BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M09

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622218.1|  PREDICTED: pollen-specific protein C13-like        191   3e-58   Nicotiana tomentosiformis
ref|XP_009760524.1|  PREDICTED: pollen-specific protein C13-like        190   6e-58   Nicotiana sylvestris
ref|XP_009600627.1|  PREDICTED: major pollen allergen Lol p 11-like     186   3e-56   Nicotiana tomentosiformis
ref|XP_006366520.1|  PREDICTED: olee1-like protein-like                 186   5e-56   Solanum tuberosum [potatoes]
ref|XP_010321468.1|  PREDICTED: LOW QUALITY PROTEIN: major pollen...    185   6e-56   
ref|XP_009797814.1|  PREDICTED: major pollen allergen Lol p 11-like     185   9e-56   Nicotiana sylvestris
ref|XP_004237415.1|  PREDICTED: pollen-specific protein C13             184   2e-55   Solanum lycopersicum
ref|XP_009764546.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          183   3e-55   Nicotiana sylvestris
ref|XP_006344595.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          181   3e-54   Solanum tuberosum [potatoes]
ref|XP_006355373.1|  PREDICTED: pollen-specific protein C13-like        177   1e-52   Solanum tuberosum [potatoes]
gb|AAF16869.1|AF109693_1  allergen-like protein BRSn20                  168   2e-49   Sambucus nigra
gb|EPS62385.1|  hypothetical protein M569_12405                         167   8e-49   Genlisea aurea
gb|EYU31033.1|  hypothetical protein MIMGU_mgv1a015328mg                164   1e-47   Erythranthe guttata [common monkey flower]
ref|XP_011097595.1|  PREDICTED: major pollen allergen Lol p 11-like     162   9e-47   Sesamum indicum [beniseed]
ref|XP_011090511.1|  PREDICTED: major pollen allergen Lol p 11-like     157   9e-45   Sesamum indicum [beniseed]
gb|EYU24008.1|  hypothetical protein MIMGU_mgv1a015363mg                147   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_009794836.1|  PREDICTED: pollen-specific protein C13-like        145   6e-41   Nicotiana sylvestris
ref|XP_002268073.1|  PREDICTED: pollen-specific protein C13             146   8e-41   Vitis vinifera
ref|XP_010261236.1|  PREDICTED: pollen-specific protein C13-like        143   2e-39   Nelumbo nucifera [Indian lotus]
gb|EPS69662.1|  hypothetical protein M569_05103                         143   2e-39   Genlisea aurea
ref|XP_002392460.1|  hypothetical protein MPER_07958                    142   3e-39   
ref|XP_004150698.1|  PREDICTED: pollen-specific protein C13-like        140   2e-38   Cucumis sativus [cucumbers]
emb|CDP01424.1|  unnamed protein product                                140   2e-38   Coffea canephora [robusta coffee]
ref|XP_010060161.1|  PREDICTED: protein DOWNSTREAM OF FLC               138   1e-37   Eucalyptus grandis [rose gum]
ref|XP_008445353.1|  PREDICTED: protein DOWNSTREAM OF FLC               138   1e-37   Cucumis melo [Oriental melon]
ref|XP_010676978.1|  PREDICTED: major pollen allergen Lol p 11-like     138   2e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003634471.1|  PREDICTED: pollen-specific protein C13             138   2e-37   Vitis vinifera
ref|XP_008348540.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          136   7e-37   Malus domestica [apple tree]
gb|ABC86745.1|  pollen-specific protein                                 135   1e-36   Vitis pseudoreticulata
ref|XP_010538956.1|  PREDICTED: major pollen allergen Lol p 11          133   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_009366359.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          133   2e-35   Pyrus x bretschneideri [bai li]
gb|AFK37732.1|  unknown                                                 132   2e-35   Lotus japonicus
ref|XP_010455288.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          132   4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002533139.1|  Pollen-specific protein C13 precursor, putative    131   6e-35   Ricinus communis
ref|XP_008245042.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          131   8e-35   Prunus mume [ume]
ref|XP_010436385.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          130   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_007206364.1|  hypothetical protein PRUPE_ppa017800mg             130   1e-34   
ref|XP_004289324.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          130   2e-34   Fragaria vesca subsp. vesca
ref|XP_010269200.1|  PREDICTED: pollen-specific protein C13-like        130   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_010090546.1|  hypothetical protein L484_016596                   130   3e-34   
gb|AFK47744.1|  unknown                                                 129   5e-34   Lotus japonicus
ref|XP_008234688.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          128   9e-34   Prunus mume [ume]
ref|XP_002513885.1|  Pollen-specific protein C13 precursor, putative    128   9e-34   Ricinus communis
ref|XP_006289520.1|  hypothetical protein CARUB_v10003061mg             128   1e-33   Capsella rubella
emb|CDY12288.1|  BnaA09g24880D                                          127   3e-33   Brassica napus [oilseed rape]
ref|XP_009134109.1|  PREDICTED: pollen-specific protein C13             127   4e-33   Brassica rapa
ref|XP_002307393.1|  pollen Ole e 1 allergen and extensin family ...    126   5e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006857531.1|  hypothetical protein AMTR_s00061p00032820          125   1e-32   Amborella trichopoda
ref|XP_002310579.1|  hypothetical protein POPTR_0007s05750g             125   1e-32   
gb|ABK94215.1|  unknown                                                 125   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002301038.1|  pollen Ole e 1 allergen and extensin family ...    125   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011016068.1|  PREDICTED: pollen-specific protein C13-like        124   3e-32   Populus euphratica
gb|KDP32694.1|  hypothetical protein JCGZ_11986                         124   3e-32   Jatropha curcas
ref|XP_011006159.1|  PREDICTED: pollen-specific protein C13-like        124   3e-32   Populus euphratica
emb|CDY05022.1|  BnaC03g28200D                                          124   4e-32   
gb|KJB59946.1|  hypothetical protein B456_009G282200                    124   5e-32   Gossypium raimondii
ref|NP_567338.1|  protein SAH7                                          123   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008797140.1|  PREDICTED: major pollen allergen Lol p 11-like     124   7e-32   Phoenix dactylifera
gb|KDP46869.1|  hypothetical protein JCGZ_24078                         122   1e-31   Jatropha curcas
gb|KFK32118.1|  hypothetical protein AALP_AA6G200700                    122   2e-31   Arabis alpina [alpine rockcress]
gb|ABK92993.1|  unknown                                                 122   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010105888.1|  hypothetical protein L484_021545                   122   3e-31   
ref|XP_008234009.1|  PREDICTED: pollen-specific protein C13             121   4e-31   Prunus mume [ume]
gb|KDO80906.1|  hypothetical protein CISIN_1g031458mg                   121   4e-31   Citrus sinensis [apfelsine]
ref|XP_006472638.1|  PREDICTED: pollen-specific protein C13-like        121   5e-31   Citrus sinensis [apfelsine]
ref|XP_006434027.1|  hypothetical protein CICLE_v10002743mg             121   5e-31   Citrus clementina [clementine]
ref|XP_006397273.1|  hypothetical protein EUTSA_v10029031mg             121   6e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010424432.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          123   1e-30   
ref|XP_006464247.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          120   2e-30   
ref|XP_002872410.1|  hypothetical protein ARALYDRAFT_489767             119   2e-30   
ref|XP_007018845.1|  Pollen-specific protein C13, putative              119   3e-30   
ref|NP_001238723.1|  uncharacterized protein LOC100499710 precursor     119   3e-30   Glycine max [soybeans]
ref|XP_006302909.1|  hypothetical protein CARUB_v10021044mg             119   4e-30   Capsella rubella
gb|KHN19737.1|  Pollen-specific protein C13                             119   4e-30   Glycine soja [wild soybean]
gb|AAT08700.1|  pollen-specific protein                                 119   4e-30   Hyacinthus orientalis [common hyacinth]
ref|XP_007225977.1|  hypothetical protein PRUPE_ppa012675mg             118   5e-30   Prunus persica
ref|XP_009421183.1|  PREDICTED: pollen-specific protein C13-like        118   7e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007136225.1|  hypothetical protein PHAVU_009G028900g             118   8e-30   Phaseolus vulgaris [French bean]
ref|XP_009403224.1|  PREDICTED: pollen-specific protein C13-like        117   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408781.1|  PREDICTED: pollen-specific protein C13-like        116   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006390031.1|  hypothetical protein EUTSA_v10019236mg             116   4e-29   Eutrema salsugineum [saltwater cress]
ref|XP_004500607.1|  PREDICTED: pollen-specific protein C13-like        116   6e-29   Cicer arietinum [garbanzo]
gb|AAM08621.1|AC107314_12  Putative Pollen specific protein C13 p...    116   6e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652233.1|  PREDICTED: pollen-specific protein C13-like        115   7e-29   
ref|XP_002307104.1|  hypothetical protein POPTR_0005s08000g             115   8e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011030966.1|  PREDICTED: protein DOWNSTREAM OF FLC               115   9e-29   Populus euphratica
ref|XP_006428158.1|  hypothetical protein CICLE_v10027141mg             117   1e-28   
dbj|BAJ86956.1|  predicted protein                                      115   1e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001064462.2|  Os10g0371000                                       116   1e-28   
ref|XP_003566418.1|  PREDICTED: major pollen allergen Lol p 11-like     115   1e-28   Brachypodium distachyon [annual false brome]
ref|XP_004146873.1|  PREDICTED: pollen allergen Che a 1-like            115   2e-28   
ref|XP_010527375.1|  PREDICTED: major pollen allergen Lol p 11-like     115   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_010521200.1|  PREDICTED: major pollen allergen Lol p 11          114   2e-28   Tarenaya hassleriana [spider flower]
gb|KJB29302.1|  hypothetical protein B456_005G093100                    114   2e-28   Gossypium raimondii
ref|XP_007025385.1|  Olee1-like protein                                 114   2e-28   Theobroma cacao [chocolate]
ref|XP_010535648.1|  PREDICTED: major pollen allergen Lol p 11-like     114   2e-28   Tarenaya hassleriana [spider flower]
gb|EMS52933.1|  hypothetical protein TRIUR3_31283                       114   3e-28   Triticum urartu
ref|XP_010942359.1|  PREDICTED: major pollen allergen Lol p 11-like     114   4e-28   Elaeis guineensis
gb|ACQ44229.1|  putative pollen Ole e 1 allergen and extensin fam...    114   4e-28   Arabis alpina [alpine rockcress]
ref|XP_004971474.1|  PREDICTED: pollen allergen Phl p 11-like           114   4e-28   Setaria italica
ref|XP_008782123.1|  PREDICTED: pollen-specific protein C13-like        114   5e-28   Phoenix dactylifera
ref|NP_001237189.1|  uncharacterized protein LOC100305566 precursor     113   5e-28   
ref|XP_008453801.1|  PREDICTED: major pollen allergen Lol p 11-like     113   5e-28   Cucumis melo [Oriental melon]
gb|KFK42186.1|  hypothetical protein AALP_AA2G222600                    114   5e-28   Arabis alpina [alpine rockcress]
ref|XP_009383585.1|  PREDICTED: pollen-specific protein C13-like        113   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008376286.1|  PREDICTED: pollen-specific protein C13-like        112   8e-28   
ref|XP_010942360.1|  PREDICTED: pollen allergen Phl p 11-like           113   1e-27   Elaeis guineensis
ref|XP_008378536.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          114   1e-27   
ref|XP_006661725.1|  PREDICTED: pollen-specific protein C13-like        112   2e-27   Oryza brachyantha
ref|XP_006399503.1|  hypothetical protein EUTSA_v10014875mg             111   3e-27   Eutrema salsugineum [saltwater cress]
ref|XP_009106450.1|  PREDICTED: protein DOWNSTREAM OF FLC               111   3e-27   Brassica rapa
ref|XP_010472003.1|  PREDICTED: major pollen allergen Lol p 11-like     111   3e-27   Camelina sativa [gold-of-pleasure]
emb|CDX87484.1|  BnaA07g33890D                                          111   4e-27   
ref|XP_003638771.1|  Pollen allergen Phl p                              111   4e-27   
ref|XP_010428908.1|  PREDICTED: major pollen allergen Lol p 11-like     111   4e-27   Camelina sativa [gold-of-pleasure]
emb|CDX88408.1|  BnaC06g38520D                                          111   4e-27   
gb|KHG30321.1|  Anther-specific LAT52                                   111   4e-27   Gossypium arboreum [tree cotton]
ref|XP_009409254.1|  PREDICTED: major pollen allergen Lol p 11-like     111   5e-27   
ref|XP_006601773.1|  PREDICTED: uncharacterized protein LOC100527...    110   5e-27   
ref|XP_010911793.1|  PREDICTED: pollen-specific protein C13-like        110   7e-27   Elaeis guineensis
gb|AAN76546.1|AF393475_1  LLP-B3 protein                                110   9e-27   Lilium longiflorum [Easter lily]
ref|NP_001057857.1|  Os06g0556600                                       110   9e-27   
gb|EAY93952.1|  hypothetical protein OsI_15725                          109   2e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_009396935.1|  PREDICTED: pollen-specific protein C13-like        109   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007048005.1|  Pollen-specific protein C13, putative              108   3e-26   
ref|XP_007141147.1|  hypothetical protein PHAVU_008G171500g             108   4e-26   Phaseolus vulgaris [French bean]
emb|CDY40079.1|  BnaC02g00510D                                          108   4e-26   Brassica napus [oilseed rape]
ref|XP_010416770.1|  PREDICTED: major pollen allergen Lol p 11-like     108   5e-26   Camelina sativa [gold-of-pleasure]
emb|CAH66537.1|  H0209H04.4                                             108   5e-26   Oryza sativa [red rice]
emb|CDX85777.1|  BnaA02g00360D                                          108   5e-26   
ref|XP_009125327.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          108   5e-26   Brassica rapa
ref|NP_001052674.1|  Os04g0398700                                       108   6e-26   
ref|XP_008803750.1|  PREDICTED: pollen-specific protein C13             108   9e-26   Phoenix dactylifera
gb|KCW69946.1|  hypothetical protein EUGRSUZ_F03264                     107   1e-25   Eucalyptus grandis [rose gum]
gb|AAM78186.1|  putative SAH7 protein                                   105   2e-25   Gossypium raimondii
ref|NP_177927.1|  pollen Ole e 1 allergen and extensin family pro...    107   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004143635.1|  PREDICTED: olee1-like protein-like                 106   3e-25   Cucumis sativus [cucumbers]
ref|XP_006645671.1|  PREDICTED: pollen allergen Phl p 11-like           106   3e-25   Oryza brachyantha
ref|XP_010062811.1|  PREDICTED: olee1-like protein                      107   3e-25   
gb|AAZ67595.1|  80A08_10                                                106   3e-25   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_004975466.1|  PREDICTED: pollen-specific protein C13-like        106   3e-25   Setaria italica
ref|XP_009122085.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          106   3e-25   
ref|NP_196575.1|  pollen_Ole_e_I-domain containing protein              105   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873440.1|  pollen ole e 1 allergen and extensin family ...    105   6e-25   
ref|XP_009402012.1|  PREDICTED: pollen-specific protein C13-like        105   7e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010277041.1|  PREDICTED: anther-specific protein LAT52           105   7e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008467237.1|  PREDICTED: olee1-like protein                      105   8e-25   Cucumis melo [Oriental melon]
ref|XP_010547621.1|  PREDICTED: protein DOWNSTREAM OF FLC               105   1e-24   Tarenaya hassleriana [spider flower]
sp|O49813.1|OLEE1_BETPN  RecName: Full=Olee1-like protein; Flags:...    104   1e-24   Betula pendula [white birch]
ref|XP_010491667.1|  PREDICTED: protein DOWNSTREAM OF FLC               104   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009386950.1|  PREDICTED: pollen-specific protein C13-like        104   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010453035.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          104   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010422886.1|  PREDICTED: protein DOWNSTREAM OF FLC               104   2e-24   Camelina sativa [gold-of-pleasure]
gb|ACK44512.1|  AT5G10130-like protein                                  105   2e-24   Arabidopsis arenosa
dbj|BAK06698.1|  predicted protein                                      104   2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010057097.1|  PREDICTED: olee1-like protein                      104   2e-24   Eucalyptus grandis [rose gum]
ref|XP_006288804.1|  hypothetical protein CARUB_v10002136mg             104   2e-24   
ref|XP_010025486.1|  PREDICTED: protein DOWNSTREAM OF FLC               104   2e-24   Eucalyptus grandis [rose gum]
ref|XP_011006522.1|  PREDICTED: olee1-like protein                      104   2e-24   Populus euphratica
ref|XP_004983223.1|  PREDICTED: pollen-specific protein C13-like        104   2e-24   Setaria italica
gb|AAM78187.1|  putative SAH7 protein                                   102   2e-24   Gossypium barbadense [Egyptian cotton]
ref|XP_010478273.1|  PREDICTED: pollen-specific protein-like At4g...    104   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010499433.1|  PREDICTED: pollen-specific protein-like At4g...    104   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010460686.1|  PREDICTED: pollen-specific protein-like At4g...    103   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006370166.1|  pollen Ole e 1 allergen and extensin family ...    103   3e-24   Populus trichocarpa [western balsam poplar]
ref|XP_003581152.1|  PREDICTED: pollen-specific protein C13-like        103   3e-24   Brachypodium distachyon [annual false brome]
ref|XP_004502439.1|  PREDICTED: pollen-specific protein C13-like        103   4e-24   Cicer arietinum [garbanzo]
ref|XP_002523378.1|  Anther-specific protein LAT52 precursor, put...    103   4e-24   Ricinus communis
ref|XP_010916905.1|  PREDICTED: pollen-specific protein C13-like        103   4e-24   Elaeis guineensis
ref|XP_003573867.1|  PREDICTED: pollen-specific protein C13             103   6e-24   Brachypodium distachyon [annual false brome]
gb|ACG32277.1|  pollen-specific protein C13 precursor                   103   6e-24   Zea mays [maize]
ref|NP_001146979.1|  LOC100280588 precursor                             103   7e-24   Zea mays [maize]
dbj|BAK07321.1|  predicted protein                                      102   8e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAM78188.1|  putative SAH7 protein                                   101   1e-23   Gossypium barbadense [Egyptian cotton]
emb|CDY43319.1|  BnaC03g58910D                                          102   1e-23   Brassica napus [oilseed rape]
ref|XP_011029563.1|  PREDICTED: olee1-like protein                      102   1e-23   Populus euphratica
ref|XP_002887714.1|  pollen ole e 1 allergen and extensin family ...    101   1e-23   Arabidopsis lyrata subsp. lyrata
gb|AFO38383.1|  putative pollen-specific protein C13                    102   1e-23   Glycine max [soybeans]
gb|AAM78185.1|  putative SAH7 protein                                   100   1e-23   Gossypium herbaceum [Arabian cotton]
ref|XP_002889170.1|  pollen ole e 1 allergen and extensin family ...    102   2e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_011070069.1|  PREDICTED: anther-specific protein LAT52-like      101   2e-23   Sesamum indicum [beniseed]
gb|AAN60344.1|  unknown                                                 100   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002316866.1|  pollen Ole e 1 allergen and extensin family ...    101   3e-23   Populus trichocarpa [western balsam poplar]
ref|NP_001148443.1|  pollen allergen Phl p 11 precursor                 101   3e-23   Zea mays [maize]
ref|XP_002454899.1|  hypothetical protein SORBIDRAFT_03g001020          100   4e-23   Sorghum bicolor [broomcorn]
gb|ADI55168.1|  AS1                                                     101   4e-23   Gossypium hirsutum [American cotton]
ref|XP_003543768.1|  PREDICTED: protein DOWNSTREAM OF FLC-like          100   4e-23   Glycine max [soybeans]
ref|XP_004960638.1|  PREDICTED: pollen allergen Phl p 11-like           100   4e-23   Setaria italica
ref|XP_008439743.1|  PREDICTED: olee1-like protein isoform X2           100   4e-23   Cucumis melo [Oriental melon]
ref|XP_008439742.1|  PREDICTED: olee1-like protein isoform X1           100   5e-23   Cucumis melo [Oriental melon]
gb|KFK44745.1|  hypothetical protein AALP_AA1G297400                    100   5e-23   Arabis alpina [alpine rockcress]
ref|XP_009109686.1|  PREDICTED: pollen-specific protein-like At4g...    100   5e-23   Brassica rapa
ref|XP_006664913.1|  PREDICTED: pollen allergen Phl p 11-like           100   6e-23   Oryza brachyantha
ref|NP_174209.1|  pollen Ole e 1 allergen and extensin family pro...    100   6e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAM78189.1|  putative SAH7 protein                                 99.0    8e-23   Gossypioides kirkii
gb|AEW90946.1|  pollen-specific protein F8-4                            100   8e-23   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
gb|KJB61584.1|  hypothetical protein B456_009G368100                    100   1e-22   Gossypium raimondii
ref|XP_004134927.1|  PREDICTED: olee1-like protein-like               99.8    1e-22   Cucumis sativus [cucumbers]
gb|EMT13715.1|  Pollen allergen Phl p 11                              99.8    1e-22   
gb|AAF17689.1|AC009243_16  F28K19.26                                    105   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002489221.1|  hypothetical protein SORBIDRAFT_0012s014630      99.4    2e-22   Sorghum bicolor [broomcorn]
ref|XP_011098227.1|  PREDICTED: anther-specific protein LAT52-like    99.0    2e-22   Sesamum indicum [beniseed]
emb|CDY21637.1|  BnaC09g46550D                                        99.4    2e-22   Brassica napus [oilseed rape]
ref|XP_003601984.1|  Pollen-specific protein C13                      99.0    2e-22   Medicago truncatula
sp|Q8LGR0.1|CHE1_CHEAL  RecName: Full=Pollen allergen Che a 1; Al...  99.0    2e-22   Chenopodium album [lamb's-quarters]
gb|KHG10520.1|  Olee1-like protein                                    99.0    3e-22   Gossypium arboreum [tree cotton]
ref|XP_007021723.1|  Pollen Ole e 1 allergen and extensin family ...  98.6    3e-22   Theobroma cacao [chocolate]
gb|EYU45018.1|  hypothetical protein MIMGU_mgv1a015317mg              98.2    4e-22   Erythranthe guttata [common monkey flower]
ref|XP_004134662.1|  PREDICTED: olee1-like protein-like               98.2    5e-22   
ref|NP_001131377.1|  uncharacterized protein LOC100192702 precursor   98.2    5e-22   Zea mays [maize]
gb|AEW90940.1|  group 11 grass pollen allergen F7-1                   98.2    5e-22   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
gb|AAX93750.1|  pollen allergen Cro s 1                               97.8    5e-22   Crocus sativus [saffron crocus]
gb|KHG12773.1|  Olee1-like protein                                    98.6    5e-22   Gossypium arboreum [tree cotton]
ref|XP_004251892.1|  PREDICTED: anther-specific protein LAT52-like    97.8    6e-22   Solanum lycopersicum
emb|CDY21640.1|  BnaC09g46520D                                        97.1    7e-22   Brassica napus [oilseed rape]
gb|AFW77548.1|  pollen allergen Phl p 11                              97.4    8e-22   
emb|CDX99789.1|  BnaC05g22110D                                        97.4    9e-22   
gb|KHG13789.1|  Anther-specific LAT52                                 97.8    9e-22   Gossypium arboreum [tree cotton]
ref|XP_004959259.1|  PREDICTED: pollen-specific protein C13-like      97.1    1e-21   
gb|AFK46977.1|  unknown                                               97.1    1e-21   Lotus japonicus
gb|AEW90948.1|  pollen-specific protein F8-6                          97.1    1e-21   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_008450951.1|  PREDICTED: olee1-like protein                    96.7    1e-21   Cucumis melo [Oriental melon]
gb|KGN49303.1|  hypothetical protein Csa_6G519560                     97.1    1e-21   Cucumis sativus [cucumbers]
gb|AFK47865.1|  unknown                                               96.7    1e-21   Lotus japonicus
ref|XP_003565925.1|  PREDICTED: pollen allergen Phl p 11              96.7    2e-21   Brachypodium distachyon [annual false brome]
gb|KHN44330.1|  Pollen-specific protein C13                           95.5    2e-21   Glycine soja [wild soybean]
ref|XP_004248244.1|  PREDICTED: anther-specific protein LAT52         96.3    2e-21   
gb|KDP32532.1|  hypothetical protein JCGZ_14735                       96.7    2e-21   Jatropha curcas
ref|XP_004144129.1|  PREDICTED: olee1-like protein-like               96.3    2e-21   Cucumis sativus [cucumbers]
ref|XP_006304746.1|  hypothetical protein CARUB_v10012122mg           96.3    2e-21   Capsella rubella
ref|XP_008343344.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  95.1    2e-21   
gb|AEW90941.1|  group 11 grass pollen allergen F7-4                   96.3    2e-21   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|NP_001150330.1|  pollen allergen Phl p 11 precursor               96.3    2e-21   Zea mays [maize]
ref|XP_010103032.1|  hypothetical protein L484_005787                 96.3    2e-21   Morus notabilis
gb|AEW90942.1|  group 11 grass pollen allergen F7-6                   96.3    2e-21   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_009115274.1|  PREDICTED: pollen-specific protein-like At4g...  95.9    3e-21   Brassica rapa
gb|AEW90943.1|  group 11 grass pollen allergen F8-6                   95.9    3e-21   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_009617824.1|  PREDICTED: olee1-like protein                    95.5    5e-21   Nicotiana tomentosiformis
ref|XP_003541705.1|  PREDICTED: olee1-like protein-like               95.1    7e-21   Glycine max [soybeans]
emb|CAA78897.1|  pollen specific gene                                 94.7    7e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_009794171.1|  PREDICTED: anther-specific protein LAT52         94.7    7e-21   Nicotiana sylvestris
gb|EAZ45758.1|  hypothetical protein OsJ_30442                        94.4    1e-20   Oryza sativa Japonica Group [Japonica rice]
gb|ADK22842.1|  Sal k 5                                               94.4    1e-20   Kali turgidum [common saltwort]
ref|XP_009604804.1|  PREDICTED: anther-specific protein LAT52         94.4    1e-20   Nicotiana tomentosiformis
ref|XP_002522577.1|  Pollen allergen Che a 1 precursor, putative      94.4    1e-20   Ricinus communis
ref|XP_003546028.1|  PREDICTED: olee1-like protein-like               94.0    1e-20   Glycine max [soybeans]
dbj|BAD46623.1|  putative Pollen specific protein C13 precursor       94.0    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|EEC85106.1|  hypothetical protein OsI_32490                        94.0    2e-20   Oryza sativa Indica Group [Indian rice]
ref|NP_001064001.1|  Os09g0572800                                     94.0    2e-20   
ref|XP_010941451.1|  PREDICTED: pollen-specific protein C13-like      94.0    2e-20   Elaeis guineensis
gb|KJB61585.1|  hypothetical protein B456_009G368200                  94.0    2e-20   Gossypium raimondii
ref|XP_010686203.1|  PREDICTED: pollen allergen Che a 1               93.6    2e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002447728.1|  hypothetical protein SORBIDRAFT_06g014740        93.6    2e-20   Sorghum bicolor [broomcorn]
gb|ACG33223.1|  pollen-specific protein C13 precursor                 93.6    3e-20   Zea mays [maize]
gb|ACU23617.1|  unknown                                               93.6    3e-20   Glycine max [soybeans]
emb|CDY69202.1|  BnaCnng62360D                                        93.6    3e-20   Brassica napus [oilseed rape]
ref|XP_004485892.1|  PREDICTED: olee1-like protein-like               93.2    3e-20   Cicer arietinum [garbanzo]
ref|XP_002459879.1|  hypothetical protein SORBIDRAFT_02g012930        93.6    3e-20   
ref|XP_009102877.1|  PREDICTED: pollen-specific protein-like At4g...  93.2    3e-20   Brassica rapa
ref|XP_006415610.1|  hypothetical protein EUTSA_v10008921mg           93.2    3e-20   Eutrema salsugineum [saltwater cress]
gb|ACF82695.1|  unknown                                               93.2    3e-20   Zea mays [maize]
ref|XP_006360048.1|  PREDICTED: anther-specific protein LAT52-like    93.2    3e-20   Solanum tuberosum [potatoes]
sp|Q8H6L7.1|PHLB_PHLPR  RecName: Full=Pollen allergen Phl p 11; A...  92.4    4e-20   Phleum pratense [timothy]
gb|AFB73932.1|  LAT52-like protein                                    92.8    4e-20   Lycium barbarum [Duke of Argyll's teatree]
gb|AFB73931.1|  LAT52-like protein                                    92.8    4e-20   Lycium barbarum [Duke of Argyll's teatree]
emb|CDY14639.1|  BnaC02g24740D                                        92.0    5e-20   Brassica napus [oilseed rape]
ref|XP_010680579.1|  PREDICTED: major pollen allergen Lol p 11-like   92.0    7e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009778120.1|  PREDICTED: anther-specific protein LAT52-like    92.0    8e-20   Nicotiana sylvestris
ref|XP_006661014.1|  PREDICTED: pollen-specific protein C13-like      92.0    9e-20   Oryza brachyantha
ref|XP_010540511.1|  PREDICTED: pollen-specific protein-like At4g...  92.0    1e-19   Tarenaya hassleriana [spider flower]
gb|ACJ83911.1|  unknown                                               91.7    1e-19   Medicago truncatula
ref|XP_010518802.1|  PREDICTED: pollen-specific protein-like At4g...  91.7    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_007148052.1|  hypothetical protein PHAVU_006G176500g           91.7    1e-19   Phaseolus vulgaris [French bean]
ref|XP_009773994.1|  PREDICTED: olee1-like protein                    91.7    2e-19   Nicotiana sylvestris
ref|XP_006358942.1|  PREDICTED: anther-specific protein LAT52-like    90.9    2e-19   Solanum tuberosum [potatoes]
ref|XP_008775180.1|  PREDICTED: pollen-specific protein C13-like      90.9    2e-19   
ref|NP_001148343.1|  LOC100281953 precursor                           90.9    3e-19   
ref|XP_011079002.1|  PREDICTED: olee1-like protein                    90.5    3e-19   Sesamum indicum [beniseed]
sp|Q7M1X5.1|LOLB_LOLPR  RecName: Full=Major pollen allergen Lol p...  89.4    4e-19   Lolium perenne [perennial ryegrass]
ref|XP_008381078.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        89.7    4e-19   
ref|XP_002890794.1|  hypothetical protein ARALYDRAFT_336019           94.7    4e-19   
ref|XP_011075462.1|  PREDICTED: olee1-like protein                    90.1    5e-19   
gb|EYU43331.1|  hypothetical protein MIMGU_mgv1a014984mg              90.1    5e-19   
ref|XP_010549400.1|  PREDICTED: pollen-specific protein-like At4g...  89.7    7e-19   
ref|NP_001105351.1|  pollen-specific protein C13 precursor            89.4    8e-19   
ref|XP_009602640.1|  PREDICTED: anther-specific protein LAT52-like    89.4    9e-19   
ref|XP_006414083.1|  hypothetical protein EUTSA_v10026398mg           89.4    1e-18   
emb|CDP06002.1|  unnamed protein product                              88.6    1e-18   
gb|KFK31513.1|  hypothetical protein AALP_AA6G122400                  89.0    1e-18   
ref|XP_010441660.1|  PREDICTED: pollen-specific protein-like At4g...  89.0    2e-18   
ref|XP_006398273.1|  hypothetical protein EUTSA_v10001051mg           89.0    2e-18   
emb|CDX87759.1|  BnaC02g31900D                                        88.6    2e-18   
ref|XP_009128814.1|  PREDICTED: pollen-specific protein-like At4g...  88.6    2e-18   
gb|KHG25858.1|  Olee1-like protein                                    88.6    2e-18   
ref|XP_010481521.1|  PREDICTED: pollen-specific protein-like At4g...  88.6    2e-18   
ref|XP_010538209.1|  PREDICTED: pollen-specific protein-like At4g...  88.6    2e-18   
ref|XP_011101379.1|  PREDICTED: olee1-like protein                    88.6    2e-18   
emb|CDP16230.1|  unnamed protein product                              88.2    2e-18   
emb|CDX77620.1|  BnaC07g18740D                                        88.6    2e-18   
ref|XP_002863445.1|  hypothetical protein ARALYDRAFT_494394           88.6    2e-18   
dbj|BAB09316.1|  Ole e I (main olive allergen)-like protein           88.2    2e-18   
ref|XP_011080816.1|  PREDICTED: major pollen allergen Ole e 1-like    88.2    2e-18   
ref|XP_010529196.1|  PREDICTED: pollen-specific protein-like At4g...  88.2    2e-18   
ref|XP_011075627.1|  PREDICTED: olee1-like protein                    87.8    3e-18   
ref|NP_568650.1|  pollen_Ole_e_I-domain containing protein            88.2    3e-18   
gb|KJB27014.1|  hypothetical protein B456_004G272200                  87.8    3e-18   
ref|XP_006838264.1|  hypothetical protein AMTR_s00103p00069180        87.0    3e-18   
gb|AEW90945.1|  group 11 grass pollen allergen R1-2                   87.8    3e-18   
gb|KFK28529.1|  hypothetical protein AALP_AA7G008600                  87.8    4e-18   
ref|XP_011085997.1|  PREDICTED: olee1-like protein                    87.4    4e-18   
gb|EYU26327.1|  hypothetical protein MIMGU_mgv1a015422mg              87.0    5e-18   
ref|XP_006348395.1|  PREDICTED: anther-specific protein LAT52-like    87.4    5e-18   
emb|CDY01556.1|  BnaC07g35460D                                        87.4    5e-18   
ref|XP_010494740.1|  PREDICTED: pollen-specific protein-like At4g...  87.4    6e-18   
ref|XP_009761932.1|  PREDICTED: anther-specific protein LAT52-like    87.0    6e-18   
ref|XP_002273294.1|  PREDICTED: olee1-like protein                    87.0    7e-18   
ref|XP_002440811.1|  hypothetical protein SORBIDRAFT_09g007260        87.0    7e-18   
gb|KJB48905.1|  hypothetical protein B456_008G104000                  86.7    8e-18   
ref|XP_009136942.1|  PREDICTED: pollen-specific protein-like At4g...  86.7    8e-18   
ref|XP_009132011.1|  PREDICTED: pollen-specific protein-like At4g...  85.9    2e-17   
ref|XP_010496255.1|  PREDICTED: pollen-specific protein-like At4g...  85.9    2e-17   
emb|CDP16229.1|  unnamed protein product                              85.5    2e-17   
ref|XP_009101556.1|  PREDICTED: pollen-specific protein-like At4g...  85.9    2e-17   
ref|XP_010439832.1|  PREDICTED: pollen-specific protein-like At4g...  85.5    2e-17   
ref|XP_004244268.1|  PREDICTED: anther-specific protein LAT52-like    85.5    2e-17   
ref|NP_567562.1|  pollen Ole e 1 allergen and extensin family pro...  85.1    3e-17   
ref|XP_011460779.1|  PREDICTED: olee1-like protein                    85.1    4e-17   
emb|CDX99452.1|  BnaC01g11000D                                        84.7    4e-17   
ref|XP_009759546.1|  PREDICTED: olee1-like protein                    84.3    6e-17   
gb|AAM65838.1|  Ole e I (main olive allergen)-like protein            84.3    6e-17   
ref|XP_002870034.1|  pollen ole e 1 allergen and extensin family ...  84.3    7e-17   
ref|XP_009598969.1|  PREDICTED: anther-specific protein LAT52-like    84.0    7e-17   
ref|XP_009608960.1|  PREDICTED: olee1-like protein                    84.0    8e-17   
ref|XP_006281481.1|  hypothetical protein CARUB_v10027565mg           84.0    9e-17   
ref|XP_010434511.1|  PREDICTED: pollen-specific protein-like At4g...  84.0    1e-16   
ref|XP_009108374.1|  PREDICTED: pollen-specific protein-like At4g...  83.6    1e-16   
ref|XP_004299638.1|  PREDICTED: pollen allergen Phl p 11-like         82.0    1e-16   
emb|CDY52214.1|  BnaAnng11370D                                        83.2    2e-16   
ref|XP_009114385.1|  PREDICTED: pollen-specific protein-like At4g...  83.2    2e-16   
gb|KJB13197.1|  hypothetical protein B456_002G061500                  83.2    2e-16   
emb|CDY65576.1|  BnaC09g52000D                                        82.8    3e-16   
ref|XP_011101449.1|  PREDICTED: olee1-like protein                    82.4    3e-16   
ref|XP_010906302.1|  PREDICTED: pollen-specific protein C13-like      81.3    4e-16   
gb|EMT21854.1|  hypothetical protein F775_27590                       81.6    4e-16   
gb|KDO56621.1|  hypothetical protein CISIN_1g041753mg                 80.5    5e-16   
ref|XP_006284941.1|  hypothetical protein CARUB_v10006240mg           81.3    8e-16   
ref|XP_008343324.1|  PREDICTED: olee1-like protein                    79.7    1e-15   
ref|XP_007212169.1|  hypothetical protein PRUPE_ppa012463mg           80.9    1e-15   
emb|CAA16739.1|  pollen-specific protein - like                       84.7    2e-15   
emb|CAA73037.1|  Ole e 1.0103 protein                                 79.3    2e-15   
gb|EPS70684.1|  hypothetical protein M569_04073                       79.7    3e-15   
gb|AAO41983.1|  unknown protein                                       78.6    3e-15   
ref|XP_007149397.1|  hypothetical protein PHAVU_005G066800g           79.3    3e-15   
pir||G53806  major allergen OLE26 - common olive (fragment)           79.0    4e-15
ref|XP_007153183.1|  hypothetical protein PHAVU_003G013900g           79.3    4e-15   
pir||S43242  allergen-like protein Syr v I isoform 1 - Syringa vu...  78.2    8e-15
ref|XP_004293940.1|  PREDICTED: olee1-like protein                    77.4    2e-14   
gb|KHG18492.1|  Anther-specific LAT52                                 77.0    2e-14   
gb|ABP58634.1|  major pollen allergen Ole e 1                         76.3    3e-14   
gb|AFK42345.1|  unknown                                               77.0    3e-14   
ref|XP_004233077.1|  PREDICTED: major pollen allergen Lig v 1-like    77.0    3e-14   
ref|XP_007149396.1|  hypothetical protein PHAVU_005G066700g           76.6    4e-14   
pir||E53806  major allergen OLE17 - common olive (fragment)           75.9    4e-14
pir||S43243  allergen-like protein Syr v I isoform 2 - Syringa vu...  75.9    4e-14
ref|XP_008371469.1|  PREDICTED: olee1-like protein                    76.3    5e-14   
gb|ABP58636.1|  major pollen allergen Ole e 1                         75.9    5e-14   
ref|XP_009348994.1|  PREDICTED: olee1-like protein                    76.3    5e-14   
gb|ABP58633.1|  major pollen allergen Ole e 1                         75.9    5e-14   
ref|NP_001237949.1|  uncharacterized protein LOC100527053             74.7    6e-14   
gb|EMS61378.1|  Pollen-specific protein C13                           75.5    6e-14   
gb|AAV74343.1|  Fra e 1.0102 major allergen                           75.5    8e-14   
gb|AFW82075.1|  hypothetical protein ZEAMMB73_949741                  74.3    8e-14   
pir||B53806  major allergen OLE5c - common olive                      75.1    8e-14
pir||F53806  major allergen OLE19 - common olive (fragment)           75.1    9e-14
gb|AEK85661.1|  major pollen allergen Ole e1                          74.7    1e-13   
emb|CAA73036.1|  Ole e 1 protein                                      74.7    1e-13   
gb|ABP58635.1|  major pollen allergen Ole e 1                         74.7    1e-13   
emb|CAA73038.1|  Ole e 1.0102 protein                                 74.7    1e-13   
gb|ABP58632.1|  major pollen allergen Ole e 1                         74.7    1e-13   
sp|P19963.2|ALL1_OLEEU  RecName: Full=Major pollen allergen Ole e...  74.7    1e-13   
gb|AAQ08947.1|  allergen Fra e 1.0101                                 74.7    1e-13   
ref|XP_007213539.1|  hypothetical protein PRUPE_ppa019680mg           75.1    1e-13   
gb|AEK85659.1|  major pollen allergen Ole e1                          74.3    1e-13   
gb|AEK85660.1|  major pollen allergen Ole e1                          74.3    1e-13   
ref|XP_009352776.1|  PREDICTED: olee1-like protein                    74.7    2e-13   
ref|XP_011460781.1|  PREDICTED: anther-specific protein LAT52-like    74.3    2e-13   
ref|XP_009342278.1|  PREDICTED: olee1-like protein                    74.3    2e-13   
gb|AAN18042.1|  major pollen allergen Ole e 1                         73.9    2e-13   
gb|AEK85663.1|  major pollen allergen Ole e1                          73.9    2e-13   
gb|KHN36879.1|  Olee1-like protein                                    74.3    2e-13   
gb|EPS72638.1|  hypothetical protein M569_02120                       73.9    3e-13   
pir||S43244  allergen-like protein Syr v I isoform 3 - Syringa vu...  73.6    4e-13
pir||C53806  major allergen OLE1c - common olive (fragment)           73.2    4e-13
gb|EMS67079.1|  hypothetical protein TRIUR3_25214                     72.4    4e-13   
ref|XP_009334049.1|  PREDICTED: olee1-like protein                    73.2    6e-13   
emb|CAA54819.1|  major allergen                                       72.8    6e-13   
gb|KDP21093.1|  hypothetical protein JCGZ_21564                       73.6    7e-13   
gb|EAZ04544.1|  hypothetical protein OsI_26693                        72.8    7e-13   
ref|XP_008383629.1|  PREDICTED: olee1-like protein                    73.2    7e-13   
ref|NP_001235303.1|  uncharacterized protein LOC100306199 precursor   72.8    7e-13   
gb|AAB32652.2|  main olive allergen                                   72.0    1e-12   
gb|AAQ10277.1|  major pollen allergen Ole e 1                         71.6    1e-12   
sp|O82015.2|LIGV1_LIGVU  RecName: Full=Major pollen allergen Lig ...  71.6    2e-12   
gb|AAQ10269.1|  major pollen allergen Ole e 1                         70.9    2e-12   
gb|AAQ07442.1|  major pollen allergen Ole e 1                         70.9    2e-12   
gb|AAQ10267.1|  major pollen allergen Ole e 1                         70.9    2e-12   
gb|AEK85658.1|  major pollen allergen Ole e1                          70.5    3e-12   
gb|AEK85662.1|  major pollen allergen Ole e1                          70.5    4e-12   
ref|XP_007153182.1|  hypothetical protein PHAVU_003G013800g           70.9    4e-12   
ref|XP_008226528.1|  PREDICTED: olee1-like protein                    70.9    4e-12   
ref|XP_008363638.1|  PREDICTED: olee1-like protein                    70.5    5e-12   
gb|AAQ10273.1|  major pollen allergen Ole e 1                         69.7    6e-12   
ref|XP_010317514.1|  PREDICTED: olee1-like protein                    69.3    6e-12   
ref|XP_008357485.1|  PREDICTED: uncharacterized protein LOC103421237  71.2    7e-12   
ref|XP_006442530.1|  hypothetical protein CICLE_v10024378mg           70.1    7e-12   
gb|EAZ40496.1|  hypothetical protein OsJ_24951                        70.1    7e-12   
ref|XP_004489034.1|  PREDICTED: olee1-like protein-like               70.1    7e-12   
pir||I53806  major allergen OLE16 - common olive (fragment)           69.3    1e-11
ref|XP_008225283.1|  PREDICTED: olee1-like protein                    69.7    1e-11   
ref|NP_001175282.1|  Os07g0590500                                     69.7    1e-11   
gb|AAQ08188.1|  major pollen allergen Ole e 1                         68.9    1e-11   
ref|XP_008359333.1|  PREDICTED: olee1-like protein                    69.3    1e-11   
gb|KEH38612.1|  pollen Ole e I family allergen                        68.9    2e-11   
gb|AAO22132.1|  major pollen allergen Ole e 1                         68.2    2e-11   
gb|ADM76637.1|  extensin-like protein                                 68.6    2e-11   
pir||H53806  major allergen OLE6 - common olive (fragment)            68.2    2e-11
ref|XP_009340070.1|  PREDICTED: olee1-like protein                    68.6    3e-11   
ref|XP_009413179.1|  PREDICTED: pollen-specific protein C13-like      67.4    3e-11   
gb|AAQ83588.1|  allergen Fra e 1                                      67.8    3e-11   
gb|AAQ10274.1|  major pollen allergen Ole e 1                         67.4    5e-11   
gb|ACJ86286.1|  unknown                                               67.4    6e-11   
gb|ACJ86288.1|  unknown                                               67.4    6e-11   
gb|AAQ10272.1|  major pollen allergen Ole e 1                         66.6    8e-11   
ref|XP_011078225.1|  PREDICTED: pollen allergen Che a 1-like          67.0    8e-11   
ref|XP_011101376.1|  PREDICTED: pollen allergen Che a 1-like isof...  67.0    1e-10   
gb|ABK22573.1|  unknown                                               66.2    1e-10   
gb|ABK21930.1|  unknown                                               66.2    1e-10   
pir||A38968  major allergen OLE20 - common olive (fragment)           65.9    2e-10
gb|KEH38613.1|  pollen Ole e I family allergen                        66.2    2e-10   
gb|ADM76653.1|  extensin-like protein                                 65.9    2e-10   
gb|ADM76665.1|  extensin-like protein                                 65.5    2e-10   
ref|XP_011101377.1|  PREDICTED: olee1-like protein isoform X2         65.5    3e-10   
ref|XP_006468202.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  63.2    1e-09   
ref|XP_009147847.1|  PREDICTED: pollen-specific protein-like At4g...  62.4    2e-09   
gb|AAO22133.1|  major pollen allergen Ole e 1                         62.4    2e-09   
ref|XP_008391140.1|  PREDICTED: olee1-like protein                    62.0    2e-09   
gb|ABP58637.1|  major pollen allergen Ole e 1                         61.2    6e-09   
ref|XP_009627730.1|  PREDICTED: pollen-specific protein C13-like      58.9    2e-08   
gb|AAQ10280.1|  major pollen allergen Ole e 1                         60.1    2e-08   
gb|AAQ10279.1|  major pollen allergen Ole e 1                         59.7    2e-08   
ref|XP_011102257.1|  PREDICTED: olee1-like protein                    60.1    2e-08   
gb|AAQ10281.1|  major pollen allergen Ole e 1                         57.8    8e-08   
ref|XP_011460780.1|  PREDICTED: anther-specific protein LAT52-like    58.2    1e-07   
emb|CDO96791.1|  unnamed protein product                              54.7    1e-06   
gb|EAY97005.1|  hypothetical protein OsI_18927                        53.9    1e-06   
gb|KDO44647.1|  hypothetical protein CISIN_1g045131mg                 53.5    2e-06   
gb|AFK44177.1|  unknown                                               52.4    9e-06   
ref|XP_008240860.1|  PREDICTED: olee1-like protein                    53.1    9e-06   
ref|XP_010064896.1|  PREDICTED: pollen-specific protein-like At4g...  49.7    3e-05   
ref|XP_009789881.1|  PREDICTED: olee1-like protein                    51.2    4e-05   
gb|EEE62779.1|  hypothetical protein OsJ_17582                        48.5    2e-04   
gb|ABN50034.1|  putative Ole e 1-like protein                         47.4    2e-04   
ref|XP_003596420.1|  Pollen allergen Che a                            48.9    3e-04   
gb|EAY96999.1|  hypothetical protein OsI_18921                        47.8    3e-04   



>ref|XP_009622218.1| PREDICTED: pollen-specific protein C13-like [Nicotiana tomentosiformis]
Length=158

 Score =   191 bits (485),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PFLVKGK Y DTC CGFET ATKYL  S V++ C +R TN +TY+ + VTNSQGEY+ILV
Sbjct  23   PFLVKGKCYCDTCRCGFETEATKYLAGSKVKIECRHRVTNEITYTIDGVTNSQGEYNILV  82

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            N D GDD+CDVVLV+SSD   GKP+ GRDRARVIL+RNNG+ +DVR+ANN+GF + +PL 
Sbjct  83   NRDCGDDVCDVVLVESSDKRCGKPNGGRDRARVILTRNNGMSSDVRYANNMGFLSDEPLK  142

Query  478  SCTQVVAQYHLNDDNF  525
            SCTQ++ QY L +D +
Sbjct  143  SCTQILQQYQLTEDQY  158



>ref|XP_009760524.1| PREDICTED: pollen-specific protein C13-like [Nicotiana sylvestris]
Length=158

 Score =   190 bits (483),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PFLVKGK Y DTC CGFET ATKYL  S V++ C NR TN +TY+   VTNSQGEY+ILV
Sbjct  23   PFLVKGKCYCDTCRCGFETEATKYLAGSKVKIECRNRVTNEITYTIGGVTNSQGEYNILV  82

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D GDD+CDVVLV+SSD   GKP+ GRDRARVIL+RNNG+++DVR+ANN+GF + +PL+
Sbjct  83   DRDCGDDVCDVVLVESSDKRCGKPNGGRDRARVILTRNNGMISDVRYANNMGFLSDEPLS  142

Query  478  SCTQVVAQYHLNDDNF  525
            +CT+++ QY L +D +
Sbjct  143  ACTRILQQYQLTEDQY  158



>ref|XP_009600627.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana tomentosiformis]
Length=162

 Score =   186 bits (472),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            FLV GKVY DTC CGFET+A+KYL  S VR+ C NRDTN ++Y+   VTNS+GEY ILV 
Sbjct  27   FLVVGKVYCDTCRCGFETSASKYLAGSRVRIECKNRDTNDISYTIEGVTNSKGEYKILVY  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             DRGD++CDVVL++SSDP+   P++GRDRARV+L+RNNG+V++ RFAN++GF + +PLAS
Sbjct  87   SDRGDEVCDVVLIRSSDPMCAVPNAGRDRARVVLTRNNGMVSNTRFANSIGFLSNEPLAS  146

Query  481  CTQVVAQYHLNDDN  522
            C Q++ QY L D +
Sbjct  147  CNQILQQYQLTDQD  160



>ref|XP_006366520.1| PREDICTED: olee1-like protein-like [Solanum tuberosum]
Length=162

 Score =   186 bits (471),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            FLV GKVY DTC CGFET+A+ YLP S VR+ C NRDTN + Y+    TNS+GEY ILVN
Sbjct  28   FLVVGKVYCDTCRCGFETSASMYLPGSRVRIECKNRDTNDLAYTVEGFTNSKGEYKILVN  87

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             DR D+ CDVVL++SSDP+  +P++GRDRARV+L+ NNG+V++ RFAN++GF + +PLAS
Sbjct  88   SDRRDEFCDVVLIRSSDPMCAEPNTGRDRARVVLTSNNGMVSNTRFANSMGFLSNEPLAS  147

Query  481  CTQVVAQYHLNDDNF  525
            CT+++ QY  ++D F
Sbjct  148  CTKILQQYEFSEDQF  162



>ref|XP_010321468.1| PREDICTED: LOW QUALITY PROTEIN: major pollen allergen Lol p 11-like 
[Solanum lycopersicum]
Length=162

 Score =   185 bits (470),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            FLV GKVY DTC CG+ET+A+KYLP S VR+ C NRDTN + Y+   VTNS+GEY ILVN
Sbjct  28   FLVIGKVYCDTCRCGYETSASKYLPGSRVRIECKNRDTNDLAYTVEGVTNSKGEYKILVN  87

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             DR D+ CDVVL++SSDP+  +P++GRDR RV+L+ NNG+V++ RFAN+LGF   +PLAS
Sbjct  88   SDRRDEFCDVVLIRSSDPMCAEPNTGRDRTRVVLTSNNGMVSNTRFANSLGFLYNEPLAS  147

Query  481  CTQVVAQYHLNDDNF  525
            CT+++ QY  ++D F
Sbjct  148  CTKILKQYEFSEDQF  162



>ref|XP_009797814.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana sylvestris]
Length=161

 Score =   185 bits (469),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            FLV GKVY DTC CGFET+A+KYL  S VR+ C  RDTN V+Y+   VTNS+GEY ILV 
Sbjct  27   FLVVGKVYCDTCRCGFETSASKYLAGSRVRIECKKRDTNDVSYTIEGVTNSKGEYKILVY  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             DRGD++CDVVL++SSDP+   P +GRDRARV+L+RNNG++++ RFAN++GF + +PLAS
Sbjct  87   SDRGDEVCDVVLIRSSDPMCATPAAGRDRARVVLTRNNGMISNTRFANSIGFLSDEPLAS  146

Query  481  CTQVVAQYHLNDDNF  525
            C Q++ QY L +D  
Sbjct  147  CNQILQQYQLTEDQI  161



>ref|XP_004237415.1| PREDICTED: pollen-specific protein C13 [Solanum lycopersicum]
Length=159

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PFLVKGK Y DTC CGFET ATKYL  S V++ C NR TN +TY+ + VTNSQGEY+ILV
Sbjct  24   PFLVKGKCYCDTCRCGFETPATKYLAGSKVKVECKNRVTNKITYTIDGVTNSQGEYNILV  83

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
              D GDD+CDVVLV+S D     P++GRDRARV L+RNNG+ +DVRFANN+GF + +PLA
Sbjct  84   KRDCGDDVCDVVLVESGDKSCNIPNAGRDRARVALTRNNGMTSDVRFANNMGFLSNEPLA  143

Query  478  SCTQVVAQYHLNDDNF  525
            +CTQ++ QY L +D +
Sbjct  144  ACTQILQQYQLTEDQY  159



>ref|XP_009764546.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Nicotiana sylvestris]
Length=161

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PFLVKGK Y DTC CGFET ATKYL  + VR+ C +R   A TY+   VTNS+GEY+I
Sbjct  24   GNPFLVKGKAYCDTCRCGFETPATKYLAGAKVRIECRHRVIEASTYTVEGVTNSKGEYNI  83

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            LVN DRGDD CDV+LVKS D    KP++GRDR+RVIL+RNNG++++ RFAN +GF   +P
Sbjct  84   LVNSDRGDDACDVILVKSPDRTCTKPNAGRDRSRVILTRNNGMISNTRFANAMGFLRDEP  143

Query  472  LASCTQVVAQYHLNDDN  522
            L+SCTQ++ QY L DD 
Sbjct  144  LSSCTQILQQYQLTDDQ  160



>ref|XP_006344595.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Solanum tuberosum]
Length=158

 Score =   181 bits (458),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            P LV+GKVY DTC CGFET AT YLP++ V++ C +R T   TY+   VTNSQGEYSILV
Sbjct  23   PLLVEGKVYCDTCRCGFETPATTYLPDAKVKIECKSRITEEPTYTVEGVTNSQGEYSILV  82

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
              DRGDD+CDVVL+KS DP   KP +GRDR+RV L+RNNG+++DV FAN +GF   +PLA
Sbjct  83   KSDRGDDVCDVVLIKSPDPTCAKPSAGRDRSRVTLTRNNGMISDVYFANAMGFIRDEPLA  142

Query  478  SCTQVVAQYHLNDDN  522
            SC +++ QY + D+ 
Sbjct  143  SCDEILRQYQVPDEQ  157



>ref|XP_006355373.1| PREDICTED: pollen-specific protein C13-like [Solanum tuberosum]
Length=159

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PFLVKGK Y DTC CGFET ATKYL    V++ C NR TN +TY  + V NS+GEY+ILV
Sbjct  24   PFLVKGKCYCDTCRCGFETPATKYLAGCKVKVECKNRVTNKITYRIDGVANSKGEYNILV  83

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
              D GDD+CDVVLV+S D     P++GRDRARV L+RNNG+ +DVR+ANN+GF + +PLA
Sbjct  84   KRDCGDDVCDVVLVESGDKTCNIPNAGRDRARVALTRNNGMTSDVRYANNMGFLSNEPLA  143

Query  478  SCTQVVAQYHLNDDNF  525
            +CTQ++ QY L +D +
Sbjct  144  TCTQILQQYQLTEDQY  159



>gb|AAF16869.1|AF109693_1 allergen-like protein BRSn20 [Sambucus nigra]
Length=159

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PFL+KG VY DTC  GFET ATKYL  + VR+ C +RDT  +TYS  AVT+S+G+YS+
Sbjct  23   GNPFLLKGSVYCDTCRAGFETDATKYLHGARVRIECKDRDTLRLTYSDEAVTDSKGKYSV  82

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            LV+ D GD +CD +LV S DP    PD GRDRA VIL+R+NG+ +D RFAN +GF   +P
Sbjct  83   LVSDDHGDQMCDAILVSSPDPECAVPDKGRDRACVILTRSNGMTSDERFANAMGFLKNEP  142

Query  472  LASCTQVVAQYHLNDDN  522
            +A CTQ++ +Y LN+D+
Sbjct  143  MAGCTQILQKYQLNEDD  159



>gb|EPS62385.1| hypothetical protein M569_12405, partial [Genlisea aurea]
Length=150

 Score =   167 bits (422),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G+P +VKG VY DTC CGFE  ATKY+  + VR+ C    T+ +TY  + VTNS G Y I
Sbjct  16   GQPLVVKGSVYCDTCRCGFENEATKYMAGAAVRIECREAHTSQITYVEDGVTNSAGHYEI  75

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V+GDRGDD+CD VL+KSSDP    PD+GRDRARV+L+RNNG+ +D RFAN++GF    P
Sbjct  76   RVHGDRGDDVCDAVLLKSSDPECSTPDAGRDRARVVLTRNNGIASDHRFANSMGFLRNAP  135

Query  472  LASCTQVVAQYHLND  516
            LA+C QV+ +Y  ++
Sbjct  136  LAACAQVLQKYRSDE  150



>gb|EYU31033.1| hypothetical protein MIMGU_mgv1a015328mg [Erythranthe guttata]
Length=161

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PFLVKG VY D+C CGFET  TKY+P + VR+ C +RD+  +TY+  AVT+  G YS 
Sbjct  26   GDPFLVKGCVYCDSCRCGFETDVTKYMPSAKVRIECRDRDSAKLTYTQEAVTDESGCYSA  85

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            +V  DRG+D CD VLVKSSD     P++GRDRARVIL+RNNG+ ++VR+ANN+GF    P
Sbjct  86   VVQSDRGEDFCDAVLVKSSDDECSVPNAGRDRARVILTRNNGMTDNVRYANNMGFLKNIP  145

Query  472  LASCTQVVAQYHLNDD  519
            L++C Q++ +Y + D+
Sbjct  146  LSNCAQILHKYQIIDN  161



>ref|XP_011097595.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum]
Length=159

 Score =   162 bits (409),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 96/134 (72%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            P L+ G VY DTC CG+ET+ATKYL  + VR+ C  RD++ +TY+  AVT+S G Y ILV
Sbjct  26   PLLLTGCVYCDTCRCGYETSATKYLAGAVVRVECRKRDSSELTYTKEAVTDSTGHYKILV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
              DRGDD CD VLVKS DP    P++GRDRARVIL+RNNG+ ++ RFAN LGF    PLA
Sbjct  86   ETDRGDDYCDSVLVKSPDPECSIPNAGRDRARVILTRNNGMNSNARFANALGFLKNTPLA  145

Query  478  SCTQVVAQYHLNDD  519
            SC QV+ QY   +D
Sbjct  146  SCPQVLQQYQEAED  159



>ref|XP_011090511.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum]
Length=159

 Score =   157 bits (396),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 92/130 (71%), Gaps = 0/130 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V G VY DTC CG+ET AT Y+  + VR+ C N+D   +TY+  AVT+S G YS+LV
Sbjct  26   PFHVTGSVYCDTCRCGYETDATTYIAGATVRIECRNKDNGQLTYTKEAVTDSTGHYSVLV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
              DRGDD CD VLVKS+DP    P+ GRDRARVIL+RNNG++++ RFAN +GF    PLA
Sbjct  86   ETDRGDDFCDAVLVKSADPECSTPNEGRDRARVILTRNNGMISNKRFANAMGFLKNTPLA  145

Query  478  SCTQVVAQYH  507
            +C  ++ +Y 
Sbjct  146  NCPMILQKYQ  155



>gb|EYU24008.1| hypothetical protein MIMGU_mgv1a015363mg [Erythranthe guttata]
Length=160

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 93/136 (68%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G   L++G  Y D C CG+ET+A+K +  + V L C +R T+ +TYS   VT+S G+Y  
Sbjct  25   GDSLLLQGSTYCDACRCGYETSASKPVAGAVVGLECRSRTTSELTYSDETVTDSAGKYKF  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            LV  DRGDD CDV L KSSDP   +P+ GRDRARVIL+RNNG+ ++ RFAN +GF    P
Sbjct  85   LVQSDRGDDFCDVFLSKSSDPECSEPNVGRDRARVILTRNNGMDSNTRFANAMGFLANTP  144

Query  472  LASCTQVVAQYHLNDD  519
            LASC +++ QY  ++D
Sbjct  145  LASCQEILKQYQESED  160



>ref|XP_009794836.1| PREDICTED: pollen-specific protein C13-like, partial [Nicotiana 
sylvestris]
Length=109

 Score =   145 bits (366),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +1

Query  199  SHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDRGDDLCDVVLVKSSDPLSGKPDSG  378
            S V++ C NR TN +TY+   VTNSQGEY+ILV+ D GDD+CDVVLV+SSD   GKP+ G
Sbjct  1    SKVKIECRNRVTNEITYTIGGVTNSQGEYNILVDRDCGDDVCDVVLVESSDKRCGKPNGG  60

Query  379  RDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCTQVVAQYHLNDDNF  525
            RDRARVIL+RNNG+++DVR+ANN+GF + +PL++CT+++ QY L +D +
Sbjct  61   RDRARVILTRNNGMISDVRYANNMGFLSDEPLSACTRILQQYQLTEDQY  109



>ref|XP_002268073.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CBI33037.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   146 bits (369),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 92/135 (68%), Gaps = 0/135 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            KPF++ G+VY DTC  GFET+AT Y+  + VR+ C +R++  + YS   VT+S G Y   
Sbjct  25   KPFVLHGRVYCDTCRAGFETSATTYIAGARVRIECKDRNSLQLVYSVEGVTDSTGTYKFS  84

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            +  D GD +CD VLVKS  P   K D+GRDR+R+ L+R+NGLV+D RFAN +GF   +P 
Sbjct  85   IADDHGDQMCDAVLVKSPQPDCAKVDAGRDRSRLSLTRSNGLVSDTRFANAMGFMKDEPA  144

Query  475  ASCTQVVAQYHLNDD  519
            + CTQ++ QY  +DD
Sbjct  145  SGCTQLLKQYQESDD  159



>ref|XP_010261236.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=163

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V G+VY DTC  GFET AT Y+P + VR+ C +RD   + +S   VT++ G Y+I V
Sbjct  28   PFNVVGRVYCDTCRAGFETPATTYIPGARVRVECRDRDNLNLLFSVEGVTDATGTYNIQV  87

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
              D GD LC+ VLV+SS    GK +SGR+RA V+L+RNNG+++D RFANN+GF   QPLA
Sbjct  88   AEDHGDQLCEAVLVRSSQEDCGKIESGRERANVVLTRNNGVLSDKRFANNMGFIKDQPLA  147

Query  478  SCTQVVAQYH  507
             C +++ QY 
Sbjct  148  GCAEILKQYQ  157



>gb|EPS69662.1| hypothetical protein M569_05103, partial [Genlisea aurea]
Length=156

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 0/132 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G P +++G VY DTC CGFET A+  +  + VR+ C +R T+ +TY+  AVT + G YS+
Sbjct  24   GVPLVLEGSVYCDTCRCGFETAASTKIAGATVRVECRDRKTSELTYTKEAVTGAAGRYSV  83

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            LV  DRGDD CD VL KSSDP    P +  DRARVIL+RNNG+ +  RFAN +GF    P
Sbjct  84   LVEDDRGDDYCDAVLAKSSDPECDTPGAESDRARVILTRNNGISSSARFANAMGFLKNTP  143

Query  472  LASCTQVVAQYH  507
            L++C +++ +Y 
Sbjct  144  LSNCPEILQKYQ  155



>ref|XP_002392460.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
 gb|EEB93390.1| hypothetical protein MPER_07958 [Moniliophthora perniciosa FA553]
Length=160

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 0/130 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            P  V GKVY DTC  GFET A+ Y+  + V++ C +R +  + YS  A T+S G Y + V
Sbjct  27   PLTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQEATTDSTGTYKLFV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D LCD +L+ S  P   KP +GRDRARVIL+R NG+V+D R+ANN+GF   QPLA
Sbjct  87   SEDHQDQLCDAMLLSSPQPNCQKPAAGRDRARVILTRYNGIVSDTRYANNMGFEMDQPLA  146

Query  478  SCTQVVAQYH  507
             CTQV+ QY 
Sbjct  147  GCTQVLQQYQ  156



>ref|XP_004150698.1| PREDICTED: pollen-specific protein C13-like [Cucumis sativus]
 ref|XP_004163322.1| PREDICTED: pollen-specific protein C13-like [Cucumis sativus]
 gb|KGN62176.1| hypothetical protein Csa_2G309370 [Cucumis sativus]
Length=159

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+GKV+ DTC  GFET+AT Y+P + VR+ C +R++  + Y+  A T+S G Y++LV
Sbjct  26   PFVVRGKVFCDTCLAGFETSATTYIPGAKVRIECKDRNSMELQYTHEATTDSTGSYTLLV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            N D GD+LCD VLV S          GRDRARVIL+R NG+ ++ R+ N +GF   +P++
Sbjct  86   NEDHGDELCDAVLVSSPQEKCSSVSEGRDRARVILTRYNGIASNERYVNAMGFAMDEPMS  145

Query  478  SCTQVVAQYHLNDD  519
             C QV++QY   +D
Sbjct  146  GCNQVMSQYQDIED  159



>emb|CDP01424.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRD-TNAVTYSANAVTNSQGEYSI  291
            +PF V GKVY DTC  G+ET AT YLP   V+LVC  RD  + +T++  A T+S G+Y +
Sbjct  23   EPFTVTGKVYCDTCRVGYETPATTYLPGCIVKLVCKKRDNPDQITFTKEATTDSTGKYEM  82

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V  D GDD+C++  VKSSDP    P++GRD AR+ L+RNNG+V++VR ANN+G+    P
Sbjct  83   QVAYDAGDDICEMEHVKSSDPTCATPNAGRDHARICLTRNNGMVSNVRHANNIGYFRDVP  142

Query  472  LASCTQVVAQYH  507
            LA C Q++ +Y 
Sbjct  143  LARCPQILQRYQ  154



>ref|XP_010060161.1| PREDICTED: protein DOWNSTREAM OF FLC [Eucalyptus grandis]
 gb|KCW66732.1| hypothetical protein EUGRSUZ_F00490 [Eucalyptus grandis]
Length=160

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            P  V GKVY DTC  GFET A+ Y+  + V++ C +R +  + YS  A T+S G Y + V
Sbjct  27   PLTVTGKVYCDTCRAGFETPASTYIAGAKVKVECKDRTSMKLLYSQEATTDSTGTYKLFV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D LCD +L+ S      KP +GRDRARVIL+R NG+V+D R+ANN+GF   QPLA
Sbjct  87   SEDHQDQLCDAMLLSSPQLNCQKPAAGRDRARVILTRYNGIVSDTRYANNMGFEMDQPLA  146

Query  478  SCTQVVAQYH  507
             CTQV+ QY 
Sbjct  147  GCTQVLQQYQ  156



>ref|XP_008445353.1| PREDICTED: protein DOWNSTREAM OF FLC [Cucumis melo]
Length=159

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 91/134 (68%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+GKV+ DTC  GFET+AT Y+P + VR+ C +R++  V Y+  A T+S G Y++LV
Sbjct  26   PFVVRGKVFCDTCLAGFETSATTYIPGAKVRIECKDRNSMEVRYTHEATTDSTGSYTLLV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D GD+LCD VLV S          GRDRARVIL+R NG+ ++ R+ N +GF   +P++
Sbjct  86   SEDHGDELCDAVLVSSPQEKCSSVAEGRDRARVILTRYNGIASNDRYVNAMGFAIDEPMS  145

Query  478  SCTQVVAQYHLNDD  519
             C QV++QY   +D
Sbjct  146  GCNQVMSQYQDIED  159



>ref|XP_010676978.1| PREDICTED: major pollen allergen Lol p 11-like [Beta vulgaris 
subsp. vulgaris]
Length=162

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 90/136 (66%), Gaps = 0/136 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            KP+ V+GKVY DTC  GFET A+ YL    V+L C +R T  V YSA A T+  G Y I 
Sbjct  26   KPYCVRGKVYCDTCRAGFETPASTYLEGVKVKLECRHRQTQEVLYSAVATTDRTGSYKIF  85

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V  D+ +++CD +L+ S        D GRDR+RV+L+ NNG+V++ R+ANN+GFT ++P+
Sbjct  86   VENDQKENICDTMLLSSPHRRCKLADPGRDRSRVVLTSNNGVVSNDRYANNMGFTVEEPM  145

Query  475  ASCTQVVAQYHLNDDN  522
            + C Q++ QY L +D 
Sbjct  146  SYCAQLMQQYQLTEDE  161



>ref|XP_003634471.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CAN61642.1| hypothetical protein VITISV_029644 [Vitis vinifera]
 emb|CBI19132.3| unnamed protein product [Vitis vinifera]
Length=159

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            +PF+++G+VY DTC  GFET+AT Y+  + VR+ C +R++  + YS   +T+S G Y I+
Sbjct  25   QPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRNSMQLLYSIEGITDSTGTYKIM  84

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V  DR D LCD VLV S        D GRDRA VIL+R NG+V+D R+AN++GF    P+
Sbjct  85   VTEDREDQLCDAVLVSSPQSDCASVDPGRDRAAVILTRYNGIVSDNRYANSMGFLKDHPM  144

Query  475  ASCTQVVAQYHLNDD  519
            + CTQ++ QY   +D
Sbjct  145  SECTQLLQQYQEFED  159



>ref|XP_008348540.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=162

 Score =   136 bits (343),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF V+G+VY DTC CGFETTAT Y+P + VR+ C +R+T  + YS    T+S G Y+I
Sbjct  25   GNPFHVQGRVYCDTCRCGFETTATNYIPGARVRIECKDRNTLQLAYSVEGETDSTGTYNI  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            LV  D  D +C+ VLV S        D GR RA V+++R NG+V D R+ANN+GF   +P
Sbjct  85   LVEEDHEDQICESVLVSSPISDCKSADPGRSRANVVVTRYNGVVKDKRYANNMGFFKNEP  144

Query  472  LASCTQVVAQY  504
            LA C +++ QY
Sbjct  145  LAGCEKILEQY  155



>gb|ABC86745.1| pollen-specific protein [Vitis pseudoreticulata]
Length=159

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 89/135 (66%), Gaps = 0/135 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            +PF+++G+VY DTC  GFET+AT Y+  + VR+ C +R++  + YS   +T+S G Y I+
Sbjct  25   QPFVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRNSMQLLYSIEGITDSTGTYKIM  84

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V  D  D LCD VLV S        D GRDRA VIL+R NG+V+D R+AN++GF    P+
Sbjct  85   VTEDHEDQLCDAVLVSSPQSDCASVDPGRDRAAVILTRYNGIVSDNRYANSMGFLKDHPM  144

Query  475  ASCTQVVAQYHLNDD  519
            + CTQ++ QY   +D
Sbjct  145  SECTQLLQQYQEFED  159



>ref|XP_010538956.1| PREDICTED: major pollen allergen Lol p 11 [Tarenaya hassleriana]
Length=159

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 88/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G+VY DTC  GFET A+ Y+P + V+L C +R +  + YS  A T+S G Y I V
Sbjct  26   PFVVRGRVYCDTCRAGFETPASTYIPGAVVKLECKDRRSMELVYSHEARTDSTGAYKIWV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            N D  D LCD++LVKS      K   GR+RARV L+R NG+ +D R+ NN+GF   + L+
Sbjct  86   NEDHEDQLCDIMLVKSPQLGCSKVSHGRERARVTLTRYNGIASDDRYVNNMGFERDEALS  145

Query  478  SCTQVVAQYHLNDD  519
             C++++ QY  N++
Sbjct  146  GCSEIMRQYQENEE  159



>ref|XP_009366359.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Pyrus x bretschneideri]
Length=162

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF V+G+VY DTC CGFETTAT Y+  + VR+ C +R+T  + YS    T+S G Y+I
Sbjct  25   GNPFHVQGRVYCDTCRCGFETTATNYISGARVRIECKDRNTLQLAYSVEGETDSTGTYNI  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            L+  D  D +C  VLV S        D GR RA V+++R NG+V D R+ANN+GF   +P
Sbjct  85   LIEEDHEDQICKSVLVSSPISDCKSADPGRSRANVVVTRYNGVVKDKRYANNMGFFKDEP  144

Query  472  LASCTQVVAQYHLNDDN  522
            LA C +++ QY  +D +
Sbjct  145  LADCEKILEQYKNSDQH  161



>gb|AFK37732.1| unknown [Lotus japonicus]
Length=162

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 90/136 (66%), Gaps = 1/136 (1%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+VKG VY D C  GFET+AT  +  + V L+C  +++N V Y+    TNS+GEY+I V
Sbjct  27   PFIVKGCVYCDPCRAGFETSATTRIAGTEVMLLCRQKNSNEVVYTKRGWTNSKGEYTISV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D GD +CD  L+ S  P   +   GRD+ARVIL+R NG+ +D RFAN +GF ++   A
Sbjct  87   SEDHGDQICDAKLISSPHPTCKEATPGRDQARVILTRYNGIASDDRFANAMGFMSENVAA  146

Query  478  SCTQVVAQY-HLNDDN  522
             CTQ++ QY  L+++N
Sbjct  147  GCTQILKQYEELDNEN  162



>ref|XP_010455288.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=159

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G+VY DTC  GFET+A+ Y+P + VRL C +R T  +TYS  A T+S G Y ILV
Sbjct  26   PFVVRGRVYCDTCLAGFETSASTYIPGAVVRLECKDRRTMELTYSHEARTDSTGSYKILV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            N D  D  CD  LV SS         G DRARV L+R NG+ +D RFAN +GF    P+ 
Sbjct  86   NEDHDDQFCDATLVSSSQLRCSTRSPGHDRARVTLTRFNGIASDERFANTMGFLRDAPMP  145

Query  478  SCTQVVAQYHLNDD  519
             C +++  Y   DD
Sbjct  146  GCAEIMKLYQETDD  159



>ref|XP_002533139.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF29251.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=161

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G+PF +KG+VY DTC CGFET  T Y+P + VR+ C +R T  + YS    T+  G Y+I
Sbjct  26   GRPFHIKGRVYCDTCRCGFETKKTTYIPGARVRIECEDRTTLRLKYSVEGETDETGTYNI  85

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            LV  D  D +C   LV S  P     D GR RA V+++RNNG ++D+ FAN++GF   Q 
Sbjct  86   LVEDDHQDQICYAALVSSPWPSCNTADPGRSRAHVVVTRNNGAISDLHFANSMGFLRNQA  145

Query  472  LASCTQVVAQYHLNDD  519
            ++ CT++V Q   +D+
Sbjct  146  MSGCTELVKQLLQSDE  161



>ref|XP_008245042.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score =   131 bits (329),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 88/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G+VY DTC CGFETTAT Y+P + VR+ C  R+T  + YS    T++ G Y+I
Sbjct  25   GNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDTTGTYNI  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            LV  D  D +C+ VLV S        D GR+RA V+++R NG+V D  +ANN+GF   QP
Sbjct  85   LVEDDHEDQICESVLVSSPVNDCKSADPGRNRANVVVTRYNGVVKDKHYANNMGFFKDQP  144

Query  472  LASCTQVVAQYHLNDDN  522
            LA C +++ QY LN D 
Sbjct  145  LAGCEELLKQY-LNYDQ  160



>ref|XP_010436385.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=159

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G+VY DTC  GFET+A+ Y+P + VRL C +R T  +TYS  A T+S G Y ILV
Sbjct  26   PFVVRGRVYCDTCLAGFETSASTYIPGAVVRLECKDRRTMELTYSHEARTDSTGSYKILV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            N D  D  CD  LV SS         G DRARV L+R NG+ +D RFAN +GF    P+ 
Sbjct  86   NEDHDDQFCDATLVSSSQLRCSTLSPGHDRARVTLTRFNGIASDERFANTMGFLRDAPMP  145

Query  478  SCTQVVAQYHLNDD  519
             C +++  Y   +D
Sbjct  146  GCAEIMKLYQETED  159



>ref|XP_007206364.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
 gb|EMJ07563.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
Length=160

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G+VY DTC CGFETTAT Y+P + VR+ C  R+T  + YS    T++ G Y+I
Sbjct  23   GNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDATGTYNI  82

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            LV  D  D +C+ VLV S        D GR RA V+++R NG+V D  +ANN+GF   QP
Sbjct  83   LVEDDHEDQICESVLVSSPVNDCKSADPGRKRANVVVTRYNGVVKDKHYANNMGFFKDQP  142

Query  472  LASCTQVVAQYHLNDDN  522
            LA C +++ QY LN D 
Sbjct  143  LAGCEELLKQY-LNYDQ  158



>ref|XP_004289324.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Fragaria vesca subsp. 
vesca]
Length=163

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            GKPF V+G+VY DTC CGFET+AT Y+  + V + C NR++ ++ YS   VT+  G Y+I
Sbjct  26   GKPFHVQGRVYCDTCRCGFETSATIYIAGATVGIKCMNRNSMSLAYSVEGVTDETGTYNI  85

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            LV  D  D +C+ VLV S        D GR RA V+L+R NG+V   RFANN+GF   Q 
Sbjct  86   LVEDDHEDQICESVLVSSPISDCKSADPGRSRANVVLTRFNGVVKTKRFANNMGFFKDQA  145

Query  472  LASCTQVVAQYHLNDDN  522
            L  CT+++ QY LN D 
Sbjct  146  LPECTELLKQY-LNYDQ  161



>ref|XP_010269200.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=159

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 83/130 (64%), Gaps = 0/130 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V GKVY D C  GFET+AT Y+P + VR+ C +RDT  + +S + VT+S G Y I V
Sbjct  26   PFTVFGKVYCDNCRAGFETSATTYIPGAKVRVECRDRDTLNLLFSVDGVTDSTGSYKIQV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
              D  D LC+ VLV S        + GR+RARVIL+R NG+ +D R+AN+LGF   QPL 
Sbjct  86   AEDHEDQLCESVLVSSPQNDCSAVEPGRERARVILTRGNGIASDNRYANSLGFIKDQPLP  145

Query  478  SCTQVVAQYH  507
             C +++ QY 
Sbjct  146  GCAEIMKQYQ  155



>ref|XP_010090546.1| hypothetical protein L484_016596 [Morus notabilis]
 gb|EXB39752.1| hypothetical protein L484_016596 [Morus notabilis]
Length=186

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 89/138 (64%), Gaps = 1/138 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF + G+VY DTC+ GFETTAT Y+P + VRL C +R+T  + YS++AVT+S G Y+I
Sbjct  46   GTPFHIIGRVYCDTCHAGFETTATYYIPGAKVRLDCLDRETLELRYSSHAVTDSTGTYNI  105

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSR-NNGLVNDVRFANNLGFTTKQ  468
             V  D  D +C+ VL  S       PD GR RA  +L+R  NG+VN+    NN+GF  ++
Sbjct  106  KVEDDHEDQICECVLESSPIAACEMPDPGRSRASALLTRYMNGVVNNKHIVNNMGFLLEK  165

Query  469  PLASCTQVVAQYHLNDDN  522
            PLA C QV+ +Y  +DD 
Sbjct  166  PLAECEQVLKRYFPDDDE  183



>gb|AFK47744.1| unknown [Lotus japonicus]
Length=162

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 89/136 (65%), Gaps = 1/136 (1%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+VKG VY D C  GFET+AT  +  + V L+C  +++N V Y+    TNS+GEY+I V
Sbjct  27   PFIVKGCVYCDPCRAGFETSATTRIAGAEVMLLCRQKNSNEVVYTKRGWTNSKGEYTISV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D GD +CD  L+ S  P   +   GRD+ARVIL+R NG+ +D RFAN +G  ++   A
Sbjct  87   SEDHGDQICDAKLISSPHPTCKEATPGRDQARVILTRYNGIASDDRFANAMGSMSENVAA  146

Query  478  SCTQVVAQY-HLNDDN  522
             CTQ++ QY  L+++N
Sbjct  147  GCTQILKQYEELDNEN  162



>ref|XP_008234688.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score =   128 bits (322),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 87/137 (64%), Gaps = 1/137 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G+VY DTC CGFETTAT Y+P + VR+ C  R+T  + YS    T++ G Y+I
Sbjct  25   GNPFHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDATGTYNI  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            LV  D  D +C+ VLV S        D  R+RA V+++R NG+V D  +ANN+GF   QP
Sbjct  85   LVEDDHEDQICESVLVSSPVNDCKSADPRRNRANVVVTRYNGIVKDKHYANNMGFFKDQP  144

Query  472  LASCTQVVAQYHLNDDN  522
            LA C +++ QY LN D 
Sbjct  145  LAGCEELLKQY-LNYDQ  160



>ref|XP_002513885.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF48468.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=159

 Score =   128 bits (322),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 86/134 (64%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V+G+VY DTC  GFET+ T Y+  + VR+ C +R T  + YS    T+S G Y I V
Sbjct  26   PFEVEGRVYCDTCRAGFETSKTTYVAGAKVRVECKDRKTMELVYSKEGTTDSTGTYRIHV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D LCD +LV S      KP SGRDRARVIL+ NNG+V++ R+AN++GF  +  ++
Sbjct  86   DEDHQDQLCDAMLVSSPQHDCMKPSSGRDRARVILTNNNGIVSNKRYANSIGFMKEDAMS  145

Query  478  SCTQVVAQYHLNDD  519
             C +++ QY   +D
Sbjct  146  GCFELLRQYQEYED  159



>ref|XP_006289520.1| hypothetical protein CARUB_v10003061mg [Capsella rubella]
 gb|EOA22418.1| hypothetical protein CARUB_v10003061mg [Capsella rubella]
Length=160

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G+VY DTC  GFET+A+ Y+P + VRL C +R T  +TYS  A T+S G Y ILV
Sbjct  27   PFVVRGRVYCDTCLAGFETSASTYIPGAVVRLECKDRRTMELTYSHEARTDSTGSYKILV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D  CD  LV+SS         G DRARV L+R NG+ +D RFAN+LGF     + 
Sbjct  87   SEDHDDQFCDATLVRSSQLRCSNVSPGHDRARVTLTRFNGIASDERFANSLGFVRDAAMP  146

Query  478  SCTQVVAQYHLNDD  519
             C +++  Y   +D
Sbjct  147  GCAEIMKLYQETED  160



>emb|CDY12288.1| BnaA09g24880D [Brassica napus]
 emb|CDX90693.1| BnaA03g23730D [Brassica napus]
Length=159

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G+VY DTC  GFET+A+ ++P + VRL C +R T  +TY   A T+S G Y ILV
Sbjct  26   PFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRRTMELTYRHEARTDSTGSYKILV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D  CD +LV SS         G DRARV L+R NG+ +D RFANNLGF       
Sbjct  86   SEDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVTLTRFNGIASDERFANNLGFLRDAASP  145

Query  478  SCTQVVAQYHLNDD  519
             C +++ QY   +D
Sbjct  146  GCAEIMKQYQETED  159



>ref|XP_009134109.1| PREDICTED: pollen-specific protein C13 [Brassica rapa]
Length=159

 Score =   127 bits (318),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G+VY DTC  GFET+A+ ++P + VRL C +R T  +TY   A T+S G Y ILV
Sbjct  26   PFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRRTMELTYRHEARTDSTGSYRILV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D  CD +LV SS         G DRARV L+R NG+ +D RFANNLGF       
Sbjct  86   SEDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVTLTRFNGIASDERFANNLGFLRDAASP  145

Query  478  SCTQVVAQYHLNDD  519
             C +++ QY   +D
Sbjct  146  GCAEIMKQYQETED  159



>ref|XP_002307393.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK95954.1| unknown [Populus trichocarpa]
 gb|EEE94389.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   126 bits (317),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G VY DTC  GFET+ T  +  + VRL C +R T  + YS    T+S G+Y+I V
Sbjct  26   PFVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTGKYTITV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D +CD +LV S       P +GRDRARVIL+ +NGLV+  R+AN +GF   QP++
Sbjct  86   DEDHEDQICDCMLVSSPRKDCRSPSAGRDRARVILTNDNGLVSTTRYANAMGFMAAQPMS  145

Query  478  SCTQVVAQYHLNDD  519
             CT+++  Y   +D
Sbjct  146  GCTELLRLYQEYED  159



>ref|XP_006857531.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
 gb|ERN18998.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
Length=159

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 88/133 (66%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+G+VY DTC  GFET+AT Y+  S VRL C +R T+ +TYS   VT++ G Y + V+
Sbjct  27   FEVEGRVYCDTCRAGFETSATTYIKGSTVRLECKDRATHQLTYSIEGVTDATGTYRLPVS  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             DR  ++C+VV+V S +   GK   GR+RARV+L+ NNG+V++ R+AN L F   +PL  
Sbjct  87   DDRQHEICEVVVVSSPEAGCGKAMLGRERARVLLTHNNGIVSNTRYANALAFLKDEPLPR  146

Query  481  CTQVVAQYHLNDD  519
            C +++  Y   ++
Sbjct  147  CAELLKLYKEKEE  159



>ref|XP_002310579.1| hypothetical protein POPTR_0007s05750g [Populus trichocarpa]
 gb|EEE91029.1| hypothetical protein POPTR_0007s05750g [Populus trichocarpa]
Length=158

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 85/136 (63%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF V+G+VY DTC CGFET  T Y+P++ VR+ C +R    + YS   VT+S G Y I
Sbjct  23   GNPFYVRGRVYCDTCQCGFETKKTTYVPDARVRIECRDRTDLQLRYSVEGVTDSTGTYKI  82

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GD+ D LC VVLV S        D+ R+ A VIL+R+NG ++D+ +AN+LGF   + 
Sbjct  83   KVEGDQADRLCHVVLVDSPLADCKTVDTARNGAEVILTRSNGAISDLHYANSLGFVKDKA  142

Query  472  LASCTQVVAQYHLNDD  519
            L  C ++V Q   +D+
Sbjct  143  LPGCAELVKQLLESDE  158



>gb|ABK94215.1| unknown [Populus trichocarpa]
Length=159

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V+G VY DTC  GFET  T Y+  S V++ C +R T  + YS    T+S G+Y I V
Sbjct  26   PFSVQGIVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGKYIITV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D +CD +LV S       P +GRDRARVIL+  NGLV+  R+AN++GF   QP++
Sbjct  86   DEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMS  145

Query  478  SCTQVVAQYHLNDD  519
             CT+++  Y   D+
Sbjct  146  GCTELLRSYQEFDN  159



>ref|XP_002301038.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK93129.1| unknown [Populus trichocarpa]
 gb|ABK94485.1| unknown [Populus trichocarpa]
 gb|ABK95752.1| unknown [Populus trichocarpa]
 gb|EEE80311.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V+G VY DTC  GFET  T Y+  S V++ C +R T  + YS    T+S G+Y I V
Sbjct  26   PFSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGKYIITV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D +CD +LV S       P +GRDRARVIL+  NGLV+  R+AN++GF   QP++
Sbjct  86   DEDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMS  145

Query  478  SCTQVVAQYHLNDD  519
             CT+++  Y   D+
Sbjct  146  GCTELLRSYQEFDN  159



>ref|XP_011016068.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011027685.1| PREDICTED: pollen-specific protein C13 isoform X1 [Populus euphratica]
 ref|XP_011027686.1| PREDICTED: pollen-specific protein C13 isoform X2 [Populus euphratica]
Length=159

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 84/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V+G+VY DTC+ GFET  T Y+  S V++ C +R T  + YS    T+S G Y I V
Sbjct  26   PFSVQGRVYCDTCHAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGTYIITV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D +CD +LV S       P +GR+RARVIL+  NGLV+  R+AN++GF   QP++
Sbjct  86   DEDHKDQICDAMLVSSPRQDCSSPSAGRERARVILTNYNGLVSTTRYANSMGFMAAQPMS  145

Query  478  SCTQVVAQYHLNDD  519
             CT+++  Y   D+
Sbjct  146  GCTELLRLYQDYDN  159



>gb|KDP32694.1| hypothetical protein JCGZ_11986 [Jatropha curcas]
Length=159

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V+G+VY DTC  GFET  T Y+  + VRL C +R +  + YS    T+S G Y I V
Sbjct  26   PFEVEGRVYCDTCRAGFETPKTTYIAGAKVRLECKDRKSMELVYSKEGTTDSTGTYKIYV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D LCD VLV S       P SGRDRARVIL+  NG+ ++ RFAN +GF      +
Sbjct  86   DDDHADQLCDAVLVSSPKKDCRSPSSGRDRARVILTSYNGIASNKRFANAIGFEKDDIES  145

Query  478  SCTQVVAQYHLNDD  519
             CT+++ QY   +D
Sbjct  146  GCTELLRQYQEYED  159



>ref|XP_011006159.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011016058.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
Length=159

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G VY DTC  GFET+ T  +  + VRL C +R T  + YS    T+S G+Y+I V
Sbjct  26   PFVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTGKYTITV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D +CD +LV S       P +GRDRARVIL+ NNGLV+  R+ N +GF    P++
Sbjct  86   DEDHKDQICDCMLVSSPRKDCRSPSAGRDRARVILTNNNGLVSTTRYVNAMGFMAAHPMS  145

Query  478  SCTQVVAQYHLNDD  519
             CT+++  Y   +D
Sbjct  146  GCTELLRLYQEYED  159



>emb|CDY05022.1| BnaC03g28200D [Brassica napus]
Length=159

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G+VY DTC  GFET+A+ ++P + VRL C +R T  +TY   A T+S G Y ILV
Sbjct  26   PFVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRRTMELTYRHEARTDSTGSYKILV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D  CD +LV SS         G +RARV L+R NG+ +D RFANNLGF       
Sbjct  86   SEDHEDQFCDTMLVSSSQLRCSNVSPGHNRARVTLTRFNGIASDERFANNLGFLRDAASP  145

Query  478  SCTQVVAQYHLNDD  519
             C +++ QY   +D
Sbjct  146  GCAEIMKQYQEIED  159



>gb|KJB59946.1| hypothetical protein B456_009G282200 [Gossypium raimondii]
Length=159

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            P +V+G+VY D C  GFET  T+ +  + V++VC+NR T  V Y     T+S G+Y I V
Sbjct  26   PLVVQGQVYCDHCRAGFETPKTRNMAGAKVKVVCSNRKTGDVVYEKEGHTDSTGQYKIAV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D++CD VLVKSS P   +   GR+RARV+L+  NG+ ++ RFAN +GF   +  A
Sbjct  86   SEDHLDEICDAVLVKSSQPECAEMSPGRERARVVLTNFNGISSNTRFANAMGFMANKAEA  145

Query  478  SCTQVVAQYHLNDD  519
             C +V+  Y   DD
Sbjct  146  GCAEVMKVYQEEDD  159



>ref|NP_567338.1| protein SAH7 [Arabidopsis thaliana]
 emb|CAB40579.1| SAH7 protein [Arabidopsis thaliana]
 gb|AAL69502.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45117.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62935.1| allergen-like protein BRSn20 [Arabidopsis thaliana]
 dbj|BAF00475.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82668.1| protein SAH7 [Arabidopsis thaliana]
Length=159

 Score =   123 bits (309),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 81/134 (60%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G+VY DTC  GFET A+ Y+  + VRL C +R T  +TYS  A T+S G Y ILV
Sbjct  26   PFVVRGRVYCDTCLAGFETPASTYISGAVVRLECKDRRTMELTYSHEARTDSTGSYKILV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            N D  +  CD +LV+SS         G DRARV L+R NG+ +D RFANN+GF     + 
Sbjct  86   NEDHDEQFCDAMLVRSSQLRCSNVSPGHDRARVTLTRFNGIASDDRFANNMGFLRDAAMP  145

Query  478  SCTQVVAQYHLNDD  519
             C  ++  Y   +D
Sbjct  146  GCADIMKLYQETED  159



>ref|XP_008797140.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
 ref|XP_008797142.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
Length=174

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 88/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
             +++G VY DTC  GFET  T Y+P + VRL CT   T+ VTY+A A T+  G Y I+V 
Sbjct  40   LVLEGHVYCDTCRAGFETDLTAYIPGAKVRLECTRYGTDEVTYAAEATTDLLGIYQIVVP  99

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
            GD  +D C VVL+KS+     +   GRDRARV+L+++ GL+++VR AN LGF   +PLA 
Sbjct  100  GDHSEDQCSVVLMKSAVDNCTEIKPGRDRARVVLAQDGGLLSNVRRANALGFLIAEPLAE  159

Query  481  CTQVVAQYHLNDDN  522
            C +++ +Y   +D+
Sbjct  160  CGKLLQKYGFANDD  173



>gb|KDP46869.1| hypothetical protein JCGZ_24078 [Jatropha curcas]
Length=159

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            +PF V G+VY DTC CGFET  T Y+P + VR+ C +R  + + YS    T+S G Y I 
Sbjct  25   RPFFVHGRVYCDTCRCGFETNKTTYIPGAKVRIECLDRVNSQLKYSIEGKTDSTGTYRIK  84

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V  D  D  C  VLV S        D GR RA VIL+R+NG V+D+ FAN++G+   QP+
Sbjct  85   VKDDHQDQFCYAVLVSSPQANCKTADPGRSRAEVILTRSNGAVSDLHFANSMGYFRYQPM  144

Query  475  ASCTQVVAQYHLNDD  519
            + C ++V +   +D+
Sbjct  145  SGCAELVKELLHSDE  159



>gb|KFK32118.1| hypothetical protein AALP_AA6G200700 [Arabis alpina]
Length=160

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 80/134 (60%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G+V+ DTC  GFET A+ Y+P + VRL C +R T  + Y+ +A T+S G Y ILV
Sbjct  27   PFVVRGRVFCDTCLAGFETPASTYIPGAVVRLECKDRRTMELRYTHDAKTDSTGSYKILV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            N D  D  CD +LV SS         G DRARV L+R NG+  D RFANN+ F     L 
Sbjct  87   NEDHEDQFCDTMLVSSSQLRCSNVSPGHDRARVTLTRFNGIATDDRFANNMAFLRDAALP  146

Query  478  SCTQVVAQYHLNDD  519
             C +++  Y   +D
Sbjct  147  GCAEIMKLYQETED  160



>gb|ABK92993.1| unknown [Populus trichocarpa]
Length=159

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 82/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+G VY DTC  GFET  T Y+  S V++ C +R T  + YS    T+S G+Y I V+
Sbjct  27   FSVQGLVYCDTCLAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGKYIITVD  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             D  D +CD +LV S       P +GRDRARVIL+  NGLV+  R+AN++GF   QP++ 
Sbjct  87   EDHKDQICDAMLVSSPRKDCSSPSAGRDRARVILTSYNGLVSTTRYANSMGFMAAQPMSG  146

Query  481  CTQVVAQYHLNDD  519
            CT+++  Y   D+
Sbjct  147  CTELLRSYQEFDN  159



>ref|XP_010105888.1| hypothetical protein L484_021545 [Morus notabilis]
 gb|EXC06707.1| hypothetical protein L484_021545 [Morus notabilis]
Length=172

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (61%), Gaps = 11/141 (8%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLP----------ESHVRLVCTNRDT-NAVTYSANAV  264
            PF+V+GKVY DTC  GFET+AT Y+P           + +R+ C +R+  + V +     
Sbjct  26   PFIVEGKVYCDTCRAGFETSATTYIPVYVNGGYYNISARIRIECVDRNAPSKVLFRKETT  85

Query  265  TNSQGEYSILVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFAN  444
            T+S+G YS+LV  D G+ +CD V+V S      K   GRDRARVIL+  NG+ ++ RF N
Sbjct  86   TDSEGCYSMLVAEDHGNQICDAVVVSSPQQNCAKAAPGRDRARVILTGYNGIASEKRFVN  145

Query  445  NLGFTTKQPLASCTQVVAQYH  507
            N+GF   +PLA C+ V+ QY 
Sbjct  146  NIGFEMDEPLALCSNVLKQYQ  166



>ref|XP_008234009.1| PREDICTED: pollen-specific protein C13 [Prunus mume]
Length=159

 Score =   121 bits (304),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 78/134 (58%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V+GKVY DTC  GFET+AT Y+P + VRL C +R T  + Y+    T+S G Y I V
Sbjct  26   PFTVEGKVYCDTCRAGFETSATTYIPGATVRLECRDRKTMDIRYTKEGRTDSTGTYKIPV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
              D  D  CD VLV SS         GRDRARVIL+  NG+ +  RFAN +GF   + + 
Sbjct  86   TEDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVILTGYNGIASYNRFANAMGFMKNEAVP  145

Query  478  SCTQVVAQYHLNDD  519
             C Q++ Q    D+
Sbjct  146  GCAQILKQLQEFDE  159



>gb|KDO80906.1| hypothetical protein CISIN_1g031458mg [Citrus sinensis]
Length=159

 Score =   121 bits (304),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            KPF V+G+VY DTC  GFET AT Y+  + V++ C +R +  V YS    T+S G Y IL
Sbjct  25   KPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKIL  84

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V+ D  D LCD VLV S          GR+R+RVIL+  NG+ ++ R+AN++GF   +P+
Sbjct  85   VSEDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPM  144

Query  475  ASCTQVVAQYHLND  516
            + C +V+  Y   D
Sbjct  145  SGCAEVLRLYQEED  158



>ref|XP_006472638.1| PREDICTED: pollen-specific protein C13-like [Citrus sinensis]
Length=159

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            KPF V+G+VY DTC  GFET AT Y+  + V++ C +R +  V YS    T+S G Y IL
Sbjct  25   KPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKIL  84

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V+ D  D LCD VLV S          GR+R+RVIL+  NG+ ++ R+AN++GF   +P+
Sbjct  85   VSEDHQDQLCDAVLVSSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPM  144

Query  475  ASCTQVVAQYHLND  516
            + C +V+  Y   D
Sbjct  145  SGCAEVLRLYQEED  158



>ref|XP_006434027.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
 gb|ESR47267.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
Length=159

 Score =   121 bits (303),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            KPF V+G+VY DTC  GFET AT Y+  + V++ C +R +  V YS    T+S G Y IL
Sbjct  25   KPFSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKIL  84

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V+ D  D LCD VL+ S          GR+R+RVIL+  NG+ ++ R+AN++GF   +P+
Sbjct  85   VSEDHQDQLCDAVLISSPQNDCKTVAPGRERSRVILTSYNGISSETRYANSMGFMKAEPM  144

Query  475  ASCTQVVAQYHLND  516
            + C +V+  Y   D
Sbjct  145  SGCAEVLRLYQEED  158



>ref|XP_006397273.1| hypothetical protein EUTSA_v10029031mg [Eutrema salsugineum]
 gb|ESQ38726.1| hypothetical protein EUTSA_v10029031mg [Eutrema salsugineum]
Length=161

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 80/130 (62%), Gaps = 0/130 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G+VY DTC  GFET A+ Y+P + VRL C +R+T  +TY+  A T+S G Y ILV
Sbjct  26   PFVVRGRVYCDTCLAGFETPASTYIPGAVVRLECKDRNTMDLTYTHEARTDSTGSYKILV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D  CD +L  SS         G DRARV L+R NG+ ++ RFANNLGF     L 
Sbjct  86   SEDHEDQFCDTMLGSSSQLRCSNVSPGHDRARVTLTRFNGIASNERFANNLGFLRDAELP  145

Query  478  SCTQVVAQYH  507
             C +++  Y 
Sbjct  146  GCAEIMKLYQ  155



>ref|XP_010424432.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=268

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 76/126 (60%), Gaps = 0/126 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF+V+G+VY  TC  GFET+A+ Y+P + VRL C +R T  +TYS  A T+S G Y ILV
Sbjct  26   PFVVRGRVYCHTCLAGFETSASTYIPGAVVRLECKDRRTMELTYSHEARTDSTGSYKILV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            N D  D  CD  LV SS         G DRARV L+R NG+ +D RFAN +GF    P+ 
Sbjct  86   NEDHDDQFCDATLVSSSQLRCSTLSPGHDRARVTLTRFNGIASDERFANTMGFLRDAPMP  145

Query  478  SCTQVV  495
             C  V 
Sbjct  146  DCADVA  151



>ref|XP_006464247.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Citrus sinensis]
Length=161

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 86/131 (66%), Gaps = 0/131 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G+VY DTC CGFET+AT Y+  +HVR+ C +R++  + YS +  T+S G Y+I
Sbjct  22   GDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNI  81

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V+GD  D +C   L+ S        D GR  ++VIL+R+NG V+++ FAN LGF   +P
Sbjct  82   HVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  472  LASCTQVVAQY  504
            LA C +++ +Y
Sbjct  142  LAFCPELLKKY  152



>ref|XP_002872410.1| hypothetical protein ARALYDRAFT_489767 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48669.1| hypothetical protein ARALYDRAFT_489767 [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 81/137 (59%), Gaps = 3/137 (2%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESH---VRLVCTNRDTNAVTYSANAVTNSQGEYS  288
            PF+V+G+VY DTC  GFET A+ Y+  +    VRL C +R T  +TYS  A T+S G Y 
Sbjct  26   PFVVRGRVYCDTCLAGFETPASTYIHGTSGAVVRLECKDRRTMELTYSHEARTDSTGSYK  85

Query  289  ILVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQ  468
            ILVN D  D  CD +LV+SS         G DRARV L+R NG+ +D RFANN+GF    
Sbjct  86   ILVNEDHDDQFCDAMLVRSSQLRCSNVSPGHDRARVTLTRFNGIASDDRFANNMGFLRDA  145

Query  469  PLASCTQVVAQYHLNDD  519
             +  C  ++  Y   +D
Sbjct  146  AMPGCADIMKLYQETED  162



>ref|XP_007018845.1| Pollen-specific protein C13, putative [Theobroma cacao]
 gb|EOY16070.1| Pollen-specific protein C13, putative [Theobroma cacao]
Length=159

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 81/133 (61%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            P +V+G+VY D C  GFET  T+ +  + V++ C++R T  V Y     T+S G Y ++V
Sbjct  26   PLVVQGQVYCDRCRAGFETPKTRNMAGAKVKVECSDRKTGQVVYKKEGYTDSTGHYKVVV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D++CD +LVKSS P   K   GR+RARVIL+  NG+ ++ RFAN +GF   +  A
Sbjct  86   SEDHLDEICDAILVKSSQPDCAKMSPGRERARVILTNFNGIASNTRFANAMGFMADEADA  145

Query  478  SCTQVVAQYHLND  516
             C +++  Y   D
Sbjct  146  GCAEIMKLYQEED  158



>ref|NP_001238723.1| uncharacterized protein LOC100499710 precursor [Glycine max]
 gb|ACU13342.1| unknown [Glycine max]
 gb|KHN09136.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF VKG+VY D C  GFET+AT Y+  + + L C +R +N V Y+    T+S G Y++ V
Sbjct  27   PFCVKGRVYCDPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMYV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D +C   LV S  P   +   GRD A VIL+R NG+ +D RFAN +GF +++  +
Sbjct  87   DEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVILTRYNGIASDDRFANAMGFMSQEVAS  146

Query  478  SCTQVVAQYHLNDDN  522
             C +V+ QY   D+ 
Sbjct  147  GCAEVLRQYEEFDNE  161



>ref|XP_006302909.1| hypothetical protein CARUB_v10021044mg [Capsella rubella]
 gb|EOA35807.1| hypothetical protein CARUB_v10021044mg [Capsella rubella]
Length=171

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 87/135 (64%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G+ Y DTC  GFET  + Y +P + V+LVC +R T   TYS  AV++ QG Y  +V
Sbjct  30   MVVQGRTYCDTCKFGFETPESSYFIPGATVKLVCKHRQTMEETYSDEAVSDKQGYYKFIV  89

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D++CDV+LVKSSD   GK   GR+++RVIL+  +G+ + +R ANN+GF  +    
Sbjct  90   HEDHKDEMCDVMLVKSSDKTCGKISVGREQSRVILNHYSGIASQIRHANNMGFEKEVSDV  149

Query  478  SCTQVVAQYHLNDDN  522
             C+ +  +Y +++D 
Sbjct  150  FCSALFQKYMVDEDE  164



>gb|KHN19737.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF VKG+VY D C  GFET+AT Y+  + + L C +R +N V Y+    T+S G Y++ V
Sbjct  27   PFCVKGRVYCDPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMYV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D +C   LV S  P   +   GRD A VIL+R NG+ +D RFAN +GF +++  +
Sbjct  87   DEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVILTRYNGIASDDRFANAMGFMSQEVAS  146

Query  478  SCTQVVAQYHLNDDN  522
             C +++ QY   D+ 
Sbjct  147  GCAEILRQYQEFDNE  161



>gb|AAT08700.1| pollen-specific protein [Hyacinthus orientalis]
Length=174

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 81/131 (62%), Gaps = 0/131 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF+V+G+V+ DTC  GFET AT Y+  + VR+ C  R T A T S + VT+  G Y+I
Sbjct  39   GSPFIVQGRVFCDTCRAGFETPATTYIAGAKVRVECKARATGAETCSFDGVTDETGTYNI  98

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V  +   + C+ VLV+S D    K    R+RA V L+RNNG+ +DVRFAN +GF    P
Sbjct  99   WVADEHEHENCESVLVESPDHECSKIIDDRERAPVFLTRNNGIASDVRFANAMGFKKDVP  158

Query  472  LASCTQVVAQY  504
            LA C  ++ QY
Sbjct  159  LAFCASLMKQY  169



>ref|XP_007225977.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
 gb|EMJ27176.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
Length=159

 Score =   118 bits (296),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 78/134 (58%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V+GKV+ D C  GFET+AT Y+P + VRL C +R T  + Y+    T+S G Y I V
Sbjct  26   PFTVEGKVFCDPCRAGFETSATTYIPGATVRLECRDRKTMDIRYTKEGRTDSTGTYKIPV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
              D  D  CD VLV SS         GRDRARVIL+  NG+ +  RFAN +GF   + ++
Sbjct  86   TEDHEDQFCDAVLVSSSQKDCAAAAPGRDRARVILTGYNGIASYNRFANAMGFMKNEAVS  145

Query  478  SCTQVVAQYHLNDD  519
             C Q++ Q    D+
Sbjct  146  GCAQILKQLQEFDE  159



>ref|XP_009421183.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   118 bits (295),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 84/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F ++G+VY D C  GFET+AT Y+  + V+L C   DT  V  +A AVT++ G Y++ V 
Sbjct  27   FRIQGRVYCDKCRAGFETSATDYIEGAKVKLECRQYDTGVVEQTATAVTDASGTYTLEVE  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +  +++C+VVLV+S  P   +  +GRDRARV++S  +GL   VR+AN+LGF    PL  
Sbjct  87   DNHEEEICEVVLVESPRPGCSEIMTGRDRARVLISAESGLTTSVRYANSLGFLNAAPLPE  146

Query  481  CTQVVAQYHLNDDN  522
            C  ++ +Y L  D 
Sbjct  147  CGLLLQKYALGVDG  160



>ref|XP_007136225.1| hypothetical protein PHAVU_009G028900g [Phaseolus vulgaris]
 gb|ESW08219.1| hypothetical protein PHAVU_009G028900g [Phaseolus vulgaris]
Length=162

 Score =   118 bits (296),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            + F VKG+VY D C  GFET+AT Y+  + V   C +R TN V ++ NA+T+S G Y++ 
Sbjct  26   REFSVKGRVYCDRCRAGFETSATTYIAGAEVMAQCKSRTTNEVVFTQNAITDSSGTYTLH  85

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V  D  D++C V ++ S  P       GRD A VIL+R NG+ +D R+AN +GF +++  
Sbjct  86   VKKDHNDEICSVKILSSPHPECTVVTPGRDEALVILTRYNGIASDDRYANAMGFMSREVA  145

Query  475  ASCTQVVAQYHLNDDN  522
            A C +V+ QY   D+ 
Sbjct  146  AGCAEVLKQYQEFDNE  161



>ref|XP_009403224.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+++G+VY DTC  GFET  ++Y+P + V+L C + +T+++ ++A  VT+  G Y+I V 
Sbjct  27   FVIQGRVYCDTCRAGFETVVSQYIPGAKVKLQCRHYETDSIEHTAVGVTDGTGTYNIEVE  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +  +++C+V LV+S  P   +    R+RARV+++  NGL +DVR+AN+LGF   +PL  
Sbjct  87   DNHEEEICEVSLVQSPVPGCSEVSGTRNRARVLVTGRNGLASDVRYANSLGFLKDEPLKE  146

Query  481  CTQVVAQYHLNDDN  522
            C  ++ QY L  D+
Sbjct  147  CGLLLQQYALGVDD  160



>ref|XP_009408781.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
             +V+G+VY DTC  GFET AT+Y+  + V+L C N  T A T +A AVTN++G Y I V+
Sbjct  30   LVVEGRVYCDTCRAGFETKATEYIEGAKVKLECKNYTTGASTLTAVAVTNNKGTYQIPVS  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             D  ++ C V+LV S      +   GR+ A V+L+ N G+ + VR+AN+LGF    PLAS
Sbjct  90   DDHQEESCAVMLVSSPRSDCSEISDGRNHAAVVLTHNVGITSSVRYANSLGFLKDVPLAS  149

Query  481  CTQVVAQYHLNDDN  522
            C Q++ QY L  D+
Sbjct  150  CGQMLMQYALGVDD  163



>ref|XP_006390031.1| hypothetical protein EUTSA_v10019236mg [Eutrema salsugineum]
 gb|ESQ27317.1| hypothetical protein EUTSA_v10019236mg [Eutrema salsugineum]
Length=166

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G  Y DTC  GFET  + Y +P + V+LVC +R T    Y+  AV++ +G+Y  +V
Sbjct  31   MVVQGSTYCDTCKFGFETAESSYFIPGATVKLVCNDRKTMKPIYTDVAVSDKEGKYKFIV  90

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D++CDVVLVKSSD    K   GR+++RVIL+  NG+ + +R ANN+GF  +    
Sbjct  91   HEDHKDEMCDVVLVKSSDASCPKISPGREQSRVILNHYNGIASQIRHANNMGFEKEVSDV  150

Query  478  SCTQVVAQYHLNDDN  522
             C++++ +Y +++D+
Sbjct  151  FCSELIKKYQVDEDD  165



>ref|XP_004500607.1| PREDICTED: pollen-specific protein C13-like [Cicer arietinum]
Length=162

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 82/136 (60%), Gaps = 1/136 (1%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            P  +KG+VY D C  GFETTA   +  + V L C  R +N V YS    T+S G Y++ V
Sbjct  27   PLCLKGRVYCDACRAGFETTAITNIAGAEVLLQCKERISNEVVYSKRGWTDSTGSYTMYV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D +CDV LV S      +   GRD+ARVIL+R NG+ ++ R+AN +GF  ++  +
Sbjct  87   DEDHADQVCDVKLVSSHQHFCREATPGRDQARVILTRFNGIASNDRYANAMGFMAQEVAS  146

Query  478  SCTQVVAQYH-LNDDN  522
             C +V+ QY  L+D+N
Sbjct  147  GCAEVLKQYQDLDDEN  162



>gb|AAM08621.1|AC107314_12 Putative Pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 gb|AAN31783.1| Putataive pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 gb|AAP53386.1| Pollen proteins Ole e I family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAY78230.1| hypothetical protein OsI_33275 [Oryza sativa Indica Group]
 gb|EAZ15857.1| hypothetical protein OsJ_31276 [Oryza sativa Japonica Group]
Length=172

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 83/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ DTC  GFET A+ Y+  + V++ C ++ T A T S    T+  G Y+I VN
Sbjct  38   FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGQTDHTGTYNIPVN  97

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +   +LC+ VLV S D   GK  +GR+RA V L+ NNG+ ++VR AN LGF    PLA+
Sbjct  98   DEHEHELCESVLVSSPDAKCGKIVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLAA  157

Query  481  CTQVVAQYHLNDD  519
            C Q++  Y   DD
Sbjct  158  CAQILKMYEEVDD  170



>ref|XP_006652233.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=166

 Score =   115 bits (289),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 85/134 (63%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            +LV+G+VY DTC  GFET  T+Y+  + VRL C +  T  +  + + VT+  G Y I + 
Sbjct  31   YLVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHYGTGNIERAVDGVTDETGTYKIELK  90

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
                +D+C+VVLVKS     G+  + RDRARV+L+RN G+ +++RFAN LG+    PL  
Sbjct  91   DSHEEDICEVVLVKSPLANCGEVQAERDRARVLLTRNVGICDNLRFANPLGYLKDIPLPV  150

Query  481  CTQVVAQYHLNDDN  522
            C +++ Q+ L DD+
Sbjct  151  CGELLKQFDLTDDD  164



>ref|XP_002307104.1| hypothetical protein POPTR_0005s08000g [Populus trichocarpa]
 gb|EEE94100.1| hypothetical protein POPTR_0005s08000g [Populus trichocarpa]
Length=157

 Score =   115 bits (288),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF V+G+VY DTC CGFET  T Y+  + VR+ C +R    + YS   VT+S G Y I
Sbjct  22   GNPFHVRGRVYCDTCQCGFETKKTTYISGATVRIECKDRTDLQLRYSMEGVTDSTGAYKI  81

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GD+ D +C VVLV S           R+RA VIL+R+NG ++D+ +AN+LGF   + 
Sbjct  82   KVVGDQADRICHVVLVDSPLADCKTVHPVRNRAEVILTRSNGAISDLHYANSLGFVKDEA  141

Query  472  LASCTQVVAQYHLNDD  519
            L  C ++V +   +D+
Sbjct  142  LPGCAELVKKLLESDE  157



>ref|XP_011030966.1| PREDICTED: protein DOWNSTREAM OF FLC [Populus euphratica]
Length=157

 Score =   115 bits (288),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 82/136 (60%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF V+G+VY DTC CGFET  T Y+P + VR+ C +R    + YS   VT+S G Y I
Sbjct  22   GNPFHVRGRVYCDTCQCGFETKKTTYIPGATVRIECKDRTDLQLRYSLEGVTDSTGAYKI  81

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GD+ D +C VVLV S            +RA VIL+R+NG ++D+ +AN+LGF   + 
Sbjct  82   KVVGDQADRICHVVLVDSPLADCKTVHPVLNRAEVILTRSNGAISDLHYANSLGFVKDEA  141

Query  472  LASCTQVVAQYHLNDD  519
            L  C ++V +   +D+
Sbjct  142  LPGCAELVKKLLESDE  157



>ref|XP_006428158.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
 gb|ESR41398.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
Length=250

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G+VY DTC CGFET+AT Y+  +HVR+ C +R++  + YS +  T+S G Y+I
Sbjct  22   GDPFHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNI  81

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V+GD  D +C   L+ S        D GR  ++VIL+R+NG V+++ FAN LGF   +P
Sbjct  82   HVDGDHQDQICYSKLISSPLADCKTADPGRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  472  LASCTQVVAQ  501
            LA C +++ +
Sbjct  142  LAFCPELLKK  151



>dbj|BAJ86956.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=169

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 82/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ DTC  GFET A+ ++  + VR+ C +R T A T S    T+  G Y+I V+
Sbjct  35   FVVRGRVWCDTCRAGFETPASTFIAGAKVRVECKSRSTGAQTCSFEGHTDHTGTYNIPVD  94

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +   +LC+ VLV S D    K  +GR+RA V L+ NNG+ ++VR AN LGF    PLA+
Sbjct  95   DEHEHELCESVLVSSPDTACAKAVAGRERAPVFLNNNNGVASNVRLANALGFEKDTPLAA  154

Query  481  CTQVVAQYHLNDD  519
            C Q++  Y   DD
Sbjct  155  CAQILKMYEEVDD  167



>ref|NP_001064462.2| Os10g0371000 [Oryza sativa Japonica Group]
 dbj|BAF26376.2| Os10g0371000, partial [Oryza sativa Japonica Group]
Length=196

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 83/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ DTC  GFET A+ Y+  + V++ C ++ T A T S    T+  G Y+I VN
Sbjct  62   FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGQTDHTGTYNIPVN  121

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +   +LC+ VLV S D   GK  +GR+RA V L+ NNG+ ++VR AN LGF    PLA+
Sbjct  122  DEHEHELCESVLVSSPDAKCGKIVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLAA  181

Query  481  CTQVVAQYHLNDD  519
            C Q++  Y   DD
Sbjct  182  CAQILKMYEEVDD  194



>ref|XP_003566418.1| PREDICTED: major pollen allergen Lol p 11-like [Brachypodium 
distachyon]
Length=169

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 88/137 (64%), Gaps = 2/137 (1%)
 Frame = +1

Query  115  KP-FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            KP FLV G+VY DTC  GFET A+  +P + V++ C + +TN + + A A T++QG Y +
Sbjct  28   KPGFLVTGRVYCDTCRAGFETNASHSIPGAVVQMECRHFETNELHHKAEATTDAQGWYKM  87

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQ  468
             V  D  +++C+V L++S +    + +  RDR RV L+RNNG+    VR+AN + F  K+
Sbjct  88   EVGEDHQEEICEVALLRSPEKDCAEIEKSRDRCRVPLTRNNGIKQSGVRYANPIAFFRKE  147

Query  469  PLASCTQVVAQYHLNDD  519
            PLA+C  V+ +Y L D+
Sbjct  148  PLANCGDVLRKYDLYDE  164



>ref|XP_004146873.1| PREDICTED: pollen allergen Che a 1-like [Cucumis sativus]
 ref|XP_004169639.1| PREDICTED: pollen allergen Che a 1-like [Cucumis sativus]
 gb|KGN53218.1| hypothetical protein Csa_4G028420 [Cucumis sativus]
Length=163

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G VY DTC CGFET  +  +  + VRL C +R T  + ++  A+T+S+G+Y I V 
Sbjct  29   FVVNGCVYCDTCRCGFETNVSTPISGAKVRLECRDRATWVLKFTKEAITDSKGKYKINVY  88

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             D  D+ C VVLV S      +PD GR+ A VIL+ NNGL +  R+AN +GF  ++PLA 
Sbjct  89   EDHKDESCKVVLVSSPHLGCNRPDVGRNSATVILTNNNGLTSIFRYANAMGFLIRRPLAF  148

Query  481  CTQVVAQY  504
            C  ++ QY
Sbjct  149  CPTILKQY  156



>ref|XP_010527375.1| PREDICTED: major pollen allergen Lol p 11-like [Tarenaya hassleriana]
Length=165

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
             +V+G+ Y D C  GFET+A+ ++P + V+L C +R T  V YS  A+T+  G Y   V+
Sbjct  31   MVVEGRTYCDPCRAGFETSASYFIPGATVKLECKDRKTMDVMYSDEAITDKDGCYKFFVH  90

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             D  D++CDV LVKS D    +   GR++++VIL+  NG+ +  R+ANN+GF  ++P   
Sbjct  91   EDHKDEMCDVKLVKSPDTNCPRISPGREQSQVILNHFNGIASQTRYANNMGFEKEEPDVF  150

Query  481  CTQVVAQYHLNDDN  522
            C +++ QY   D+ 
Sbjct  151  CAELMKQYQELDEE  164



>ref|XP_010521200.1| PREDICTED: major pollen allergen Lol p 11 [Tarenaya hassleriana]
Length=164

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 85/137 (62%), Gaps = 1/137 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G   +V+G+ Y D C  GFET+A+ ++P + V+L C +R T  V ++    T++ G Y  
Sbjct  27   GNTMVVEGRTYCDPCLAGFETSASYFIPGATVKLECKDRKTMKVMHTEETTTDNGGSYKF  86

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V+ D  D +CDV LVKS D    +   GR+++RVIL+ NNG+ +  R+ANN+GF  + P
Sbjct  87   FVHEDHKDQMCDVKLVKSPDTNCPRISPGREQSRVILNHNNGIASQNRYANNMGFEKEAP  146

Query  472  LASCTQVVAQYH-LNDD  519
             A C +++ QY  LN+D
Sbjct  147  DAFCAELLKQYQDLNED  163



>gb|KJB29302.1| hypothetical protein B456_005G093100 [Gossypium raimondii]
Length=161

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 81/134 (60%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
             +V+G VY DTC  GFET  T+ L ++ VRLVC++R +  V +     T+  G+Y I V+
Sbjct  27   LVVEGYVYCDTCRAGFETPKTRSLADAMVRLVCSDRKSGQVVFKKEGYTDKTGKYQIRVS  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             D  D +CD VLVKSS         GR+RARVIL+  NG+ +  R+AN +GF   +P A 
Sbjct  87   EDHLDQICDAVLVKSSQLGCATMSPGRERARVILTNFNGISSTTRYANAMGFMVDEPEAG  146

Query  481  CTQVVAQYHLNDDN  522
            C +++  Y  ++++
Sbjct  147  CAEMMKMYQEDEED  160



>ref|XP_007025385.1| Olee1-like protein [Theobroma cacao]
 gb|EOY28007.1| Olee1-like protein [Theobroma cacao]
Length=170

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 82/138 (59%), Gaps = 3/138 (2%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+GKVY D C   F T  +KY+  + VRL C +R+   +TYS +  T+  G Y I V 
Sbjct  32   FFVEGKVYCDNCRAQFVTKISKYMAGAQVRLECRDREGGDITYSVDGETDESGTYHIKVE  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            GD  +++C+V LV+SSDP   + D     R  AR+ L++ +G+ +D R AN LGF  K+P
Sbjct  92   GDHEEEICEVSLVQSSDPECSEIDKENFLRKSARISLTKYSGITSDSRLANPLGFMVKKP  151

Query  472  LASCTQVVAQYHLNDDNF  525
            L  CT+V+ +  +  D F
Sbjct  152  LPECTEVLRELGITADGF  169



>ref|XP_010535648.1| PREDICTED: major pollen allergen Lol p 11-like [Tarenaya hassleriana]
Length=166

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
             +V+G+ Y D C  GFET+A+ ++P + V+L C +R T  V Y+  A T++ G Y   V+
Sbjct  32   MVVEGRTYCDPCRAGFETSASYFIPGATVKLECKDRKTMEVMYTDEATTDNNGCYKFFVH  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             D  D++CDV LVKS D    +   GR+++RVIL+  NG+ +  R+ANN+GF  ++P   
Sbjct  92   DDHKDEMCDVKLVKSPDTNCPRISPGREQSRVILNHYNGIASQTRYANNMGFEKEEPDVF  151

Query  481  CTQVVAQYHLNDDN  522
            C +++ QY   D+ 
Sbjct  152  CAELLKQYQEFDEE  165



>gb|EMS52933.1| hypothetical protein TRIUR3_31283 [Triticum urartu]
Length=169

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 81/133 (61%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ DTC  GFET A+ ++  + VR+ C +R T A T S    T+  G Y+I V 
Sbjct  35   FVVRGRVWCDTCRAGFETPASTFIAGAKVRVECKSRSTGAQTCSFEGHTDHTGTYNIPVA  94

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +   +LC+ VLV S D    K  +GR+RA V L+ NNG+ ++VR AN LGF    PLA+
Sbjct  95   DEHEHELCESVLVSSPDTACAKAVAGRERAPVFLNNNNGVASNVRLANALGFEKDTPLAA  154

Query  481  CTQVVAQYHLNDD  519
            C Q++  Y   DD
Sbjct  155  CAQILKMYEEVDD  167



>ref|XP_010942359.1| PREDICTED: major pollen allergen Lol p 11-like [Elaeis guineensis]
Length=174

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 83/136 (61%), Gaps = 0/136 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            K F++ G+VY DTC  GFET  T  +P + VRL C    T+ +TY A A T   G Y ++
Sbjct  38   KDFVLTGRVYCDTCRAGFETDITSSMPGAKVRLECKRYGTDELTYEAEATTQLSGMYQMI  97

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V  D  +D C VVLVKSS     + + GRDR R+ L+++ GL+++ R AN LGF   +PL
Sbjct  98   VPDDHSNDQCSVVLVKSSFNKCTEIEPGRDRVRITLAQDGGLLSNSRQANALGFLIDEPL  157

Query  475  ASCTQVVAQYHLNDDN  522
             SC +++ +Y   +D+
Sbjct  158  PSCGKLLQKYGFANDD  173



>gb|ACQ44229.1| putative pollen Ole e 1 allergen and extensin family protein 
[Arabis alpina]
 gb|KFK25306.1| hypothetical protein AALP_AA8G095400 [Arabis alpina]
Length=164

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 76/136 (56%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + VR+VC +R T        AVT  +G Y +
Sbjct  25   GTPFHIEGTVYCDTCRFGFETIATKYIIGAKVRVVCKDRVTLKSEVVGQAVTGRRGRYRV  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GDR D  C   LVKSS P     D GR  A VIL+R+NG  +   FAN +GF   QP
Sbjct  85   AVTGDRQDQQCLAELVKSSMPDCHVADPGRSTATVILTRSNGAASTRHFANAMGFFRDQP  144

Query  472  LASCTQVVAQYHLNDD  519
            L  C  +  +Y  + D
Sbjct  145  LRGCAALRKRYLADGD  160



>ref|XP_004971474.1| PREDICTED: pollen allergen Phl p 11-like [Setaria italica]
Length=168

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 80/136 (59%), Gaps = 1/136 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G  F+V G+VY D C  GFET  +K +P + V +VC     +  T  A A T+  G Y +
Sbjct  28   GGGFVVTGRVYCDPCRAGFETNVSKSVPGATVEVVCRQFGASKETLKAEATTDEYGWYKL  87

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQ  468
             ++ D  D++C+ VL KSSDP   + +  RDRARV L+ NNG+    VR+AN + F  K 
Sbjct  88   EIDQDHQDEICEAVLAKSSDPACAEVEEFRDRARVPLTSNNGIKQQGVRYANPIAFFRKD  147

Query  469  PLASCTQVVAQYHLND  516
            PL  C Q++++Y L D
Sbjct  148  PLKECGQILSKYDLKD  163



>ref|XP_008782123.1| PREDICTED: pollen-specific protein C13-like [Phoenix dactylifera]
Length=175

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 81/131 (62%), Gaps = 4/131 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ DTC  GFET  T Y+  + VR+ C +R T A T S +  T+  G Y+ILV 
Sbjct  41   FVVQGRVFCDTCRAGFETPKTTYIAGAKVRVECRSRTTGAKTCSFDGTTDGSGAYNILVA  100

Query  301  GDRGDDLCDVVLVKSSDPLSG--KPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
             +   + C+ +LV  S P+ G  K   GR+RARV L+ NNG+ +  RFAN+LGF    PL
Sbjct  101  DEHEHETCEAMLV--SSPVKGCDKMLEGRERARVFLTHNNGIASSKRFANSLGFQKDIPL  158

Query  475  ASCTQVVAQYH  507
            A C Q++  YH
Sbjct  159  AGCAQLLEMYH  169



>ref|NP_001237189.1| uncharacterized protein LOC100305566 precursor [Glycine max]
 gb|ACU13310.1| unknown [Glycine max]
Length=162

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF VKG+VY   C  GFET+AT Y+  + + L C +R +N V Y+    T+S G Y++ V
Sbjct  27   PFCVKGRVYCGPCRAGFETSATTYIAGAEIMLQCKSRVSNEVVYTKKGYTDSTGAYTMCV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D +C   LV S  P   +   GRD A VI +R NG+ +D RFAN +GF +++  +
Sbjct  87   DEDHADQICSAKLVSSPHPQCKEVTPGRDEAVVIPTRYNGIASDDRFANAMGFMSQEVAS  146

Query  478  SCTQVVAQYHLNDDN  522
             C +++ QY   D+ 
Sbjct  147  GCAEILRQYQEFDNE  161



>ref|XP_008453801.1| PREDICTED: major pollen allergen Lol p 11-like [Cucumis melo]
Length=163

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G VY DTC CGFET  +  +  + VRL C +R T  + ++  A TNS+G+Y I V 
Sbjct  29   FVVNGCVYCDTCRCGFETNVSTPVSGAKVRLECRDRATWVLKFTKEATTNSKGKYKIDVY  88

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             D  D+ C VVLV S      +PD GR+ A VIL+ NNGL +  R+AN +GF  ++PLA 
Sbjct  89   EDHKDESCKVVLVSSPHRGCDRPDIGRNSATVILTNNNGLTSISRYANAMGFLIRRPLAF  148

Query  481  CTQVVAQY  504
            C  ++ QY
Sbjct  149  CPTILKQY  156



>gb|KFK42186.1| hypothetical protein AALP_AA2G222600 [Arabis alpina]
Length=168

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 84/135 (62%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G+ Y +TC  GFET  + Y +  + V+LVC NR T    Y+A  V+  +G+Y  +V
Sbjct  33   LVVQGRTYCETCKFGFETPESSYFISGATVKLVCKNRKTMEKVYTAETVSGKEGKYQFVV  92

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D++CDV+LVKSSD    K   GR+ +RVIL+  NG+ + +R ANN+GF       
Sbjct  93   HEDHKDEMCDVMLVKSSDASCSKITEGREMSRVILNHYNGIASQIRHANNMGFEKDVSDV  152

Query  478  SCTQVVAQYHLNDDN  522
             C++++ +Y +++D 
Sbjct  153  FCSELIKKYQVDEDE  167



>ref|XP_009383585.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=169

 Score =   113 bits (283),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            + F+V+G+V+ DTC  GFET A+ Y+  + V + C +R T A T S +  T+  G Y+IL
Sbjct  34   RGFVVQGRVFCDTCRAGFETPASTYIRGAKVSVECRSRITGAKTCSFDGTTDHTGTYNIL  93

Query  295  VNGDRGD-DLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            +  +  D ++C+ VLV S +        GR+RARV LSRNNG+ +D RFAN+LGFT   P
Sbjct  94   IADEHDDHEICESVLVSSPESGCKTVLRGRERARVFLSRNNGIASDTRFANSLGFTKDTP  153

Query  472  LASCTQVVAQYH  507
            L+ CTQ++  Y 
Sbjct  154  LSICTQLLKTYE  165



>ref|XP_008376286.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008343323.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008353938.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_009369651.1| PREDICTED: pollen-specific protein C13-like [Pyrus x bretschneideri]
Length=159

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 76/133 (57%), Gaps = 0/133 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V+GKVY DTC  G+ET A  Y+  + VRL C ++ + A+ Y+    T+S G Y I V
Sbjct  26   PFTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKSSMALVYTKEGTTDSAGCYKIPV  85

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
              D  D  CD VLV S          GR+RARVIL+  NG+ +  RFAN +GF   + L+
Sbjct  86   AEDHLDQFCDAVLVSSPQKDCATVSPGRERARVILTGYNGIASYTRFANAMGFMRTEALS  145

Query  478  SCTQVVAQYHLND  516
             CTQ++ +    D
Sbjct  146  GCTQILKELQELD  158



>ref|XP_010942360.1| PREDICTED: pollen allergen Phl p 11-like [Elaeis guineensis]
Length=174

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 84/136 (62%), Gaps = 0/136 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            K F ++G+VY DTC  GFET  T Y+P + VRL C    T+ +TY A A T+  G Y + 
Sbjct  38   KDFTLEGRVYCDTCRTGFETDLTTYMPGAKVRLECMRYGTDELTYKAEATTDFLGIYQMT  97

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V  D  +D C VVLVKSS     + + GRDR R+ L+++ GL++++R AN LG+   +PL
Sbjct  98   VPDDHSNDQCSVVLVKSSLDNCTEIEPGRDRVRITLAQDGGLLSNIRQANALGYLIDKPL  157

Query  475  ASCTQVVAQYHLNDDN  522
              C +++ +Y   +D+
Sbjct  158  LECGKLLQKYGFANDD  173



>ref|XP_008378536.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=218

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 78/134 (58%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF V+GKVY DTC  G+ET A  Y+  + VRL C ++ + A+ Y+    T+S G Y I V
Sbjct  85   PFTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKTSMALLYTKEGTTDSAGCYKIPV  144

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
              D  D  CD VLV S          GR+RARVIL+ NNG+ +  RFAN +GF   + L+
Sbjct  145  AEDHLDQFCDAVLVSSPQKDCATVSPGRERARVILTANNGIASYNRFANAMGFMRTEALS  204

Query  478  SCTQVVAQYHLNDD  519
             CTQ++ +    D+
Sbjct  205  GCTQILKELQELDE  218



>ref|XP_006661725.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=175

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ DTC  GFET A+ Y+  + V++ C ++ T A T S    T+  G Y+I V+
Sbjct  40   FVVRGRVWCDTCLAGFETPASTYIAGAKVKVECRSKSTGAKTCSFEGETDHTGTYNIAVD  99

Query  301  GDRGDDLCDVVLVKSSDPLS-GKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
             +   +LC+ VLV S D    GK  +GR+RA V L+ NNG+ ++VR AN LGF    PLA
Sbjct  100  DEHEHELCESVLVSSPDAARCGKAVAGRERAPVFLTNNNGVTSNVRLANALGFQKDAPLA  159

Query  478  SCTQVVAQYHLNDD  519
            +C Q++  Y   DD
Sbjct  160  ACAQIMKMYEEVDD  173



>ref|XP_006399503.1| hypothetical protein EUTSA_v10014875mg [Eutrema salsugineum]
 gb|ESQ40956.1| hypothetical protein EUTSA_v10014875mg [Eutrema salsugineum]
Length=164

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 79/141 (56%), Gaps = 1/141 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PFLV+G+VY DTC  GFET ATKY+  + VR+VC +  T        AVT   G YSI
Sbjct  25   GTPFLVEGRVYCDTCRFGFETIATKYIIGATVRIVCKDGVTLKQEVVGEAVTGGLGTYSI  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GDR D  C   LVKSS       D GR  A VIL+R+NG  +   FAN +G+   QP
Sbjct  85   AVTGDRHDQQCQAELVKSSMHDCHVADPGRSTATVILTRSNGAASTRHFANAMGYLRDQP  144

Query  472  LASCTQVVAQYHLNDDNF*AI  534
            L  C  +   Y L+D +  AI
Sbjct  145  LPGCAALRKLY-LSDGDARAI  164



>ref|XP_009106450.1| PREDICTED: protein DOWNSTREAM OF FLC [Brassica rapa]
Length=165

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 84/136 (62%), Gaps = 1/136 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G  Y DTC  GFET  + Y +P + V+LVC +R T    Y+  A +N  G+Y  +V
Sbjct  30   LVVQGITYCDTCKFGFETAESSYTVPGATVKLVCRDRKTMKELYTDVATSNRHGKYMFVV  89

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D++CDV+LVKSSD    K   GR+++RVIL+  NG+ + +R ANN+GF       
Sbjct  90   HEDHKDEMCDVMLVKSSDKGCSKISKGREQSRVILNHYNGIASQIRHANNMGFEKDVSDV  149

Query  478  SCTQVVAQYHLNDDNF  525
             C++++ +Y +++D  
Sbjct  150  FCSELIKKYQVDEDEI  165



>ref|XP_010472003.1| PREDICTED: major pollen allergen Lol p 11-like [Camelina sativa]
Length=171

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 84/135 (62%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G+ Y DTC  GFET  + Y +P + V+LVC +R T    YS  AV++ +G Y  +V
Sbjct  30   MVVEGRTYCDTCKFGFETPESSYFIPGATVKLVCKHRQTMEEVYSDVAVSDKKGNYKFVV  89

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D++CDV+LVKSSD    K   GR+++RVIL+  +G+ + +R ANN+GF       
Sbjct  90   HDDHKDEMCDVMLVKSSDKSCAKISVGREQSRVILNHYSGIASQIRHANNMGFEKDVSDI  149

Query  478  SCTQVVAQYHLNDDN  522
             C+ +  +Y +N+D 
Sbjct  150  FCSALFQKYMVNEDE  164



>emb|CDX87484.1| BnaA07g33890D [Brassica napus]
Length=165

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 84/136 (62%), Gaps = 1/136 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G  Y DTC  GFET  + Y +P + V+LVC +R T    Y+  A +N  G+Y  +V
Sbjct  30   LVVQGITYCDTCKFGFETAESSYTVPGATVKLVCRDRKTMKELYTDVATSNRHGKYMFVV  89

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D++CDV+LVKSSD    K   GR+++RVIL+  NG+ + +R ANN+GF       
Sbjct  90   HEDHKDEMCDVMLVKSSDKGCSKISKGREQSRVILNHYNGIASQIRHANNMGFEKDVSDV  149

Query  478  SCTQVVAQYHLNDDNF  525
             C++++ +Y +++D  
Sbjct  150  FCSELIKKYQVDEDEI  165



>ref|XP_003638771.1| Pollen allergen Phl p [Medicago truncatula]
 gb|ACJ86158.1| unknown [Medicago truncatula]
 gb|AFK43522.1| unknown [Medicago truncatula]
 gb|KEH34886.1| pollen Ole e I family allergen [Medicago truncatula]
Length=162

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF +KG+V  D C  G+ET+A  ++  + V LVC  R TN V ++    T++ GEY+I V
Sbjct  27   PFCLKGRVVCDPCRAGYETSAITHIAGADVMLVCKQRITNEVVFTKPGKTDATGEYTIYV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + DR DD+CDV L+ S +    +   GRD+ARVIL+R NG+ ++ RFAN + +  ++  +
Sbjct  87   DQDRADDVCDVQLINSPERSCSEKAPGRDQARVILTRYNGISSNDRFANAMLYMAEEVAS  146

Query  478  SCTQVVAQYH-LNDDN  522
             C +V+ Q   L+++N
Sbjct  147  GCAEVLKQMQELDEEN  162



>ref|XP_010428908.1| PREDICTED: major pollen allergen Lol p 11-like [Camelina sativa]
Length=171

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 85/135 (63%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G+ Y DTC  GFET  + Y +P + V+LVC +R T    Y+  AV++ +G Y  +V
Sbjct  30   MVVEGRTYCDTCKFGFETPESSYFIPGATVKLVCKHRQTMEEVYTDVAVSDKKGNYKFVV  89

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D++CDV+LVKSSD   GK   GR+++RVIL+  +G+ + +R ANN+GF       
Sbjct  90   HDDHKDEMCDVLLVKSSDKSCGKISVGREKSRVILNHYSGIASQIRHANNMGFEKDVSDI  149

Query  478  SCTQVVAQYHLNDDN  522
             C+ +  +Y +++D 
Sbjct  150  FCSALFQKYMVDEDE  164



>emb|CDX88408.1| BnaC06g38520D [Brassica napus]
Length=165

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 84/135 (62%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G  Y DTC  GFET  + Y +P + V+LVC +R T    Y+  A +N  G+Y  +V
Sbjct  30   LVVQGVTYCDTCKFGFETAESSYTVPGATVKLVCRDRKTMKELYTNVATSNRHGKYMFVV  89

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D++CDV+LVKSSD    K   GR+++RVIL+  NG+ + +R ANN+GF       
Sbjct  90   HEDHKDEMCDVMLVKSSDKGCSKISKGREQSRVILNHYNGIASQIRHANNMGFEKDVSDV  149

Query  478  SCTQVVAQYHLNDDN  522
             C++++ +Y +++D 
Sbjct  150  FCSELIKKYQVDEDE  164



>gb|KHG30321.1| Anther-specific LAT52 [Gossypium arboreum]
Length=161

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 81/134 (60%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
             +V+G VY DTC  GFET  T+ L ++ V+LVC++R T  V +     T+  G+Y I V+
Sbjct  27   LVVEGYVYCDTCRAGFETPKTRRLADAMVKLVCSDRKTGGVVFEKEGYTDKTGKYQIRVS  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             D  D +CD VLVKS          GR+RARVIL+ +NG+ +  R+AN++GF   +  A 
Sbjct  87   EDHLDQICDAVLVKSPQLGCATMSPGRERARVILTNSNGISSTTRYANSMGFMVDKAEAG  146

Query  481  CTQVVAQYHLNDDN  522
            C +++  Y  ++++
Sbjct  147  CAEMMKMYREDEED  160



>ref|XP_009409254.1| PREDICTED: major pollen allergen Lol p 11-like [Musa acuminata 
subsp. malaccensis]
Length=168

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ DTC  GFET  + Y   + VR+ C ++ T A T +    T+  G Y+ILV 
Sbjct  36   FVVQGRVFCDTCRAGFETPVSTYTKGAKVRIECRSKATGAKTCNFEGTTDHTGTYNILVA  95

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +   ++C+ +LV S +     P  GR+RARV LS NNG+ +D R+AN+LGF T  PL+ 
Sbjct  96   DEHEHEICESMLVSSPESRCKTPLQGRERARVFLSHNNGIASDTRYANSLGFQTDTPLSV  155

Query  481  CTQVVAQY  504
            C +++  Y
Sbjct  156  CAELLKTY  163



>ref|XP_006601773.1| PREDICTED: uncharacterized protein LOC100527053 isoform X1 [Glycine 
max]
 gb|KHN31359.1| Pollen-specific protein C13 [Glycine soja]
Length=157

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 82/135 (61%), Gaps = 2/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F VKG VY DTC  GFET AT Y+  + V + C  R T  V + +  VT+S G Y I V 
Sbjct  23   FHVKGSVYCDTCRAGFETNATFYIRGARVGIQCKERKTMKVAFYSEGVTDSTGTYHIEVE  82

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSR-NNGLVNDVRFANNLGFTTKQPLA  477
             D  D++C+ +LVKS       PDSGRD++ ++L+   NG+VN + +AN +G+   +PL 
Sbjct  83   NDHRDNICECLLVKSPIKWCSTPDSGRDKSSIVLTHYQNGIVNHLHYANAMGYLRDEPLP  142

Query  478  SCTQVVAQYHLNDDN  522
             C +++ +Y+L D +
Sbjct  143  ECHKLL-KYYLADSD  156



>ref|XP_010911793.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=175

 Score =   110 bits (276),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 78/131 (60%), Gaps = 0/131 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            K F+V+G+V+ DTC  GFET  + Y+  + VRL C +R T A T S + VT+  G Y+IL
Sbjct  39   KGFVVQGRVFCDTCRAGFETPKSTYIAGAKVRLECRSRTTGAKTCSFDGVTDRSGTYNIL  98

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V  +   + C+ VLV S      K   GR+RARV L+ NNG+ +  RFAN+LGF     L
Sbjct  99   VADEHEHETCEAVLVSSPVKGCAKTLEGRERARVFLTNNNGIASTKRFANSLGFQRDIAL  158

Query  475  ASCTQVVAQYH  507
            A C Q++  Y 
Sbjct  159  AGCAQLLKMYQ  169



>gb|AAN76546.1|AF393475_1 LLP-B3 protein [Lilium longiflorum]
Length=160

 Score =   110 bits (275),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 82/132 (62%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+VY D+C  GFET  T Y+  + V+L C + D +++ ++   VTNS G YSI + 
Sbjct  28   FIVEGRVYCDSCRAGFETNITTYIEGAKVKLECRHFDNDSIAHTVEGVTNSTGTYSIQLE  87

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             D   ++C+VVLV S      + D  RDRARV L+ NNG+ + +R+AN+LGF  +QP   
Sbjct  88   NDHESEICEVVLVSSPIFDCNEIDYDRDRARVTLTNNNGIDSPIRYANSLGFLQEQPDII  147

Query  481  CTQVVAQYHLND  516
            C  ++  Y + D
Sbjct  148  CGDLLKAYGIAD  159



>ref|NP_001057857.1| Os06g0556600 [Oryza sativa Japonica Group]
 dbj|BAD53560.1| putative pollen allergen Phl p 11 [Oryza sativa Japonica Group]
 dbj|BAD54134.1| putative pollen allergen Phl p 11 [Oryza sativa Japonica Group]
 dbj|BAF19771.1| Os06g0556600 [Oryza sativa Japonica Group]
 gb|EAZ01328.1| hypothetical protein OsI_23359 [Oryza sativa Indica Group]
 gb|EAZ37341.1| hypothetical protein OsJ_21682 [Oryza sativa Japonica Group]
 dbj|BAG93005.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score =   110 bits (275),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G+VY D C  GFET  +K +P + V + C +      +  A A T+ +G Y + ++
Sbjct  38   FVVTGRVYCDPCRAGFETNVSKSIPGATVSVECRHYGAGRESLKAEATTDEKGWYKVEID  97

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGL-VNDVRFANNLGFTTKQPLA  477
             D  +++C+VVL KSSDP   + +  RDR+RV L+ NNGL  N +R+AN + F  K+PLA
Sbjct  98   QDHQEEICEVVLDKSSDPACSETEKTRDRSRVPLTSNNGLKQNGIRYANPIAFFRKEPLA  157

Query  478  SCTQVVAQYHLND  516
             C  ++ +Y L D
Sbjct  158  DCGSILQKYDLKD  170



>gb|EAY93952.1| hypothetical protein OsI_15725 [Oryza sativa Indica Group]
Length=165

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 84/135 (62%), Gaps = 0/135 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            ++V+G+VY DTC  GFET  T+Y+  + VRL C +  T+ V  + + VT+  G Y I + 
Sbjct  30   YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
                +D+C+VVLV S      + ++ RDRARV+L+RN G+ +++R AN LG+    PL  
Sbjct  90   DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIPLPV  149

Query  481  CTQVVAQYHLNDDNF  525
            C  ++ Q+ L DD++
Sbjct  150  CGALLKQFDLADDDY  164



>ref|XP_009396935.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 82/133 (62%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
             +V+G+VY DTC  GFETTAT+Y+  + V+L C N  T  + ++  A T++ G+Y I V 
Sbjct  30   IVVEGRVYCDTCRAGFETTATEYIAGAKVKLECKNYTTGEIIHTNQATTDATGKYQITVV  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             D  ++ C V L+ S      +   GR+ A V+++ N G+ + VR+AN+LGF  ++PL +
Sbjct  90   DDHQEETCQVTLISSPRSDCSEISEGRNSALVVVTHNVGITSGVRYANSLGFLKEKPLET  149

Query  481  CTQVVAQYHLNDD  519
            C Q++ QY L  D
Sbjct  150  CGQLLLQYALGVD  162



>ref|XP_007048005.1| Pollen-specific protein C13, putative [Theobroma cacao]
 gb|EOX92162.1| Pollen-specific protein C13, putative [Theobroma cacao]
Length=157

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            +PF + GKVY D C  GFET+   Y+P + V + C +R T ++ +S  AVT+S G Y IL
Sbjct  23   EPFRIVGKVYCDGCRAGFETSKCSYIPGATVEVKCYDRTTLSLKFSVGAVTDSTGTYDIL  82

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V  D  D +C   LV S  P     D  R++A VIL+R+NG+++++ +AN +GF   +P 
Sbjct  83   VEDDHQDQICYASLVSSPIPSCRNADPRRNKATVILTRSNGVISNLHYANAMGFLQDEPE  142

Query  475  ASCTQVVAQYHLNDD  519
            A C +++ Q  L DD
Sbjct  143  AGCQELL-QKLLEDD  156



>ref|XP_007141147.1| hypothetical protein PHAVU_008G171500g [Phaseolus vulgaris]
 gb|ESW13141.1| hypothetical protein PHAVU_008G171500g [Phaseolus vulgaris]
Length=160

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 80/135 (59%), Gaps = 0/135 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF VKG+VY D C  GFET  T Y+  + V + C +R    + YS    T+S G Y+I V
Sbjct  24   PFYVKGRVYCDPCRAGFETPLTTYIAGAEVTMECRDRMRGNIVYSKKVKTDSSGSYTIFV  83

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + ++ +  CD  LV S      +P  GRD +RV+L+R NG+  + RF NNLGF  ++  +
Sbjct  84   DANQANQNCDASLVTSPLRDCREPTPGRDHSRVVLNRFNGIATNDRFVNNLGFMKQKVAS  143

Query  478  SCTQVVAQYHLNDDN  522
            +C +++ +Y  +DD+
Sbjct  144  ACAKILRRYREHDDD  158



>emb|CDY40079.1| BnaC02g00510D [Brassica napus]
Length=164

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 78/141 (55%), Gaps = 1/141 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + VR++C +R T        AVT  +G Y +
Sbjct  25   GTPFHIEGSVYCDTCRFGFETVATKYITGARVRIMCKDRVTLKQDVVGEAVTGHRGIYKV  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GDR D  C   LV S       PD GR  A VIL+R+NG  +   FAN +GF   +P
Sbjct  85   AVKGDRQDQQCFAKLVHSPLRKCQVPDPGRSTATVILTRSNGAASTRHFANAMGFFRDEP  144

Query  472  LASCTQVVAQYHLNDDNF*AI  534
            L  C   + +Y+L D +  AI
Sbjct  145  LRGCA-ALRRYYLADGDSRAI  164



>ref|XP_010416770.1| PREDICTED: major pollen allergen Lol p 11-like [Camelina sativa]
Length=171

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 83/135 (61%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G+ Y DTC  GFET  + Y +P + V+LVC +R T    YS  AV++ +G Y  +V
Sbjct  30   MVVEGRTYCDTCKFGFETPESSYFIPGATVKLVCKHRQTMEEVYSDVAVSDKKGNYKFVV  89

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D++CDV+LVKSSD    K   GR+++RVIL+  +G+ + +R ANN+GF       
Sbjct  90   HDDHKDEMCDVMLVKSSDKSCAKISVGREQSRVILNHYSGIASQIRHANNMGFEKDVSDI  149

Query  478  SCTQVVAQYHLNDDN  522
             C+ +  +Y ++ D 
Sbjct  150  FCSALFQKYMVDADE  164



>emb|CAH66537.1| H0209H04.4 [Oryza sativa Indica Group]
 gb|AFI71825.1| pollen specific protein [Oryza sativa]
Length=165

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            ++V+G+VY DTC  GFET  T+Y+  + VRL C +  T+ V  + + VT+  G Y I + 
Sbjct  30   YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
                +D+C+VVLV S      + ++ RDRARV+L+RN G+ +++R AN LG+    PL  
Sbjct  90   DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIPLPV  149

Query  481  CTQVVAQYHLNDDN  522
            C  ++ Q+ L DD+
Sbjct  150  CGALLKQFDLADDD  163



>emb|CDX85777.1| BnaA02g00360D [Brassica napus]
Length=164

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 78/141 (55%), Gaps = 1/141 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + VR++C +R T        AVT  +G Y +
Sbjct  25   GTPFHIEGSVYCDTCRFGFETVATKYITGARVRILCKDRVTLKQDVVGEAVTGHRGIYKV  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GDR D  C   LV S       PD GR  A VIL+R+NG  +   FAN +GF   +P
Sbjct  85   AVKGDRQDQQCFAELVHSPLRKCQVPDPGRSTATVILTRSNGAASTRHFANAMGFFRDEP  144

Query  472  LASCTQVVAQYHLNDDNF*AI  534
            L  C   + +Y+L D +  AI
Sbjct  145  LRGCA-ALRRYYLADGDSRAI  164



>ref|XP_009125327.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Brassica rapa]
Length=166

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 78/141 (55%), Gaps = 1/141 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + VR++C +R T        AVT  +G Y +
Sbjct  27   GTPFHIEGSVYCDTCRFGFETVATKYITGARVRILCKDRVTLKQDVVGEAVTGHRGIYKV  86

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GDR D  C   LV S       PD GR  A VIL+R+NG  +   FAN +GF   +P
Sbjct  87   AVKGDRQDQQCFAELVHSPLRKCQVPDPGRSTATVILTRSNGAASTRHFANAMGFFRDEP  146

Query  472  LASCTQVVAQYHLNDDNF*AI  534
            L  C   + +Y+L D +  AI
Sbjct  147  LRGCA-ALRRYYLADGDSRAI  166



>ref|NP_001052674.1| Os04g0398700 [Oryza sativa Japonica Group]
 emb|CAE05158.2| OSJNBa0039C07.14 [Oryza sativa Japonica Group]
 dbj|BAF14588.1| Os04g0398700 [Oryza sativa Japonica Group]
 gb|EAZ30594.1| hypothetical protein OsJ_14643 [Oryza sativa Japonica Group]
Length=165

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            ++V+G+VY DTC  GFET  T+Y+  + VRL C +  T+ V  + + VT+  G Y I + 
Sbjct  30   YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
                +D+C+VVLV S      + ++ RDRARV+L+RN G+ +++R AN LG+    PL  
Sbjct  90   DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDIPLPI  149

Query  481  CTQVVAQYHLNDDN  522
            C  ++ Q+ L DD+
Sbjct  150  CGALLKQFDLADDD  163



>ref|XP_008803750.1| PREDICTED: pollen-specific protein C13 [Phoenix dactylifera]
Length=176

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 80/130 (62%), Gaps = 4/130 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+++ DTC  GFET  T Y+  + VR+ C +R T A T S + VT+  G Y+ILV 
Sbjct  42   FVVEGRIFCDTCQAGFETPKTTYIAGAKVRVECQSRTTGAKTCSFDGVTDRSGTYNILVA  101

Query  301  GDRGDDLCDVVLVKSSDPLSG--KPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
             +   + C+ VLV  S P+ G  K   GR+R+ V L+ NNG+ +D RFAN+LGF    PL
Sbjct  102  DEHEHETCESVLV--SSPVKGCDKILKGRERSPVFLTHNNGIASDKRFANSLGFQNDIPL  159

Query  475  ASCTQVVAQY  504
              C Q++  Y
Sbjct  160  EGCAQLMEMY  169



>gb|KCW69946.1| hypothetical protein EUGRSUZ_F03264 [Eucalyptus grandis]
Length=167

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 1/126 (1%)
 Frame = +1

Query  127  VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  306
            V GKV+ DTC   FET  +  L +S VRL C NR + A+T SA AVT+  GEY + V GD
Sbjct  32   VVGKVFCDTCRVDFETKVSYGLADSKVRLECHNRTSGALTLSAEAVTDKTGEYRLEVEGD  91

Query  307  RGDDLCDVVLVKSSDP-LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  483
              +++C+V L++SS+P  S   +     ARV L+  NG+    RFAN L F  K+ LA C
Sbjct  92   HEEEICEVQLIESSEPECSSLLEGAVHNARVALTNKNGVAQPARFANALAFAKKETLADC  151

Query  484  TQVVAQ  501
             QV+ +
Sbjct  152  AQVLLE  157



>gb|AAM78186.1| putative SAH7 protein [Gossypium raimondii]
Length=119

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 71/118 (60%), Gaps = 0/118 (0%)
 Frame = +1

Query  130  KGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDR  309
            +G VY DTC  GFET  T+ L ++ VRLVC++R +  V +     T+  G+Y I V+ D 
Sbjct  1    EGYVYCDTCRAGFETPKTRSLADAMVRLVCSDRKSGQVVFKKEGYTDKTGKYQIRVSEDH  60

Query  310  GDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  483
             D +CD VLVKSS         GR+RARVIL+  NG+ +  R+AN +GF   +P A C
Sbjct  61   LDQICDAVLVKSSQLGCATMSPGRERARVILTNFNGISSTTRYANAMGFMVDEPEAGC  118



>ref|NP_177927.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 ref|NP_001077838.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAM64292.1| allergen, putative [Arabidopsis thaliana]
 gb|AAO42838.1| At1g78040 [Arabidopsis thaliana]
 dbj|BAE99504.1| phosphoglycerate mutase 1 like protein [Arabidopsis thaliana]
 gb|AEE36060.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AEE36061.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=171

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G  Y D C  GFET  + Y +P + V+L C +R T    Y+  AV++ +G+Y  +V
Sbjct  30   MVVQGSTYCDICKFGFETPESSYFIPGATVKLSCKDRKTMEEVYTDKAVSDKEGKYKFIV  89

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + D  D +CDV+LVKSSD    K   GR+++RVIL+  +G+ + +R ANN+GF  +    
Sbjct  90   HDDHRDQMCDVLLVKSSDKTCSKISVGREKSRVILNHYSGIASQIRHANNMGFEKEVSDV  149

Query  478  SCTQVVAQYHLNDDN  522
             C+ +  +Y +++D 
Sbjct  150  FCSALFQKYMVDEDE  164



>ref|XP_004143635.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004168700.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN50408.1| hypothetical protein Csa_5G172880 [Cucumis sativus]
Length=166

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 81/135 (60%), Gaps = 2/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            FLV+GKVY D C   F T A+K+L  + V+LVC   +  +VT S  AVT+  G YSI  +
Sbjct  28   FLVEGKVYCDACRVQFFTKASKFLEGATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIEAD  87

Query  301  GDRGDDLCDVVLVKSSDPLSGKP--DSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            GD  +DLC+V LVKS+DP   +   +     ARV ++ N+G+ N VR AN L F  K+ L
Sbjct  88   GDHEEDLCEVTLVKSNDPDCSEISLEKYEHMARVSITNNSGITNPVRHANPLAFMKKEKL  147

Query  475  ASCTQVVAQYHLNDD  519
              C +V+ +   +++
Sbjct  148  PECKEVLRELGFDEE  162



>ref|XP_006645671.1| PREDICTED: pollen allergen Phl p 11-like, partial [Oryza brachyantha]
Length=152

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 78/133 (59%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G+VY D C  GFET  +  +P S V + C +         A A T+ +G Y + ++
Sbjct  15   FVVTGRVYCDPCRAGFETNVSSSIPGSTVSVECRHFGGGPERLKAEATTDERGWYKVEID  74

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGL-VNDVRFANNLGFTTKQPLA  477
             D  +++C+ VLVKS DP   + +  RDR+RV L+ NNGL  N VR+AN + F  K+PLA
Sbjct  75   QDHQEEICEAVLVKSGDPKCSETEQFRDRSRVPLTSNNGLKQNGVRYANPIAFFRKEPLA  134

Query  478  SCTQVVAQYHLND  516
             C  ++ +Y L D
Sbjct  135  DCGFILQKYDLKD  147



>ref|XP_010062811.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
Length=196

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 1/126 (1%)
 Frame = +1

Query  127  VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  306
            V GKV+ DTC   FET  +  L +S VRL C NR + A+T SA AVT+  GEY + V GD
Sbjct  61   VVGKVFCDTCRVDFETKVSYGLADSKVRLECHNRTSGALTLSAEAVTDKTGEYRLEVEGD  120

Query  307  RGDDLCDVVLVKSSDP-LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  483
              +++C+V L++SS+P  S   +     ARV L+  NG+    RFAN L F  K+ LA C
Sbjct  121  HEEEICEVQLIESSEPECSSLLEGAVHNARVALTNKNGVAQPARFANALAFAKKETLADC  180

Query  484  TQVVAQ  501
             QV+ +
Sbjct  181  AQVLLE  186



>gb|AAZ67595.1| 80A08_10 [Brassica rapa subsp. pekinensis]
 emb|CDX69860.1| BnaA10g22090D [Brassica napus]
Length=164

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 74/136 (54%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + +++VC +  T        AVT  +G Y +
Sbjct  25   GTPFHIEGCVYCDTCRFGFETIATKYITGAKLKIVCKDSVTLKSEVVGEAVTGRRGRYRV  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GDR D  C  VLV S       PD GR+ A VIL+R+NG  +   FAN +GF   +P
Sbjct  85   SVKGDRQDQQCLAVLVNSPISNCQFPDPGRNTATVILTRSNGAASTRHFANAMGFFRDEP  144

Query  472  LASCTQVVAQYHLNDD  519
            L  C  +  QY    D
Sbjct  145  LRGCATLRKQYLAEGD  160



>ref|XP_004975466.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=163

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 83/134 (62%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+++G+VY DTC  GF+T  T+Y+  + VRL C +  T AV  + + VT+  G Y+I + 
Sbjct  29   FVIQGRVYCDTCRAGFQTNVTEYIKGAKVRLECKHFGTGAVERAIDGVTDESGFYTIKLK  88

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
            G   +D+C+V+L++S      +  +  DRA V+L+++ G+ +D+RF N LG+    PL  
Sbjct  89   GGHEEDICEVILIESPRKDCAEVPAHSDRASVLLAKDAGISDDMRFPNPLGYFKDVPLPV  148

Query  481  CTQVVAQYHLNDDN  522
            C  V+ +Y L+D +
Sbjct  149  CGAVLKEYLLDDQD  162



>ref|XP_009122085.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Brassica rapa]
 ref|XP_009122087.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Brassica rapa]
Length=168

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 74/136 (54%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + +++VC +  T        AVT  +G Y +
Sbjct  29   GTPFHIEGCVYCDTCRFGFETIATKYITGAKLKIVCKDSVTLKSEVVGEAVTGRRGRYRV  88

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GDR D  C  VLV S       PD GR+ A VIL+R+NG  +   FAN +GF   +P
Sbjct  89   SVKGDRQDQQCLAVLVNSPISNCQFPDPGRNTATVILTRSNGAASTRHFANAMGFFRDEP  148

Query  472  LASCTQVVAQYHLNDD  519
            L  C  +  QY    D
Sbjct  149  LRGCATLRKQYLAEGD  164



>ref|NP_196575.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
 sp|Q9LX15.1|DFC_ARATH RecName: Full=Protein DOWNSTREAM OF FLC; Short=AtDFC; AltName: 
Full=Pollen allergen-like protein; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB92054.1| pollen allergen-like protein [Arabidopsis thaliana]
 gb|AAR24213.1| At5g10130 [Arabidopsis thaliana]
 gb|AAT06432.1| At5g10130 [Arabidopsis thaliana]
 gb|AED91497.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
Length=164

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 75/137 (55%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET AT+Y+  + VR+VC +R T        AVT   G+Y +
Sbjct  25   GTPFHIEGSVYCDTCRFGFETIATQYIRGARVRIVCKDRVTLKSELVGVAVTGPDGKYKV  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   +P
Sbjct  85   AVRGDRQDQQCLAELVHSPLSRCQEADPGRSTATVILTRSNGAASTRHYANAMGFFRDEP  144

Query  472  LASCTQVVAQYHLNDDN  522
            L  C  +  +Y  + DN
Sbjct  145  LRGCAALRKRYLADGDN  161



>ref|XP_002873440.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49699.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=164

 Score =   105 bits (262),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 74/136 (54%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + VR+VC +R T        AVT   G+Y +
Sbjct  25   GTPFHIEGCVYCDTCRFGFETIATKYIHGARVRIVCKDRVTLKSELVGVAVTGPNGKYKV  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GDR D  C   LV S      + D GR  A VIL+R+NG  +   FAN +GF   +P
Sbjct  85   AVRGDRQDQQCLAELVHSPLSRCQEADPGRSTATVILTRSNGAASTRHFANAMGFFRDEP  144

Query  472  LASCTQVVAQYHLNDD  519
            L  C  +  +Y  + D
Sbjct  145  LRGCAALRKRYLADGD  160



>ref|XP_009402012.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=160

 Score =   105 bits (262),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 86/134 (64%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+++G+VY DTC  GF+T  ++Y+  + V+L C N +T+AV +   AVT+S G Y I V 
Sbjct  27   FVIEGRVYCDTCRAGFQTAVSQYIAGAKVKLQCRNYETDAVEHLVEAVTDSTGTYHIEVE  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
                +++C+V L++S  P   +    R+RAR++++  +GL +D+R+AN+LGF   +PL  
Sbjct  87   DSHEEEICEVSLLQSPQPGCTEVAQSRNRARILVTGRSGLASDIRYANSLGFLKDEPLQQ  146

Query  481  CTQVVAQYHLNDDN  522
            C  ++ QY L  D+
Sbjct  147  CGLLLQQYALGVDD  160



>ref|XP_010277041.1| PREDICTED: anther-specific protein LAT52 [Nelumbo nucifera]
Length=165

 Score =   105 bits (262),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 77/130 (59%), Gaps = 0/130 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+GKVY DTC   FET  ++ +  + VRL C +R+ + V YS    T++ G Y + V 
Sbjct  30   FFVQGKVYCDTCRTQFETKLSEPISGAKVRLECRSRENDDVAYSVEGETDTTGIYKLPVE  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
            G   +D+C+V L+ S      +P  G D ARV+LS NNG+ +  RFAN+LGF   +P+  
Sbjct  90   GSHEEDICEVKLLSSPRKDCSEPAPGLDHARVLLSSNNGISSASRFANSLGFMVLKPIEG  149

Query  481  CTQVVAQYHL  510
            C+ V+ +  L
Sbjct  150  CSDVLKELGL  159



>ref|XP_008467237.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=166

 Score =   105 bits (262),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 81/135 (60%), Gaps = 2/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            FLV+GKVY D C   F T A+K+L  + V+LVC   +  +VT S  AVT+  G YSI  +
Sbjct  28   FLVEGKVYCDACRVQFFTKASKFLEGATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIEAD  87

Query  301  GDRGDDLCDVVLVKSSDPLSGKP--DSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            GD  ++LC+V LVKS+DP   +   +     ARV ++ N+G+ N VR AN L F  K+ L
Sbjct  88   GDHEEELCEVTLVKSNDPDCSEISLEKYEHMARVSITNNSGITNPVRHANPLAFMKKEKL  147

Query  475  ASCTQVVAQYHLNDD  519
              C +++ +   +++
Sbjct  148  PECKEILRELGFDEE  162



>ref|XP_010547621.1| PREDICTED: protein DOWNSTREAM OF FLC [Tarenaya hassleriana]
Length=166

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F ++G VY DTC  GFET A++Y+P + V++ C +R T      A AVT+  G Y + V 
Sbjct  30   FQIEGCVYCDTCRFGFETDASEYIPGATVKIECKDRVTLRSEEVAKAVTDKGGRYRVTVK  89

Query  301  GDRGDDLCDVVLVKSSDPLSG--KPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            GDR D  C   LV S  P+SG  + D GR  A VIL+R+NG  ++  FAN +GF   QPL
Sbjct  90   GDRQDQQCLAKLVDS--PMSGCQEQDPGRSSATVILTRSNGAASNRHFANAMGFLRSQPL  147

Query  475  ASCTQVVAQYHLNDDNF*AI  534
              C  +  +Y L D +F +I
Sbjct  148  PGCAALRKRY-LADGDFKSI  166



>sp|O49813.1|OLEE1_BETPN RecName: Full=Olee1-like protein; Flags: Precursor [Betula pendula]
 emb|CAA74365.1| putative Ole e 1 protein [Betula pendula]
Length=166

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 81/138 (59%), Gaps = 5/138 (4%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+GKVY D C   F T  + Y+  + V L C NR+   + YS+++ T+  G Y I V+
Sbjct  27   FFVEGKVYCDNCRTQFVTKLSTYMKGAKVSLECRNREGGTLIYSSDSETDKSGTYRIPVD  86

Query  301  GDRGDDLCDVVLVKSSDP----LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQ  468
            GD  +++C++ L KSSDP    +S  P   +  AR+ L++NNG+   VR AN LGF  K+
Sbjct  87   GDHEEEICEIALKKSSDPDCSEVSKDP-FLKKSARISLTKNNGISTPVRLANPLGFMKKK  145

Query  469  PLASCTQVVAQYHLNDDN  522
            PL  C + + +  +N D+
Sbjct  146  PLPECAKALRELGMNPDD  163



>ref|XP_010491667.1| PREDICTED: protein DOWNSTREAM OF FLC [Camelina sativa]
Length=166

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 73/137 (53%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + V++VC +R T        AVT   G+Y +
Sbjct  27   GTPFHIEGCVYCDTCRFGFETIATKYISGARVKIVCKDRVTLKSEVVGKAVTGPDGKYKV  86

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             + GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   QP
Sbjct  87   AIKGDRQDQQCLAELVHSPMSRCHEADPGRSTATVILTRSNGAASTRHYANAMGFFRDQP  146

Query  472  LASCTQVVAQYHLNDDN  522
            L  C  +   Y  + D 
Sbjct  147  LRGCASLRKLYLADGDE  163



>ref|XP_009386950.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=166

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 80/136 (59%), Gaps = 1/136 (1%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            + F+V+G+V+ DTC  GFET  + Y+  + VR+ C +  T A T S    T+  G Y+IL
Sbjct  31   RGFVVQGRVFCDTCRAGFETPVSTYIQGATVRVECRSEFTGAKTCSFEGTTDHTGTYNIL  90

Query  295  VNGDRGD-DLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            V G+  D ++C+ +LV S +        GR+RA V LS NNG+ +D RFAN+LGF     
Sbjct  91   VEGEHDDHEICESLLVSSPESGCKTALQGRERAPVFLSHNNGIASDTRFANSLGFLKDTS  150

Query  472  LASCTQVVAQYHLNDD  519
            L  CT+++  Y   +D
Sbjct  151  LPVCTELLKSYEQYED  166



>ref|XP_010453035.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=166

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 72/137 (53%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + V++VC +R T        AVT   G Y +
Sbjct  27   GTPFHIEGCVYCDTCRFGFETVATKYISGARVKIVCKDRVTLKSEVVGKAVTGPDGRYKV  86

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             + GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   QP
Sbjct  87   AIKGDRQDQQCLAELVHSPMSRCHEADPGRSTATVILTRSNGAASTRHYANAMGFFRDQP  146

Query  472  LASCTQVVAQYHLNDDN  522
            L  C  +   Y  + D 
Sbjct  147  LRGCASLRKLYLADGDE  163



>ref|XP_010422886.1| PREDICTED: protein DOWNSTREAM OF FLC [Camelina sativa]
Length=166

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 72/137 (53%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + V++VC +R T        AVT   G Y +
Sbjct  27   GTPFHIEGCVYCDTCRFGFETVATKYISGARVKIVCKDRVTLKSEVVGKAVTGPDGRYKV  86

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             + GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   QP
Sbjct  87   AIKGDRQDQQCLAELVHSPMSRCHEADPGRSTATVILTRSNGAASTRHYANAMGFFRDQP  146

Query  472  LASCTQVVAQYHLNDDN  522
            L  C  +   Y  + D 
Sbjct  147  LRGCASLRKLYLADGDE  163



>gb|ACK44512.1| AT5G10130-like protein [Arabidopsis arenosa]
Length=184

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 74/136 (54%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + VR+VC +R T        AVT   G+Y +
Sbjct  25   GTPFHIEGCVYCDTCRFGFETIATKYIHGARVRIVCKDRVTLKSELVGEAVTGPNGKYKV  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   +P
Sbjct  85   AVRGDRQDQQCLAELVHSPLSHCQEADPGRSTATVILTRSNGAASTRHYANAMGFFRDEP  144

Query  472  LASCTQVVAQYHLNDD  519
            L  C  +  +Y  + D
Sbjct  145  LRGCAALRKRYLADGD  160



>dbj|BAK06698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            ++V+G+VY DTC  GFET  T+Y+  + VRL C    T+ +  S + VT+  G Y I + 
Sbjct  32   YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECRRFGTDKLERSIDGVTDESGTYKIELK  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
                +D+C++VLV+S  P   +  + R+RA ++LSRN G+ +++R AN LG+   +PL  
Sbjct  92   DSHPEDICEMVLVQSPLPNCNEIQALRNRAEIVLSRNVGISDNIRLANPLGYLKDKPLPV  151

Query  481  CTQVVAQYHLNDDN  522
            C  ++  ++L  D+
Sbjct  152  CPDLLKMFNLTTDD  165



>ref|XP_010057097.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
 gb|KCW74109.1| hypothetical protein EUGRSUZ_E02748 [Eucalyptus grandis]
Length=168

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 82/134 (61%), Gaps = 5/134 (4%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+GKVY DTC   F T  +K +P++ VRL C +R+  +VTYS   VT++ G Y + V+
Sbjct  30   FFVEGKVYCDTCRTQFITKVSKDMPDAKVRLECKDREGGSVTYSIEGVTDNTGMYRLPVD  89

Query  301  GDRGDDLCDVVLVKSSDP----LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQ  468
            G+  +++C++VLVKSS P    +S  P   R  AR+ L++NNG+   VR AN LG+   +
Sbjct  90   GEHEEEICEIVLVKSSQPGCEEVSNDPFL-RKTARISLTKNNGMATPVRQANPLGYMKNE  148

Query  469  PLASCTQVVAQYHL  510
             L  C  V+ +  +
Sbjct  149  SLPECADVLRELGM  162



>ref|XP_006288804.1| hypothetical protein CARUB_v10002136mg [Capsella rubella]
 gb|EOA21702.1| hypothetical protein CARUB_v10002136mg [Capsella rubella]
Length=164

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 72/137 (53%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + V++VC +R T        AVT   G Y +
Sbjct  25   GTPFHIEGCVYCDTCRFGFETIATKYISGARVKIVCKDRVTLKSEVVGKAVTGPDGRYKV  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             + GDR D  C   LV S      + D GR  A VIL+R+NG  +   +AN +GF   QP
Sbjct  85   AIKGDRQDQQCLAELVHSPMSRCHEADPGRSTATVILTRSNGAASTRHYANAMGFFRDQP  144

Query  472  LASCTQVVAQYHLNDDN  522
            L  C  +   Y  + D 
Sbjct  145  LRGCASLRKLYLADGDE  161



>ref|XP_010025486.1| PREDICTED: protein DOWNSTREAM OF FLC [Eucalyptus grandis]
 gb|KCW62152.1| hypothetical protein EUGRSUZ_H04813 [Eucalyptus grandis]
Length=164

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 0/135 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            + F ++G VY DTC  GFET A+ ++  + VR+ C +     + YS + VT+S G++ + 
Sbjct  29   RSFYIQGSVYCDTCRFGFETPASTHIEGAAVRVECKDSTGTQLDYSIDTVTDSNGKWEVT  88

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
            V  D  D LC  VLV S        D GR +A +IL+R+NG ++   +AN++G  T QPL
Sbjct  89   VEDDHDDQLCSAVLVSSPKAGCQTVDPGRSKATLILTRSNGAISSRHYANSMGCLTDQPL  148

Query  475  ASCTQVVAQYHLNDD  519
            A C  +   Y L+ D
Sbjct  149  AECANLRTYYQLDSD  163



>ref|XP_011006522.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=161

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 75/125 (60%), Gaps = 0/125 (0%)
 Frame = +1

Query  127  VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  306
            V+GKVY D C   F+T  ++ +P + V+LVC NRD    TY+    T+S G Y + V GD
Sbjct  29   VEGKVYCDPCRVEFQTKISEGIPAAKVKLVCNNRDNGTETYTVEGATDSSGTYRLSVAGD  88

Query  307  RGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCT  486
              DD+C++ LV+SS P   +P    D A+++L++N G+V+  R+ N LG+  K+    C 
Sbjct  89   HEDDICEIRLVESSRPDCNEPFRSIDSAKILLTKNAGVVDKTRYPNALGYMKKEAQPECA  148

Query  487  QVVAQ  501
             V+ +
Sbjct  149  NVLKE  153



>ref|XP_004983223.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=170

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 77/135 (57%), Gaps = 0/135 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ DTC  GFET  + Y+  + VR+ C ++ T   + +    T+  G Y+ILV 
Sbjct  36   FVVRGRVWCDTCRAGFETPVSTYIAGAKVRVECRSKTTGLKSCTYEGHTDRTGTYNILVT  95

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +  D+LC+ VL+ S D        GR+RA V L+ NNG+ ++VR AN LGF     L  
Sbjct  96   DEHEDELCESVLISSPDMRCATTVPGRERAPVFLTSNNGVASNVRMANALGFQKDVALPR  155

Query  481  CTQVVAQYHLNDDNF  525
            C QV+  Y   DD+ 
Sbjct  156  CAQVLKMYEDEDDHL  170



>gb|AAM78187.1| putative SAH7 protein [Gossypium barbadense]
Length=119

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 0/118 (0%)
 Frame = +1

Query  130  KGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDR  309
            +G VY DTC  GFET  T+ L ++ V+LVC++R T  V +     T+  G+Y I V+ D 
Sbjct  1    EGYVYCDTCRAGFETPKTRRLADAMVKLVCSDRKTGGVVFEKEGYTDKTGKYQIRVSEDH  60

Query  310  GDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  483
             D +CD VLVKS          GR+RARVIL+ +NG+ +  R+AN++GF   +   SC
Sbjct  61   LDQICDAVLVKSPQLGCATMSPGRERARVILTNSNGISSTTRYANSMGFMVDKAAVSC  118



>ref|XP_010478273.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT+S G Y + V 
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYEMEVM  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  468
            GD  ++LC++VLV+S DP  G+ ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92   GDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  469  PLASCTQVVAQYHLNDD  519
            PLA C Q   +  +  D
Sbjct  152  PLADCPQAFKELGIVPD  168



>ref|XP_010499433.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT+S G Y + V 
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYQMEVM  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  468
            GD  ++LC++VLV+S DP  G+ ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92   GDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  469  PLASCTQVVAQYHLNDD  519
            PLA C Q   +  +  D
Sbjct  152  PLADCPQAFKELGIVPD  168



>ref|XP_010460686.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT+S G Y + V 
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYQMEVM  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  468
            GD  ++LC++VLV+S DP  G+ ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92   GDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  469  PLASCTQVVAQYHLNDD  519
            PLA C Q   +  +  D
Sbjct  152  PLADCPQAFKELGIVPD  168



>ref|XP_006370166.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ERP66735.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=161

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 75/125 (60%), Gaps = 0/125 (0%)
 Frame = +1

Query  127  VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  306
            V+GKVY D C   F+T  ++ +P + V+LVC NRD    TY+    T++ G Y + V GD
Sbjct  29   VEGKVYCDPCRVEFQTKISEGIPAAKVKLVCNNRDNGTETYTVEGATDNSGTYRLPVAGD  88

Query  307  RGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCT  486
              DD+C+V LV+SS P   +P    D AR++L++N G+V+  R+ N LG+  K+    C 
Sbjct  89   HEDDICEVRLVESSRPDCNEPFRSIDSARILLTKNVGVVDKTRYPNALGYMKKEAQPECA  148

Query  487  QVVAQ  501
             V+ +
Sbjct  149  DVLKE  153



>ref|XP_003581152.1| PREDICTED: pollen-specific protein C13-like [Brachypodium distachyon]
Length=171

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            ++V+G+VY DTC  GFET  T Y+  + VRL C    T  V  + + VT+  G Y I + 
Sbjct  31   YIVQGRVYCDTCRAGFETNVTTYIKGAKVRLECKRFGTEKVERALDGVTDETGTYKIELK  90

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
                +D+C+VVL++S      K  + RDRARV L+RN G+ +++R AN+LG+    PL  
Sbjct  91   DSHPEDICEVVLIQSPLADCNKIQALRDRARVELTRNIGISDNLRLANSLGYLKDVPLPV  150

Query  481  CTQVVAQYH  507
            C Q++ Q+ 
Sbjct  151  CAQLLKQFK  159



>ref|XP_004502439.1| PREDICTED: pollen-specific protein C13-like [Cicer arietinum]
Length=160

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 81/135 (60%), Gaps = 2/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F VKG VY DTC  GFET AT Y+  + V + C +R++  V +    VT+S G Y+I+V 
Sbjct  26   FHVKGSVYCDTCRAGFETNATFYIQGARVGVRCQDRNSMDVVFYTEGVTDSTGTYNIIVE  85

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSR-NNGLVNDVRFANNLGFTTKQPLA  477
             D  D +C  +LV S       PD GRDR+ ++L+   NG+VN + +AN +G+   +P  
Sbjct  86   KDHHDHICRCLLVSSPIAWCKTPDPGRDRSSIVLTHYKNGVVNHLHYANAMGYLKDKPSP  145

Query  478  SCTQVVAQYHLNDDN  522
             C +++ +Y+L+D +
Sbjct  146  QCHKLL-KYYLSDSD  159



>ref|XP_002523378.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
 gb|EEF38957.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
Length=166

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 74/123 (60%), Gaps = 0/123 (0%)
 Frame = +1

Query  127  VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  306
            V+GKVY DTC   FET  ++ +P + V+L C NR+ N +TY+   VT++ G Y + V G+
Sbjct  32   VEGKVYCDTCRVEFETKLSEVIPGTRVKLECKNRENNTLTYAVEGVTDASGIYRLPVEGE  91

Query  307  RGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCT  486
              +DLC+V L+KS  P   +     D ARV+L+ N G+V   R+ N LGF  ++    C 
Sbjct  92   HEEDLCEVKLIKSGKPDCAEAFKSVDHARVLLTHNVGVVQPTRYTNPLGFMKQKASPECG  151

Query  487  QVV  495
            +V+
Sbjct  152  KVL  154



>ref|XP_010916905.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=175

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 80/130 (62%), Gaps = 4/130 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ DTC  GFET  T Y+  + VR+ C +R T A   S + +T+  G Y+ILV 
Sbjct  41   FVVEGRVFCDTCRAGFETPKTTYIAGAKVRVECRSRMTGAKICSFDGMTDHTGTYNILVA  100

Query  301  GDRGDDLCDVVLVKSSDPLSG--KPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
             +   + C+ VLV  S P+ G  +   GR+RA V L+ NNG+ +D RFAN+LGF    P+
Sbjct  101  DEHEHENCESVLV--SSPVKGCDRILEGRERASVSLTHNNGITSDKRFANSLGFQKNIPV  158

Query  475  ASCTQVVAQY  504
            A C Q++  Y
Sbjct  159  AGCAQLLEMY  168



>ref|XP_003573867.1| PREDICTED: pollen-specific protein C13 [Brachypodium distachyon]
Length=169

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 78/133 (59%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G V+ DTC  GFET A+ Y+  + VR+ C ++ T   T S    T+  G Y+I V+
Sbjct  35   FVVRGSVWCDTCRAGFETPASTYIAGAKVRVECKSKSTGVKTCSFEGHTDHTGTYNISVD  94

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +   +LC+ VLV S D    K  +GR+RA V L+  NG+ ++VR AN LGF     LA+
Sbjct  95   DEHEHELCESVLVSSPDRGCAKLVAGRERAPVFLNNKNGVASNVRLANALGFQKDVALAA  154

Query  481  CTQVVAQYHLNDD  519
            C Q++  Y   +D
Sbjct  155  CAQILKMYQEVED  167



>gb|ACG32277.1| pollen-specific protein C13 precursor [Zea mays]
Length=172

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 77/133 (58%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ D C  GFET A+ Y+  + VR+ C ++ T A T S    T+  G Y+ILV 
Sbjct  38   FVVRGRVWCDNCRAGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVI  97

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +   +LC+ VLV S D       +GR+RA V L+ NNG+ ++VR AN LGF     L  
Sbjct  98   DEHEHELCESVLVSSPDKGCANVVAGRERAPVFLASNNGVASNVRLANALGFQKDVALPR  157

Query  481  CTQVVAQYHLNDD  519
            C Q++  Y   DD
Sbjct  158  CAQILKMYQDEDD  170



>ref|NP_001146979.1| LOC100280588 precursor [Zea mays]
 gb|ACG24873.1| pollen-specific protein C13 precursor [Zea mays]
 gb|ACN27364.1| unknown [Zea mays]
 tpg|DAA46881.1| TPA: pollen-specific protein C13 [Zea mays]
Length=172

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 77/133 (58%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ D C  GFET A+ Y+  + VR+ C ++ T A T S    T+  G Y+ILV 
Sbjct  38   FVVRGRVWCDNCRAGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVI  97

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +   +LC+ VLV S D       +GR+RA V L+ NNG+ ++VR AN LGF     L  
Sbjct  98   DEHEHELCESVLVSSPDKGCANVVAGRERAPVFLTSNNGVASNVRLANALGFQKDVALPR  157

Query  481  CTQVVAQYHLNDD  519
            C Q++  Y   DD
Sbjct  158  CAQILKMYQDEDD  170



>dbj|BAK07321.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score =   102 bits (255),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 72/133 (54%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            FLV G+VY D C  GFET  +K +  + V + C           A A T+ QG Y I ++
Sbjct  30   FLVTGRVYCDPCRAGFETNISKNVEGATVAMDCRPFGGGESKLKAEATTDKQGWYKIEID  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  477
             D  D++C+VVL KS DP   + +  RDRARV L+ NNG+     R+AN + F  KQP  
Sbjct  90   QDHQDEICEVVLTKSPDPACAEIEEFRDRARVPLTSNNGMKQQGTRYANPIAFFPKQPRP  149

Query  478  SCTQVVAQYHLND  516
             C  ++  Y L D
Sbjct  150  ECGGILQAYDLKD  162



>gb|AAM78188.1| putative SAH7 protein [Gossypium barbadense]
Length=119

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 69/116 (59%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  KGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDR  309
            +G VY DTC  GFET  T+ L ++ VRLVC++R +  V +     T+  G+Y I V+ D 
Sbjct  1    EGYVYCDTCRAGFETPKTRSLADAMVRLVCSDRKSGQVVFKKEGYTDKTGKYQIRVSEDH  60

Query  310  GDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
             D +CD VLVK S         GR+RARVIL+  NG+ +  R+AN +GF   +P A
Sbjct  61   LDQICDAVLVKGSQLGCATMSPGRERARVILTNFNGISSTTRYANAMGFMVDEPEA  116



>emb|CDY43319.1| BnaC03g58910D [Brassica napus]
Length=171

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 83/137 (61%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F +KG VY DTC   F T  +K L  + V+L C  R+   VT +  AVT+ +G+Y ++V 
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAVTDKEGKYEMVVM  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  468
            GD  +++C+++LV+S D   G+ ++    R+ AR+ L+ N+G+V N+VR  N LGF  K 
Sbjct  92   GDHEEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMRKT  151

Query  469  PLASCTQVVAQYHLNDD  519
            PLA C QV  +  +  D
Sbjct  152  PLADCPQVFKELGIVPD  168



>ref|XP_011029563.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=166

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 76/125 (61%), Gaps = 0/125 (0%)
 Frame = +1

Query  127  VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  306
            V+GKVY DTC   F+T  +  LP + V+L C NR+   +TY+    T+S+G Y + V GD
Sbjct  32   VEGKVYCDTCRVEFQTKISDALPGAKVKLACNNRENGTLTYTVEGSTDSRGTYRLPVAGD  91

Query  307  RGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCT  486
              +D+C+V LV+S      +P    D AR++L++N G+VN +R+AN LG+  K     C 
Sbjct  92   HEEDICEVRLVESPRADCNEPFKSVDSARILLTKNVGVVNSLRYANALGYMKKVAQPECA  151

Query  487  QVVAQ  501
            +V+ +
Sbjct  152  KVLEE  156



>ref|XP_002887714.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH63973.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=151

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G+ Y D C  GFET  + Y +P + V+L C +R T    Y+  AV++ QG Y  +V
Sbjct  10   MVVQGRTYCDLCKFGFETPESSYFIPGATVKLSCRDRKTMEEVYTDEAVSDKQGNYKFIV  69

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + +  D++CDV+LVKS+     K   GR+++RVIL+  +G+ + +R ANN+GF  +    
Sbjct  70   HDEHKDEMCDVLLVKSAVKGCSKISVGREKSRVILNHYSGIASQIRHANNMGFEKEVSDV  129

Query  478  SCTQVVAQYHLNDDN  522
             C+ +  +Y +++D 
Sbjct  130  FCSALYHKYMVDEDE  144



>gb|AFO38383.1| putative pollen-specific protein C13 [Glycine max]
Length=193

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 69/113 (61%), Gaps = 1/113 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F VKG VY DTC  GFET AT Y+  + V + C  R T  V Y    VT+S G Y I V 
Sbjct  78   FHVKGSVYCDTCRAGFETNATFYIQGAKVGIQCKERKTMKVVYYTEGVTDSTGTYHIEVE  137

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRN-NGLVNDVRFANNLGF  456
             D  D++C+ VLVKS       PDSGRD++ ++L+ + NG+VN + +AN +G+
Sbjct  138  NDHRDNICECVLVKSPIKWCNTPDSGRDKSSIVLTHHQNGVVNHLHYANAMGY  190



>gb|AAM78185.1| putative SAH7 protein [Gossypium herbaceum]
Length=119

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 70/118 (59%), Gaps = 0/118 (0%)
 Frame = +1

Query  130  KGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDR  309
            +G VY DTC  GFET  T+ L ++ V+LVC++R T  V +     T+  G+Y I V+ D 
Sbjct  1    EGYVYCDTCRAGFETPKTRRLADAMVKLVCSDRKTGGVVFEKEGYTDKTGKYQIRVSEDH  60

Query  310  GDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  483
             D +CD VLVKS          GR+RARVIL+ +NG+ +  R+AN++GF   +    C
Sbjct  61   LDQICDAVLVKSPQLGCATMSPGRERARVILTNSNGISSTTRYANSMGFMVDKAEVGC  118



>ref|XP_002889170.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH65429.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=170

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G+ Y D C  GFET  + Y +P + V+L C +R T    Y+  AV++ QG Y  +V
Sbjct  29   MVVQGRTYCDLCKFGFETPESSYFIPGATVKLSCRDRKTMEEVYTDEAVSDKQGNYKFIV  88

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + +  D++CDV+LVKS+     K   GR+++RVIL+  +G+ + +R ANN+GF  +    
Sbjct  89   HDEHKDEMCDVLLVKSAVKGCSKISVGREKSRVILNHYSGIASQIRHANNMGFEKEVSDV  148

Query  478  SCTQVVAQYHLNDDN  522
             C+ +  +Y +++D 
Sbjct  149  FCSALFHKYMVDEDE  163



>ref|XP_011070069.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=161

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+G VY D C   FET  +  L  + VRL C + +T  VTYS   VT S G YS+ V 
Sbjct  26   FHVEGDVYCDPCRVQFETELSYNLAGATVRLECRDIETKTVTYSMEGVTGSDGHYSLTVK  85

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
            GD   D+C+V+ VKS      +P    +RA++  + N+GL N +R+AN +GF T + L +
Sbjct  86   GDHEKDICEVIPVKSPKAECSEPMGDYERAKIECTENSGLHNPIRYANPIGFMTPEILPA  145

Query  481  CTQVVA  498
            C  ++A
Sbjct  146  CGPILA  151



>gb|AAN60344.1| unknown [Arabidopsis thaliana]
Length=148

 Score =   100 bits (250),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
             +V+G  Y D C  GFET  + Y +P + V+L C +R T    Y+  AV++ +G+Y  +V
Sbjct  30   MVVQGSTYCDICKFGFETPESSYFIPGATVKLSCKDRKTMEEVYTDKAVSDKEGKYKFIV  89

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGF  456
            + D  D +CDV+LVKSSD    K   GR+++RVIL+  +G+ + +R ANN+GF
Sbjct  90   HDDHRDQMCDVLLVKSSDKTCSKISVGREKSRVILNHYSGIASQIRHANNMGF  142



>ref|XP_002316866.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|EEE97478.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=164

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 77/125 (62%), Gaps = 0/125 (0%)
 Frame = +1

Query  127  VKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGD  306
            V+GKVY DTC   F+T  +  +P + V+LVC NR+   +TY+    T+S G Y + V GD
Sbjct  32   VEGKVYCDTCRVEFQTKISDAIPGAKVKLVCNNRENGTLTYTVEGTTDSSGTYRLPVVGD  91

Query  307  RGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCT  486
              +D+C+V LV+S      +P    D AR++L++N G+V+++R+AN LG+  K     C 
Sbjct  92   HEEDICEVRLVESPRADCNEPFKSVDSARILLTKNVGVVDNLRYANALGYMKKVAQPECA  151

Query  487  QVVAQ  501
            +V+ +
Sbjct  152  KVLEE  156



>ref|NP_001148443.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG31481.1| pollen allergen Phl p 11 [Zea mays]
 gb|ACN35276.1| unknown [Zea mays]
 gb|AFW80473.1| pollen allergen Phl p 11 [Zea mays]
Length=178

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 77/133 (58%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G+VY D C  GFET  ++ +  + V +VC +   +  T  A A T+  G Y + ++
Sbjct  41   FVVTGRVYCDPCRAGFETNVSRSVAGATVEVVCRHFGASKETLKAEATTDDSGWYKLEID  100

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  477
             D  +++C+VVL +S DP   + +  RDRARV L+ NNG+    VR+AN + F  K PL 
Sbjct  101  QDHQEEICEVVLARSPDPGCAEIEEFRDRARVPLTSNNGIKQQGVRYANPIAFFRKDPLK  160

Query  478  SCTQVVAQYHLND  516
             C  ++ +Y L D
Sbjct  161  ECGALLEKYDLKD  173



>ref|XP_002454899.1| hypothetical protein SORBIDRAFT_03g001020 [Sorghum bicolor]
 gb|EES00019.1| hypothetical protein SORBIDRAFT_03g001020 [Sorghum bicolor]
Length=166

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 76/133 (57%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G+VY D C  GFET  +K +  + V +VC + + +  T  A A T+  G Y + ++
Sbjct  29   FVVTGRVYCDPCRAGFETNVSKSVAGATVEVVCRHFEASKETLKAEATTDDFGWYKLEID  88

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  477
             D  +++C+VVL KS DP   + +  R RARV L+ NNG+     R+AN + F  K PL 
Sbjct  89   QDHQEEICEVVLKKSPDPACAEIEEQRARARVPLTSNNGIKQKGTRYANPIAFFRKDPLK  148

Query  478  SCTQVVAQYHLND  516
             C  ++ +Y L D
Sbjct  149  ECGAILQKYDLKD  161



>gb|ADI55168.1| AS1 [Gossypium hirsutum]
Length=182

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 75/128 (59%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVT-NSQGEYSILV  297
            F V G VY DTC   FET+ ++ +P + VRL C NR    +TY +  +T   +G Y I V
Sbjct  40   FEVLGHVYCDTCRVEFETSISEPIPGATVRLECRNRTDEKITYQSPEITAGDKGNYKIQV  99

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
             GD  +  CDV+LVKS       P     +ARV+L+  +G+  ++RFANNLGF  K+ L 
Sbjct  100  TGDYEESDCDVMLVKSPRADCNDPTEEWRKARVVLTTLDGVSGEIRFANNLGFKKKEALP  159

Query  478  SCTQVVAQ  501
             CT+V+ +
Sbjct  160  ECTKVLTE  167



>ref|XP_003543768.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Glycine max]
 gb|KHN26075.1| Pollen-specific protein C13 [Glycine soja]
Length=162

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 72/130 (55%), Gaps = 0/130 (0%)
 Frame = +1

Query  118  PFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILV  297
            PF VKG+V+ D C  GFET  T Y+  + V L C +R TN   YS    T+S G ++I V
Sbjct  27   PFYVKGRVFCDPCRAGFETPLTTYIAGAEVTLQCKDRITNNNVYSKQVKTDSTGSFTIFV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
            + ++ +  CD  LV S      +P  GRD  RV L+R NG+  + RF NNLGF  +   +
Sbjct  87   DANQANQNCDASLVTSPLRDCKEPTPGRDHTRVNLNRFNGIATNDRFVNNLGFMKEIVAS  146

Query  478  SCTQVVAQYH  507
            SC ++   Y 
Sbjct  147  SCAKIFKSYQ  156



>ref|XP_004960638.1| PREDICTED: pollen allergen Phl p 11-like [Setaria italica]
Length=172

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 84/136 (62%), Gaps = 1/136 (1%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            K  +V G+VY D C  GFETTA+  +  + V++ C + +T  +   A A T++ G Y + 
Sbjct  32   KGLVVTGRVYCDNCRAGFETTASHNIAGATVQMECRHFETMQLHDKAEATTDAGGWYRMD  91

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGL-VNDVRFANNLGFTTKQP  471
            +  D  +++C+VVL+KS +    + +  RDR+R+ L+RNNG+  N VR+AN + F  K+P
Sbjct  92   IGDDHQEEICEVVLLKSPEADCAEIEQFRDRSRIALTRNNGMEQNAVRYANPIAFFRKEP  151

Query  472  LASCTQVVAQYHLNDD  519
            L +C +++  Y L +D
Sbjct  152  LQNCGEILRAYALYND  167



>ref|XP_008439743.1| PREDICTED: olee1-like protein isoform X2 [Cucumis melo]
Length=168

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 83/136 (61%), Gaps = 5/136 (4%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNA--VTYSANAVTNSQGEYSIL  294
            F ++GKVY DTC   F T  +KYLP + V+LVC   + NA   T++  AVT+  G Y I 
Sbjct  29   FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVC-REEANAGNETFTGEAVTDKNGVYKIE  87

Query  295  VNGDRGDDLCDVVLVKSSDPLSGK-PDSGRDR-ARVILSRNNGLVNDVRFANNLGFTTKQ  468
            V+GD  +++C+V L++S D   G+ P  G    ARV ++ NNG+++ VR AN LGF  K+
Sbjct  88   VDGDHEEEICEVSLLESGDKGCGEIPTDGYGHFARVSITGNNGIIDPVRQANPLGFKKKE  147

Query  469  PLASCTQVVAQYHLND  516
             L  C +V+ +   +D
Sbjct  148  ALPQCKEVLRELGFDD  163



>ref|XP_008439742.1| PREDICTED: olee1-like protein isoform X1 [Cucumis melo]
 ref|XP_008439744.1| PREDICTED: olee1-like protein isoform X3 [Cucumis melo]
Length=168

 Score =   100 bits (249),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 5/137 (4%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNA--VTYSANAVTNSQGEYSIL  294
            F ++GKVY DTC   F T  +KYLP + V+LVC   + NA   T++  AVT+  G Y I 
Sbjct  29   FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVC-REEANAGNETFTGEAVTDKNGVYKIE  87

Query  295  VNGDRGDDLCDVVLVKSSD-PLSGKPDSGRDR-ARVILSRNNGLVNDVRFANNLGFTTKQ  468
            V+GD  +++C+V L++S+D   SG P  G    ARV ++ NNG+ N VR AN LGF  K 
Sbjct  88   VDGDHEEEICEVSLLESADKECSGIPTDGYGHFARVSITGNNGITNPVRQANPLGFLRKD  147

Query  469  PLASCTQVVAQYHLNDD  519
             L  C +V+ +   +++
Sbjct  148  ALPQCKEVLRELGFDEE  164



>gb|KFK44745.1| hypothetical protein AALP_AA1G297400 [Arabis alpina]
Length=171

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT++ G Y + V 
Sbjct  32   FHIKGSVYCDTCRVQFVTRVSKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQMEVM  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  468
            GD  +++C++VLV+S DP  G  ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92   GDHEEEVCEIVLVQSPDPECGDINNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKN  151

Query  469  PLASCTQVVAQYHLNDD  519
            PL  C+QV  +  +  D
Sbjct  152  PLEDCSQVFKELGIVPD  168



>ref|XP_009109686.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX90169.1| BnaA08g18150D [Brassica napus]
Length=171

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F +KG VY DTC   F T  +K L  + V+L C  R+   VT +  AVT+  G+Y ++V 
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKARENQTVTLTKEAVTDKDGKYEMVVM  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  468
            GD  +++C+++LV+S D   G+ ++    R+ AR+ L+ N+G+V N+VR  N LGF  K 
Sbjct  92   GDHEEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMRKT  151

Query  469  PLASCTQVVAQYHLNDD  519
            PLA C QV  +  +  D
Sbjct  152  PLADCPQVFKELGIVPD  168



>ref|XP_006664913.1| PREDICTED: pollen allergen Phl p 11-like [Oryza brachyantha]
Length=175

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = +1

Query  112  GKP-FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYS  288
            G P F V G+VY D C  GFET  +  +  + V++ C + +T  V + A A  N  G Y 
Sbjct  32   GPPGFTVTGRVYCDNCRAGFETNVSHSIKGATVQMECRHFETQEVKHRAEAAANEWGWYK  91

Query  289  ILVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTK  465
            + V G+   ++C+V LV+S +    + +  RDR+RV L+RNNG+  D  R+AN + F  K
Sbjct  92   MEVGGEHEAEICEVALVRSPEAECAEIERFRDRSRVPLTRNNGIKQDGFRYANPIAFFRK  151

Query  466  QPLASCTQVVAQYHLNDDN  522
             P  +C  ++  Y L DD+
Sbjct  152  DPPPACGDILRSYDLYDDD  170



>ref|NP_174209.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAF88123.1|AC021043_16 Similar to major allergen OLE5c [Arabidopsis thaliana]
 gb|AEE31049.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=171

 Score =   100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT++ G Y + V 
Sbjct  32   FHIKGSVYCDTCRVQFITRISKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQMEVM  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  468
            GD  +++C++VL++S DP  G  ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92   GDHEEEVCEIVLLQSPDPECGDVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  469  PLASCTQVVAQYHLNDD  519
            PLA C QV  +  +  D
Sbjct  152  PLAECPQVFKELGIVPD  168



>gb|AAM78189.1| putative SAH7 protein [Gossypioides kirkii]
Length=119

 Score = 99.0 bits (245),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 0/118 (0%)
 Frame = +1

Query  130  KGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDR  309
            +G VY D C  GFET  T+ L ++ V++VCT+R T  V +     T+  G+Y I V+ D 
Sbjct  1    EGHVYCDRCRAGFETPKTRSLADALVKVVCTDRKTGQVVFEKEGHTDKTGKYQIRVSEDH  60

Query  310  GDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASC  483
             D +CD VLVKSS         GR+RARVIL+  NG+ +  R+AN +GF   +  A C
Sbjct  61   LDQVCDAVLVKSSQLDCATMTPGRERARVILTNLNGISSTTRYANAMGFMVDEAEAGC  118



>gb|AEW90946.1| pollen-specific protein F8-4 [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AEW90947.1| pollen-specific protein F8-5 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 78/134 (58%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            ++V+G+VY DTC  GFET  T+Y+  + VRL C    T  V  S + VT+  G Y I + 
Sbjct  30   YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKRFGTEKVERSIDGVTDETGTYKIELK  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
                +D+C++VLV+S      +    RDRA ++LSRN G+ +++R AN LG+   +PL  
Sbjct  90   DSHPEDICEMVLVQSPLANCNEIQDLRDRAEIVLSRNVGISDNIRMANPLGYLKDKPLPV  149

Query  481  CTQVVAQYHLNDDN  522
            C  ++  ++   D+
Sbjct  150  CPDLLKTFNPTTDD  163



>gb|KJB61584.1| hypothetical protein B456_009G368100 [Gossypium raimondii]
Length=180

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN-RDTNAVTYSANAVTNSQGEYSILV  297
            F+V+G+VY DTC   FET  +K +  + V+L C N  +   V++S + VT+  G Y I V
Sbjct  32   FIVEGRVYCDTCRVEFETKISKPIKGASVKLECRNITNEKIVSHSQDVVTDEAGGYKIEV  91

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
             GD  D++C+V LVKS      +P     +ARV+L++ +G+    RFANNLG+  K+ L 
Sbjct  92   KGDHEDEICEVSLVKSPRADCSEPTEVWRKARVVLTKADGVSGIYRFANNLGYMKKEALP  151

Query  478  SCTQVVAQ---YHLNDD  519
             C +V+ +   + L D+
Sbjct  152  ECKKVLTEMGYFELQDE  168



>ref|XP_004134927.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172170.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN49302.1| hypothetical protein Csa_6G519550 [Cucumis sativus]
Length=168

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 82/136 (60%), Gaps = 5/136 (4%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNA--VTYSANAVTNSQGEYSIL  294
            F ++GKVY DTC   F T  +KYLP + V+LVC   + NA   T++   VT+  G Y I 
Sbjct  29   FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVC-REEANAGNETFTGEGVTDKNGVYKIE  87

Query  295  VNGDRGDDLCDVVLVKSSDPLSGK-PDSGRDR-ARVILSRNNGLVNDVRFANNLGFTTKQ  468
            V+GD  +++C+V L++S+D   G+ P  G    ARV ++ NNG++N VR AN LGF  K 
Sbjct  88   VDGDHEEEICEVSLLESADTGCGEIPTDGYGHFARVSITGNNGIINPVRQANPLGFMKKD  147

Query  469  PLASCTQVVAQYHLND  516
             L  C +V+ +   +D
Sbjct  148  ALPQCKEVLRELGFDD  163



>gb|EMT13715.1| Pollen allergen Phl p 11 [Aegilops tauschii]
Length=167

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 73/133 (55%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G+VY D C  GFET  +K +  + V + C           A A T+++G Y I ++
Sbjct  30   FIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYKIEID  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  477
             D  D++C+VVL KS DP   + +  RDRARV L+ NNG+     RFAN + F  K+P  
Sbjct  90   QDHQDEICEVVLTKSPDPSCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPKEPRK  149

Query  478  SCTQVVAQYHLND  516
             C  ++  Y L D
Sbjct  150  ECGGILQAYDLKD  162



>gb|AAF17689.1|AC009243_16 F28K19.26 [Arabidopsis thaliana]
Length=677

 Score =   105 bits (261),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 50/127 (39%), Positives = 79/127 (62%), Gaps = 1/127 (1%)
 Frame = +1

Query  124  LVKGKVYLDTCNCGFETTATKY-LPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            +V+G  Y D C  GFET  + Y +P + V+L C +R T    Y+  AV++ +G+Y  +V+
Sbjct  229  VVQGSTYCDICKFGFETPESSYFIPGATVKLSCKDRKTMEEVYTDKAVSDKEGKYKFIVH  288

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             D  D +CDV+LVKSSD    K   GR+++RVIL+  +G+ + +R ANN+GF  +  +A+
Sbjct  289  DDHRDQMCDVLLVKSSDKTCSKISVGREKSRVILNHYSGIASQIRHANNMGFEKEVRMAT  348

Query  481  CTQVVAQ  501
             T +  Q
Sbjct  349  STTMSHQ  355



>ref|XP_002489221.1| hypothetical protein SORBIDRAFT_0012s014630 [Sorghum bicolor]
 gb|EES20226.1| hypothetical protein SORBIDRAFT_0012s014630 [Sorghum bicolor]
Length=171

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 76/133 (57%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V+G+V+ D C  GFET A+ Y+  + VR+ C ++ T A T S    T+  G Y+ILV 
Sbjct  37   FVVRGRVWCDNCRTGFETPASTYIAGAKVRVDCKSKTTGANTCSFEGHTDRTGTYNILVA  96

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
             +   +LC+ +LV S D        GR+RA V L+ NNG+ +++R AN LGF     L  
Sbjct  97   DEHEHELCESILVSSPDKGCSNVVVGRERAPVFLTSNNGVASNIRLANALGFEKDVALPR  156

Query  481  CTQVVAQYHLNDD  519
            C Q++  Y   +D
Sbjct  157  CAQILKMYQDEND  169



>ref|XP_011098227.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=163

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 73/126 (58%), Gaps = 0/126 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+G VY D C   FET  + ++  + VR+ C + +T  +T+S   VT S G YSI+V 
Sbjct  28   FYVEGDVYCDPCRVQFETELSYHIAGAMVRVECRDIETKKITFSMEGVTGSDGHYSIMVT  87

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
            GD   D+C+V+  +S      +P    +RA+V  + N+GL N +R+AN +GF T + L  
Sbjct  88   GDHEKDICEVIPTRSPKNECSEPMGDYERAKVECTENSGLHNTIRYANPVGFMTPKVLPE  147

Query  481  CTQVVA  498
            C  ++A
Sbjct  148  CAPILA  153



>emb|CDY21637.1| BnaC09g46550D [Brassica napus]
Length=180

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 67/115 (58%), Gaps = 0/115 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET ATKY+  + V++VC +  T        AVT  +G Y +
Sbjct  63   GTPFHIEGCVYYDTCRFGFETIATKYITGAKVKIVCKDSVTLKSEVVGEAVTGRRGRYRV  122

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGF  456
             V GDR D  C  VLV S       PD GR+ A VIL+R+NG+ +   FAN +GF
Sbjct  123  AVEGDRQDQQCLAVLVNSPISNCQFPDPGRNTATVILTRSNGIASTRHFANAMGF  177



>ref|XP_003601984.1| Pollen-specific protein C13 [Medicago truncatula]
 gb|AES72235.1| pollen Ole e I family allergen [Medicago truncatula]
Length=160

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F +KG VY DTC  GFET AT Y+  + V + C +R T    +    VT+S G Y+I+V 
Sbjct  25   FHIKGCVYCDTCRAGFETNATFYIQGAKVGIRCQDRKTMDEVFYTEGVTDSTGTYNIMVE  84

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSR-NNGLVNDVRFANNLGFTTKQPLA  477
             D  D++C  VLV S       PD GR+R+ ++L+   NG++N + +AN +G+    PL 
Sbjct  85   NDHHDNICKTVLVSSPISSCNTPDPGRNRSSIVLTHYKNGVLNHLHYANAMGYFKDDPLP  144

Query  478  SCTQVVAQYHLNDDN  522
                 + +Y+L+D +
Sbjct  145  QYCHQLLKYYLSDSD  159



>sp|Q8LGR0.1|CHE1_CHEAL RecName: Full=Pollen allergen Che a 1; AltName: Allergen=Che 
a 1; Flags: Precursor [Chenopodium album]
 gb|AAL07319.1| Che a 1 allergen precursor [Chenopodium album]
Length=168

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 3/135 (2%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+G VY DTC   F T  +  +  + V+L C N      T+ A AVT+  G+YSI VN
Sbjct  30   FKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDS---GRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            GD  DD+C++ LVKS +    +       +  A+V L+ NNG  +D+R AN LGF  K+P
Sbjct  90   GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP  149

Query  472  LASCTQVVAQYHLND  516
            L  C +V+ +  L D
Sbjct  150  LKECPEVLKELDLYD  164



>gb|KHG10520.1| Olee1-like protein [Gossypium arboreum]
Length=180

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN-RDTNAVTYSANAVTNSQGEYSILV  297
            F+V+G+VY DTC   FET  ++ +  + V+L C N  +   V++S + VT+  G Y I V
Sbjct  32   FIVEGRVYCDTCRVEFETKISQPIKGASVKLECRNITNEKIVSHSQDVVTDEAGGYKIEV  91

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
             GD  D++C+V LVKS      +P     +ARV+L++ +G+    RFANNLG+  K+ L 
Sbjct  92   KGDHEDEICEVSLVKSPRADCNEPTEVWRKARVVLTKADGVSGTYRFANNLGYMKKEALP  151

Query  478  SCTQVVAQ---YHLNDD  519
             C +V+ +   + L D+
Sbjct  152  ECKKVLTEMGYFELQDE  168



>ref|XP_007021723.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY13248.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=162

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 78/128 (61%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTN-AVTYSANAVTNSQGEYSILV  297
            F V+GKVY DTC   FET  ++ +  + V L C +R    ++TYS  +VT+  G+Y I V
Sbjct  28   FFVEGKVYCDTCRVEFETRLSQPIKGATVILECRDRTVGGSITYSQESVTDESGKYRIPV  87

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
             GD  +++C+V +VKS      +      RARV+L++ NG+ + +R+ANNLGF  K+ + 
Sbjct  88   QGDHEEEICEVRVVKSPREDCNEFMEAWQRARVLLTKKNGVSDPIRYANNLGFLKKEAVP  147

Query  478  SCTQVVAQ  501
             C +V+ +
Sbjct  148  GCAEVLEE  155



>gb|EYU45018.1| hypothetical protein MIMGU_mgv1a015317mg [Erythranthe guttata]
Length=161

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 74/132 (56%), Gaps = 0/132 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F ++G VY D C   F T  +K +P + VRL C N +T AVTYS   +TN+ G YS+ V+
Sbjct  30   FNIEGDVYCDPCRVQFHTELSKRIPGATVRLECQNEETKAVTYSVEGLTNADGHYSLRVD  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
            GD   D+C V  +KS      +P +    +R++ + N G+ + VRFAN +GF TK     
Sbjct  90   GDHEKDVCVVKAIKSPIAECSEPMTDVRESRIVCTNNIGMHSAVRFANPIGFMTKVGSPQ  149

Query  481  CTQVVAQYHLND  516
            C  V+  +  +D
Sbjct  150  CIPVLQDFFADD  161



>ref|XP_004134662.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172168.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
Length=168

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNA--VTYSANAVTNSQGEYSIL  294
            F ++GKVY DTC   F T  +KYLP + V+LVC   + NA   T++   VT+  G Y I 
Sbjct  29   FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVC-REEANAGNETFTGEGVTDKNGVYKIE  87

Query  295  VNGDRGDDLCDVVLVKSSD-PLSGKPDSGRDR-ARVILSRNNGLVNDVRFANNLGFTTKQ  468
            V+GD  +++C+V L++S+D   S  P  G    ARV ++ NNG++N VR AN LGF  K 
Sbjct  88   VDGDHEEEICEVSLLESADEECSDIPTDGYGHFARVSITGNNGIINPVRQANPLGFLKKD  147

Query  469  PLASCTQVVAQYHLND  516
             L  C +V+ +   +D
Sbjct  148  ALPQCKEVLRELGFDD  163



>ref|NP_001131377.1| uncharacterized protein LOC100192702 precursor [Zea mays]
 gb|ACF79764.1| unknown [Zea mays]
 gb|AFW82076.1| hypothetical protein ZEAMMB73_949741 [Zea mays]
Length=164

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 79/137 (58%), Gaps = 1/137 (1%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G  F+V G++Y D C  GFET  +  +  + V + C + ++  V   A A T   G Y +
Sbjct  23   GVGFVVTGRIYCDNCRAGFETNVSHAIQGATVEMECRHFESQQVHDKAEATTGPGGWYRM  82

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQ  468
             ++GD  D++CDV L+KS +    + D  RDR RV L+RN+G+    VR+AN + F  K+
Sbjct  83   EISGDHQDEICDVRLLKSPEADCAEIDHSRDRCRVPLTRNDGIKQSGVRYANPIAFLRKE  142

Query  469  PLASCTQVVAQYHLNDD  519
            PL +C +++  Y L ++
Sbjct  143  PLPNCGELLRAYDLYNE  159



>gb|AEW90940.1| group 11 grass pollen allergen F7-1 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 71/133 (53%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            FLV G+VY D C  GFET  +K +  + V + C           A A T+ QG Y I ++
Sbjct  30   FLVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDKQGWYKIEID  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  477
             D  D++C+VVL KS DP   + +  RDRARV L+ NN +     R+AN + F  K+P  
Sbjct  90   QDHQDEICEVVLTKSPDPSCAEIEEFRDRARVPLTSNNDMKQQGTRYANPIAFFPKEPRK  149

Query  478  SCTQVVAQYHLND  516
             C  ++  Y L D
Sbjct  150  ECGGILQAYDLKD  162



>gb|AAX93750.1| pollen allergen Cro s 1 [Crocus sativus]
Length=168

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 76/135 (56%), Gaps = 3/135 (2%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+G VY DTC   F T  +  +  + V+L C N      T+ A AVT+  G+YSI V+
Sbjct  30   FKVQGMVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVH  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDS---GRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            GD  DD+C++ LVKS +    +       +  A+V L+ NNG  +D+R AN LGF  K+P
Sbjct  90   GDFQDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP  149

Query  472  LASCTQVVAQYHLND  516
            L  C +V+ +  L D
Sbjct  150  LKECPEVLKELDLYD  164



>gb|KHG12773.1| Olee1-like protein [Gossypium arboreum]
Length=187

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTY-SANAVTNSQGEYSILV  297
            ++V G VY DTC   FET  ++ +  + V+L C NR  N +T+ S   VT+  G+Y I V
Sbjct  31   YIVVGHVYCDTCRVEFETKLSEPIGGAVVKLECRNRTDNQLTFQSQEIVTDEHGDYHIAV  90

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
             GD  +  CDV LV+S +P    P      +RV+L+  +G+  ++RFANNLGF  K  L 
Sbjct  91   EGDYEESDCDVALVRSPNPDCNDPSEIWRISRVVLTTLDGVSGELRFANNLGFKKKVALP  150

Query  478  SCTQVVAQ---YHLNDD  519
             CTQV+ +   Y LN +
Sbjct  151  QCTQVLQEIGYYELNQE  167



>ref|XP_004251892.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=161

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 77/132 (58%), Gaps = 0/132 (0%)
 Frame = +1

Query  115  KPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSIL  294
            + F V+G VY DTC   F+T  ++Y+  + V+L C + +T  VTY+A A+T+  G+Y+I 
Sbjct  25   EAFKVEGTVYCDTCRVQFQTRISEYIEGAKVKLTCRDMETEKVTYTAEALTDKNGKYTIE  84

Query  295  VNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPL  474
             +GD   +LCDV +V+S       P  G + +RV+ S N G+ N  R+AN L F  K+ L
Sbjct  85   ASGDHEKELCDVGVVQSPREDCKDPAIGFENSRVVCSNNVGMHNPTRYANPLFFMKKETL  144

Query  475  ASCTQVVAQYHL  510
              C  V+ +  L
Sbjct  145  PDCKDVLDELGL  156



>emb|CDY21640.1| BnaC09g46520D [Brassica napus]
Length=142

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 66/115 (57%), Gaps = 0/115 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G PF ++G VY DTC  GFET  TKY+  + V++VC +  T        AVT  +G Y +
Sbjct  25   GTPFHIEGCVYCDTCRFGFETILTKYITGAKVKIVCKDSVTLKSEVVGEAVTGRRGRYRV  84

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGF  456
             V GDR D  C  VLV S       PD GR+ A VIL+R+NG+ +   FAN +GF
Sbjct  85   AVEGDRQDQQCLAVLVNSPISNCQFPDPGRNTATVILTRSNGIASTRHFANAMGF  139



>gb|AFW77548.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G+VY D C  GFET  +  +  + V + C + ++  V   A A T++ G Y + ++
Sbjct  27   FVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYRMEIS  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  477
            GD  D++C+V+L+KS +    + +  RDR RV L+RN+G+    +R+AN + F  K+PL+
Sbjct  87   GDHQDEICEVLLLKSPEADCAEIERTRDRCRVPLTRNDGIRQSGIRYANPIAFFRKEPLS  146

Query  478  SCTQVVAQYHL  510
            +C +++  Y L
Sbjct  147  NCGELLRAYDL  157



>emb|CDX99789.1| BnaC05g22110D [Brassica napus]
Length=171

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F + G VY DTC   F T  +K+L  + V+L C +R    VT +  AVT+  G+Y + V 
Sbjct  32   FNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKSRVNQTVTLTKEAVTDKDGKYQMEVM  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  468
            GD  ++LC+++LV+S D   G+ ++    R+ AR+ L+ N+G+V N++R  N LGF  K 
Sbjct  92   GDHEEELCEIILVQSPDAECGEVNNEEFLRNAARISLTANDGIVSNEIRTINPLGFMRKT  151

Query  469  PLASCTQVVAQYHLNDD  519
            PLA C QV  +  +  D
Sbjct  152  PLADCPQVFKELGIVPD  168



>gb|KHG13789.1| Anther-specific LAT52 [Gossypium arboreum]
Length=188

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 80/138 (58%), Gaps = 4/138 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTY-SANAVTNSQGEYSILV  297
            ++V G VY DTC   FET  ++ +  + V+L C NR   A+T+ S+  V +S G+Y I+V
Sbjct  33   YMVVGHVYCDTCRVEFETKLSEPISGAVVKLECRNRTNEAITFQSSEIVADSHGDYHIIV  92

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
             GD  +  CDV LV+S       P     ++RV+L+  +GL N +RFANNLGF     L 
Sbjct  93   EGDYEESDCDVALVRSPRADCSDPTEAWRKSRVVLTTFDGLSNKLRFANNLGFKKDIALP  152

Query  478  SCTQVVAQ---YHLNDDN  522
             CT+++ +   Y L+ ++
Sbjct  153  QCTRILKEMGYYELSQED  170



>ref|XP_004959259.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=168

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN--RDTNAVTYSANAVTNSQGEYSIL  294
            F V+G VY DTC  GFET AT  +  + VRL C +    + AV  SA   T++ G Y + 
Sbjct  30   FFVEGSVYCDTCRAGFETNATTPIAGARVRLECRHYMSRSGAVERSAEGATDAAGRYRVE  89

Query  295  VNGDRG-DDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            +  +RG +++C V LV S  P   + ++GRDRA V    ++GL   VR AN LGF   QP
Sbjct  90   LVDNRGAEEVCVVALVSSPLPGCAEKEAGRDRAPVEPLADDGLATTVRRANPLGFLKDQP  149

Query  472  LASCTQVVAQYHLN  513
            L +C Q+++ Y L 
Sbjct  150  LPNCGQILSSYALR  163



>gb|AFK46977.1| unknown [Lotus japonicus]
Length=168

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 82/137 (60%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNA-VTYSANAVTNSQGEYSILV  297
            F ++G VY DTC   F T  ++++  + V +VC  RD  A VT+S  AVT++ G YS+ V
Sbjct  27   FFIEGTVYCDTCRTQFLTRVSEFMSGATVGVVCRERDAGAKVTFSKEAVTDANGMYSVAV  86

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLVNDVRFANNLGFTTKQ  468
            +GD  D++C+V L+KSS     + D+       +R+ ++ NNG+V+ VR AN LGF   +
Sbjct  87   DGDHEDEVCEVKLLKSSRADCSEVDTESHLEQASRISITNNNGIVSPVRTANPLGFLKTE  146

Query  469  PLASCTQVVAQYHLNDD  519
             L  C  ++ Q  L++D
Sbjct  147  RLPECGHILLQLGLHED  163



>gb|AEW90948.1| pollen-specific protein F8-6 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 77/134 (57%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            ++V+G+VY DTC  GFET  T+Y+  + VRL C    T  V  S + VT+  G Y I + 
Sbjct  30   YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKRFGTEKVECSIDGVTDETGTYKIELK  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
                +D+C++VLV+S      +    RDRA ++LSR  G+ +++R AN LG+   +PL  
Sbjct  90   DSHPEDICEMVLVQSPLANCNEIQDLRDRAEIVLSRYVGISDNIRMANPLGYLKDKPLPV  149

Query  481  CTQVVAQYHLNDDN  522
            C  ++  ++   D+
Sbjct  150  CPDLLKTFNPTTDD  163



>ref|XP_008450951.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=165

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 79/138 (57%), Gaps = 4/138 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+GKVY DTC   F T  +K+L  + V+L C   +  +VT +  AVT+  G+YSI  +
Sbjct  27   FFVEGKVYCDTCRVQFFTKVSKFLKGATVKLECKEIEGGSVTLNKEAVTDKSGKYSIEAD  86

Query  301  GDRGDDLCDVVLVKSSDP---LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            GD  +++C+V LVKS DP      K   G   +RV ++ N+G+ N VR AN L F  K+ 
Sbjct  87   GDHEEEVCEVSLVKSVDPDCDEISKEGYGH-TSRVTITNNSGITNPVRLANPLAFLKKEK  145

Query  472  LASCTQVVAQYHLNDDNF  525
            L  C +V+ +   +++  
Sbjct  146  LPECKEVLRELGFDEEGL  163



>gb|KGN49303.1| hypothetical protein Csa_6G519560 [Cucumis sativus]
Length=168

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNA--VTYSANAVTNSQGEYSIL  294
            F ++GKVY DTC   F T  +KYLP + V+LVC   + NA   T++   VT+  G Y I 
Sbjct  29   FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVC-REEANAGNETFTGEGVTDKNGVYKIE  87

Query  295  VNGDRGDDLCDVVLVKSSD-PLSGKPDSGRDR-ARVILSRNNGLVNDVRFANNLGFTTKQ  468
            V+GD  +++C+V +++S+D   S  P  G    ARV ++ NNG++N VR AN LGF  K 
Sbjct  88   VDGDHEEEICEVSVLESADEECSDIPTDGYGHFARVSITGNNGIINPVRQANPLGFLKKD  147

Query  469  PLASCTQVVAQYHLND  516
             L  C +V+ +   +D
Sbjct  148  ALPQCKEVLRELGFDD  163



>gb|AFK47865.1| unknown [Lotus japonicus]
Length=168

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 82/136 (60%), Gaps = 3/136 (2%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+G VY DTC   F T  +++L  + VR+ C      +VT++   VT+++G Y + V+
Sbjct  28   FFVEGVVYCDTCRTQFITKLSEFLEGATVRVECKEEGNGSVTFTKEVVTDAKGSYKVEVD  87

Query  301  GDRGDDLCDVVLVKS--SDPLSGKPDSGRDR-ARVILSRNNGLVNDVRFANNLGFTTKQP  471
            GD  ++LC VVLVKS  SD      DS  ++ A++ +++NNG+V+ VR AN LGF  K+ 
Sbjct  88   GDHEEELCQVVLVKSPRSDCSEIDSDSHLEQAAKISITKNNGIVSPVRAANPLGFLKKER  147

Query  472  LASCTQVVAQYHLNDD  519
            L  C  V+ +  + +D
Sbjct  148  LPGCADVLKELGIKED  163



>ref|XP_003565925.1| PREDICTED: pollen allergen Phl p 11 [Brachypodium distachyon]
Length=170

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 74/133 (56%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G+VY D C  GFET  +K +  + V + C   +       A A T+  G Y I ++
Sbjct  33   FVVTGRVYCDPCRAGFETNVSKNIGGATVAVDCRPFNGGDSKLKAEATTDQYGWYKIDID  92

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  477
             D  +++C+V+L +S DP   + +  RDRARV L+RNNGL     R+AN + F  K+PL 
Sbjct  93   QDHQEEICEVLLARSPDPACSEIEEFRDRARVPLTRNNGLKQQGTRYANPIAFFRKEPLK  152

Query  478  SCTQVVAQYHLND  516
             C  ++  Y L D
Sbjct  153  DCGGILQAYDLKD  165



>gb|KHN44330.1| Pollen-specific protein C13, partial [Glycine soja]
Length=127

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 4/113 (4%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F VKG VY DTC  GFET AT Y+  + V +    R T  V Y    VT+S G Y I V 
Sbjct  15   FHVKGSVYCDTCRAGFETNATFYIQGAKVGI---QRKTMKVVYYTEGVTDSTGTYHIEVE  71

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRN-NGLVNDVRFANNLGF  456
             D  D++C+ VLVKS       PDSGRD++ ++L+ + NG+VN + +AN +G+
Sbjct  72   NDHRDNICECVLVKSPIKWCNTPDSGRDKSSIVLTHHQNGVVNHLHYANAMGY  124



>ref|XP_004248244.1| PREDICTED: anther-specific protein LAT52 [Solanum lycopersicum]
 sp|P13447.1|LAT52_SOLLC RecName: Full=Anther-specific protein LAT52; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA33854.1| LAT52 [Solanum lycopersicum]
Length=161

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 75/130 (58%), Gaps = 0/130 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+GKVY DTC   FET  ++ L  + V+L C N  T A T+S   VT+  G+Y + VN
Sbjct  27   FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVN  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
            GD  +D+C+V +VKS      +  SG ++AR+  S N G+ N VRFAN L F   + +  
Sbjct  87   GDHENDICEVTVVKSPREDCKESVSGYEKARIECSDNVGIHNAVRFANPLFFMKAESVQG  146

Query  481  CTQVVAQYHL  510
            C + + +  L
Sbjct  147  CKEALDELGL  156



>gb|KDP32532.1| hypothetical protein JCGZ_14735 [Jatropha curcas]
Length=165

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 75/128 (59%), Gaps = 0/128 (0%)
 Frame = +1

Query  112  GKPFLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSI  291
            G    V+GKVY D C   FET  ++ +  + V+L C  R+ N +TY+    T+ QG Y +
Sbjct  27   GANMFVEGKVYCDVCRVEFETKLSEPIKGAVVKLECKIRENNTLTYAVEGETDPQGIYRL  86

Query  292  LVNGDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             V G+  +D+C+V LVKS      +P    DRAR++LS+N G+V   R+AN LG+  K+ 
Sbjct  87   PVEGEHEEDICEVRLVKSGMTDCIEPFKSTDRARILLSQNVGVVQASRYANPLGYMKKEA  146

Query  472  LASCTQVV  495
              +C QV+
Sbjct  147  NPNCGQVL  154



>ref|XP_004144129.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004171680.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN66323.1| hypothetical protein Csa_1G597700 [Cucumis sativus]
Length=165

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 79/138 (57%), Gaps = 4/138 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+GKVY DTC   F T  +K+L  + V+L C   +  +VT    AVT+  G+YSI  +
Sbjct  27   FFVEGKVYCDTCRVQFFTKVSKFLEGATVKLECKEIEGGSVTLDKEAVTDKSGKYSIEAD  86

Query  301  GDRGDDLCDVVLVKSSDP---LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            GD  +++C+V L+KS DP      K   G   +RV ++ N+G+ N VR AN L F  K+ 
Sbjct  87   GDHEEEVCEVSLMKSVDPDCDEISKEGYGH-TSRVTITNNSGITNPVRLANPLAFLKKEK  145

Query  472  LASCTQVVAQYHLNDDNF  525
            L+ C +V+ +   +++  
Sbjct  146  LSECKEVLRELGFDEEGL  163



>ref|XP_006304746.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
 gb|EOA37644.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
Length=171

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F +KG VY DTC   F T  +K+L  + V+L C  R+   VT +  AVT+  G Y + V 
Sbjct  32   FHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDKAGNYQMEVM  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  468
            GD  +++C++VL++S D   G+ ++    R+ AR+ L+ N+G+V N+ R  N LGF  K 
Sbjct  92   GDHEEEVCEIVLLQSPDAECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  469  PLASCTQVVAQYHLNDD  519
            PLA C Q   +  +  D
Sbjct  152  PLAECPQAFKELGIVPD  168



>ref|XP_008343344.1| PREDICTED: LOW QUALITY PROTEIN: olee1-like protein, partial [Malus 
domestica]
Length=125

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 67/123 (54%), Gaps = 0/123 (0%)
 Frame = +1

Query  148  DTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVNGDRGDDLCD  327
            DTC  G+ET A  Y+  + VRL C ++ + A+ Y+    T+S G Y I V  D  D  CD
Sbjct  2    DTCRAGYETKAITYIAGAKVRLECRDKSSMALVYTKEGTTDSAGCYKIPVAEDHLDQFCD  61

Query  328  VVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLASCTQVVAQYH  507
             VLV S          GR+RARVIL+  NG+ +  RFAN  GF   + L+ CTQ++ +  
Sbjct  62   AVLVSSPQKDCATVSPGRERARVILTGYNGIASYTRFANARGFMRTEALSGCTQILKELQ  121

Query  508  LND  516
              D
Sbjct  122  ELD  124



>gb|AEW90941.1| group 11 grass pollen allergen F7-4 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 72/133 (54%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G+VY D C  GFET  +K +  + V + C           A A T+++G Y I ++
Sbjct  30   FIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYKIEID  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  477
             D  D++C+VVL KS D    + +  RDRARV L+ NNG+     RFAN + F  K+P  
Sbjct  90   QDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFLPKEPRK  149

Query  478  SCTQVVAQYHLND  516
             C  ++  Y L D
Sbjct  150  ECGGILQAYDLKD  162



>ref|NP_001150330.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG38668.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G+VY D C  GFET  +  +  + V + C + ++  V   A A T++ G Y + ++
Sbjct  27   FVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYRMEIS  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  477
            GD  D++C+V+L+KS +    + +  R+R RV L+RN+G+    +R+AN + F  K+PL+
Sbjct  87   GDHQDEICEVLLLKSPEADCAEIERTRERCRVPLTRNDGIRQSGIRYANPIAFFRKEPLS  146

Query  478  SCTQVVAQYHL  510
            +C +++  Y L
Sbjct  147  NCGELLRAYDL  157



>ref|XP_010103032.1| hypothetical protein L484_005787 [Morus notabilis]
 gb|EXB94630.1| hypothetical protein L484_005787 [Morus notabilis]
Length=166

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 79/139 (57%), Gaps = 5/139 (4%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
             +V+G+VY DTC   F T  + Y+  + VRL C   +  +VTYS + VT+  G Y I V+
Sbjct  28   LIVEGRVYCDTCRAQFVTKVSNYIKGAKVRLECRESEGGSVTYSNDGVTDESGTYRIAVD  87

Query  301  GDRGDDLCDVVLVKSSDP----LSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQ  468
            GD  +++C+V LVKSS P    +S  P   +  ARV L+ NNG+ + VR AN LGF  K 
Sbjct  88   GDHEEEVCEVKLVKSSVPDCSEISNDP-YNKLNARVSLTSNNGITSPVRQANPLGFLKKN  146

Query  469  PLASCTQVVAQYHLNDDNF  525
             L  C +V+ +  +  +  
Sbjct  147  SLPECPEVLRELGITPEGL  165



>gb|AEW90942.1| group 11 grass pollen allergen F7-6 [Secale cereale x Triticum 
turgidum subsp. durum]
 gb|AEW90944.1| group 11 grass pollen allergen F8-9 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 72/133 (54%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G+VY D C  GFET  +K +  + V + C           A A T+++G Y I ++
Sbjct  30   FIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYKIEID  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  477
             D  D++C+VVL KS D    + +  RDRARV L+ NNG+     RFAN + F  K+P  
Sbjct  90   QDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPKEPRK  149

Query  478  SCTQVVAQYHLND  516
             C  ++  Y L D
Sbjct  150  ECGGILQAYDLKD  162



>ref|XP_009115274.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=171

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 80/137 (58%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F + G VY DTC   F T  +K+L  + V+L C +R    VT +  AVT+  G+Y + V 
Sbjct  32   FNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKSRVNQTVTLTKEAVTDKDGKYQMEVM  91

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLV-NDVRFANNLGFTTKQ  468
            GD  ++LC+ +LV+S D   G+ ++    R+ AR+ L+ N+G+V N++R  N LGF  K 
Sbjct  92   GDHEEELCEFILVQSPDAECGEVNNEEFLRNAARISLTANDGIVSNEIRTINPLGFMRKT  151

Query  469  PLASCTQVVAQYHLNDD  519
            PLA C QV  +  +  D
Sbjct  152  PLADCPQVFKELGIVPD  168



>gb|AEW90943.1| group 11 grass pollen allergen F8-6 [Secale cereale x Triticum 
turgidum subsp. durum]
Length=167

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 72/133 (54%), Gaps = 1/133 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F+V G+VY D C  GFET  +K +  + V + C           A A T+++G Y I ++
Sbjct  30   FIVTGRVYCDPCRAGFETNVSKNVEGATVAMDCRPFGGGESKLKAEATTDNKGWYKIEID  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVND-VRFANNLGFTTKQPLA  477
             D  D++C+VVL KS D    + +  RDRARV L+ NNG+     RFAN + F  K+P  
Sbjct  90   RDHQDEICEVVLTKSPDASCAEIEEFRDRARVPLTSNNGMKQQGTRFANPIAFFPKEPRK  149

Query  478  SCTQVVAQYHLND  516
             C  ++  Y L D
Sbjct  150  ECGGILQAYDLKD  162



>ref|XP_009617824.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=171

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 76/133 (57%), Gaps = 3/133 (2%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+GKVY D C   FE   +K +P + VRL C N   ++VT +    T+  G YS+LV 
Sbjct  31   FHVEGKVYCDFCRALFENRLSKPMPGAEVRLQCRNSTDDSVTLTVEGQTDKNGVYSLLVE  90

Query  301  GDRGDDLCDVVLVKSS-DPLSGKPDSG--RDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
             D  D++C+++L+KSS +  S  P+ G  ++ AR+ ++ NNG+   +R AN L F  K+ 
Sbjct  91   RDHEDEICEMILMKSSKEDCSEIPNEGHAKESARITITSNNGMAETIRHANPLFFVKKEA  150

Query  472  LASCTQVVAQYHL  510
               C +V  +  L
Sbjct  151  APECAEVFKELEL  163



>ref|XP_003541705.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN08444.1| Olee1-like protein [Glycine soja]
Length=169

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRD-TNAVTYSANAVTNSQGEYSILV  297
            F+V+G VY DTC   F T  +++L  + VR+VC+  D    VT+S  AVT++ G Y + V
Sbjct  28   FMVEGTVYCDTCRVQFLTKLSEFLEGATVRVVCSQVDNAKNVTFSKEAVTDASGSYKVEV  87

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLVNDVRFANNLGFTTKQ  468
            +GD  +D C+V L+KS      + D     +  AR+ +++NNG+V+ +R AN LGF  K 
Sbjct  88   DGDHEEDTCEVTLLKSPRADCSEVDQESHLQQAARISITKNNGIVSPIRQANPLGFLKKD  147

Query  469  PLASCTQVVAQYHLNDD  519
             L  C  ++ +  +N+D
Sbjct  148  RLPGCLDLLKELGINED  164



>emb|CAA78897.1| pollen specific gene [Oryza sativa Indica Group]
Length=164

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 80/134 (60%), Gaps = 1/134 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            ++V+G+VY DTC   FET  T+Y+  + VRL C +  T+ V  + + VT+  G Y I + 
Sbjct  30   YVVQGRVYCDTCRAEFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
                +D+C+VVLV S      + ++ RDRARV+L+RN G+ +++R AN LG+       S
Sbjct  90   DSHEEDICEVVLVHSPLANCSEIEAERDRARVLLTRNVGICDNLRLANPLGYLKDYHCPS  149

Query  481  CTQVVAQYHLNDDN  522
               ++ Q+ L DD+
Sbjct  150  -AALLKQFDLADDD  162



>ref|XP_009794171.1| PREDICTED: anther-specific protein LAT52 [Nicotiana sylvestris]
Length=161

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 75/130 (58%), Gaps = 0/130 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+GKVY DTC   FET  ++ +  + VRL C N  T   T+S   VT+  G+Y + V 
Sbjct  27   FDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNISTEIETFSVEGVTDKDGKYKLTVE  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
            GD  DD+C+V +VKS      +  +G ++AR+  S N G+ N VR+AN L F   + ++ 
Sbjct  87   GDHQDDICEVTVVKSPREDCKEAVTGYEKARIECSDNVGIHNAVRYANALFFMKSEAVSG  146

Query  481  CTQVVAQYHL  510
            C +V+ +  L
Sbjct  147  CKEVLDELGL  156



>gb|EAZ45758.1| hypothetical protein OsJ_30442 [Oryza sativa Japonica Group]
Length=151

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN--RDTNAVTYSANAVTNSQGEYSIL  294
            F V+G VY DTC  GF+T AT  +  + VRL C +    + AV  SA   T++ G Y I 
Sbjct  13   FFVEGDVYCDTCRAGFQTNATTAIQGARVRLECRHFMSASGAVERSAEGTTDAAGHYRIE  72

Query  295  VNGDRG-DDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            +  +RG +++C V L+ S DP   + + GRDRA V L ++ GL   VR AN LGF   +P
Sbjct  73   LVDNRGAEEVCAVALLSSPDPECHETEVGRDRAPVTLVQDAGLATMVRRANPLGFLKTRP  132

Query  472  LASCTQVVAQYHLN  513
            L  C  ++  Y L 
Sbjct  133  LPICGDLLKSYALG  146



>gb|ADK22842.1| Sal k 5, partial [Salsola kali]
Length=151

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 73/135 (54%), Gaps = 3/135 (2%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            + VKG VY DTC   F T  +  +  + V L C N      T+ A AVT+  G Y+I V+
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD  68

Query  301  GDRGDDLCDVVLVKS-SDPLSGKPDS--GRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            GD  DD+C +VLVKS     S  P+       A+V L+ NNG  +DVR AN LGF  K P
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP  128

Query  472  LASCTQVVAQYHLND  516
            L  C +V+ +  + D
Sbjct  129  LPECPEVLKELDMYD  143



>ref|XP_009604804.1| PREDICTED: anther-specific protein LAT52 [Nicotiana tomentosiformis]
Length=161

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 75/130 (58%), Gaps = 0/130 (0%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V+GKVY DTC   FET  ++ +  + VRL C N  T   T+S   VT+  G+Y + V 
Sbjct  27   FDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNISTETETFSVEGVTDKDGKYKLTVE  86

Query  301  GDRGDDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLAS  480
            GD  DD+C+V +VKS      +  +G ++AR+  S N G+ N VR+AN L F   + ++ 
Sbjct  87   GDHQDDICEVTVVKSPREDCKESVTGYEKARIECSDNVGIHNAVRYANPLFFMKTEAVSG  146

Query  481  CTQVVAQYHL  510
            C +V+ +  L
Sbjct  147  CKEVLDELGL  156



>ref|XP_002522577.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
 gb|EEF39877.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
Length=171

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 80/131 (61%), Gaps = 4/131 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTN-AVTYSANAVTNSQGEYSILV  297
            F V+GKVY DTC   F T AT Y+  + VRL C +R+   A+T+SA A T++ G Y I V
Sbjct  31   FTVEGKVYCDTCRVQFITKATSYIKGARVRLECKDREGGGAITFSAEAETDATGTYHIPV  90

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLVNDVRFANNLGFTTKQ  468
            NG+  ++LC+++ +KS DP   + +     +  A++ L+ +NG+ +  R AN +GF  +Q
Sbjct  91   NGEHEEELCEIIPLKSPDPDCNEINQDPFVKKAAQITLTNHNGIASPTRSANPIGFLKQQ  150

Query  469  PLASCTQVVAQ  501
             +  C+ ++ +
Sbjct  151  AVPECSGILRE  161



>ref|XP_003546028.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN18912.1| Olee1-like protein [Glycine soja]
Length=169

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRD-TNAVTYSANAVTNSQGEYSILV  297
            F+V+G VY DTC   F T  ++ L  + VR+ C+  D    VT+S  AVT++ G Y + V
Sbjct  28   FMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQVDNAKNVTFSKEAVTDASGSYKVEV  87

Query  298  NGDRGDDLCDVVLVKSSDPLSGKPDSG---RDRARVILSRNNGLVNDVRFANNLGFTTKQ  468
             GD  +D C+V L+KS  P   + D     +  AR+ +++NNG+V+ +R AN LGF  K 
Sbjct  88   EGDHEEDTCEVTLLKSPRPDCSEIDRESHLQQAARISITKNNGIVSPLRQANPLGFLKKD  147

Query  469  PLASCTQVVAQYHLNDD  519
             L  C  ++ +  +N+D
Sbjct  148  RLPGCADLLKELGINED  164



>dbj|BAD46623.1| putative Pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
 dbj|BAD54680.1| putative Pollen specific protein C13 precursor [Oryza sativa 
Japonica Group]
Length=165

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN--RDTNAVTYSANAVTNSQGEYSIL  294
            F V+G VY DTC  GF+T AT  +  + VRL C +    + AV  SA   T++ G Y I 
Sbjct  27   FFVEGDVYCDTCRAGFQTNATTAIQGARVRLECRHFMSASGAVERSAEGTTDAAGHYRIE  86

Query  295  VNGDRG-DDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            +  +RG +++C V L+ S DP   + + GRDRA V L ++ GL   VR AN LGF   +P
Sbjct  87   LVDNRGAEEVCAVALLSSPDPECHETEVGRDRAPVTLVQDAGLATMVRRANPLGFLKTRP  146

Query  472  LASCTQVVAQYHLN  513
            L  C  ++  Y L 
Sbjct  147  LPICGDLLKSYALG  160



>gb|EEC85106.1| hypothetical protein OsI_32490 [Oryza sativa Indica Group]
Length=167

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN--RDTNAVTYSANAVTNSQGEYSIL  294
            F V+G VY DTC  GF+T AT  +  + VRL C +    + AV  SA   T++ G Y I 
Sbjct  29   FFVEGDVYCDTCRAGFQTNATTAIQGARVRLECRHFMSASGAVERSAEGTTDAAGHYRIE  88

Query  295  VNGDRG-DDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            +  +RG +++C V L+ S DP   + + GRDRA V L ++ GL   VR AN LGF   +P
Sbjct  89   LVDNRGAEEVCAVALLSSPDPECHETEVGRDRAPVTLVQDAGLATMVRRANPLGFLKTRP  148

Query  472  LASCTQVVAQYHLN  513
            L  C  ++  Y L 
Sbjct  149  LPICGDLLKSYALG  162



>ref|NP_001064001.1| Os09g0572800 [Oryza sativa Japonica Group]
 dbj|BAF25915.1| Os09g0572800 [Oryza sativa Japonica Group]
 dbj|BAH00168.1| unnamed protein product [Oryza sativa Japonica Group]
Length=167

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTN--RDTNAVTYSANAVTNSQGEYSIL  294
            F V+G VY DTC  GF+T AT  +  + VRL C +    + AV  SA   T++ G Y I 
Sbjct  29   FFVEGDVYCDTCRAGFQTNATTAIQGARVRLECRHFMSASGAVERSAEGTTDAAGHYRIE  88

Query  295  VNGDRG-DDLCDVVLVKSSDPLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQP  471
            +  +RG +++C V L+ S DP   + + GRDRA V L ++ GL   VR AN LGF   +P
Sbjct  89   LVDNRGAEEVCAVALLSSPDPECHETEVGRDRAPVTLVQDAGLATMVRRANPLGFLKTRP  148

Query  472  LASCTQVVAQYHLN  513
            L  C  ++  Y L 
Sbjct  149  LPICGDLLKSYALG  162



>ref|XP_010941451.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=165

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 78/135 (58%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FLVKGKVYLDTCNCGFETTATKYLPESHVRLVCTNRDTNAVTYSANAVTNSQGEYSILVN  300
            F V G+VY DTC  GF    T+YL  + VRL C +  +  V++S  A+T+  G Y+I ++
Sbjct  27   FSVTGRVYCDTCRAGFVHEFTEYLGGAKVRLECRDYVSGQVSHSGEALTDKYGYYTITMS  86

Query  301  GDRGDDLCDVVLVKSSD-PLSGKPDSGRDRARVILSRNNGLVNDVRFANNLGFTTKQPLA  477
             D  +++C+VVL+ S        P   RDRARV L+RNNG+ ++ R  N +G+    PL 
Sbjct  87   DDHQEEICEVVLLDSPRYDCKEIPADHRDRARVALTRNNGMSSEQRNVNAIGYLKDVPLP  146

Query  478  SCTQVVAQYHLNDDN  522
             C  ++ +Y L  D+
Sbjct  147  KCGPMLQRYALFTDD  161



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645