BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M08

Length=591
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006339954.1|  PREDICTED: uncharacterized protein LOC102588951  89.0    6e-19   
ref|XP_009589889.1|  PREDICTED: uncharacterized protein LOC104087187  87.4    2e-18   Nicotiana tomentosiformis
ref|XP_004248826.1|  PREDICTED: uncharacterized protein LOC101253946  84.0    4e-17   Solanum lycopersicum
ref|XP_004488461.1|  PREDICTED: uncharacterized protein LOC101498545  84.3    4e-17   Cicer arietinum [garbanzo]
ref|NP_001237566.1|  uncharacterized protein LOC100306614             80.5    1e-15   Glycine max [soybeans]
gb|KHN24834.1|  hypothetical protein glysoja_046412                   78.6    4e-15   Glycine soja [wild soybean]
ref|XP_007149103.1|  hypothetical protein PHAVU_005G041500g           77.8    8e-15   Phaseolus vulgaris [French bean]
gb|KEH38168.1|  transmembrane protein, putative                       77.4    1e-14   Medicago truncatula
ref|XP_006439018.1|  hypothetical protein CICLE_v10033102mg           76.3    2e-14   Citrus clementina [clementine]
emb|CDP07675.1|  unnamed protein product                              75.5    5e-14   Coffea canephora [robusta coffee]
ref|XP_007052619.1|  UPF0182 protein jk1603, putative                 73.9    2e-13   
ref|XP_009794908.1|  PREDICTED: uncharacterized protein LOC104241660  72.8    6e-13   Nicotiana sylvestris
ref|XP_011093393.1|  PREDICTED: uncharacterized protein LOC105173378  71.6    2e-12   Sesamum indicum [beniseed]
ref|XP_009365051.1|  PREDICTED: uncharacterized protein LOC103954923  71.6    2e-12   Pyrus x bretschneideri [bai li]
gb|AFK47963.1|  unknown                                               70.5    4e-12   Lotus japonicus
ref|XP_004306488.1|  PREDICTED: uncharacterized protein LOC101307043  70.1    5e-12   Fragaria vesca subsp. vesca
ref|XP_010257472.1|  PREDICTED: uncharacterized protein LOC104597557  68.6    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_009401869.1|  PREDICTED: uncharacterized protein LOC103985771  66.6    7e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008350220.1|  PREDICTED: uncharacterized protein LOC103413530  66.6    1e-10   
ref|XP_007220770.1|  hypothetical protein PRUPE_ppa024515mg           63.5    5e-10   
ref|XP_008786723.1|  PREDICTED: uncharacterized protein LOC103704958  62.4    1e-09   Phoenix dactylifera
ref|XP_006369469.1|  hypothetical protein POPTR_0001s23730g           60.5    1e-08   
ref|XP_008245399.1|  PREDICTED: uncharacterized protein LOC103343516  57.4    1e-07   Prunus mume [ume]
ref|XP_008245799.1|  PREDICTED: uncharacterized protein LOC103343947  57.0    2e-07   Prunus mume [ume]
gb|EMS55679.1|  hypothetical protein TRIUR3_04852                     54.7    1e-06   Triticum urartu
gb|EMT28192.1|  hypothetical protein F775_15048                       54.7    1e-06   
dbj|BAJ98526.1|  predicted protein                                    54.3    2e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010229270.1|  PREDICTED: uncharacterized protein LOC104581893  53.9    3e-06   Brachypodium distachyon [annual false brome]
ref|XP_006649321.1|  PREDICTED: uncharacterized protein LOC102703193  49.7    1e-04   Oryza brachyantha



>ref|XP_006339954.1| PREDICTED: uncharacterized protein LOC102588951 [Solanum tuberosum]
Length=113

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = +1

Query  145  RPESPFIFRLTPRRNAQSTHFNFRLRSSDWLHLKQKPFQVFASNPNPSKGSYATEGNNVP  324
            RP++ FI   T  R+A  T FNFR  +   +HL+Q+   +  S+ NPS G    E +   
Sbjct  20   RPQTSFI---TSTRDAFPTQFNFRFNNVLSVHLRQRLLPISKSSTNPSGGP---EKSKDA  73

Query  325  QGPPLATILAGFLVLFAVCWILGSIVMWLVSLITNVPSSK  444
              PPLATILAG LV   VCWI+GSIV+WL+SLITNVP SK
Sbjct  74   SSPPLATILAGVLVFCVVCWIVGSIVIWLISLITNVPPSK  113



>ref|XP_009589889.1| PREDICTED: uncharacterized protein LOC104087187 [Nicotiana tomentosiformis]
Length=119

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 3/100 (3%)
 Frame = +1

Query  145  RPESPFIFRLTPRRNAQSTHFNFRLRSSDWLHLKQKPFQVFASNPNPSKGSYATEGNNVP  324
            RP+S F+  L+P   A   HFNFR  ++  + L+Q+   + ASN N S GS  +   +  
Sbjct  23   RPQSSFVTFLSPSHGAFLAHFNFRFNNAVSVQLRQRLLPISASNNNSSGGSDKSSDAS--  80

Query  325  QGPPLATILAGFLVLFAVCWILGSIVMWLVSLITNVPSSK  444
             GPPLATILAG LV   VCWI+GS+VMWL+SLITNVP  K
Sbjct  81   -GPPLATILAGVLVFCVVCWIVGSVVMWLISLITNVPPLK  119



>ref|XP_004248826.1| PREDICTED: uncharacterized protein LOC101253946 [Solanum lycopersicum]
Length=113

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 63/100 (63%), Gaps = 6/100 (6%)
 Frame = +1

Query  145  RPESPFIFRLTPRRNAQSTHFNFRLRSSDWLHLKQKPFQVFASNPNPSKGSYATEGNNVP  324
            RP++ FI    P R+A  T FN R  +   ++ +Q+   +  S+ NPS G    E +   
Sbjct  20   RPQTSFI---APTRDASPTQFNIRFNNVLNVYQRQRLLPISKSSTNPSGGP---EKSKDA  73

Query  325  QGPPLATILAGFLVLFAVCWILGSIVMWLVSLITNVPSSK  444
              PPLATILAG LV  AVCWI+GSIV+WL+SLITNV +SK
Sbjct  74   SSPPLATILAGILVFCAVCWIVGSIVLWLISLITNVLASK  113



>ref|XP_004488461.1| PREDICTED: uncharacterized protein LOC101498545 [Cicer arietinum]
Length=124

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 62/107 (58%), Gaps = 12/107 (11%)
 Frame = +1

Query  142  SRPESPFIFRLTPRRNAQSTHFNFRLRSSDWLHLKQKPFQVFASNPN------PSKGSYA  303
            S+P++P I  L      +++   FR  SS  L   QK   V A+NPN       ++GS  
Sbjct  24   SKPQNPLISTL------KTSFSTFRCISSRRLQTNQKLLTVSATNPNTGGEKSANEGSDV  77

Query  304  TEGNNVPQGPPLATILAGFLVLFAVCWILGSIVMWLVSLITNVPSSK  444
             E +N  QGPPL TILAG  V F VCW++GSI MWL+SLI NVP  K
Sbjct  78   KETSNASQGPPLLTILAGIFVFFLVCWVIGSIGMWLISLIVNVPPPK  124



>ref|NP_001237566.1| uncharacterized protein LOC100306614 [Glycine max]
 gb|ACU14884.1| unknown [Glycine max]
Length=123

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +1

Query  208  NFRLRSSDWLHLKQKPFQVFASNPN------PSKGSYATEGNNVPQGPPLATILAGFLVL  369
              R +    L + Q+   VFA+NPN      P++GS   E +N  QGPPL TILAGF VL
Sbjct  39   TIRCKGFSRLIVNQRLVTVFATNPNSVGEKSPTEGSDVNETSNAAQGPPLLTILAGFFVL  98

Query  370  FAVCWILGSIVMWLVSLITNVPSSK  444
            F VCW + SI+ WL+SLI NVP+ K
Sbjct  99   FVVCWSIWSIITWLISLIVNVPAPK  123



>gb|KHN24834.1| hypothetical protein glysoja_046412 [Glycine soja]
Length=122

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = +1

Query  208  NFRLRSSDWLHLKQKPFQVFASNPN------PSKGSYATEGNNVPQGPPLATILAGFLVL  369
              R +    L + Q+   VFA+NPN      P++GS   E +N  QGPPL TILAGF VL
Sbjct  39   TIRCKGFSRLIVNQRLVTVFATNPNSVGEKSPTEGSDVNETSNAAQGPPLLTILAGFFVL  98

Query  370  FAVCWILGSIVMWLVSLITNVPS  438
            F VCW + SI+ WL+SLI NVP+
Sbjct  99   FVVCWSIWSIITWLISLIVNVPA  121



>ref|XP_007149103.1| hypothetical protein PHAVU_005G041500g [Phaseolus vulgaris]
 gb|ESW21097.1| hypothetical protein PHAVU_005G041500g [Phaseolus vulgaris]
Length=125

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 57/105 (54%), Gaps = 6/105 (6%)
 Frame = +1

Query  148  PESPFIFRLTPRRNAQSTHFNFRLRSSDWLHLKQKPFQVFASNPN------PSKGSYATE  309
            P  P    + P  N   +  +FR +    L + Q+   VFA+NPN      P +GS   +
Sbjct  21   PSPPQFLSIAPPLNFSLSSSSFRCKVFRRLKVNQRVLTVFATNPNSVDGKSPKEGSEVNK  80

Query  310  GNNVPQGPPLATILAGFLVLFAVCWILGSIVMWLVSLITNVPSSK  444
             +N  QGPPL TILAG  VLF VCW + SI+ WL+SLI   P+ K
Sbjct  81   TSNAAQGPPLLTILAGLFVLFVVCWSIWSIIAWLISLIVTAPAPK  125



>gb|KEH38168.1| transmembrane protein, putative [Medicago truncatula]
 gb|KEH38170.1| transmembrane protein, putative [Medicago truncatula]
Length=123

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = +1

Query  211  FRLRSSDWLHLKQKPFQVFASNPNPSKGSYATEGNNVP------QGPPLATILAGFLVLF  372
            FR   S  L + +K   V A+NPN   G  + EG++V       QGPPL TILAG  V F
Sbjct  40   FRCIGSRKLQINRKLLTVSATNPNSGGGKSSNEGSDVKETGNASQGPPLLTILAGLFVFF  99

Query  373  AVCWILGSIVMWLVSLITNVPSSK  444
             V W++GS+V+WL+SLI NVPS K
Sbjct  100  LVGWVIGSVVVWLISLIVNVPSPK  123



>ref|XP_006439018.1| hypothetical protein CICLE_v10033102mg [Citrus clementina]
 ref|XP_006482808.1| PREDICTED: uncharacterized protein LOC102623948 [Citrus sinensis]
 gb|ESR52258.1| hypothetical protein CICLE_v10033102mg [Citrus clementina]
 gb|KDO46055.1| hypothetical protein CISIN_1g033511mg [Citrus sinensis]
Length=117

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 57/97 (59%), Gaps = 5/97 (5%)
 Frame = +1

Query  166  FRLTPRRNAQSTHFNFRLRSSDWLHLKQKPFQVFASNPNPSKGSY-----ATEGNNVPQG  330
             +L PR ++  ++F F+  S+  L  +Q+   VFASN  PS G        T+ ++  QG
Sbjct  21   LKLVPRVSSLPSNFRFKSNSTVRLQARQRFSTVFASNSTPSGGDSLQEKSDTKASDASQG  80

Query  331  PPLATILAGFLVLFAVCWILGSIVMWLVSLITNVPSS  441
            PP  TILAGF+V   VCWI+GSIV+WL  LI  +  S
Sbjct  81   PPFLTILAGFVVSVLVCWIVGSIVLWLTGLIVQLLKS  117



>emb|CDP07675.1| unnamed protein product [Coffea canephora]
Length=115

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 55/96 (57%), Gaps = 5/96 (5%)
 Frame = +1

Query  157  PFIFRLTPRRNAQSTHFNFRLRSSDWLHLKQKPFQVFASNPNPSKGSYATEGNNVPQGPP  336
            P I  L  R+ A  T+ NFRL++S  L L        AS  N S+GS    G    QGPP
Sbjct  25   PCIHFLHFRQYAPPTYVNFRLKNSVTLKL----LPTCASKTNSSEGSDRKNGETA-QGPP  79

Query  337  LATILAGFLVLFAVCWILGSIVMWLVSLITNVPSSK  444
              TILAGFLV F +CWI+GSIV+WL+ L    P SK
Sbjct  80   FLTILAGFLVFFVLCWIIGSIVLWLIGLSVRAPPSK  115



>ref|XP_007052619.1| UPF0182 protein jk1603, putative [Theobroma cacao]
 gb|EOX96776.1| UPF0182 protein jk1603, putative [Theobroma cacao]
Length=120

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 60/106 (57%), Gaps = 9/106 (8%)
 Frame = +1

Query  118  HLATAGGGSRPESPFIFRLTPRRNAQSTHFNFRLRSSDWLHLKQKPFQVFASNPNPSKGS  297
            HLA      RP      +L P+R   S    F+LR +  +  +++  ++F SNP PS  S
Sbjct  22   HLAFQPLNPRP------KLAPKRIPPSAS-TFKLRFNGTVKFERR-LRLFCSNP-PSGDS  72

Query  298  YATEGNNVPQGPPLATILAGFLVLFAVCWILGSIVMWLVSLITNVP  435
               +  +  QGPP  TILAGFLV F +CW+LGSI+MWL+ +I   P
Sbjct  73   ITEKSGDTAQGPPFPTILAGFLVFFLICWMLGSIIMWLIGVIVKFP  118



>ref|XP_009794908.1| PREDICTED: uncharacterized protein LOC104241660 [Nicotiana sylvestris]
Length=119

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 62/100 (62%), Gaps = 3/100 (3%)
 Frame = +1

Query  145  RPESPFIFRLTPRRNAQSTHFNFRLRSSDWLHLKQKPFQVFASNPNPSKGSYATEGNNVP  324
            RP+S F+  L+P   A   HFN R  ++  + L+Q+   + ASN   S  S  ++ ++  
Sbjct  23   RPQSSFVTFLSPSHGAFPAHFNSRFNNAVCVQLRQRLLPISASN---SNSSGGSDKSSDA  79

Query  325  QGPPLATILAGFLVLFAVCWILGSIVMWLVSLITNVPSSK  444
             GPPLATILAG LV   VCWI+ S+V+WL SLITNVP  K
Sbjct  80   SGPPLATILAGVLVFCVVCWIICSVVLWLTSLITNVPPLK  119



>ref|XP_011093393.1| PREDICTED: uncharacterized protein LOC105173378 [Sesamum indicum]
Length=136

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  208  NFRLRSSDWLHLKQKPFQVFASNPNPSKGSYATEGNNVPQGPPLATILAGFLVLFAVCWI  387
              RL +     +K+    ++AS+ NPS+GS  T+ +N  QGPP  TILAG +V   +CW+
Sbjct  58   KLRLTNEIREQVKESWHPLYASSTNPSEGSDDTKTSNTAQGPPFLTILAGLVVFLIICWL  117

Query  388  LGSIVMWLVSLITNVPSSK  444
            +GSI+MWL+ L+ + P  K
Sbjct  118  IGSILMWLIGLVVHPPQLK  136



>ref|XP_009365051.1| PREDICTED: uncharacterized protein LOC103954923 [Pyrus x bretschneideri]
Length=137

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 56/88 (64%), Gaps = 8/88 (9%)
 Frame = +1

Query  205  FNFRL-RSSDWLHLKQKPFQVFASNPNPSKG------SYATEGNN-VPQGPPLATILAGF  360
             +FRL ++   L +K+    V ASN NP  G      S   E N+  PQGPPL TILAG 
Sbjct  50   IHFRLNKNVLGLQIKETRHAVSASNSNPPDGDSTKDKSGGVETNDPAPQGPPLLTILAGI  109

Query  361  LVLFAVCWILGSIVMWLVSLITNVPSSK  444
            LVLF V W+LGSI+MW++SL+  +P+SK
Sbjct  110  LVLFLVFWVLGSILMWVISLLFRLPASK  137



>gb|AFK47963.1| unknown [Lotus japonicus]
Length=130

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 6/96 (6%)
 Frame = +1

Query  175  TPRRNAQSTHFNFRLRSSDWLHLKQKPFQVFASNPN------PSKGSYATEGNNVPQGPP  336
            TP      +    R + S  L + QK + V A+NPN      P++GS   E +N  QGPP
Sbjct  35   TPILKLSPSSSTLRCKVSRRLQINQKLWSVPATNPNSVGGKSPNEGSDVKETSNAGQGPP  94

Query  337  LATILAGFLVLFAVCWILGSIVMWLVSLITNVPSSK  444
              TILAG  V   + W +GSIV+WL+SLI N+P  K
Sbjct  95   FLTILAGLAVFLLITWFIGSIVVWLLSLIVNLPPPK  130



>ref|XP_004306488.1| PREDICTED: uncharacterized protein LOC101307043 [Fragaria vesca 
subsp. vesca]
Length=128

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 57/103 (55%), Gaps = 9/103 (9%)
 Frame = +1

Query  148  PESPFIFRLTPRRNAQSTHFNFRLRSSDW-LHLKQKPFQVFASNPNP------SKGSYAT  306
            P+ P   +L+P  +     F+FR + S   L L+++   V AS  NP         S + 
Sbjct  25   PQIPIALKLSPATD--QAPFDFRFKKSVLNLKLRERWQPVSASKSNPRDEESIEDQSGSV  82

Query  307  EGNNVPQGPPLATILAGFLVLFAVCWILGSIVMWLVSLITNVP  435
            +  + PQGPP  TILAGFLVLF V WI+GSI+MWLVS     P
Sbjct  83   KSGDAPQGPPFLTILAGFLVLFLVFWIIGSILMWLVSFFVTSP  125



>ref|XP_010257472.1| PREDICTED: uncharacterized protein LOC104597557 [Nelumbo nucifera]
Length=125

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 5/82 (6%)
 Frame = +1

Query  208  NFRLRSSDWLHLKQKPFQVFASNPNPSKGSYA---TEGNNVP--QGPPLATILAGFLVLF  372
            +FR  ++  + L+Q+   V AS+ NPS G  +   T+G      +GPP  TILAG +V  
Sbjct  43   SFRFVNAVNVRLRQRLPLVLASSTNPSGGDSSKEQTKGTETAGSEGPPFLTILAGLVVFL  102

Query  373  AVCWILGSIVMWLVSLITNVPS  438
             +CWILGSI+MWL+ LI NV S
Sbjct  103  FICWILGSIIMWLIGLIVNVSS  124



>ref|XP_009401869.1| PREDICTED: uncharacterized protein LOC103985771 [Musa acuminata 
subsp. malaccensis]
Length=124

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = +1

Query  169  RLTPRRNAQSTHFNFRLRSSDWLHLKQKPFQVFAS---NPNPSKGSYATEGNNVPQGPPL  339
            R  PR  A+     FR  ++    L +    VFAS   N  P+        +NV  GPPL
Sbjct  31   RPVPRAAARPARLGFRPGNAPNFDLNRWVATVFASDSSNTKPTANEKVDSSSNVGDGPPL  90

Query  340  ATILAGFLVLFAVCWILGSIVMWLVSLITNVPSS  441
             TILAG +V    CW +GSIV+WLV LI N PSS
Sbjct  91   PTILAGVVVFLLFCWAVGSIVLWLVGLIVNPPSS  124



>ref|XP_008350220.1| PREDICTED: uncharacterized protein LOC103413530 [Malus domestica]
Length=137

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 48/77 (62%), Gaps = 7/77 (9%)
 Frame = +1

Query  235  LHLKQKPFQVFASNPNPSKG------SYATEGNNV-PQGPPLATILAGFLVLFAVCWILG  393
            L +K+    V ASN NP  G      S   E N+  PQGPP  TILAGFLVL  V W+LG
Sbjct  61   LQIKETRHAVSASNSNPPDGDXTKDKSGXVETNDAAPQGPPPLTILAGFLVLILVFWVLG  120

Query  394  SIVMWLVSLITNVPSSK  444
            SI+MW++SL+  +P SK
Sbjct  121  SILMWVISLLFRLPPSK  137



>ref|XP_007220770.1| hypothetical protein PRUPE_ppa024515mg, partial [Prunus persica]
 gb|EMJ21969.1| hypothetical protein PRUPE_ppa024515mg, partial [Prunus persica]
Length=83

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 6/76 (8%)
 Frame = +1

Query  235  LHLKQKPFQVFASNPNPSKG------SYATEGNNVPQGPPLATILAGFLVLFAVCWILGS  396
            L +++    V ASN NPS G      S   + N+  QGPPL TI+AGF+V F + WILGS
Sbjct  8    LKIRESWHAVSASNSNPSSGDSVEDKSGGVKTNDAAQGPPLLTIVAGFVVFFLLFWILGS  67

Query  397  IVMWLVSLITNVPSSK  444
             +MWL+ L+   P  K
Sbjct  68   TLMWLIGLVVRFPPPK  83



>ref|XP_008786723.1| PREDICTED: uncharacterized protein LOC103704958 [Phoenix dactylifera]
Length=84

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 4/82 (5%)
 Frame = +1

Query  202  HFNFRLRSSDWLHLKQKP---FQVFASNPNP-SKGSYATEGNNVPQGPPLATILAGFLVL  369
             F  RL ++  L +K++      + ASNP   SK       + V  GPPL TILAG  V 
Sbjct  2    SFKSRLGNAVSLPVKRRVPVVLSLGASNPETTSKDKADKSSSGVAGGPPLLTILAGLFVF  61

Query  370  FAVCWILGSIVMWLVSLITNVP  435
              VCW++GSI MWLV LI NVP
Sbjct  62   LLVCWVVGSIAMWLVGLIVNVP  83



>ref|XP_006369469.1| hypothetical protein POPTR_0001s23730g [Populus trichocarpa]
 gb|ERP66038.1| hypothetical protein POPTR_0001s23730g [Populus trichocarpa]
Length=127

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 40/75 (53%), Gaps = 6/75 (8%)
 Frame = -2

Query  404  ITMDPKIQHTANKTKKPAKMVANGGPWGTLLPSVAYD------PFEGLGFDAKT*NGFCF  243
            + +DPK QH   KT+ PAK+V NGGPW + L  V  D      P EGL F+A T      
Sbjct  1    MMIDPKTQHKREKTRNPAKIVRNGGPWASSLDIVPPDFSSLESPSEGLEFEANTVYNLVL  60

Query  242  RCNQSELLNLKLKWV  198
             CN +  LNL  K +
Sbjct  61   NCNLAAFLNLDPKEI  75



>ref|XP_008245399.1| PREDICTED: uncharacterized protein LOC103343516 [Prunus mume]
Length=129

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  295  SYATEGNNVPQGPPLATILAGFLVLFAVCWILGSIVMWLVSLITNVPSSK  444
            S   + N+  QGPPL TI+AGF+V F + WILGSI+MWL+ L+   P  K
Sbjct  80   SGGVKTNDAAQGPPLLTIVAGFVVFFLLFWILGSILMWLIGLVVRFPPPK  129



>ref|XP_008245799.1| PREDICTED: uncharacterized protein LOC103343947 [Prunus mume]
Length=129

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  295  SYATEGNNVPQGPPLATILAGFLVLFAVCWILGSIVMWLVSLITNVPSSK  444
            S   + N+  QGPPL TI+AGF+V F + WILGSI+MWL+ L+   P  K
Sbjct  80   SGGVKTNDAAQGPPLLTIVAGFVVFFLLFWILGSILMWLIGLVVRFPPPK  129



>gb|EMS55679.1| hypothetical protein TRIUR3_04852 [Triticum urartu]
Length=129

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +1

Query  220  RSSDWLHLKQKPFQVFASNPNP-----SKGSYATEGNNVPQGPPLATILAGFLVLFAVCW  384
            R+S W     +   +FAS  +      SK S   + N+ P GPP+ TILAG  V F + W
Sbjct  51   RNSGWFENAARKKALFASETDSPSTEVSKQSSTGDANSSPHGPPVLTILAGIAVFFLLLW  110

Query  385  ILGSIVMWLVSLI  423
            ++GSI  W+V L+
Sbjct  111  VIGSIFTWIVGLV  123



>gb|EMT28192.1| hypothetical protein F775_15048 [Aegilops tauschii]
Length=129

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 5/73 (7%)
 Frame = +1

Query  220  RSSDWLHLKQKPFQVFASN---PNP--SKGSYATEGNNVPQGPPLATILAGFLVLFAVCW  384
            R+S W     K   +FAS+   PN   SK S   + +  P GPP+ TILAG +V F + W
Sbjct  51   RNSGWFENATKKKALFASDSDSPNTEVSKQSSTGDASASPDGPPVLTILAGIVVFFLLLW  110

Query  385  ILGSIVMWLVSLI  423
            ++GSI  W+V L+
Sbjct  111  VIGSIFTWIVGLV  123



>dbj|BAJ98526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=134

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = +1

Query  214  RLRSSDWLHLKQKPFQVFASNPNP--SKGSYATEGNNVPQGPPLATILAGFLVLFAVCWI  387
            RLR+ +  + K+  F     +PN   SK S  ++ N+ P GPP+ TILAG +V F + W+
Sbjct  59   RLRTEN--NPKKALFASETDSPNTEISKQSSTSDANSSPDGPPVLTILAGIVVFFLLLWV  116

Query  388  LGSIVMWLVSLI  423
            +GSI  W+V L+
Sbjct  117  IGSIFTWIVGLV  128



>ref|XP_010229270.1| PREDICTED: uncharacterized protein LOC104581893 [Brachypodium 
distachyon]
Length=137

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 42/85 (49%), Gaps = 9/85 (11%)
 Frame = +1

Query  196  STHFNFRLRSSDWL---------HLKQKPFQVFASNPNPSKGSYATEGNNVPQGPPLATI  348
            S H +   R+S W          H K+  F     +P       + + ++ P GPP+ TI
Sbjct  47   SRHPDLPARNSVWFENATMLRTEHKKKALFASETDSPTTDSSKRSDDNSSPPDGPPVLTI  106

Query  349  LAGFLVLFAVCWILGSIVMWLVSLI  423
            LAG +V F V W++GSI  W+V L+
Sbjct  107  LAGIIVFFLVLWVIGSIFTWIVGLV  131



>ref|XP_006649321.1| PREDICTED: uncharacterized protein LOC102703193 [Oryza brachyantha]
Length=128

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +1

Query  244  KQKPFQVFASNPNPSKGSYATEGN-NVPQGPPLATILAGFLVLFAVCWILGSIVMWLVSL  420
            K+   QV  ++   S  + AT+ N + P GPP+ TILAG +V   V W++GS++ W+  L
Sbjct  62   KEHQKQVLFASDRDSTSTGATDDNLSSPDGPPVLTILAGVIVFLLVLWVIGSVITWITGL  121

Query  421  I  423
            +
Sbjct  122  V  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160