [Fe], chloroplastic precursor [Glycine max]
 sp|P28759.1|SODF_SOYBN RecName: Full=Superoxide dismutase [Fe], chloroplastic; Flags: 
Precursor [Glycine max]
 gb|AAA33960.1| Fe-superoxide dismutase [Glycine max]
 prf||1803527A Fe superoxide dismutase
Length=248

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            PK+ A  ELKPPPYP+N LEP MS+QT E+HWGKHH+ YV+NL KQ+VGTELDG SLE+I
Sbjct  21   PKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHKTYVENLKKQVVGTELDGKSLEEI  80

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            ++ +YN GD+LPAFNNAAQ WNH FFWE M
Sbjct  81   IVTSYNKGDILPAFNNAAQVWNHDFFWECM  110



>ref|XP_010438938.1| PREDICTED: superoxide dismutase [Fe] 1, chloroplastic-like [Camelina 
sativa]
Length=266

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPY ++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++GTEL+G  L+ I+ 
Sbjct  58   VTANYVLKPPPYALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLDHIIN  117

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             TYNNGDLLPAFNNAAQAWNH FFWESMKP
Sbjct  118  KTYNNGDLLPAFNNAAQAWNHEFFWESMKP  147



>gb|ACU23782.1| unknown [Glycine max]
Length=248

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            PK+ A  ELKPPPYP+N LEP MS+QT E+HWGKHH+ YV+NL KQ+VGTELDG SLE+I
Sbjct  21   PKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHKTYVENLKKQVVGTELDGESLEEI  80

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            ++ +YN GD+LPAFNNAAQ WNH FFWE M
Sbjct  81   IVTSYNKGDILPAFNNAAQVWNHDFFWECM  110



>ref|XP_004166617.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Cucumis 
sativus]
Length=305

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = +1

Query  145  CGKIEKK--FTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNK  318
            C  I++K   ++    KI A  ELKPPPYP++ALEPHMSR T EYHWGKHHRAYVDNLN+
Sbjct  35   CTSIKQKQHGSKTYLTKISAKFELKPPPYPLDALEPHMSRSTLEYHWGKHHRAYVDNLNR  94

Query  319  QIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            QI GTEL+ +SLEDI++ TY  G++L  FNNAAQ WNH F WES+KP
Sbjct  95   QIEGTELEELSLEDIIMKTYKKGNILQQFNNAAQIWNHDFLWESIKP  141



>ref|XP_006838440.1| hypothetical protein AMTR_s00002p00128010 [Amborella trichopoda]
 gb|ERN01009.1| hypothetical protein AMTR_s00002p00128010 [Amborella trichopoda]
Length=280

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = +1

Query  139  FKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNK  318
            F  GK  K   R     I A  ELKPPPYP+ ALEPH+SRQT E+HWGKH + YV+NLN+
Sbjct  5    FATGKYLKITHRSS---IVAQFELKPPPYPLVALEPHLSRQTLEHHWGKHQKGYVENLNQ  61

Query  319  QIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            QI+GTELDG+ LEDI+LA+YN GD LPAFNNAAQ WNH FFWESM
Sbjct  62   QILGTELDGMGLEDIILASYNKGDPLPAFNNAAQIWNHEFFWESM  106



>gb|AEG89520.1| Fe superoxide dismutase [Brassica oleracea var. botrytis]
Length=212

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPYP++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++G+EL+G  LE I+ 
Sbjct  7    VTANYVLKPPPYPLDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGSELEGKPLEHIIQ  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYNNGDLLPAFNNAAQAWNH FFWESM
Sbjct  67   NTYNNGDLLPAFNNAAQAWNHEFFWESM  94



>gb|AAA32791.1| Fe-superoxide dismutase, partial [Arabidopsis thaliana]
Length=226

 Score =   148 bits (374),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 81/102 (79%), Gaps = 1/102 (1%)
 Frame = +1

Query  151  KIEKKFTR-GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIV  327
            K+E +  R      + A   LKPPP+ ++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++
Sbjct  7    KLELQLQRMAASSAVTANYVLKPPPFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVL  66

Query  328  GTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            GTEL+G  LE I+ +TYNNGDLLPAFNNAAQAWNH FFWESM
Sbjct  67   GTELEGKPLEHIIHSTYNNGDLLPAFNNAAQAWNHEFFWESM  108



>gb|KHN05550.1| Superoxide dismutase [Fe], chloroplastic [Glycine soja]
Length=313

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 5/115 (4%)
 Frame = +1

Query  127  SNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVD  306
            S+  FK  K E +  R     I A  ELKPPPYP+N+LEP MS +T EYHWGKHHR YVD
Sbjct  30   SSGTFKFSKKESRCIRKA-GSITAKFELKPPPYPLNSLEPIMSEETIEYHWGKHHRTYVD  88

Query  307  NLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQ----AWNHAFFWESMKP  459
            NLN+QI GT+LDG SLED ++  YN GD+LPAFNNAAQ    AWNH FFWESMKP
Sbjct  89   NLNRQIDGTDLDGNSLEDTMVILYNKGDILPAFNNAAQACMLAWNHDFFWESMKP  143



>ref|XP_008453838.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Cucumis 
melo]
Length=305

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +1

Query  139  FKCGKIEKKF--TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNL  312
            F C  I++K   ++    KI A  ELKPPPYP++ALEPHMSR T EYHWGKHHRAYVDNL
Sbjct  33   FPCSSIKQKQHGSKTYLTKISAKFELKPPPYPLDALEPHMSRSTLEYHWGKHHRAYVDNL  92

Query  313  NKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            N+QI GTEL+ +SLEDI+  TY  G++L  FNNAAQ WNH F WESM
Sbjct  93   NRQIEGTELEELSLEDIITKTYKKGNILQQFNNAAQIWNHDFLWESM  139



>gb|ACL81495.1| FeSOD [Ginkgo biloba]
Length=239

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 6/101 (6%)
 Frame = +1

Query  169  TRGGFPKIRAA------LELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            ++GG  K RAA       ELKPPPY  +ALEPHMS++TFE+HWGKHHRAYVDNLNKQI G
Sbjct  24   SKGGLSKFRAAPSTVALFELKPPPYSFDALEPHMSKRTFEFHWGKHHRAYVDNLNKQIEG  83

Query  331  TELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            TEL+G +L D++ ATY+NG+  PAFNNAAQAWNH FFWE M
Sbjct  84   TELEGYTLGDVIKATYSNGEPQPAFNNAAQAWNHEFFWECM  124



>ref|XP_010536565.1| PREDICTED: superoxide dismutase [Fe] 1, chloroplastic [Tarenaya 
hassleriana]
 ref|XP_010536566.1| PREDICTED: superoxide dismutase [Fe] 1, chloroplastic [Tarenaya 
hassleriana]
 ref|XP_010536567.1| PREDICTED: superoxide dismutase [Fe] 1, chloroplastic [Tarenaya 
hassleriana]
Length=213

 Score =   147 bits (372),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPY ++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++GTEL+G +L+ IVL
Sbjct  7    VTANYVLKPPPYSLDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGNTLQHIVL  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYN GD+LPAFNNAAQAWNH FFWESM
Sbjct  67   NTYNKGDILPAFNNAAQAWNHEFFWESM  94



>gb|AAC15842.1| superoxide dismutase [Raphanus sativus]
Length=212

 Score =   147 bits (371),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPYP++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++G+EL+G +LE I+ 
Sbjct  7    VTANYVLKPPPYPLDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGSELEGKALEHIIQ  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYNNGDLLP FNNAAQAWNH FFWESM
Sbjct  67   NTYNNGDLLPPFNNAAQAWNHEFFWESM  94



>ref|NP_194240.1| superoxide dismutase [Fe] [Arabidopsis thaliana]
 ref|NP_849440.1| superoxide dismutase [Fe] [Arabidopsis thaliana]
 ref|NP_849441.1| superoxide dismutase [Fe] [Arabidopsis thaliana]
 ref|NP_001190834.1| superoxide dismutase [Fe] [Arabidopsis thaliana]
 sp|P21276.4|SODF1_ARATH RecName: Full=Superoxide dismutase [Fe] 1, chloroplastic; AltName: 
Full=Protein FE SUPEROXIDE DISMUTASE 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG40062.1|AF324711_1 AT4g25100 [Arabidopsis thaliana]
 gb|AAG41444.1|AF326862_1 putative Fe superoxide dismutase [Arabidopsis thaliana]
 gb|AAK00367.1|AF339685_1 putative Fe superoxide dismutase [Arabidopsis thaliana]
 gb|AAK62615.1| AT4g25100/F13M23_240 [Arabidopsis thaliana]
 gb|AAM64776.1| superoxide dismutase (EC 1.15.1.1) (Fe)(fragment) [Arabidopsis 
thaliana]
 gb|AAM91056.1| AT4g25100/F13M23_240 [Arabidopsis thaliana]
 gb|AEE85007.1| superoxide dismutase [Fe] [Arabidopsis thaliana]
 gb|AEE85008.1| superoxide dismutase [Fe] [Arabidopsis thaliana]
 gb|AEE85009.1| superoxide dismutase [Fe] [Arabidopsis thaliana]
 gb|AEE85011.1| superoxide dismutase [Fe] [Arabidopsis thaliana]
Length=212

 Score =   147 bits (370),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPP+ ++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++GTEL+G  LE I+ 
Sbjct  7    VTANYVLKPPPFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIIH  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            +TYNNGDLLPAFNNAAQAWNH FFWESM
Sbjct  67   STYNNGDLLPAFNNAAQAWNHEFFWESM  94



>ref|XP_010448479.1| PREDICTED: superoxide dismutase [Fe] 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=215

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   L+PPPY ++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++GT+L+G  L+ I+ 
Sbjct  7    VTANYVLQPPPYALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTDLEGKPLDHIIN  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             TYNNGDLLPAFNNAAQAWNH FFWESMKP
Sbjct  67   KTYNNGDLLPAFNNAAQAWNHEFFWESMKP  96



>ref|XP_010448478.1| PREDICTED: superoxide dismutase [Fe] 1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=253

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   L+PPPY ++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++GT+L+G  L+ I+ 
Sbjct  45   VTANYVLQPPPYALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTDLEGKPLDHIIN  104

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             TYNNGDLLPAFNNAAQAWNH FFWESMKP
Sbjct  105  KTYNNGDLLPAFNNAAQAWNHEFFWESMKP  134



>gb|AFH08835.1| iron superoxide dismutase 5, partial [Diospyros oleifera]
Length=126

 Score =   144 bits (362),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            + G   + A  ELKPPPYP++ALEPHMS++T EYHWGKHHR YVDNLNK I GTELD +S
Sbjct  34   KAGGTSVTAQFELKPPPYPLDALEPHMSKETLEYHWGKHHRGYVDNLNKLIAGTELDELS  93

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFW  444
            LEDI+LATYN GDLLP FN+AAQ  NH FFW
Sbjct  94   LEDIILATYNKGDLLPPFNHAAQIRNHDFFW  124



>emb|CDY11055.1| BnaA03g47140D [Brassica napus]
Length=216

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPY ++ALEPHMSRQT E+HWGKHHRAYVDNL KQ++G+EL+G +L+ I+L
Sbjct  7    VTADYVLKPPPYSLDALEPHMSRQTLEFHWGKHHRAYVDNLKKQVLGSELEGKTLDHIIL  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYNNGDLL AFNNAAQAWNH FFWESM
Sbjct  67   NTYNNGDLLHAFNNAAQAWNHEFFWESM  94



>emb|CDY34342.1| BnaA01g14450D [Brassica napus]
Length=213

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPYP++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++G+EL+G  LE I+ 
Sbjct  7    VTANYVLKPPPYPLDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGSELEGKPLEHIIQ  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYNNGDLLP FNNAAQAWNH FFWESM
Sbjct  67   NTYNNGDLLPPFNNAAQAWNHEFFWESM  94



>ref|NP_001288905.1| fibronectin type III and SPRY domain-containing protein 1 [Brassica 
rapa]
 gb|ABV89632.1| superoxide dismutase [Brassica rapa]
Length=212

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPYP++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++G+EL+G  LE I+ 
Sbjct  7    VTANYVLKPPPYPLDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGSELEGKPLEHIIQ  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYNNGDLLP FNNAAQAWNH FFWESM
Sbjct  67   NTYNNGDLLPPFNNAAQAWNHEFFWESM  94



>ref|XP_009138864.1| PREDICTED: superoxide dismutase [Fe] 1, chloroplastic [Brassica 
rapa]
 gb|AGW21779.1| iron superoxide dismutase [Brassica rapa subsp. oleifera]
Length=212

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPYP++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++G+EL+G  LE I+ 
Sbjct  7    VTANYVLKPPPYPLDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGSELEGKPLEHIIQ  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYNNGDLLP FNNAAQAWNH FFWESM
Sbjct  67   NTYNNGDLLPPFNNAAQAWNHEFFWESM  94



>gb|KGN53188.1| hypothetical protein Csa_4G025180 [Cucumis sativus]
Length=318

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +1

Query  145  CGKIEKKF--TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNK  318
            C  I++K   ++    KI A  ELKPPPYP++ALEPHMSR T EYHWGKHHRAYVDNLN+
Sbjct  48   CTSIKQKQHGSKTYLTKISAKFELKPPPYPLDALEPHMSRSTLEYHWGKHHRAYVDNLNR  107

Query  319  QIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            QI GTEL+ +SLEDI++ TY  G++L  FNNAAQ WNH F WES+
Sbjct  108  QIEGTELEELSLEDIIMKTYKKGNILQQFNNAAQIWNHDFLWESI  152



>emb|CAB36752.1| superoxide dismutase (EC 1.15.1.1) (Fe)(fragment) [Arabidopsis 
thaliana]
 emb|CAB79419.1| superoxide dismutase (EC 1.15.1.1) (Fe)(fragment) [Arabidopsis 
thaliana]
Length=234

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPP+ ++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++GTEL+G  LE I+ 
Sbjct  29   VTANYVLKPPPFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIIH  88

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            +TYNNGDLLPAFNNAAQAWNH FFWESM
Sbjct  89   STYNNGDLLPAFNNAAQAWNHEFFWESM  116



>ref|XP_004146889.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Cucumis 
sativus]
Length=305

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +1

Query  145  CGKIEKKF--TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNK  318
            C  I++K   ++    KI A  ELKPPPYP++ALEPHMSR T EYHWGKHHRAYVDNLN+
Sbjct  35   CTSIKQKQHGSKTYLTKISAKFELKPPPYPLDALEPHMSRSTLEYHWGKHHRAYVDNLNR  94

Query  319  QIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            QI GTEL+ +SLEDI++ TY  G++L  FNNAAQ WNH F WES+
Sbjct  95   QIEGTELEELSLEDIIMKTYKKGNILQQFNNAAQIWNHDFLWESI  139



>gb|KHN30686.1| Superoxide dismutase [Fe], chloroplastic [Glycine soja]
Length=253

 Score =   146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 77/94 (82%), Gaps = 4/94 (4%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            PK+ A  ELKPPPYP+N LEP MS+QT E+HWGKHH+ YV+NL KQIVGTELDG SLE+I
Sbjct  27   PKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHKTYVENLKKQIVGTELDGKSLEEI  86

Query  364  VLATYNNGDLLPAFNNAAQA----WNHAFFWESM  453
            ++ +YN GD+LPAFNNAAQA    WNH FFWE M
Sbjct  87   IVTSYNKGDILPAFNNAAQACMLVWNHDFFWECM  120



>ref|XP_002867626.1| hypothetical protein ARALYDRAFT_492324 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43885.1| hypothetical protein ARALYDRAFT_492324 [Arabidopsis lyrata subsp. 
lyrata]
Length=215

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPY ++ALEPHMS+QT E+HWGKHHRAYV+NL KQ++GTEL+G  LE I+ 
Sbjct  7    VTANYVLKPPPYALDALEPHMSKQTLEFHWGKHHRAYVENLKKQVLGTELEGKPLEHIIH  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            +TYNNG+LLPAFNNAAQAWNH FFWESM
Sbjct  67   STYNNGELLPAFNNAAQAWNHEFFWESM  94



>ref|XP_009599437.1| PREDICTED: superoxide dismutase [Fe], chloroplastic isoform X2 
[Nicotiana tomentosiformis]
Length=246

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = +1

Query  229  MNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFN  408
            MNALEPHMS  TFEYHWGKHHRAYVDNLNKQI GT+LDG++LEDI+L TYN GDLLP FN
Sbjct  1    MNALEPHMSHTTFEYHWGKHHRAYVDNLNKQIDGTKLDGMTLEDIILITYNRGDLLPPFN  60

Query  409  NAAQAWNHAFFWESMKP  459
            NAAQAWNH FFW+SMKP
Sbjct  61   NAAQAWNHQFFWDSMKP  77



>emb|CDX92676.1| BnaC07g39340D [Brassica napus]
Length=216

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPY ++ALEP MSRQT E+HWGKHHRAYV+NL KQ++G++L+G +L+ I+L
Sbjct  7    VTADYVLKPPPYSLDALEPFMSRQTLEFHWGKHHRAYVENLKKQVLGSDLEGKTLDHIIL  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYNNGDLLPAFNNAAQAWNH FFWESM
Sbjct  67   NTYNNGDLLPAFNNAAQAWNHEFFWESM  94



>emb|CDY03380.1| BnaC01g17020D [Brassica napus]
Length=208

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPYP++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++G+EL+G  LE I+ 
Sbjct  7    VTANYVLKPPPYPLDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGSELEGKPLEHIIQ  66

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYNNGDLLP FNNAAQAWNH FFW SM
Sbjct  67   NTYNNGDLLPPFNNAAQAWNHEFFWGSM  94



>gb|AAS92466.1| Fe-superoxide dismutase 2 precursor [Lotus japonicus]
 gb|AAS92467.1| Fe-superoxide dismutase 2 precursor [Lotus japonicus]
 gb|AFK36592.1| unknown [Lotus japonicus]
Length=250

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            PK+  A +LKPPPYP+NALEP MS +T E+HWGKHHR+YV+NL KQIVGTE +G SLE I
Sbjct  17   PKVTPAFQLKPPPYPLNALEPIMSEKTLEFHWGKHHRSYVENLKKQIVGTEHEGKSLEAI  76

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            ++ +YN GD LPAFNNAAQ WNH FFWE M
Sbjct  77   IVTSYNKGDTLPAFNNAAQVWNHDFFWECM  106



>ref|XP_006282692.1| hypothetical protein CARUB_v10005448mg [Capsella rubella]
 gb|EOA15590.1| hypothetical protein CARUB_v10005448mg [Capsella rubella]
Length=279

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A   LKPPPY ++ALEPHMS+QT E+HWGKHHRAYV+NL KQ++ TEL+G  L+ I+ 
Sbjct  71   VTANYVLKPPPYALDALEPHMSKQTLEFHWGKHHRAYVENLKKQVLETELEGKPLDHIIH  130

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TYNNGDLLPAFNNAAQAWNH FFWESM
Sbjct  131  KTYNNGDLLPAFNNAAQAWNHEFFWESM  158



>gb|AFH08836.1| iron superoxide dismutase 6 [Diospyros oleifera]
Length=209

 Score =   139 bits (350),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +1

Query  244  PHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQA  423
            PHMSR T EYHWGKHHRAYVDNLNKQIVGTELDG +LED++LATYN GDLLP FNNAAQA
Sbjct  5    PHMSRDTLEYHWGKHHRAYVDNLNKQIVGTELDGKTLEDVILATYNKGDLLPPFNNAAQA  64

Query  424  WNHAFFWESMK  456
            WNH FFWESMK
Sbjct  65   WNHEFFWESMK  75



>ref|XP_006437024.1| hypothetical protein CICLE_v10032233mg [Citrus clementina]
 gb|ESR50264.1| hypothetical protein CICLE_v10032233mg [Citrus clementina]
Length=254

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  232  NALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNN  411
            NALEPHMS+ T EYHWGKHHRAYV+NLNKQIVGTELDG+SLED+++ +YN GD+LP FNN
Sbjct  11   NALEPHMSKDTLEYHWGKHHRAYVENLNKQIVGTELDGMSLEDVIIVSYNKGDMLPPFNN  70

Query  412  AAQAWNHAFFWESM  453
            AAQAWNH FFWESM
Sbjct  71   AAQAWNHEFFWESM  84



>gb|KDO57700.1| hypothetical protein CISIN_1g0220782mg, partial [Citrus sinensis]
Length=167

 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  232  NALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNN  411
            NALEPHMS+ T EYHWGKHHRAYV+NLNKQIVGTELDG+SLED+++ +YN G++LP FNN
Sbjct  1    NALEPHMSKDTLEYHWGKHHRAYVENLNKQIVGTELDGMSLEDVIIVSYNKGNMLPPFNN  60

Query  412  AAQAWNHAFFWESM  453
            AAQAWNH FFWESM
Sbjct  61   AAQAWNHEFFWESM  74



>dbj|BAC66946.1| chloroplastic iron superoxide dismutase [Barbula unguiculata]
 dbj|BAG24134.1| chloroplastic iron superoxide dismutase [Barbula unguiculata]
Length=211

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +1

Query  175  GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSL  354
               P     ++L+PPPY ++ALEPHMS++T EYHWGKHHRAYVDNL KQI GTEL   +L
Sbjct  2    AAVPLPLTTVDLRPPPYALDALEPHMSKETLEYHWGKHHRAYVDNLKKQIEGTELASQTL  61

Query  355  EDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            EDIV ATYNNG+    FNNAAQAWNH FFW SM P
Sbjct  62   EDIVRATYNNGEPTAPFNNAAQAWNHEFFWLSMSP  96



>gb|KDO57697.1| hypothetical protein CISIN_1g0220782mg [Citrus sinensis]
Length=254

 Score =   138 bits (347),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  232  NALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNN  411
            NALEPHMS+ T EYHWGKHHRAYV+NLNKQIVGTELDG+SLED+++ +YN G++LP FNN
Sbjct  11   NALEPHMSKDTLEYHWGKHHRAYVENLNKQIVGTELDGMSLEDVIIVSYNKGNMLPPFNN  70

Query  412  AAQAWNHAFFWESM  453
            AAQAWNH FFWESM
Sbjct  71   AAQAWNHEFFWESM  84



>gb|KDO57698.1| hypothetical protein CISIN_1g0220782mg, partial [Citrus sinensis]
Length=244

 Score =   137 bits (346),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +1

Query  232  NALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNN  411
            NALEPHMS+ T EYHWGKHHRAYV+NLNKQIVGTELDG+SLED+++ +YN G++LP FNN
Sbjct  1    NALEPHMSKDTLEYHWGKHHRAYVENLNKQIVGTELDGMSLEDVIIVSYNKGNMLPPFNN  60

Query  412  AAQAWNHAFFWESM  453
            AAQAWNH FFWESM
Sbjct  61   AAQAWNHEFFWESM  74



>gb|ABR23159.1| iron-superoxide dismutase 1 [Ulva fasciata]
Length=231

 Score =   137 bits (345),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 83/116 (72%), Gaps = 5/116 (4%)
 Frame = +1

Query  127  SNHNFKCG-KIEKKFTRGGFPK----IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHH  291
            +  +F  G +++ +  R   P+    ++AALELK PPY ++ALEPHMS+ T E+HWGKHH
Sbjct  2    ARSSFATGQRLQMQARRATAPRQSVVVKAALELKAPPYELDALEPHMSKNTMEFHWGKHH  61

Query  292  RAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            R YV+N+NKQI GTEL   SLE+I++A++N G   P FNNAAQ WNH FFWE M P
Sbjct  62   RTYVNNMNKQIEGTELQDKSLEEIIMASWNCGSPTPVFNNAAQIWNHTFFWEGMAP  117



>gb|ACB30317.1| iron superoxide dismutase [Solanum tuberosum]
Length=145

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  232  NALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNN  411
            +ALEPHMS +T E HWGKHHRAYVDNLNKQI GTELDG +L+DI+L TYNNG  LPAFNN
Sbjct  1    DALEPHMSSRTLEIHWGKHHRAYVDNLNKQIDGTELDGKTLKDILLITYNNGSPLPAFNN  60

Query  412  AAQAWNHAFFWESMKP  459
            AAQAWNH FFWESMKP
Sbjct  61   AAQAWNHQFFWESMKP  76



>gb|AAS47494.1| iron superoxide dismutase [Pinus pinaster]
Length=249

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            P   A L L PPPY  +ALEPHMS+QT  +HWGKHHRAYVDN N QI  TEL+  +LEDI
Sbjct  42   PPTVALLNLNPPPYDFDALEPHMSKQTLSFHWGKHHRAYVDNCNNQIKDTELEECTLEDI  101

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            +  TYNNGD  P FNNAAQAWNH FFWE MKP
Sbjct  102  IKKTYNNGDPRPVFNNAAQAWNHEFFWECMKP  133



>ref|XP_010063026.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic isoform 
X2 [Eucalyptus grandis]
Length=258

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  226  PMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAF  405
            P +ALEPHMSR T  YHWGKHHR YV+NLN QIVGT+LDG+SLEDI++ +YN GD+LP+F
Sbjct  11   PQDALEPHMSRDTISYHWGKHHRGYVENLNMQIVGTDLDGMSLEDIIILSYNKGDILPSF  70

Query  406  NNAAQAWNHAFFWESMKP  459
            NNAAQ WNH FFWESM P
Sbjct  71   NNAAQIWNHDFFWESMVP  88



>gb|ADR01109.1| Fe superoxide dismutase 1, partial [Brassica rapa]
Length=195

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  223  YPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPA  402
            YP++ALEPHMS+QT E+HWGKHHRAYVDNL KQ++G+EL+G  LE I+  TYNNGDLLP 
Sbjct  1    YPLDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGSELEGKPLEHIIQNTYNNGDLLPP  60

Query  403  FNNAAQAWNHAFFWESM  453
            FNNAAQAWNH FFWESM
Sbjct  61   FNNAAQAWNHEFFWESM  77



>dbj|BAO18397.1| cytosolic Fe-superoxide dismutase [Pogonatum inflexum]
 dbj|BAO18398.1| cytosolic iron superoxide dismutase-2 [Pogonatum inflexum]
 dbj|BAO18400.1| cytosolic iron superoxide dismutase-2 [Pogonatum inflexum]
 dbj|BAO18401.1| cytosolic iron superoxide dismutase-2 [Pogonatum inflexum]
 dbj|BAO18402.1| cytosolic iron superoxide dismutase-2 [Pogonatum inflexum]
 dbj|BAO18403.1| cytosolic iron superoxide dismutase-2 [Pogonatum inflexum]
Length=211

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +1

Query  184  PKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDI  363
            P     ++L+PPPY ++ALEPHMS+QT EYHWGKHHR+YVDNL KQI GTEL   SLE+I
Sbjct  5    PLPLTTVDLRPPPYALDALEPHMSKQTLEYHWGKHHRSYVDNLKKQIEGTELATKSLEEI  64

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            V  +YNNG    AFNNA QAWNH FFW SM P
Sbjct  65   VKVSYNNGQPTAAFNNAGQAWNHEFFWLSMSP  96



>gb|ADE77392.1| unknown [Picea sitchensis]
Length=253

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 76/106 (72%), Gaps = 6/106 (6%)
 Frame = +1

Query  160  KKFTRGGFPKIRAA------LELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQ  321
            K  TRG   + R A        LK PPY ++ALEP MSR+T E+HWGKHHR YVDNLNKQ
Sbjct  23   KTKTRGAMLRSRMAPLTVALFGLKEPPYKLDALEPFMSRRTLEFHWGKHHRGYVDNLNKQ  82

Query  322  IVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            I G EL+G +LE+++  TYNNG+ +PAFNNAAQ WNH  FWE M+P
Sbjct  83   IEGNELEGFTLEELIKVTYNNGNPMPAFNNAAQVWNHDLFWECMEP  128



>gb|ABR23160.1| iron-superoxide dismutase 2 [Ulva fasciata]
Length=203

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  202  LELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYN  381
            +EL PPP+ ++ALEPHMS+++ EYHWGKHHR YV NLNK I GT++DG+++E+IV AT+N
Sbjct  3    VELPPPPFELHALEPHMSKESMEYHWGKHHRGYVTNLNKAIAGTDMDGLAIEEIVKATWN  62

Query  382  NGDLLPAFNNAAQAWNHAFFWESMKP  459
            NG    +FNNAAQ WNH FFW+SMKP
Sbjct  63   NGAPTASFNNAAQVWNHTFFWDSMKP  88



>ref|XP_010432693.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic-like [Camelina 
sativa]
Length=193

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  175  GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSL  354
             G   I A  ELKPPPYP++ALEPHMSR+T +YHWGKHHR YV+NLNKQIVGT+LD +SL
Sbjct  46   AGSGVITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHRTYVENLNKQIVGTDLDALSL  105

Query  355  EDIVLATYNNGDLLPAFNNAAQ  420
            E++VL +YN G++LPAFNNAA+
Sbjct  106  EEVVLLSYNRGNMLPAFNNAAK  127



>emb|CDY70727.1| BnaCnng69530D [Brassica napus]
Length=279

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 75/89 (84%), Gaps = 1/89 (1%)
 Frame = +1

Query  157  EKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE  336
            EK+F+R     I A  ELKPPPYP++ALEPHMS++T +YHWGKHH+ YV+NLNKQIVGT+
Sbjct  168  EKRFSRK-VAFITAGFELKPPPYPLDALEPHMSQETLDYHWGKHHKTYVENLNKQIVGTD  226

Query  337  LDGVSLEDIVLATYNNGDLLPAFNNAAQA  423
            LDG+SLE++VL +YN G++LPAFNN AQ 
Sbjct  227  LDGLSLEEVVLLSYNRGNMLPAFNNVAQV  255



>gb|KHN00993.1| Superoxide dismutase [Fe], chloroplastic [Glycine soja]
Length=261

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 73/89 (82%), Gaps = 2/89 (2%)
 Frame = +1

Query  157  EKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE  336
            E +  +G  PK+ A  ELKPPPYP+N LEP MS+QT E+HWGKHH+ YV+NL KQ+VGTE
Sbjct  29   EGRIRKG--PKVNAKFELKPPPYPLNGLEPVMSQQTLEFHWGKHHKTYVENLKKQVVGTE  86

Query  337  LDGVSLEDIVLATYNNGDLLPAFNNAAQA  423
            LDG SLE+I++ +YN GD+LPAFNNAAQA
Sbjct  87   LDGKSLEEIIVTSYNKGDILPAFNNAAQA  115



>dbj|BAO18766.1| chloroplastic Fe-superoxide dismutase [Equisetum arvense]
Length=284

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 77/103 (75%), Gaps = 2/103 (2%)
 Frame = +1

Query  157  EKKFTRGGFPK--IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVG  330
            +++ T+G      + AA  L PPPY ++ LEPH+S++T E+HWGKHHRAYVDNLNKQI  
Sbjct  41   QRRRTKGLLASSPVNAAFILNPPPYELDELEPHISKRTLEFHWGKHHRAYVDNLNKQIEN  100

Query  331  TELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            T+ +  +LE+IV  TYNNG+ LP FNNAAQAWNH F WESM P
Sbjct  101  TDYERNTLEEIVTITYNNGNPLPPFNNAAQAWNHEFLWESMAP  143



>ref|XP_010493451.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic [Camelina 
sativa]
Length=263

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGGF K+ A   LK PPYP++ALEP+MSR+T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  40   SRGGF-KVVAYYGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYG  98

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  99   YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>ref|XP_006376943.1| hypothetical protein POPTR_0012s11400g [Populus trichocarpa]
 gb|ERP54740.1| hypothetical protein POPTR_0012s11400g [Populus trichocarpa]
Length=122

 Score =   127 bits (319),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +1

Query  229  MNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFN  408
            M+ LEPHMS+ TFEYH GKHHRAYVDNLNKQI GTE D +SL+D+VL TYN G  LPAFN
Sbjct  1    MDDLEPHMSKDTFEYHRGKHHRAYVDNLNKQIDGTERDDMSLDDVVLVTYNKGGPLPAFN  60

Query  409  NAAQAWNHAFFWESMKP  459
            NAAQAWNH FF ESMKP
Sbjct  61   NAAQAWNHEFFLESMKP  77



>gb|AFV66768.1| iron superoxide dismutase [Musa acuminata AAA Group]
 gb|AIT56201.1| iron superoxide dismutase 1A [Musa acuminata AAA Group]
 gb|AIT56202.1| iron superoxide dismutase 1A [Musa acuminata AAA Group]
 gb|AIT56208.1| iron superoxide dismutase 1A [Musa acuminata AAA Group]
Length=301

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +1

Query  136  NFKCGKIEKKFTRG--GFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDN  309
            +F+  KI+++  R      +I A LELKPPPY +++LEPHMSR+T EYHWG+HHRA+V +
Sbjct  22   SFRWSKIKREGGRRLPRCARIAAQLELKPPPYSLSSLEPHMSRETLEYHWGRHHRAHVAS  81

Query  310  LNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            LN  I GT+LDG+ L++IV+ +YN G+ LP F +AAQ WNH FFW+S+K
Sbjct  82   LNNLIAGTDLDGMGLDEIVVVSYNKGNPLPLFVHAAQVWNHDFFWQSIK  130



>ref|XP_009384755.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=301

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = +1

Query  139  FKCGKIEKKFTRG--GFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNL  312
            F+  KI+++  R      +I A LELKPPPY +++LEPHMSR+T EYHWG+HHRA+V +L
Sbjct  23   FRWSKIKREGGRRLPRCARIAAQLELKPPPYSLSSLEPHMSRETLEYHWGRHHRAHVASL  82

Query  313  NKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            N  I GT+LDG+ L++IV+ +YN G+ LP F +AAQ WNH FFW+S+K
Sbjct  83   NNLIAGTDLDGMGLDEIVVVSYNKGNPLPLFVHAAQVWNHDFFWQSIK  130



>gb|AFJ66200.1| hypothetical protein 7G9.19 [Boechera stricta]
Length=283

 Score =   131 bits (330),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            I A  ELKPPPYP++ALEPHMSR+T +YHWGKHHR YV+NLNKQI GT+LD +SLE++VL
Sbjct  40   ITAGFELKPPPYPLDALEPHMSRETLDYHWGKHHRTYVENLNKQIAGTDLDALSLEEVVL  99

Query  370  ATYNNGDLLPAFNNAAQ  420
             +YN G++LPAFNNAAQ
Sbjct  100  LSYNRGNMLPAFNNAAQ  116



>gb|AFX61787.2| iron superoxide dismutase [Musa acuminata]
Length=300

 Score =   131 bits (330),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +1

Query  136  NFKCGKIEKKFTRG--GFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDN  309
            +F+  KI+++  R      +I A LELKPPPY +++LEPHMSR+T EYHWG+HHRA+V +
Sbjct  21   SFRWSKIKREGGRRLPRCARIAAQLELKPPPYSLSSLEPHMSRETLEYHWGRHHRAHVAS  80

Query  310  LNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            LN  I GT+LDG+ L++IV+ +YN G+ LP F +AAQ WNH FFW+S+K
Sbjct  81   LNNLIAGTDLDGMGLDEIVVVSYNKGNPLPPFVHAAQVWNHDFFWQSIK  129



>ref|XP_002946031.1| superoxide dismutase [Fe] [Volvox carteri f. nagariensis]
 gb|EFJ53026.1| superoxide dismutase [Fe] [Volvox carteri f. nagariensis]
Length=237

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 70/89 (79%), Gaps = 3/89 (3%)
 Frame = +1

Query  202  LELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYN  381
            +ELK PPYP++ALEPHMS++T E HWGKHHRA+VDNLNKQI GT L G SLE+I L  Y 
Sbjct  34   VELKAPPYPLDALEPHMSKRTLELHWGKHHRAHVDNLNKQIEGTPLAGKSLEEIFLNIYR  93

Query  382  NGDL---LPAFNNAAQAWNHAFFWESMKP  459
             G     +P F+NAAQAWNH FFWESMKP
Sbjct  94   GGAYRNNIPVFHNAAQAWNHTFFWESMKP  122



>ref|XP_002872050.1| hypothetical protein ARALYDRAFT_489192 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48309.1| hypothetical protein ARALYDRAFT_489192 [Arabidopsis lyrata subsp. 
lyrata]
Length=263

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGG  K+ A   LK PPYP++ALEP+MSR+T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  40   SRGGL-KVEAYYGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYG  98

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  99   YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>gb|ADR01298.1| iron-superoxide dismutase [Ceratopteris thalictroides]
Length=266

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +1

Query  154  IEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGT  333
            + K  TR  +  I     L+P P+ M+ALEP+MS+QT E+HWGKHHR YVDNLNKQI GT
Sbjct  26   LRKGNTRSSYRPIVMEFHLRPLPFEMDALEPYMSKQTLEFHWGKHHRTYVDNLNKQIKGT  85

Query  334  ELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            EL+G+ L++++   YNNG+    FNNA QAWNH FFWES+KP
Sbjct  86   ELEGMQLDELLKHGYNNGNPTAYFNNAGQAWNHDFFWESIKP  127



>gb|AAX92665.1| chloroplast iron superoxide dismutase [Dunaliella salina]
Length=227

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +1

Query  184  PKIRA-ALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLED  360
            P +R  A+ LKP PY  +ALEPHMS+ TFE+H GKHHRAY DNLNKQI G E D   L+ 
Sbjct  21   PSVRTNAVALKPLPYAPDALEPHMSKATFEFHHGKHHRAYADNLNKQIAGKEWDQKDLDT  80

Query  361  IVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            IV+A++NNG+  P FNNAAQ WNH FFWESMKP
Sbjct  81   IVMASWNNGNPTPEFNNAAQVWNHEFFWESMKP  113



>ref|XP_010454614.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic-like [Camelina 
sativa]
Length=261

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +R GF K+ A   LK PPYP++ALEP+MSR+T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  38   SRVGF-KVEAYYGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLRKDDRLYG  96

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  97   YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  134



>ref|XP_002982004.1| hypothetical protein SELMODRAFT_115358 [Selaginella moellendorffii]
 gb|EFJ17097.1| hypothetical protein SELMODRAFT_115358 [Selaginella moellendorffii]
Length=208

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A  EL P PY MNALEP MS+ T E+HWGKH RAY+DNLNKQI GTEL+ + LEDI+ 
Sbjct  4    VVAKFELPPLPYEMNALEPFMSKTTLEFHWGKHQRAYIDNLNKQISGTELESLKLEDIIT  63

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TY  G+  PAFNNAAQAWNH FF+ SM
Sbjct  64   KTYGGGNAQPAFNNAAQAWNHDFFFHSM  91



>ref|XP_010421131.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic-like [Camelina 
sativa]
Length=263

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGG  K+ A   LK PPYP++ALEP+MSR+T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  40   SRGGL-KVEAYYGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYG  98

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++  TYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  99   YTMEELIKVTYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>emb|CDY45763.1| BnaC02g42190D [Brassica napus]
Length=263

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGG  K+ A   LK PPYP++ALEP+MS++T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  40   SRGGL-KVEAYYGLKTPPYPLDALEPYMSKRTLEVHWGKHHRGYVDNLNKQLGKDDRLYG  98

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  99   YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>ref|XP_009150862.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic [Brassica 
rapa]
Length=263

 Score =   128 bits (322),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQI-VGTELDG  345
            +RGG  K+ A   LK PPYP++ALEP+MS++T E HWGKHHR YVDNLNKQ+    +L G
Sbjct  40   SRGGL-KVEAYYGLKTPPYPLDALEPYMSQRTLEVHWGKHHRGYVDNLNKQLGKDDKLYG  98

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  99   YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>emb|CDX88013.1| BnaA06g26040D [Brassica napus]
Length=264

 Score =   128 bits (322),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGG  K+ A   LK PPYP++ALEP+MS++T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  41   SRGGL-KVEAYYGLKTPPYPLDALEPYMSQRTLEVHWGKHHRGYVDNLNKQLGKDDKLYG  99

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  100  YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  137



>ref|XP_006394599.1| hypothetical protein EUTSA_v10004781mg [Eutrema salsugineum]
 gb|ESQ31885.1| hypothetical protein EUTSA_v10004781mg [Eutrema salsugineum]
Length=263

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGG  K+ A   LK PPYP++ALEP+MSR+T E HWGKHHR YV+NLNKQ+   + L G
Sbjct  40   SRGGL-KVEAYYGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVENLNKQLGKDDRLYG  98

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  99   YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>gb|ABR24272.1| iron-containing superoxide dismutase [Brassica napus]
Length=263

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGG  K+ A   LK PPYP++ALEP+MS++T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  40   SRGGL-KVEAYYGLKTPPYPLDALEPYMSQRTLEVHWGKHHRGYVDNLNKQLGKDDKLYG  98

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  99   YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>emb|CDY16845.1| BnaA09g05370D [Brassica napus]
Length=263

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGG  K+ A   LK PPYP++ALEP+MS++T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  40   SRGGL-KVEAYYGLKTPPYPLDALEPYMSQRTLEVHWGKHHRGYVDNLNKQLGKDDRLYG  98

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  99   YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>dbj|BAC66948.1| chloroplastic iron superoxide dismutase [Marchantia paleacea 
subsp. diptera]
Length=254

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  196  AALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLAT  375
            A  +LK PPYP++ALEPHMS++T E+HWGKHHRAYV+NLN QI  ++L+  +LE+IV ++
Sbjct  42   AKFDLKDPPYPLDALEPHMSKETLEFHWGKHHRAYVNNLNGQIENSDLERNTLEEIVQSS  101

Query  376  YNNGDLLPAFNNAAQAWNHAFFWESMK  456
            YNNG+  PAFNNA Q WNH FFW+SMK
Sbjct  102  YNNGNPTPAFNNAGQIWNHDFFWQSMK  128



>emb|CDX87176.1| BnaC09g04910D [Brassica napus]
Length=260

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGG  K+ A   LK PPYP++ALEP+MS++T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  37   SRGGL-KVEAYYGLKTPPYPLDALEPYMSQRTLEVHWGKHHRGYVDNLNKQLGKDDRLYG  95

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  96   YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  133



>gb|KDO57693.1| hypothetical protein CISIN_1g026199mg [Citrus sinensis]
Length=177

 Score =   125 bits (315),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 63/69 (91%), Gaps = 1/69 (1%)
 Frame = +1

Query  250  MSRQTFEYHWGKHHRAYVDNLNKQIVGTEL-DGVSLEDIVLATYNNGDLLPAFNNAAQAW  426
            MS+ T E+HWGKHHRAYVDNLNKQIVGTEL DG SLED+V+A+YN GDLLPAFNNAAQAW
Sbjct  1    MSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAW  60

Query  427  NHAFFWESM  453
            NH FFWESM
Sbjct  61   NHDFFWESM  69



>ref|XP_006437026.1| hypothetical protein CICLE_v10032233mg [Citrus clementina]
 gb|ESR50266.1| hypothetical protein CICLE_v10032233mg [Citrus clementina]
Length=238

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  250  MSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWN  429
            MS+ T EYHWGKHHRAYV+NLNKQIVGTELDG+SLED+++ +YN GD+LP FNNAAQAWN
Sbjct  1    MSKDTLEYHWGKHHRAYVENLNKQIVGTELDGMSLEDVIIVSYNKGDMLPPFNNAAQAWN  60

Query  430  HAFFWESM  453
            H FFWESM
Sbjct  61   HEFFWESM  68



>ref|XP_002986085.1| hypothetical protein SELMODRAFT_123324 [Selaginella moellendorffii]
 gb|EFJ12904.1| hypothetical protein SELMODRAFT_123324 [Selaginella moellendorffii]
Length=208

 Score =   126 bits (317),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +1

Query  190  IRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVL  369
            + A  EL P PY MNALEP MS+ T E+HWGKH RAY+DNLNKQI GTEL+ + LEDI+ 
Sbjct  4    VVAKFELPPLPYEMNALEPFMSKTTLEFHWGKHQRAYIDNLNKQISGTELESLKLEDIIT  63

Query  370  ATYNNGDLLPAFNNAAQAWNHAFFWESM  453
             TY  G+  P+FNNAAQAWNH FF+ SM
Sbjct  64   KTYGGGNAQPSFNNAAQAWNHDFFFHSM  91



>gb|AAO16563.1| iron superoxide dismutase [Solanum tuberosum]
Length=187

 Score =   125 bits (315),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +1

Query  247  HMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAW  426
            HMS +TFE+HWGKHH+ YVDNLNKQI GTELDG +LEDI+L TYN G  LPAFN+AAQAW
Sbjct  1    HMSSRTFEFHWGKHHKTYVDNLNKQIDGTELDGKTLEDIILVTYNKGAPLPAFNDAAQAW  60

Query  427  NHAFFWESMKP  459
            NH FFWESMKP
Sbjct  61   NHQFFWESMKP  71



>ref|XP_010942991.1| PREDICTED: superoxide dismutase [Fe], chloroplastic-like [Elaeis 
guineensis]
Length=300

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +1

Query  157  EKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE  336
            E++  R     I A  ELK PPYP+++LEPHMSR+T E+HWG+HHR++VD LN QI GT+
Sbjct  33   ERRKVRCAL--ITAQFELKRPPYPLDSLEPHMSRKTVEHHWGRHHRSHVDGLNAQIAGTQ  90

Query  337  LDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            L+ + LED+V+A+YN G  LP F +AAQ WNH FFW+SM
Sbjct  91   LEEMELEDVVIASYNKGSPLPPFVHAAQVWNHDFFWQSM  129



>gb|KFK39196.1| hypothetical protein AALP_AA3G212200 [Arabis alpina]
Length=264

 Score =   127 bits (320),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGG  K+ A   L+ PPYP++ALEP+MS++T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  41   SRGGL-KVEAYYGLRTPPYPLDALEPYMSKRTLEVHWGKHHRGYVDNLNKQLGKDDRLYG  99

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  100  YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  137



>ref|XP_009141488.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic-like [Brassica 
rapa]
Length=263

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGG  K+ A   LK PPYP++ALEP+MS++T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  40   SRGGV-KVEAYYGLKTPPYPLDALEPYMSQRTLEVHWGKHHRGYVDNLNKQLGKDDRLYG  98

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  99   YTMEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>ref|NP_197722.1| Fe superoxide dismutase 3 [Arabidopsis thaliana]
 sp|Q9FMX0.1|SODF3_ARATH RecName: Full=Superoxide dismutase [Fe] 3, chloroplastic; AltName: 
Full=Protein FE SUPEROXIDE DISMUTASE 3; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11186.1| iron superoxide dismutase 3 [Arabidopsis thaliana]
 gb|AAL38899.1| putative iron superoxide dismutase 3 [Arabidopsis thaliana]
 gb|AAM14164.1| putative iron superoxide dismutase 3 [Arabidopsis thaliana]
 gb|AED93150.1| Fe superoxide dismutase 3 [Arabidopsis thaliana]
Length=263

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = +1

Query  187  KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDGVSLEDI  363
            K+ A   LK PPYP++ALEP+MSR+T E HWGKHHR YVDNLNKQ+   + L G ++E++
Sbjct  45   KVEAYYGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYGYTMEEL  104

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            + ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  105  IKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>gb|AAC24834.1| iron superoxide dismutase 3 [Arabidopsis thaliana]
Length=262

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = +1

Query  187  KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDGVSLEDI  363
            K+ A   LK PPYP++ALEP+MSR+T E HWGKHHR YVDNLNKQ+   + L G ++E++
Sbjct  45   KVEAYYGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYGYTMEEL  104

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            + ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  105  IKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>gb|AAM63713.1| iron superoxide dismutase 3 [Arabidopsis thaliana]
Length=263

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = +1

Query  187  KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDGVSLEDI  363
            K+ A   LK PPYP++ALEP+MSR+T E HWGKHHR YVDNLNKQ+   + L G ++E++
Sbjct  45   KVEAYYGLKTPPYPLDALEPYMSRRTLEVHWGKHHRGYVDNLNKQLGKDDRLYGYTMEEL  104

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            + ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  105  IKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  136



>gb|AGH25521.1| Fe superoxide dismutase, partial [Mentha x piperita]
Length=68

 Score =   120 bits (301),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  268  EYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWE  447
            EYHWGKHHRAYVDNL+KQIVGTELD  SLE+I+LATYN GDLLP FNNAAQ WNH FFWE
Sbjct  1    EYHWGKHHRAYVDNLDKQIVGTELDTKSLEEIILATYNKGDLLPPFNNAAQVWNHEFFWE  60

Query  448  SMKP  459
            SMKP
Sbjct  61   SMKP  64



>gb|AFM43802.1| iron superoxide dismutase Fe-SOD6, partial [Litchi chinensis]
Length=236

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  250  MSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWN  429
            MS+ T EYHWGKHHR+YV+NLNKQI GTELDG+SLED+V+ TYN GD LP+FNNAAQAWN
Sbjct  1    MSQDTLEYHWGKHHRSYVENLNKQIAGTELDGMSLEDVVVVTYNRGDFLPSFNNAAQAWN  60

Query  430  HAFFWESM  453
            H FFWESM
Sbjct  61   HDFFWESM  68



>gb|KJB06967.1| hypothetical protein B456_001G052700 [Gossypium raimondii]
 gb|KJB06971.1| hypothetical protein B456_001G052700 [Gossypium raimondii]
 gb|KJB06973.1| hypothetical protein B456_001G052700 [Gossypium raimondii]
Length=245

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  250  MSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWN  429
            MSR+T  YHWGKHHR YV+NLNKQ+VGT+L+G+SLEDI++ TYN GD+LPAFNNAAQAWN
Sbjct  1    MSRETLAYHWGKHHRTYVENLNKQVVGTDLEGLSLEDIIIVTYNKGDILPAFNNAAQAWN  60

Query  430  HAFFWESM  453
            H FFWESM
Sbjct  61   HDFFWESM  68



>gb|KDO57699.1| hypothetical protein CISIN_1g0220782mg [Citrus sinensis]
Length=238

 Score =   125 bits (313),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  250  MSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWN  429
            MS+ T EYHWGKHHRAYV+NLNKQIVGTELDG+SLED+++ +YN G++LP FNNAAQAWN
Sbjct  1    MSKDTLEYHWGKHHRAYVENLNKQIVGTELDGMSLEDVIIVSYNKGNMLPPFNNAAQAWN  60

Query  430  HAFFWESM  453
            H FFWESM
Sbjct  61   HEFFWESM  68



>gb|AFV96148.1| iron superoxide dismutase, partial [Brassica oleracea]
Length=178

 Score =   123 bits (308),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +1

Query  175  GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDGVS  351
            GG  K+ A   LK PPYP++ALEP+MS++T E HWGKHHR YVDNLNKQ    + L G +
Sbjct  1    GGL-KVEAYYGLKTPPYPLDALEPYMSKRTLEVHWGKHHRGYVDNLNKQSGKDDRLYGYT  59

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            +E+++ ATYNNG+ LP FNNAAQ +NH FFWESM+P
Sbjct  60   MEELIKATYNNGNPLPEFNNAAQVYNHDFFWESMQP  95



>ref|NP_001031710.1| superoxide dismutase [Fe] [Arabidopsis thaliana]
 gb|AEE85010.1| superoxide dismutase [Fe] [Arabidopsis thaliana]
Length=186

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  250  MSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWN  429
            MS+QT E+HWGKHHRAYVDNL KQ++GTEL+G  LE I+ +TYNNGDLLPAFNNAAQAWN
Sbjct  1    MSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIIHSTYNNGDLLPAFNNAAQAWN  60

Query  430  HAFFWESM  453
            H FFWESM
Sbjct  61   HEFFWESM  68



>gb|AET75833.1| iron-superoxide dismutase [Diospyros oleifera]
Length=161

 Score =   121 bits (303),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  268  EYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWE  447
            E HWGKHHRAYVDNLNKQIVGTELDG +LED++LATYN GDLLP FNNAAQAWNH FFWE
Sbjct  1    ELHWGKHHRAYVDNLNKQIVGTELDGKTLEDVILATYNKGDLLPPFNNAAQAWNHEFFWE  60

Query  448  SMK  456
            SM+
Sbjct  61   SMR  63



>ref|XP_002267399.2| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic [Vitis 
vinifera]
 emb|CBI28995.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 84/130 (65%), Gaps = 14/130 (11%)
 Frame = +1

Query  112  SFPVSS-------NHNFKCGKIEKKFTRGGF------PKIRAALELKPPPYPMNALEPHM  252
            SFP SS       +  +KC K++    +G F       K+ A   LK PPY ++ALEPHM
Sbjct  65   SFPASSHVLLTDLSQRWKCPKLQNLRHKGQFHGSQKASKVLAFYGLKAPPYKLDALEPHM  124

Query  253  SRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDGVSLEDIVLATYNNGDLLPAFNNAAQAWN  429
            SR+T E HWG HHR YV+ LNKQ+   + L G +L+++V  TYNNG+ LP FNNAAQ WN
Sbjct  125  SRRTLEMHWGDHHRGYVEGLNKQLEKDDILYGHTLDELVKVTYNNGNPLPEFNNAAQVWN  184

Query  430  HAFFWESMKP  459
            H FFWESM+P
Sbjct  185  HDFFWESMQP  194



>gb|AJP77020.1| Fe superoxide dismutase [Isoetes sinensis]
Length=247

 Score =   122 bits (306),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 0/96 (0%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVS  351
            R   P  ++ L LK PPY ++ALEP+MS+++ E+HWGKHHRAYVDNLNKQI GTE +  +
Sbjct  26   RVRVPVAKSGLTLKHPPYELDALEPYMSKKSLEFHWGKHHRAYVDNLNKQIEGTEYEKNT  85

Query  352  LEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            LE++V  +++ G+    FNNA Q WNH FFWESMKP
Sbjct  86   LEELVTNSFHRGNPGAVFNNAGQVWNHDFFWESMKP  121



>ref|XP_010915011.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic isoform 
X9 [Elaeis guineensis]
Length=235

 Score =   122 bits (305),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +1

Query  175  GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSL  354
            G   KI A   L  PPY ++ALEP+MS++T E HWGKHHR YVD+LNKQ+    L G ++
Sbjct  47   GRASKILAYYGLTTPPYELDALEPYMSQRTLELHWGKHHRDYVDSLNKQLAKNPLYGHTM  106

Query  355  EDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            E+++  TYNNG+ LP FNNAAQ WNH FFWESM+P
Sbjct  107  EELIKVTYNNGNPLPEFNNAAQVWNHDFFWESMQP  141



>ref|XP_001751975.1| predicted protein [Physcomitrella patens]
 gb|EDQ83410.1| predicted protein, partial [Physcomitrella patens]
Length=202

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +1

Query  196  AALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLAT  375
            A  +L+P PY ++ALEPHMS++T E+HWGKHH+AYVDNLNKQ+ GTE +  +L ++VL+ 
Sbjct  1    AEFQLRPLPYELDALEPHMSKETLEFHWGKHHKAYVDNLNKQVEGTEAERQNLSELVLSA  60

Query  376  YNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            YN+G+    FNNA Q WNH FFW SM P
Sbjct  61   YNDGNPKAYFNNAGQIWNHEFFWSSMSP  88



>ref|XP_010915008.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic isoform 
X7 [Elaeis guineensis]
Length=250

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +1

Query  175  GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSL  354
            G   KI A   L  PPY ++ALEP+MS++T E HWGKHHR YVD+LNKQ+    L G ++
Sbjct  47   GRASKILAYYGLTTPPYELDALEPYMSQRTLELHWGKHHRDYVDSLNKQLAKNPLYGHTM  106

Query  355  EDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            E+++  TYNNG+ LP FNNAAQ WNH FFWESM+P
Sbjct  107  EELIKVTYNNGNPLPEFNNAAQVWNHDFFWESMQP  141



>gb|ABR24273.1| iron-containing superoxide dismutase [Brassica napus]
Length=263

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +1

Query  169  TRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDG  345
            +RGG  K+ A    K PPYP++ALEP+MS++T E HWGKHHR YVDNLNKQ+   + L G
Sbjct  40   SRGGL-KVEAYYGPKTPPYPLDALEPYMSQRTLEVHWGKHHRGYVDNLNKQLGKDDRLYG  98

Query  346  VSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
             ++E+++ ATYNNG+ LP FN AAQ +NH FFWESM+P
Sbjct  99   YTMEELIKATYNNGNPLPEFNYAAQVYNHDFFWESMQP  136



>ref|XP_010521891.1| PREDICTED: superoxide dismutase [Fe] 3, chloroplastic [Tarenaya 
hassleriana]
Length=264

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +1

Query  172  RGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDGV  348
            R G  K+ A   LK PPYP++ALEP+MSR+T E HW KHHR YVDNLNKQ+   + L G 
Sbjct  42   RSGL-KVEAYYGLKTPPYPLDALEPYMSRRTLEVHWDKHHRGYVDNLNKQLGKNDILYGY  100

Query  349  SLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            ++E+++ ATYNNG+  P FNNAAQ +NH FFWESM+P
Sbjct  101  TMEELIKATYNNGNPFPEFNNAAQVYNHDFFWESMQP  137



>ref|XP_002436456.1| hypothetical protein SORBIDRAFT_10g002970 [Sorghum bicolor]
 gb|EER87823.1| hypothetical protein SORBIDRAFT_10g002970 [Sorghum bicolor]
Length=215

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +1

Query  181  FPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLED  360
            F K+ +   L  PPY ++ALEP+MS++T E HWGKHH+ YVD LNKQ+  + L G +LED
Sbjct  42   FSKVVSYYGLTTPPYKLDALEPYMSKRTVELHWGKHHQDYVDGLNKQLATSPLYGYTLED  101

Query  361  IVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            ++   YNNG+ LP +NNAAQ WNH FFWESM+P
Sbjct  102  LIKEAYNNGNPLPEYNNAAQVWNHHFFWESMQP  134



>ref|XP_002520915.1| superoxide dismutase [fe], putative [Ricinus communis]
 gb|EEF41460.1| superoxide dismutase [fe], putative [Ricinus communis]
Length=265

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 3/101 (3%)
 Frame = +1

Query  160  KKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-  336
            ++F R    K+ A   LK PPYP++ALEP+MSR+T E HWG+HHRAYV+ LNKQ+   + 
Sbjct  40   RQFQRAS--KLVAYYGLKTPPYPLDALEPYMSRKTLEIHWGEHHRAYVEGLNKQLAKDDI  97

Query  337  LDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            L G +++++V  TYNNG+  P FNNAAQ WNH FFWESM+P
Sbjct  98   LYGYTMDELVKVTYNNGNPFPEFNNAAQVWNHDFFWESMQP  138



>ref|XP_010915005.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic isoform 
X4 [Elaeis guineensis]
Length=267

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +1

Query  175  GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSL  354
            G   KI A   L  PPY ++ALEP+MS++T E HWGKHHR YVD+LNKQ+    L G ++
Sbjct  46   GRASKILAYYGLTTPPYELDALEPYMSQRTLELHWGKHHRDYVDSLNKQLAKNPLYGHTM  105

Query  355  EDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            E+++  TYNNG+ LP FNNAAQ WNH FFWESM+P
Sbjct  106  EELIKVTYNNGNPLPEFNNAAQVWNHDFFWESMQP  140



>ref|XP_010915004.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic isoform 
X3 [Elaeis guineensis]
Length=268

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +1

Query  175  GGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSL  354
            G   KI A   L  PPY ++ALEP+MS++T E HWGKHHR YVD+LNKQ+    L G ++
Sbjct  47   GRASKILAYYGLTTPPYELDALEPYMSQRTLELHWGKHHRDYVDSLNKQLAKNPLYGHTM  106

Query  355  EDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            E+++  TYNNG+ LP FNNAAQ WNH FFWESM+P
Sbjct  107  EELIKVTYNNGNPLPEFNNAAQVWNHDFFWESMQP  141



>gb|KCW46214.1| hypothetical protein EUGRSUZ_K00110 [Eucalyptus grandis]
 gb|KCW46215.1| hypothetical protein EUGRSUZ_K00110 [Eucalyptus grandis]
Length=191

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  250  MSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWN  429
            MS  T  +HWGKHHRAYVDNLNKQIVGTEL+  SLEDIV+ TYN+GDLLP FNNAAQ WN
Sbjct  1    MSANTLSFHWGKHHRAYVDNLNKQIVGTELEAKSLEDIVIQTYNDGDLLPPFNNAAQIWN  60

Query  430  HAFFWESM  453
            H FFWESM
Sbjct  61   HDFFWESM  68



>dbj|BAO18396.1| chloroplastic Fe-superoxide dismutase-1 [Pogonatum inflexum]
 dbj|BAO18399.1| chloroplastic iron superoxide dismutase-1 [Pogonatum inflexum]
Length=250

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 8/116 (7%)
 Frame = +1

Query  106  RQSFPVSSNHNFKCGKIEKKFTRGGFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGK  285
            R SF VS  ++        +    G P  RA   LKP PY ++ALEPHMS++T E+H+GK
Sbjct  16   RHSFGVSKKYS------TPRMRSVGIP--RAQFFLKPLPYELDALEPHMSKKTLEFHYGK  67

Query  286  HHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESM  453
            HHRAYVDNLNKQI  T+ +  +LE+IV  +YNNG+ L  FNNA QAWNH FFW S+
Sbjct  68   HHRAYVDNLNKQIENTDFERNTLEEIVKISYNNGNPLAPFNNAGQAWNHDFFWSSL  123



>gb|ABI26730.1| putative iron superoxide dismutase [Fagus sylvatica]
Length=158

 Score =   118 bits (295),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +1

Query  268  EYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWE  447
            EYHWGKHHR YVDNLN QIVGTELDG+SLEDI++ +YN GD+LPAFNNAAQ WNH FFWE
Sbjct  1    EYHWGKHHRGYVDNLNNQIVGTELDGMSLEDIIILSYNKGDILPAFNNAAQTWNHDFFWE  60

Query  448  SM  453
            SM
Sbjct  61   SM  62



>ref|XP_008809006.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic [Phoenix 
dactylifera]
 ref|XP_008809008.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic [Phoenix 
dactylifera]
Length=268

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +1

Query  187  KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIV  366
            K+ A   L  PPY ++ALEP+MS++T E HWGKHHR YVD+LNKQ+V + L G ++E+++
Sbjct  51   KVLAYYGLTTPPYKLDALEPYMSQRTLELHWGKHHRDYVDSLNKQLVKSPLYGHTMEELI  110

Query  367  LATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
              TYNNG+ LP FNNAAQ WNH FFWESM+
Sbjct  111  KVTYNNGNPLPEFNNAAQVWNHDFFWESMQ  140



>ref|XP_008648270.1| PREDICTED: chloroplastic iron-superoxide dismutase isoform X1 
[Zea mays]
Length=249

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 73/107 (68%), Gaps = 5/107 (5%)
 Frame = +1

Query  151  KIEKKFTRGG-----FPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLN  315
            K+  K  R G     F K+ +   L  PPY ++ALEP+MS++T E HWGKHH+ YVD LN
Sbjct  24   KLRSKIQRQGGLSRRFSKVVSYYGLTTPPYKLDALEPYMSKRTVELHWGKHHQDYVDGLN  83

Query  316  KQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            KQ+  + L G +LED++   YNNG+ LP +NNAAQ WNH FFWESM+
Sbjct  84   KQLATSPLYGYTLEDLIKEAYNNGNPLPEYNNAAQVWNHHFFWESMQ  130



>gb|ACG32380.1| superoxide dismutase, chloroplast [Zea mays]
 gb|ACN27012.1| unknown [Zea mays]
 gb|AFW75474.1| iron superoxide dismutase [Zea mays]
Length=258

 Score =   120 bits (301),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 73/107 (68%), Gaps = 5/107 (5%)
 Frame = +1

Query  151  KIEKKFTRGG-----FPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLN  315
            K+  K  R G     F K+ +   L  PPY ++ALEP+MS++T E HWGKHH+ YVD LN
Sbjct  24   KLRSKIQRQGGLSRRFSKVVSYYGLTTPPYKLDALEPYMSKRTVELHWGKHHQDYVDGLN  83

Query  316  KQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMK  456
            KQ+  + L G +LED++   YNNG+ LP +NNAAQ WNH FFWESM+
Sbjct  84   KQLATSPLYGYTLEDLIKEAYNNGNPLPEYNNAAQVWNHHFFWESMQ  130



>ref|XP_008376353.1| PREDICTED: superoxide dismutase [Fe] 2, chloroplastic [Malus 
domestica]
Length=240

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  250  MSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWN  429
            MS++T EYHWGKHHR YVDNLNK I GTEL+ +SLEDI+LATYN GDLLP FN AAQ WN
Sbjct  1    MSKETLEYHWGKHHRGYVDNLNKLIAGTELNELSLEDIILATYNKGDLLPPFNQAAQIWN  60

Query  430  HAFFWESM  453
            H FFWESM
Sbjct  61   HDFFWESM  68



>ref|XP_006376942.1| hypothetical protein POPTR_0012s11400g [Populus trichocarpa]
 gb|ERP54739.1| hypothetical protein POPTR_0012s11400g [Populus trichocarpa]
Length=119

 Score =   116 bits (290),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +1

Query  250  MSRQTFEYHWGKHHRAYVDNLNKQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWN  429
            MS+ TFEYH GKHHRAYVDNLNKQI GTE D +SL+D+VL TYN G  LPAFNNAAQAWN
Sbjct  1    MSKDTFEYHRGKHHRAYVDNLNKQIDGTERDDMSLDDVVLVTYNKGGPLPAFNNAAQAWN  60

Query  430  HAFFWESMKP  459
            H FF ESMKP
Sbjct  61   HEFFLESMKP  70



>gb|AEN71832.1| chloroplast iron superoxide dismutase variant 1 [Dimocarpus longan]
Length=215

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +1

Query  187  KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDGVSLEDI  363
            K+ A   LK PPY ++ALEP+MS++T E HWG+HHR YVD LNKQ+  ++ L G +++++
Sbjct  32   KVVAYYGLKTPPYKLDALEPYMSKRTLEMHWGEHHRGYVDGLNKQLEKSDLLYGYTMDEL  91

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            V  TYNNG+ LP FNNAAQ WNH FFWESM+P
Sbjct  92   VKVTYNNGNPLPEFNNAAQVWNHDFFWESMQP  123



>gb|AEN71833.1| chloroplast iron superoxide dismutase variant 2 [Dimocarpus longan]
Length=212

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +1

Query  187  KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDGVSLEDI  363
            K+ A   LK PPY ++ALEP+MS++T E HWG+HHR YVD LNKQ+  ++ L G +++++
Sbjct  32   KVVAYYGLKTPPYKLDALEPYMSKRTLEMHWGEHHRGYVDGLNKQLEKSDLLYGYTMDEL  91

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            V  TYNNG+ LP FNNAAQ WNH FFWESM+P
Sbjct  92   VKVTYNNGNPLPEFNNAAQVWNHDFFWESMQP  123



>gb|AEN71834.1| chloroplast iron superoxide dismutase variant 3 [Dimocarpus longan]
Length=242

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +1

Query  187  KIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLNKQIVGTE-LDGVSLEDI  363
            K+ A   LK PPY ++ALEP+MS++T E HWG+HHR YVD LNKQ+  ++ L G +++++
Sbjct  32   KVVAYYGLKTPPYKLDALEPYMSKRTLEMHWGEHHRGYVDGLNKQLEKSDLLYGYTMDEL  91

Query  364  VLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            V  TYNNG+ LP FNNAAQ WNH FFWESM+P
Sbjct  92   VKVTYNNGNPLPEFNNAAQVWNHDFFWESMQP  123



>ref|XP_006855573.1| hypothetical protein AMTR_s00044p00032580 [Amborella trichopoda]
 gb|ERN17040.1| hypothetical protein AMTR_s00044p00032580 [Amborella trichopoda]
Length=268

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 76/108 (70%), Gaps = 1/108 (1%)
 Frame = +1

Query  139  FKCGKIEKKFTRG-GFPKIRAALELKPPPYPMNALEPHMSRQTFEYHWGKHHRAYVDNLN  315
             K  K +K++ +     ++ A    K PPY ++ALEP+MS++T E HWGKHH+ YVD LN
Sbjct  34   LKLSKFQKRYKQSLRDSRVLAFYGRKTPPYKLDALEPYMSQRTLEVHWGKHHQEYVDGLN  93

Query  316  KQIVGTELDGVSLEDIVLATYNNGDLLPAFNNAAQAWNHAFFWESMKP  459
            KQ+  + L G +LE++V  TYNNG+ +P FNNAAQ WNH FFWESM+P
Sbjct  94   KQLENSPLYGHTLEELVKVTYNNGNPMPEFNNAAQLWNHDFFWESMQP  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563956788320