BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M06

Length=506
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP09103.1|  unnamed protein product                                263   6e-80   Coffea canephora [robusta coffee]
gb|EPS58613.1|  hypothetical protein M569_16199                         253   8e-79   Genlisea aurea
gb|KJB83752.1|  hypothetical protein B456_013G262700                    256   1e-78   Gossypium raimondii
gb|KJB83751.1|  hypothetical protein B456_013G262700                    257   2e-78   Gossypium raimondii
gb|KJB83755.1|  hypothetical protein B456_013G262700                    258   1e-77   Gossypium raimondii
gb|KJB83748.1|  hypothetical protein B456_013G262700                    258   2e-77   Gossypium raimondii
gb|KJB83749.1|  hypothetical protein B456_013G262700                    258   2e-77   Gossypium raimondii
gb|KHF99787.1|  Serine/arginine repetitive matrix 1                     258   2e-77   Gossypium arboreum [tree cotton]
ref|XP_009612859.1|  PREDICTED: serine/arginine repetitive matrix...    256   8e-77   Nicotiana tomentosiformis
ref|XP_007016333.1|  Splicing factor PWI domain-containing protei...    256   2e-76   
ref|XP_007016332.1|  Splicing factor PWI domain-containing protei...    256   2e-76   
gb|KDP42210.1|  hypothetical protein JCGZ_02940                         253   1e-75   Jatropha curcas
emb|CBI16084.3|  unnamed protein product                                253   1e-75   Vitis vinifera
ref|XP_009789294.1|  PREDICTED: serine/arginine repetitive matrix...    253   1e-75   Nicotiana sylvestris
ref|XP_002280607.2|  PREDICTED: serine/arginine repetitive matrix...    253   2e-75   Vitis vinifera
ref|XP_010326175.1|  PREDICTED: serine/arginine repetitive matrix...    248   3e-75   
ref|XP_002520517.1|  copper ion binding protein, putative               251   5e-75   
gb|AAP06864.1|  SR-rich pre-mRNA splicing activator                     235   5e-75   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049684.1|  Os03g0270200                                       234   7e-75   
gb|EEC74941.1|  hypothetical protein OsI_10913                          234   8e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_002314154.2|  hypothetical protein POPTR_0009s04160g             250   1e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010043495.1|  PREDICTED: serine/arginine repetitive matrix...    249   3e-74   
ref|XP_010043494.1|  PREDICTED: serine/arginine repetitive matrix...    249   3e-74   
ref|XP_009375945.1|  PREDICTED: serine/arginine repetitive matrix...    248   5e-74   Pyrus x bretschneideri [bai li]
ref|XP_010262597.1|  PREDICTED: serine/arginine repetitive matrix...    244   6e-74   
ref|XP_009375946.1|  PREDICTED: serine/arginine repetitive matrix...    248   6e-74   
ref|XP_009375943.1|  PREDICTED: serine/arginine repetitive matrix...    248   7e-74   Pyrus x bretschneideri [bai li]
ref|XP_009364350.1|  PREDICTED: serine/arginine repetitive matrix...    248   8e-74   
ref|XP_008356772.1|  PREDICTED: serine/arginine repetitive matrix...    248   8e-74   Malus domestica [apple tree]
ref|XP_008356765.1|  PREDICTED: serine/arginine repetitive matrix...    248   8e-74   Malus domestica [apple tree]
ref|XP_008385098.1|  PREDICTED: serine/arginine repetitive matrix...    248   1e-73   
gb|KEH30184.1|  SR-rich pre-mRNA splicing activator                     247   2e-73   Medicago truncatula
ref|XP_008222060.1|  PREDICTED: serine/arginine repetitive matrix...    247   2e-73   
gb|KDO66636.1|  hypothetical protein CISIN_1g003124mg                   246   2e-73   Citrus sinensis [apfelsine]
gb|AES88912.2|  SR-rich pre-mRNA splicing activator                     248   2e-73   Medicago truncatula
gb|KEH30183.1|  SR-rich pre-mRNA splicing activator                     248   2e-73   Medicago truncatula
ref|XP_003606715.1|  Serine/arginine repetitive matrix protein          247   2e-73   
ref|XP_002299851.2|  hypothetical protein POPTR_0001s25140g             246   3e-73   Populus trichocarpa [western balsam poplar]
ref|XP_006488383.1|  PREDICTED: serine/arginine repetitive matrix...    246   3e-73   Citrus sinensis [apfelsine]
ref|XP_006488382.1|  PREDICTED: serine/arginine repetitive matrix...    246   3e-73   
ref|XP_006424900.1|  hypothetical protein CICLE_v10030390mg             246   3e-73   
gb|KDO66635.1|  hypothetical protein CISIN_1g003124mg                   246   3e-73   Citrus sinensis [apfelsine]
ref|XP_006651246.1|  PREDICTED: serine/arginine repetitive matrix...    236   3e-73   
tpg|DAA44607.1|  TPA: hypothetical protein ZEAMMB73_474732              229   4e-73   
ref|XP_007208179.1|  hypothetical protein PRUPE_ppa001408mg             245   8e-73   
ref|XP_004507160.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    245   1e-72   
ref|XP_006592181.1|  PREDICTED: serine/arginine repetitive matrix...    244   2e-72   Glycine max [soybeans]
ref|XP_002879206.1|  hypothetical protein ARALYDRAFT_901882             244   3e-72   Arabidopsis lyrata subsp. lyrata
gb|ABW81062.1|  proline-rich-protein                                    244   3e-72   Arabidopsis lyrata subsp. lyrata
ref|NP_180484.2|  splicing factor PWI domain-containing protein         244   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409968.1|  hypothetical protein EUTSA_v10016250mg             243   4e-72   Eutrema salsugineum [saltwater cress]
ref|XP_006846337.1|  hypothetical protein AMTR_s00012p00256890          243   5e-72   Amborella trichopoda
ref|XP_011461330.1|  PREDICTED: serine/arginine repetitive matrix...    243   5e-72   Fragaria vesca subsp. vesca
ref|XP_011461331.1|  PREDICTED: serine/arginine repetitive matrix...    243   5e-72   Fragaria vesca subsp. vesca
gb|EEE58772.1|  hypothetical protein OsJ_10288                          239   6e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010510519.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    242   1e-71   
ref|XP_006293680.1|  hypothetical protein CARUB_v10022637mg             240   5e-71   Capsella rubella
ref|XP_009416221.1|  PREDICTED: serine/arginine repetitive matrix...    239   5e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416220.1|  PREDICTED: serine/arginine repetitive matrix...    239   6e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010469978.1|  PREDICTED: serine/arginine repetitive matrix...    240   6e-71   Camelina sativa [gold-of-pleasure]
gb|ABF95203.1|  retrotransposon protein, putative, unclassified, ...    239   8e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010262596.1|  PREDICTED: serine/arginine repetitive matrix...    239   1e-70   
ref|XP_010262593.1|  PREDICTED: serine/arginine repetitive matrix...    239   1e-70   
ref|XP_004153149.1|  PREDICTED: uncharacterized protein LOC101206654    239   2e-70   
ref|XP_004145330.1|  PREDICTED: uncharacterized protein LOC101207842    239   2e-70   Cucumis sativus [cucumbers]
ref|XP_008457448.1|  PREDICTED: serine/arginine repetitive matrix...    239   3e-70   Cucumis melo [Oriental melon]
ref|XP_010256833.1|  PREDICTED: serine/arginine repetitive matrix...    238   4e-70   
ref|XP_010256831.1|  PREDICTED: serine/arginine repetitive matrix...    238   4e-70   Nelumbo nucifera [Indian lotus]
ref|XP_004984929.1|  PREDICTED: serine/arginine repetitive matrix...    237   7e-70   Setaria italica
ref|XP_001762564.1|  predicted protein                                  220   2e-69   
gb|KDO66637.1|  hypothetical protein CISIN_1g003124mg                   235   2e-69   Citrus sinensis [apfelsine]
ref|XP_010685690.1|  PREDICTED: serine/arginine repetitive matrix...    236   4e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010685692.1|  PREDICTED: serine/arginine repetitive matrix...    235   5e-69   
ref|XP_010228813.1|  PREDICTED: serine/arginine repetitive matrix...    230   1e-68   
ref|XP_010106541.1|  Serine/arginine repetitive matrix protein 1        233   1e-68   
ref|XP_001774764.1|  predicted protein                                  216   7e-68   
ref|XP_010228812.1|  PREDICTED: serine/arginine repetitive matrix...    230   3e-67   Brachypodium distachyon [annual false brome]
gb|ABW81113.1|  proline-rich protein                                    230   3e-67   Boechera divaricarpa
ref|XP_011035260.1|  PREDICTED: serine/arginine repetitive matrix...    230   4e-67   Populus euphratica
ref|XP_011035259.1|  PREDICTED: serine/arginine repetitive matrix...    230   4e-67   Populus euphratica
ref|XP_011035261.1|  PREDICTED: serine/arginine repetitive matrix...    229   5e-67   Populus euphratica
ref|XP_006362050.1|  PREDICTED: serine/arginine repetitive matrix...    229   5e-67   Solanum tuberosum [potatoes]
ref|XP_010521878.1|  PREDICTED: serine/arginine repetitive matrix...    229   6e-67   Tarenaya hassleriana [spider flower]
ref|XP_008803113.1|  PREDICTED: serine/arginine repetitive matrix...    229   9e-67   Phoenix dactylifera
ref|XP_008803112.1|  PREDICTED: serine/arginine repetitive matrix...    229   1e-66   Phoenix dactylifera
ref|XP_011035262.1|  PREDICTED: serine/arginine repetitive matrix...    228   1e-66   Populus euphratica
gb|KDO66634.1|  hypothetical protein CISIN_1g003124mg                   228   1e-66   Citrus sinensis [apfelsine]
gb|KDO66630.1|  hypothetical protein CISIN_1g003124mg                   228   1e-66   Citrus sinensis [apfelsine]
ref|XP_011032244.1|  PREDICTED: serine/arginine repetitive matrix...    228   2e-66   Populus euphratica
ref|XP_011032245.1|  PREDICTED: serine/arginine repetitive matrix...    227   3e-66   Populus euphratica
ref|XP_011080705.1|  PREDICTED: serine/arginine repetitive matrix...    227   3e-66   Sesamum indicum [beniseed]
ref|XP_011080704.1|  PREDICTED: serine/arginine repetitive matrix...    227   3e-66   Sesamum indicum [beniseed]
ref|XP_011080697.1|  PREDICTED: serine/arginine repetitive matrix...    227   3e-66   Sesamum indicum [beniseed]
ref|XP_010937571.1|  PREDICTED: serine/arginine repetitive matrix...    228   3e-66   Elaeis guineensis
ref|XP_011080706.1|  PREDICTED: serine/arginine repetitive matrix...    227   3e-66   Sesamum indicum [beniseed]
ref|XP_010326174.1|  PREDICTED: serine/arginine repetitive matrix...    227   3e-66   
emb|CAC03679.1|  SRM102                                                 227   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010937572.1|  PREDICTED: serine/arginine repetitive matrix...    227   4e-66   
ref|XP_004246955.1|  PREDICTED: serine/arginine repetitive matrix...    227   4e-66   Solanum lycopersicum
ref|XP_011032246.1|  PREDICTED: serine/arginine repetitive matrix...    226   5e-66   Populus euphratica
gb|KHN32153.1|  Serine/arginine repetitive matrix protein 1             227   6e-66   Glycine soja [wild soybean]
tpg|DAA44610.1|  TPA: hypothetical protein ZEAMMB73_474732              222   8e-66   
gb|EMS59731.1|  Serine/arginine repetitive matrix protein 1             226   9e-66   Triticum urartu
gb|AAC95214.1|  putative proline-rich protein                           226   9e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008801616.1|  PREDICTED: serine/arginine repetitive matrix...    225   2e-65   Phoenix dactylifera
ref|XP_008801619.1|  PREDICTED: serine/arginine repetitive matrix...    224   3e-65   Phoenix dactylifera
ref|XP_007132039.1|  hypothetical protein PHAVU_011G061700g             224   3e-65   Phaseolus vulgaris [French bean]
ref|XP_009144394.1|  PREDICTED: serine/arginine repetitive matrix...    224   4e-65   Brassica rapa
ref|XP_010920517.1|  PREDICTED: serine/arginine repetitive matrix...    223   8e-65   
gb|KHN21923.1|  Serine/arginine repetitive matrix protein 1             223   1e-64   Glycine soja [wild soybean]
ref|XP_010920514.1|  PREDICTED: serine/arginine repetitive matrix...    223   1e-64   Elaeis guineensis
emb|CDY65665.1|  BnaC04g54780D                                          222   1e-64   Brassica napus [oilseed rape]
ref|XP_003539073.1|  PREDICTED: serine/arginine repetitive matrix...    223   2e-64   Glycine max [soybeans]
gb|ABW81077.1|  Prp9                                                    220   1e-63   Tarenaya spinosa
ref|XP_008681504.1|  PREDICTED: uncharacterized protein LOC100304...    218   7e-63   
ref|XP_008681507.1|  PREDICTED: uncharacterized protein LOC100304...    218   7e-63   
ref|XP_008681486.1|  PREDICTED: uncharacterized protein LOC100304...    218   8e-63   Zea mays [maize]
ref|XP_008681498.1|  PREDICTED: uncharacterized protein LOC100304...    218   9e-63   Zea mays [maize]
ref|XP_002973816.1|  hypothetical protein SELMODRAFT_100233             202   4e-62   
ref|XP_009419742.1|  PREDICTED: serine/arginine repetitive matrix...    214   9e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPB85601.1|  hypothetical protein HMPREF1544_07594                   166   2e-48   Mucor circinelloides f. circinelloides 1006PhL
emb|CDS13551.1|  hypothetical protein LRAMOSA05727                      168   2e-47   Lichtheimia ramosa
emb|CDH50351.1|  pwi domain-containing protein                          167   2e-47   Lichtheimia corymbifera JMRC:FSU:9682
emb|CEG73501.1|  Putative PWI domain-containing protein                 163   2e-46   Rhizopus microsporus
dbj|GAN09279.1|  PWI domain-containing protein                          163   2e-46   Mucor ambiguus
gb|KDQ07409.1|  hypothetical protein BOTBODRAFT_120067                  158   2e-45   Botryobasidium botryosum FD-172 SS1
emb|CEP13732.1|  hypothetical protein                                   158   2e-44   Parasitella parasitica
gb|KDD75666.1|  hypothetical protein H632_c561p1                        153   1e-43   Helicosporidium sp. ATCC 50920
gb|KJB83750.1|  hypothetical protein B456_013G262700                    162   4e-43   Gossypium raimondii
emb|CDH50352.1|  pwi domain-containing protein                          156   5e-43   Lichtheimia corymbifera JMRC:FSU:9682
gb|KDO66638.1|  hypothetical protein CISIN_1g003124mg                   160   2e-42   Citrus sinensis [apfelsine]
gb|KDQ31993.1|  hypothetical protein PLEOSDRAFT_1025753                 149   3e-42   Pleurotus ostreatus PC15
gb|KIJ61599.1|  hypothetical protein HYDPIDRAFT_137559                  152   6e-42   Hydnomerulius pinastri MD-312
ref|XP_006409967.1|  hypothetical protein EUTSA_v10016250mg             159   6e-42   Eutrema salsugineum [saltwater cress]
gb|KIM46751.1|  hypothetical protein M413DRAFT_40460                    146   4e-41   Hebeloma cylindrosporum h7
gb|KIM70671.1|  hypothetical protein SCLCIDRAFT_76017                   146   4e-41   Scleroderma citrinum Foug A
ref|XP_009549905.1|  hypothetical protein HETIRDRAFT_243565             145   6e-41   Heterobasidion irregulare TC 32-1
ref|XP_007366678.1|  PWI domain-containing protein                      148   6e-41   Dichomitus squalens LYAD-421 SS1
emb|CCO26855.1|  PWI domain-containing protein C825,05c                 149   1e-40   Rhizoctonia solani AG-1 IB
gb|KII87767.1|  hypothetical protein PLICRDRAFT_112049                  150   1e-40   Plicaturopsis crispa FD-325 SS-3
ref|XP_002124610.1|  PREDICTED: serine/arginine repetitive matrix...    146   1e-40   
ref|XP_002124674.1|  PREDICTED: serine/arginine repetitive matrix...    147   2e-40   
gb|KIK98909.1|  hypothetical protein PAXRUDRAFT_618522                  146   2e-40   Paxillus rubicundulus Ve08.2h10
gb|KIK68799.1|  hypothetical protein GYMLUDRAFT_68631                   151   3e-40   Gymnopus luxurians FD-317 M1
ref|XP_005988815.1|  PREDICTED: serine/arginine repetitive matrix...    155   3e-40   
gb|KIK21297.1|  hypothetical protein PISMIDRAFT_66449                   144   3e-40   Pisolithus microcarpus 441
ref|XP_005988814.1|  PREDICTED: serine/arginine repetitive matrix...    155   3e-40   Latimeria chalumnae
gb|KIO14306.1|  hypothetical protein M404DRAFT_992582                   152   5e-40   Pisolithus tinctorius Marx 270
ref|XP_007852080.1|  hypothetical protein Moror_3102                    150   1e-39   
gb|KIO25371.1|  hypothetical protein M407DRAFT_25274                    149   1e-39   Tulasnella calospora MUT 4182
gb|KIP02407.1|  hypothetical protein PHLGIDRAFT_112065                  144   2e-39   Phlebiopsis gigantea 11061_1 CR5-6
gb|AHH81768.1|  serine/arginine repetitive matrix protein 1-like ...    147   2e-39   Biomphalaria glabrata [bloodfluke planorb]
ref|XP_008041955.1|  PWI domain-containing protein                      145   3e-39   Trametes versicolor FP-101664 SS1
emb|CDO71127.1|  hypothetical protein BN946_scf184844.g131              146   5e-39   Trametes cinnabarina
gb|ELU41649.1|  SR-rich pre-mRNA splicing activator                     148   5e-39   Rhizoctonia solani AG-1 IA
gb|EMS22473.1|  SR-rich pre-mRNA splicing activator                     147   9e-39   Rhodotorula toruloides NP11
gb|EXX63474.1|  hypothetical protein RirG_151940                        146   9e-39   Rhizophagus irregularis DAOM 197198w
gb|EUC66839.1|  serine/arginine repetitive matrix-like protein, p...    148   9e-39   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_007869448.1|  PWI domain-containing protein                      144   1e-38   Gloeophyllum trabeum ATCC 11539
dbj|BAB25575.1|  unnamed protein product                                143   1e-38   Mus musculus [mouse]
gb|KDR80213.1|  hypothetical protein GALMADRAFT_242506                  147   2e-38   Galerina marginata CBS 339.88
gb|KJA25476.1|  hypothetical protein HYPSUDRAFT_64668                   147   2e-38   Hypholoma sublateritium FD-334 SS-4
gb|KIK37574.1|  hypothetical protein CY34DRAFT_451867                   142   3e-38   Suillus luteus UH-Slu-Lm8-n1
gb|KIJ11168.1|  hypothetical protein PAXINDRAFT_15897                   147   3e-38   Paxillus involutus ATCC 200175
gb|KIM86657.1|  hypothetical protein PILCRDRAFT_311079                  145   3e-38   Piloderma croceum F 1598
ref|XP_007392708.1|  hypothetical protein PHACADRAFT_26227              146   3e-38   Phanerochaete carnosa HHB-10118-sp
emb|CEL57689.1|  protein phosphatase 2 (formerly 2A), regulatory ...    149   4e-38   Rhizoctonia solani AG-1 IB
gb|EPT02135.1|  hypothetical protein FOMPIDRAFT_1048148                 144   7e-38   Fomitopsis pinicola FP-58527 SS1
ref|XP_007771072.1|  PWI domain-containing protein                      138   7e-38   Coniophora puteana RWD-64-598 SS2
gb|AAL89660.1|AF411956_1  SRm160/300 splicing coactivator               138   9e-38   Takifugu rubripes [tiger puffer]
ref|XP_006752139.1|  PREDICTED: serine/arginine repetitive matrix...    143   9e-38   Leptonychotes weddellii
ref|XP_006463501.1|  hypothetical protein AGABI2DRAFT_194307            145   1e-37   Agaricus bisporus var. bisporus H97
gb|KIY47475.1|  PWI domain-containing protein                           137   1e-37   Fistulina hepatica ATCC 64428
ref|XP_007334057.1|  hypothetical protein AGABI1DRAFT_116472            145   1e-37   Agaricus bisporus var. burnettii JB137-S8
ref|XP_007270525.1|  hypothetical protein FOMMEDRAFT_136573             145   2e-37   Fomitiporia mediterranea MF3/22
gb|EMD35594.1|  hypothetical protein CERSUDRAFT_85538                   144   2e-37   Gelatoporia subvermispora B
ref|XP_007346622.1|  PWI domain-containing protein                      139   2e-37   
gb|KIJ98811.1|  hypothetical protein K443DRAFT_195324                   144   2e-37   Laccaria amethystina LaAM-08-1
gb|ERZ98846.1|  hypothetical protein GLOINDRAFT_70246                   137   2e-37   
emb|CAJ83937.1|  serine/arginine repetitive matrix 1                    147   2e-37   Xenopus tropicalis [western clawed frog]
ref|XP_009046201.1|  hypothetical protein LOTGIDRAFT_137917             136   3e-37   Lottia gigantea
ref|NP_001005645.1|  serine/arginine repetitive matrix 1                146   3e-37   Xenopus tropicalis [western clawed frog]
ref|XP_007301834.1|  hypothetical protein STEHIDRAFT_154602             144   3e-37   Stereum hirsutum FP-91666 SS1
gb|AAH77771.1|  LOC445881 protein                                       145   4e-37   Xenopus laevis [clawed frog]
gb|EIE88227.1|  hypothetical protein RO3G_12938                         146   4e-37   Rhizopus delemar RA 99-880
ref|XP_004592301.1|  PREDICTED: serine/arginine repetitive matrix...    146   5e-37   Ochotona princeps [southern American pika]
gb|EDL80753.1|  serine/arginine repetitive matrix 1 (predicted), ...    143   5e-37   Rattus norvegicus [brown rat]
ref|XP_004592299.1|  PREDICTED: serine/arginine repetitive matrix...    146   5e-37   Ochotona princeps [southern American pika]
ref|XP_004592300.1|  PREDICTED: serine/arginine repetitive matrix...    146   6e-37   Ochotona princeps [southern American pika]
ref|XP_004592298.1|  PREDICTED: serine/arginine repetitive matrix...    146   6e-37   Ochotona princeps [southern American pika]
dbj|BAK63562.1|  serine/arginine repetitive matrix protein 1            143   6e-37   Pan troglodytes
gb|AAH97656.1|  LOC494754 protein                                       145   7e-37   Xenopus laevis [clawed frog]
ref|XP_004341588.1|  PWI domain containing protein                      142   7e-37   Acanthamoeba castellanii str. Neff
ref|XP_007424155.1|  PREDICTED: serine/arginine repetitive matrix...    145   7e-37   
ref|XP_005988816.1|  PREDICTED: serine/arginine repetitive matrix...    145   7e-37   Latimeria chalumnae
gb|ETS63133.1|  hypothetical protein PaG_02911                          140   7e-37   Moesziomyces aphidis DSM 70725
ref|XP_005988813.1|  PREDICTED: serine/arginine repetitive matrix...    145   7e-37   Latimeria chalumnae
ref|NP_001086440.1|  serine/arginine repetitive matrix 1                145   8e-37   Xenopus laevis [clawed frog]
ref|XP_011060800.1|  PREDICTED: serine/arginine repetitive matrix...    135   1e-36   Acromyrmex echinatior
ref|XP_010824971.1|  PREDICTED: serine/arginine repetitive matrix...    144   1e-36   
ref|XP_003027506.1|  hypothetical protein SCHCODRAFT_17474              139   2e-36   Schizophyllum commune H4-8
ref|XP_007424152.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Python bivittatus
ref|XP_007424151.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Python bivittatus
ref|XP_003227241.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Anolis carolinensis [Carolina anole]
ref|XP_007424150.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Python bivittatus
ref|XP_008118563.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Anolis carolinensis [Carolina anole]
ref|XP_004394850.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   
ref|XP_003482044.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   
ref|XP_007121181.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   
ref|XP_011282836.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   
ref|XP_011282833.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   
gb|ACN10942.1|  Serine/arginine repetitive matrix protein 1             142   2e-36   Salmo salar
ref|XP_011282835.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   
ref|XP_005665158.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   
dbj|GAC76886.1|  splicing coactivator SRm160/300, subunit SRm160        139   2e-36   Moesziomyces antarcticus T-34
ref|XP_004425801.1|  PREDICTED: uncharacterized protein LOC101387...    144   2e-36   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005665157.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   
ref|XP_010343877.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Saimiri boliviensis boliviensis
ref|XP_006862351.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Chrysochloris asiatica
ref|XP_007121180.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Physeter catodon
ref|XP_011282832.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   
gb|AAP97290.1|AF419855_1  Ser/Arg-related nuclear matrix protein        144   2e-36   Homo sapiens [man]
ref|XP_011282834.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   
ref|XP_008573197.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Galeopterus variegatus [Malayan flying lemur]
ref|XP_003415444.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Loxodonta africana [African bush elephant]
emb|CCM00237.1|  predicted protein                                      141   2e-36   Fibroporia radiculosa
dbj|GAA99222.1|  hypothetical protein E5Q_05915                         141   2e-36   Mixia osmundae IAM 14324
ref|XP_007933924.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Orycteropus afer afer
ref|XP_004850657.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-36   Heterocephalus glaber [naked mole rat]
ref|XP_010593392.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Loxodonta africana [African bush elephant]
ref|XP_005665155.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004425799.1|  PREDICTED: uncharacterized protein LOC101387...    144   3e-36   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_004465431.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004850656.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Heterocephalus glaber [naked mole rat]
ref|XP_010593393.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008961404.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Pan paniscus [bonobo]
ref|XP_006078051.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_007121179.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Physeter catodon
ref|XP_005245778.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_007121183.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_002716019.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Oryctolagus cuniculus [domestic rabbit]
ref|XP_007121182.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Physeter catodon
ref|XP_008998898.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Callithrix jacchus [common marmoset]
ref|XP_011226923.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    144   3e-36   
ref|XP_004425800.1|  PREDICTED: uncharacterized protein LOC101387...    144   3e-36   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_010828369.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Bison bison bison
ref|XP_005353112.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005665156.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_009200129.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Papio anubis [baboon]
ref|XP_007978194.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Chlorocebus sabaeus
emb|CBQ72148.1|  conserved hypothetical protein                         139   3e-36   Sporisorium reilianum SRZ2
ref|XP_004741210.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Mustela putorius furo [black ferret]
ref|XP_008573198.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Galeopterus variegatus [Malayan flying lemur]
ref|XP_011355919.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Pteropus vampyrus
ref|XP_852745.1|  PREDICTED: serine/arginine repetitive matrix pr...    144   3e-36   Canis lupus familiaris [dogs]
ref|XP_003799816.1|  PREDICTED: uncharacterized protein LOC100961...    144   3e-36   Otolemur garnettii
gb|EDL29987.1|  serine/arginine repetitive matrix 1, isoform CRA_c      144   3e-36   Mus musculus [mouse]
ref|XP_004850655.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006862350.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Chrysochloris asiatica
ref|XP_004850654.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Heterocephalus glaber [naked mole rat]
ref|XP_008531008.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Equus przewalskii [Przewalski horse]
gb|AAC17422.1|  plenty-of-prolines-101                                  144   3e-36   Mus musculus [mouse]
ref|XP_006078050.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Bubalus bubalis [domestic water buffalo]
ref|XP_005544475.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Macaca fascicularis [crab eating macaque]
ref|XP_006631428.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Lepisosteus oculatus
ref|XP_007522639.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Erinaceus europaeus [common hedgehog]
ref|XP_008573196.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Galeopterus variegatus [Malayan flying lemur]
ref|XP_010632001.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Fukomys damarensis [Damara mole rat]
ref|XP_004741209.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004465430.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_007522638.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Erinaceus europaeus [common hedgehog]
ref|XP_004465429.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Dasypus novemcinctus
ref|XP_003891388.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Papio anubis [baboon]
ref|XP_005875244.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005353111.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Microtus ochrogaster [prairie voles]
ref|XP_008820510.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Nannospalax galili
ref|XP_004783474.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_007491380.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Monodelphis domestica
ref|XP_001362878.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   Monodelphis domestica
ref|XP_003810827.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_007491378.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006539094.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004465432.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_007121178.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_009449174.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004603509.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|NP_005830.2|  serine/arginine repetitive matrix protein 1 iso...    144   3e-36   
ref|XP_010593390.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_007491381.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010828368.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005197655.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008820511.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010828366.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010593391.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005544473.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006862349.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004465427.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
gb|EDL29985.1|  serine/arginine repetitive matrix 1, isoform CRA_a      144   3e-36   
ref|XP_001252332.2|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005617847.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010354028.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010828370.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008531007.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005079656.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005197654.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004377162.1|  PREDICTED: uncharacterized protein LOC101351...    144   3e-36   
ref|XP_010354027.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005317676.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005079655.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005544474.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005197653.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005617846.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004603508.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004377161.1|  PREDICTED: uncharacterized protein LOC101351...    144   3e-36   
ref|XP_008820509.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008820508.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010354026.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004465428.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_002750477.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
dbj|BAH13726.1|  unnamed protein product                                144   3e-36   
ref|XP_005977453.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005875243.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010354024.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|NP_001126712.1|  serine/arginine repetitive matrix protein 1        144   3e-36   
ref|XP_006777593.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006539092.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004741208.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_001106234.2|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006539091.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_011355917.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010632010.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008146299.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006539090.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_009200134.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_007491377.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_007491375.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006078049.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_001362791.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005245779.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
gb|AAH36187.1|  Serine/arginine repetitive matrix 1                     144   3e-36   
ref|XP_005079657.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006777592.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006196850.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008961402.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006078048.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005353109.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006777594.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_011355920.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008961405.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006104159.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    144   3e-36   
ref|XP_005394872.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008531006.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_007491379.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_011248603.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006078047.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006159461.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008531009.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010354025.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_003891389.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_003799817.1|  PREDICTED: uncharacterized protein LOC100961...    144   3e-36   
ref|XP_005245775.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010631995.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010631984.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008998894.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008263883.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008998899.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004678682.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010631979.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008998897.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008263885.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006975730.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004465426.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004741207.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
gb|AAH94322.1|  Srrm1 protein                                           144   3e-36   
ref|XP_008146298.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004465425.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005617844.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_004603507.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006539093.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008263884.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005617845.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_009200124.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_006239247.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008961403.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|NP_001101456.2|  serine/arginine repetitive matrix protein 1        144   3e-36   
ref|XP_005353110.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_008998895.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_010354022.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_005245777.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-36   
ref|XP_003810828.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_008998896.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_005317675.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_005353108.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_011355916.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|NP_001123949.1|  serine/arginine repetitive matrix protein 1 ...    144   4e-36   
ref|XP_005544476.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_005544472.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_007491376.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_006159459.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_006539089.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_005317673.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|NP_058079.2|  serine/arginine repetitive matrix protein 1 iso...    144   4e-36   
dbj|GAK63772.1|  PWI domain-containing protein                          138   4e-36   
ref|XP_006159460.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_004657568.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_006777591.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_006777590.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
gb|EDL29988.1|  serine/arginine repetitive matrix 1, isoform CRA_d      144   4e-36   
ref|XP_008263882.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|NP_001290377.1|  serine/arginine repetitive matrix protein 1 ...    144   4e-36   
ref|XP_006159462.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_005394871.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_008531005.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_008961401.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_008531003.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
sp|Q52KI8.2|SRRM1_MOUSE  RecName: Full=Serine/arginine repetitive...    144   4e-36   
ref|XP_006196849.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_006239246.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_006975729.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_005245774.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_005394869.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_007978191.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_005317674.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_005544471.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_004678681.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
gb|KFO37728.1|  Serine/arginine repetitive matrix protein 1             144   4e-36   
ref|XP_001106172.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
gb|EHH49656.1|  hypothetical protein EGM_00354                          144   4e-36   
gb|EAW95140.1|  serine/arginine repetitive matrix 1, isoform CRA_c      144   4e-36   
ref|XP_008531004.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_006777589.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_004678680.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_011355915.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_008060364.1|  PREDICTED: serine/arginine repetitive matrix...    143   4e-36   
ref|XP_004657567.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_008146297.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_005394870.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_006239245.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_006239244.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_005544470.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_004657566.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_004657564.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_006196848.1|  PREDICTED: serine/arginine repetitive matrix...    144   4e-36   
ref|XP_008060362.1|  PREDICTED: serine/arginine repetitive matrix...    143   4e-36   
ref|XP_005875245.1|  PREDICTED: serine/arginine repetitive matrix...    143   4e-36   
ref|XP_008060363.1|  PREDICTED: serine/arginine repetitive matrix...    143   4e-36   
ref|XP_004678679.1|  PREDICTED: serine/arginine repetitive matrix...    143   4e-36   
ref|XP_004657565.1|  PREDICTED: serine/arginine repetitive matrix...    143   4e-36   
ref|NP_001026665.1|  serine/arginine repetitive matrix protein 1        143   4e-36   
ref|XP_005875242.1|  PREDICTED: serine/arginine repetitive matrix...    143   5e-36   
ref|XP_005529770.1|  PREDICTED: serine/arginine repetitive matrix...    143   5e-36   
gb|EPQ13299.1|  Serine/arginine repetitive matrix protein 1             143   5e-36   
ref|XP_011285989.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    140   6e-36   
ref|XP_007257645.1|  PREDICTED: serine/arginine repetitive matrix...    142   6e-36   
ref|XP_007257644.1|  PREDICTED: serine/arginine repetitive matrix...    142   6e-36   
gb|EJU02382.1|  hypothetical protein DACRYDRAFT_94712                   140   7e-36   
ref|XP_010787172.1|  PREDICTED: serine/arginine repetitive matrix...    140   8e-36   
ref|XP_010787170.1|  PREDICTED: serine/arginine repetitive matrix...    140   9e-36   
gb|KDE06621.1|  hypothetical protein MVLG_03117                         139   9e-36   
ref|NP_998607.1|  serine/arginine repetitive matrix protein 1           142   9e-36   
ref|XP_011488896.1|  PREDICTED: serine/arginine repetitive matrix...    142   9e-36   
ref|XP_010787171.1|  PREDICTED: serine/arginine repetitive matrix...    139   9e-36   
ref|XP_008313453.1|  PREDICTED: serine/arginine repetitive matrix...    142   9e-36   
ref|XP_008313300.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-35   
ref|XP_001624661.1|  predicted protein                                  132   1e-35   
emb|CDQ64409.1|  unnamed protein product                                142   1e-35   
ref|XP_005922372.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-35   
emb|CDQ74671.1|  unnamed protein product                                142   1e-35   
ref|XP_005651911.1|  hypothetical protein COCSUDRAFT_64195              138   1e-35   
gb|ACN11002.1|  Serine/arginine repetitive matrix protein 1             142   1e-35   
ref|XP_003446232.2|  PREDICTED: serine/arginine repetitive matrix...    142   1e-35   
ref|NP_001131046.1|  serine/arginine repetitive matrix 1                141   1e-35   
ref|XP_005739009.1|  PREDICTED: serine/arginine repetitive matrix...    142   2e-35   
gb|AAI30177.1|  LOC494754 protein                                       141   2e-35   
ref|XP_004566623.1|  PREDICTED: serine/arginine repetitive matrix...    142   2e-35   
ref|XP_006800709.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-35   
ref|XP_005922371.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-35   
ref|XP_010877536.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-35   
ref|XP_007415598.1|  hypothetical protein MELLADRAFT_79059              138   2e-35   
gb|AAI08753.1|  LOC494754 protein                                       141   2e-35   
ref|XP_007574465.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-35   
ref|XP_005761923.1|  hypothetical protein EMIHUDRAFT_58282              132   2e-35   
ref|XP_005158559.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-35   
ref|XP_005799192.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-35   
ref|XP_005799191.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-35   
ref|XP_008397816.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-35   
ref|XP_007574441.1|  PREDICTED: serine/arginine repetitive matrix...    141   3e-35   
ref|XP_007574450.1|  PREDICTED: serine/arginine repetitive matrix...    141   3e-35   
ref|XP_008397815.1|  PREDICTED: serine/arginine repetitive matrix...    141   3e-35   
ref|XP_007574456.1|  PREDICTED: serine/arginine repetitive matrix...    141   3e-35   
gb|KIL64103.1|  hypothetical protein M378DRAFT_11682                    138   3e-35   
ref|XP_008397817.1|  PREDICTED: serine/arginine repetitive matrix...    141   3e-35   
ref|XP_007459367.1|  PREDICTED: serine/arginine repetitive matrix...    140   3e-35   
ref|XP_008282436.1|  PREDICTED: serine/arginine repetitive matrix...    140   3e-35   
ref|XP_010877535.1|  PREDICTED: serine/arginine repetitive matrix...    140   4e-35   
ref|XP_010729605.1|  PREDICTED: serine/arginine repetitive matrix...    140   4e-35   
ref|XP_005665165.1|  PREDICTED: serine/arginine repetitive matrix...    140   5e-35   
ref|XP_002590791.1|  hypothetical protein BRAFLDRAFT_218692             130   5e-35   
gb|ADX97057.1|  serine/arginine repetitive matrix protein 1             130   6e-35   
ref|XP_005665163.1|  PREDICTED: serine/arginine repetitive matrix...    140   6e-35   



>emb|CDP09103.1| unnamed protein product [Coffea canephora]
Length=767

 Score =   263 bits (673),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMRPWIATRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFMERNTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMERNTGKFMKELWSLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>gb|EPS58613.1| hypothetical protein M569_16199, partial [Genlisea aurea]
Length=445

 Score =   253 bits (645),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY+LLEGK+VNGKE+QI LTGFMERNTGKFMKELW +LLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYTLLEGKEVNGKEIQISLTGFMERNTGKFMKELWVMLLSAQKNVSGVPQ  120

Query  469  QFLDAKEEETR  501
            QFLDAKEEETR
Sbjct  121  QFLDAKEEETR  131



>gb|KJB83752.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
 gb|KJB83753.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=604

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>gb|KJB83751.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=660

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>gb|KJB83755.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=815

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>gb|KJB83748.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=860

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>gb|KJB83749.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=862

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>gb|KHF99787.1| Serine/arginine repetitive matrix 1 [Gossypium arboreum]
Length=863

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_009612859.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Nicotiana 
tomentosiformis]
Length=873

 Score =   256 bits (655),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K VNGKEVQI LTGFMERNTGKFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLERKVVNGKEVQISLTGFMERNTGKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFL+AKEEE RK
Sbjct  121  QFLEAKEEEMRK  132



>ref|XP_007016333.1| Splicing factor PWI domain-containing protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY33952.1| Splicing factor PWI domain-containing protein, putative isoform 
2 [Theobroma cacao]
Length=896

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDMTKVEMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWTLLLSAQRNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_007016332.1| Splicing factor PWI domain-containing protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY33951.1| Splicing factor PWI domain-containing protein, putative isoform 
1 [Theobroma cacao]
Length=943

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDMTKVEMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWTLLLSAQRNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>gb|KDP42210.1| hypothetical protein JCGZ_02940 [Jatropha curcas]
Length=870

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMRKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+VNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDAKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAQKNESGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>emb|CBI16084.3| unnamed protein product [Vitis vinifera]
Length=866

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD+ KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDVTKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ KDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDRKDVNGKEVQISLTGFMEKNTGKFMKELWALLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETR+
Sbjct  121  QFLDAKEEETRR  132



>ref|XP_009789294.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Nicotiana 
sylvestris]
Length=873

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K VNGKEVQI LTGFMERNTGKFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLERKVVNGKEVQISLTGFMERNTGKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
             FL+AKEEE RK
Sbjct  121  LFLEAKEEEMRK  132



>ref|XP_002280607.2| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Vitis vinifera]
Length=922

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD+ KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDVTKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ KDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDRKDVNGKEVQISLTGFMEKNTGKFMKELWALLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETR+
Sbjct  121  QFLDAKEEETRR  132



>ref|XP_010326175.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Solanum lycopersicum]
Length=621

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV++PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLE K  NGKE+QI LTGFMERNT KFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTAKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETR  501
            QFL+AKEEE R
Sbjct  121  QFLEAKEEEMR  131



>ref|XP_002520517.1| copper ion binding protein, putative [Ricinus communis]
 gb|EEF41930.1| copper ion binding protein, putative [Ricinus communis]
Length=860

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQA+LLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQARLLKSQKFAPELEHLVDMRKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+VNGKEVQIQLTGFME+NT KFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLEAKEVNGKEVQIQLTGFMEKNTVKFMKELWALLLSAQKNESGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>gb|AAP06864.1| SR-rich pre-mRNA splicing activator [Oryza sativa Japonica Group]
 gb|AAP06930.1| SR-rich pre-mRNA splicing activator [Oryza sativa Japonica Group]
Length=199

 Score =   235 bits (599),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKE E ++
Sbjct  121  QFLDAKEAEIQQ  132



>ref|NP_001049684.1| Os03g0270200 [Oryza sativa Japonica Group]
 dbj|BAF11598.1| Os03g0270200 [Oryza sativa Japonica Group]
Length=186

 Score =   234 bits (597),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKE E ++
Sbjct  121  QFLDAKEAEIQQ  132



>gb|EEC74941.1| hypothetical protein OsI_10913 [Oryza sativa Indica Group]
Length=201

 Score =   234 bits (598),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKE E ++
Sbjct  121  QFLDAKEAEIQQ  132



>ref|XP_002314154.2| hypothetical protein POPTR_0009s04160g [Populus trichocarpa]
 gb|EEE88109.2| hypothetical protein POPTR_0009s04160g [Populus trichocarpa]
Length=882

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAQKNESGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_010043495.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Eucalyptus grandis]
Length=877

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELE LVDM KVKMDVM+PWIA RVT L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEFLVDMTKVKMDVMKPWIATRVTGLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQIQLTGFME+NTGKFMKELW+LL+SAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTGKFMKELWTLLISAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_010043494.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW85510.1| hypothetical protein EUGRSUZ_B02307 [Eucalyptus grandis]
Length=878

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELE LVDM KVKMDVM+PWIA RVT L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEFLVDMTKVKMDVMKPWIATRVTGLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQIQLTGFME+NTGKFMKELW+LL+SAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTGKFMKELWTLLISAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_009375945.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=850

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EE RK
Sbjct  121  QFLDAKQEEARK  132



>ref|XP_010262597.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Nelumbo nucifera]
Length=616

 Score =   244 bits (623),  Expect = 6e-74, Method: Composition-based stats.
 Identities = 117/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA RVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIANRVTKLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLIN IY LL+GKDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINLIYGLLDGKDVNGKEVQIHLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_009375946.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Pyrus x bretschneideri]
Length=849

 Score =   248 bits (634),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EE RK
Sbjct  121  QFLDAKQEEARK  132



>ref|XP_009375943.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009375944.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=851

 Score =   248 bits (633),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EE RK
Sbjct  121  QFLDAKQEEARK  132



>ref|XP_009364350.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Pyrus 
x bretschneideri]
Length=838

 Score =   248 bits (633),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMSKVSMDVMRPWIANRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGK-VNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  119

Query  469  QFLDAKEEETRK  504
            QFLDAK+EE RK
Sbjct  120  QFLDAKQEEARK  131



>ref|XP_008356772.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Malus domestica]
Length=829

 Score =   248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMSKVSMDVMRPWIANRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGK-VNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  119

Query  469  QFLDAKEEETRK  504
            QFLDAK+EE RK
Sbjct  120  QFLDAKQEEARK  131



>ref|XP_008356765.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Malus domestica]
Length=830

 Score =   248 bits (632),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMSKVSMDVMRPWIANRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGK-VNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  119

Query  469  QFLDAKEEETRK  504
            QFLDAK+EE RK
Sbjct  120  QFLDAKQEEARK  131



>ref|XP_008385098.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Malus 
domestica]
Length=876

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EE RK
Sbjct  121  QFLDAKQEEARK  132



>gb|KEH30184.1| SR-rich pre-mRNA splicing activator [Medicago truncatula]
Length=845

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKEEE
Sbjct  121  QFLDAKEEE  129



>ref|XP_008222060.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222067.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222071.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222078.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222085.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
Length=859

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVD  KV M+VMRPWIAKRVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDTSKVNMEVMRPWIAKRVTDLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKEVQI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEVQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLDAKEEETR  501
            QFLDAK+EE R
Sbjct  121  QFLDAKQEEAR  131



>gb|KDO66636.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=803

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE RK
Sbjct  121  QFLDAKEEEARK  132



>gb|AES88912.2| SR-rich pre-mRNA splicing activator [Medicago truncatula]
Length=911

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKEEE
Sbjct  121  QFLDAKEEE  129



>gb|KEH30183.1| SR-rich pre-mRNA splicing activator [Medicago truncatula]
Length=897

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKEEE
Sbjct  121  QFLDAKEEE  129



>ref|XP_003606715.1| Serine/arginine repetitive matrix protein [Medicago truncatula]
Length=891

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKEEE
Sbjct  121  QFLDAKEEE  129



>ref|XP_002299851.2| hypothetical protein POPTR_0001s25140g [Populus trichocarpa]
 gb|EEE84656.2| hypothetical protein POPTR_0001s25140g [Populus trichocarpa]
Length=826

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMDV++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTKKVKMDVIKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_006488383.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Citrus sinensis]
Length=843

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE RK
Sbjct  121  QFLDAKEEEARK  132



>ref|XP_006488382.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Citrus sinensis]
Length=846

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE RK
Sbjct  121  QFLDAKEEEARK  132



>ref|XP_006424900.1| hypothetical protein CICLE_v10030390mg [Citrus clementina]
 gb|ESR38140.1| hypothetical protein CICLE_v10030390mg [Citrus clementina]
Length=846

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE RK
Sbjct  121  QFLDAKEEEARK  132



>gb|KDO66635.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=832

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE RK
Sbjct  121  QFLDAKEEEARK  132



>ref|XP_006651246.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Oryza 
brachyantha]
Length=364

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKE E
Sbjct  121  QFLDAKEAE  129



>tpg|DAA44607.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=173

 Score =   229 bits (583),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLD KE E ++
Sbjct  121  QFLDEKEAEIQQ  132



>ref|XP_007208179.1| hypothetical protein PRUPE_ppa001408mg [Prunus persica]
 gb|EMJ09378.1| hypothetical protein PRUPE_ppa001408mg [Prunus persica]
Length=836

 Score =   245 bits (625),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVD+ KV M+VM PWIAKRVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDISKVNMEVMHPWIAKRVTDLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKEVQI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEVQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLDAKEEETR  501
            QFLDAK+EE R
Sbjct  121  QFLDAKQEEAR  131



>ref|XP_004507160.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine repetitive matrix 
protein 1-like [Cicer arietinum]
Length=870

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV M++MRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMEIMRPWITRKVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+SLL+ K VNGKEVQIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHSLLDAKIVNGKEVQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKEEE
Sbjct  121  QFLDAKEEE  129



>ref|XP_006592181.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Glycine max]
Length=890

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+SLL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHSLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKEEE
Sbjct  121  QFLDAKEEE  129



>ref|XP_002879206.1| hypothetical protein ARALYDRAFT_901882 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55465.1| hypothetical protein ARALYDRAFT_901882 [Arabidopsis lyrata subsp. 
lyrata]
Length=861

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDA+E ET+K
Sbjct  121  QFLDAREAETKK  132



>gb|ABW81062.1| proline-rich-protein [Arabidopsis lyrata subsp. lyrata]
Length=861

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDA+E ET+K
Sbjct  121  QFLDAREAETKK  132



>ref|NP_180484.2| splicing factor PWI domain-containing protein [Arabidopsis thaliana]
 gb|AAM78093.1| At2g29210/F16P2.41 [Arabidopsis thaliana]
 gb|AAN18199.1| At2g29210/F16P2.41 [Arabidopsis thaliana]
 gb|AEC08223.1| serine/arginine repetitive matrix protein 1-like protein [Arabidopsis 
thaliana]
Length=878

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDITKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            GIEDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN SGVPQ
Sbjct  61   GIEDEVLINFIYGLLDGKVVNGKEIQITLTGFMEKNTGKFMKELWTLLLSAQNNPSGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDA+  ET+K
Sbjct  121  QFLDARAAETKK  132



>ref|XP_006409968.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
 gb|ESQ51421.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
Length=831

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LL+SAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLISAQNNSSGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKE ET+K
Sbjct  121  QFLDAKEAETKK  132



>ref|XP_006846337.1| hypothetical protein AMTR_s00012p00256890 [Amborella trichopoda]
 gb|ERN08012.1| hypothetical protein AMTR_s00012p00256890 [Amborella trichopoda]
Length=885

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK AKLLKSQKFA EL+HLVD+ KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKAAKLLKSQKFASELDHLVDISKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GKDV+GK++QIQLTGFME+NTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKDVDGKQIQIQLTGFMEKNTGKFMKELWNLLLSAQKNISGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEET++
Sbjct  121  QFLDAKEEETKQ  132



>ref|XP_011461330.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=855

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMDVMRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+ NGKE+QI LTGFME+NT KFMKELW+ LLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEANGKEIQISLTGFMEKNTVKFMKELWTHLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EE RK
Sbjct  121  QFLDAKQEEARK  132



>ref|XP_011461331.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=854

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMDVMRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+ NGKE+QI LTGFME+NT KFMKELW+ LLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEANGKEIQISLTGFMEKNTVKFMKELWTHLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EE RK
Sbjct  121  QFLDAKQEEARK  132



>gb|EEE58772.1| hypothetical protein OsJ_10288 [Oryza sativa Japonica Group]
Length=595

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKE E
Sbjct  121  QFLDAKEAE  129



>ref|XP_010510519.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine repetitive matrix 
protein 1-like [Camelina sativa]
Length=841

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDA+E +T+K
Sbjct  121  QFLDAREADTKK  132



>ref|XP_006293680.1| hypothetical protein CARUB_v10022637mg [Capsella rubella]
 gb|ABW81160.1| unknown [Capsella rubella]
 gb|EOA26578.1| hypothetical protein CARUB_v10022637mg [Capsella rubella]
Length=839

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQ N+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQGNSSGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDA+E +T+K
Sbjct  121  QFLDAREADTKK  132



>ref|XP_009416221.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=780

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFA EL+H VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAAELDHPVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGF+E+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFLEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFL+AKEEE +K
Sbjct  121  QFLNAKEEEMKK  132



>ref|XP_009416220.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=785

 Score =   239 bits (611),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFA EL+H VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAAELDHPVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGF+E+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFLEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFL+AKEEE +K
Sbjct  121  QFLNAKEEEMKK  132



>ref|XP_010469978.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Camelina 
sativa]
Length=842

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK +NGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVLNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDA+E +T+K
Sbjct  121  QFLDAREADTKK  132



>gb|ABF95203.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 gb|ABF95204.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=840

 Score =   239 bits (611),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKE E
Sbjct  121  QFLDAKEAE  129



>ref|XP_010262596.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Nelumbo nucifera]
Length=850

 Score =   239 bits (611),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 117/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA RVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIANRVTKLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLIN IY LL+GKDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINLIYGLLDGKDVNGKEVQIHLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_010262593.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010262594.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010262595.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
Length=852

 Score =   239 bits (611),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 117/132 (89%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA RVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIANRVTKLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLIN IY LL+GKDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINLIYGLLDGKDVNGKEVQIHLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_004153149.1| PREDICTED: uncharacterized protein LOC101206654 [Cucumis sativus]
 ref|XP_004163809.1| PREDICTED: uncharacterized protein LOC101225621 [Cucumis sativus]
Length=899

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKF  EL+ LVD  KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFPAELDQLVDTTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQIQLTGFME+NT KFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTVKFMKELWILLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE RK
Sbjct  121  QFLDAKEEEIRK  132



>ref|XP_004145330.1| PREDICTED: uncharacterized protein LOC101207842 [Cucumis sativus]
 gb|KGN65748.1| hypothetical protein Csa_1G524700 [Cucumis sativus]
Length=878

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKF  EL+ LVD  KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFPAELDQLVDTTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQIQLTGFME+NT KFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTVKFMKELWILLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE RK
Sbjct  121  QFLDAKEEEIRK  132



>ref|XP_008457448.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Cucumis 
melo]
Length=893

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKF  EL+ LVD  KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFPAELDQLVDTTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQIQLTGFME+NT KFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTVKFMKELWILLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE RK
Sbjct  121  QFLDAKEEEIRK  132



>ref|XP_010256833.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Nelumbo nucifera]
Length=919

 Score =   238 bits (608),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKF+PEL+HLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFSPELDHLVDMTKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GKDVNGKEVQIQLTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKDVNGKEVQIQLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_010256831.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
Length=925

 Score =   238 bits (608),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKF+PEL+HLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFSPELDHLVDMTKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GKDVNGKEVQIQLTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKDVNGKEVQIQLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_004984929.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Setaria italica]
Length=842

 Score =   237 bits (605),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWGLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLD KE E
Sbjct  121  QFLDEKEAE  129



>ref|XP_001762564.1| predicted protein [Physcomitrella patens]
 gb|EDQ72687.1| predicted protein [Physcomitrella patens]
Length=183

 Score =   220 bits (561),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK  KLLKSQKFAPEL+  +D  KV+MDV++PW+A RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKMKKLLKSQKFAPELDVTIDTSKVQMDVIKPWVATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY +LE K+V+GK VQIQLTGFME+NTGKFMKELWSLL+SAQ+N SG+PQ
Sbjct  61   GFEDEVLINFIYGMLEEKNVDGKHVQIQLTGFMEKNTGKFMKELWSLLMSAQSNVSGIPQ  120

Query  469  QFLDAKEEETR  501
            QFLD K EETR
Sbjct  121  QFLDQKAEETR  131



>gb|KDO66637.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=774

 Score =   235 bits (599),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE RK
Sbjct  121  QFLDAKEEEARK  132



>ref|XP_010685690.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010685691.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=888

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTE-L  285
            MSGGFFRGTSA+QDTRFSNKQAKLLK+QKFA ELEHLVD+ KVKMDV++PWIAKRVTE L
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAAELEHLVDITKVKMDVIKPWIAKRVTEFL  60

Query  286  VGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
             G EDE+LINFIY LLEGK+VNGK+VQIQLTGFME+NTGKFMKELW+LLLSAQNNASGVP
Sbjct  61   EGFEDELLINFIYGLLEGKEVNGKQVQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVP  120

Query  466  QQFLDA  483
            QQFLDA
Sbjct  121  QQFLDA  126



>ref|XP_010685692.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=874

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTE-L  285
            MSGGFFRGTSA+QDTRFSNKQAKLLK+QKFA ELEHLVD+ KVKMDV++PWIAKRVTE L
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAAELEHLVDITKVKMDVIKPWIAKRVTEFL  60

Query  286  VGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
             G EDE+LINFIY LLEGK+VNGK+VQIQLTGFME+NTGKFMKELW+LLLSAQNNASGVP
Sbjct  61   EGFEDELLINFIYGLLEGKEVNGKQVQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVP  120

Query  466  QQFLDA  483
            QQFLDA
Sbjct  121  QQFLDA  126



>ref|XP_010228813.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Brachypodium distachyon]
Length=586

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK AKLLK+QKFA EL+H VDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKHAKLLKTQKFASELDHQVDMSKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+V+GK +QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEVDGKHIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKE E
Sbjct  121  QFLDAKEAE  129



>ref|XP_010106541.1| Serine/arginine repetitive matrix protein 1 [Morus notabilis]
 gb|EXC10717.1| Serine/arginine repetitive matrix protein 1 [Morus notabilis]
Length=775

 Score =   233 bits (594),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 116/132 (88%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV M+V+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVSMNVVRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EETRK
Sbjct  121  QFLDAKQEETRK  132



>ref|XP_001774764.1| predicted protein [Physcomitrella patens]
 gb|EDQ60435.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   216 bits (550),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK  KLLKSQKFAPEL+ ++D  KV+MDV++PW+A RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKMKKLLKSQKFAPELDVMIDTSKVQMDVIKPWVAIRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI  +LE K+V+GK VQIQLTGFME+NTGKFMKELWSLL+SAQ+N SG+PQ
Sbjct  61   GFEDEVLINFINGMLEEKNVDGKHVQIQLTGFMEKNTGKFMKELWSLLISAQSNVSGIPQ  120

Query  469  QFLDAKEEETR  501
            QFLD K EETR
Sbjct  121  QFLDQKAEETR  131



>ref|XP_010228812.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Brachypodium distachyon]
Length=844

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK AKLLK+QKFA EL+H VDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKHAKLLKTQKFASELDHQVDMSKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+V+GK +QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEVDGKHIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKE E
Sbjct  121  QFLDAKEAE  129



>gb|ABW81113.1| proline-rich protein [Boechera divaricarpa]
Length=883

 Score =   230 bits (587),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDA+E ET+K
Sbjct  121  QFLDAREAETKK  132



>ref|XP_011035260.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Populus euphratica]
Length=879

 Score =   230 bits (586),  Expect = 4e-67, Method: Composition-based stats.
 Identities = 112/132 (85%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_011035259.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Populus euphratica]
Length=890

 Score =   230 bits (586),  Expect = 4e-67, Method: Composition-based stats.
 Identities = 112/132 (85%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_011035261.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Populus euphratica]
Length=877

 Score =   229 bits (585),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 112/132 (85%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_006362050.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Solanum tuberosum]
Length=882

 Score =   229 bits (585),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLE K  NGKE+QI LTGFMERNTGKFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTGKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETR  501
            QFL+AKEEE R
Sbjct  121  QFLEAKEEEMR  131



>ref|XP_010521878.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Tarenaya hassleriana]
Length=907

 Score =   229 bits (585),  Expect = 6e-67, Method: Composition-based stats.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAPELEHLVDMAKVKMDVMKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NT KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTTKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKE ETRK
Sbjct  121  QFLDAKEAETRK  132



>ref|XP_008803113.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Phoenix dactylifera]
Length=875

 Score =   229 bits (583),  Expect = 9e-67, Method: Composition-based stats.
 Identities = 110/132 (83%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KV+MDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVEMDVIRPWIATRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            Q LDAK+EET +
Sbjct  121  QLLDAKKEETDR  132



>ref|XP_008803112.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Phoenix dactylifera]
Length=896

 Score =   229 bits (583),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 110/132 (83%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KV+MDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVEMDVIRPWIATRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            Q LDAK+EET +
Sbjct  121  QLLDAKKEETDR  132



>ref|XP_011035262.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Populus euphratica]
Length=854

 Score =   228 bits (582),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 112/132 (85%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>gb|KDO66634.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=843

 Score =   228 bits (582),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE RK
Sbjct  121  QFLDAKEEEARK  132



>gb|KDO66630.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
 gb|KDO66631.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
 gb|KDO66632.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
 gb|KDO66633.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=846

 Score =   228 bits (582),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE RK
Sbjct  121  QFLDAKEEEARK  132



>ref|XP_011032244.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Populus euphratica]
Length=874

 Score =   228 bits (580),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_011032245.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Populus euphratica]
Length=856

 Score =   227 bits (579),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>ref|XP_011080705.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Sesamum indicum]
Length=877

 Score =   227 bits (579),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 113/124 (91%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  469  QFLD  480
            QFLD
Sbjct  121  QFLD  124



>ref|XP_011080704.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Sesamum indicum]
Length=878

 Score =   227 bits (579),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 113/124 (91%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  469  QFLD  480
            QFLD
Sbjct  121  QFLD  124



>ref|XP_011080697.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080699.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080700.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080701.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080702.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080703.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
Length=879

 Score =   227 bits (579),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 113/124 (91%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  469  QFLD  480
            QFLD
Sbjct  121  QFLD  124



>ref|XP_010937571.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Elaeis guineensis]
Length=911

 Score =   228 bits (580),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 110/132 (83%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIATRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEV+INF+Y LL+ K+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVIINFVYGLLDVKEVDGKQIQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EET +
Sbjct  121  QFLDAKKEETDR  132



>ref|XP_011080706.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Sesamum indicum]
Length=873

 Score =   227 bits (579),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 113/124 (91%), Positives = 118/124 (95%), Gaps = 0/124 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  469  QFLD  480
            QFLD
Sbjct  121  QFLD  124



>ref|XP_010326174.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Solanum lycopersicum]
Length=897

 Score =   227 bits (579),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV++PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLE K  NGKE+QI LTGFMERNT KFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTAKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETR  501
            QFL+AKEEE R
Sbjct  121  QFLEAKEEEMR  131



>emb|CAC03679.1| SRM102 [Arabidopsis thaliana]
Length=894

 Score =   227 bits (579),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 112/132 (85%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDITKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            GIEDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN SGVPQ
Sbjct  61   GIEDEVLINFIYGLLDGKVVNGKEIQITLTGFMEKNTGKFMKELWTLLLSAQNNPSGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDA+  ET+K
Sbjct  121  QFLDARAAETKK  132



>ref|XP_010937572.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Elaeis guineensis]
Length=876

 Score =   227 bits (578),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 110/132 (83%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIATRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEV+INF+Y LL+ K+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVIINFVYGLLDVKEVDGKQIQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EET +
Sbjct  121  QFLDAKKEETDR  132



>ref|XP_004246955.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Solanum lycopersicum]
Length=921

 Score =   227 bits (579),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV++PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLE K  NGKE+QI LTGFMERNT KFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTAKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETR  501
            QFL+AKEEE R
Sbjct  121  QFLEAKEEEMR  131



>ref|XP_011032246.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Populus euphratica]
Length=840

 Score =   226 bits (577),  Expect = 5e-66, Method: Composition-based stats.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEETRK
Sbjct  121  QFLDAKEEETRK  132



>gb|KHN32153.1| Serine/arginine repetitive matrix protein 1 [Glycine soja]
Length=952

 Score =   227 bits (578),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +1

Query  130  GTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDEVL  309
            GTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+G EDEVL
Sbjct  70   GTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELLGFEDEVL  129

Query  310  INFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQFLDAKE  489
            INFI+SLL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NASGVPQQFLDAKE
Sbjct  130  INFIHSLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQQFLDAKE  189

Query  490  EE  495
            EE
Sbjct  190  EE  191



>tpg|DAA44610.1| TPA: hypothetical protein ZEAMMB73_474732, partial [Zea mays]
Length=581

 Score =   222 bits (566),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLD KE E ++
Sbjct  121  QFLDEKEAEIQQ  132



>gb|EMS59731.1| Serine/arginine repetitive matrix protein 1 [Triticum urartu]
Length=915

 Score =   226 bits (577),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK AKLLK+QKFA EL+H VDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKHAKLLKTQKFASELDHQVDMSKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+V+GK +QIQLTGFME+NT KFM+ELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDAKEVDGKYIQIQLTGFMEKNTIKFMRELWSLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEE  495
            QFLDAKE E
Sbjct  121  QFLDAKEAE  129



>gb|AAC95214.1| putative proline-rich protein [Arabidopsis thaliana]
Length=891

 Score =   226 bits (576),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  130  GTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDEVL  309
            GTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+GIEDEVL
Sbjct  28   GTSAEQDTRFSNKQAKLMKSQKFAPELENLVDITKVKMDVMKPWIATRVTELLGIEDEVL  87

Query  310  INFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQFLDAKE  489
            INFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN SGVPQQFLDA+ 
Sbjct  88   INFIYGLLDGKVVNGKEIQITLTGFMEKNTGKFMKELWTLLLSAQNNPSGVPQQFLDARA  147

Query  490  EETRK  504
             ET+K
Sbjct  148  AETKK  152



>ref|XP_008801616.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801617.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801618.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
Length=874

 Score =   225 bits (573),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQD RFSNKQAKLLKSQKFAPEL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDARFSNKQAKLLKSQKFAPELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EET K
Sbjct  121  QFLDAKKEETDK  132



>ref|XP_008801619.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Phoenix dactylifera]
Length=868

 Score =   224 bits (572),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQD RFSNKQAKLLKSQKFAPEL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDARFSNKQAKLLKSQKFAPELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EET K
Sbjct  121  QFLDAKKEETDK  132



>ref|XP_007132039.1| hypothetical protein PHAVU_011G061700g [Phaseolus vulgaris]
 gb|ESW04033.1| hypothetical protein PHAVU_011G061700g [Phaseolus vulgaris]
Length=924

 Score =   224 bits (572),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 111/132 (84%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PW+ +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWVTRRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+SLL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHSLLDVKEVNGKEVQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE  K
Sbjct  121  QFLDAKEEELLK  132



>ref|XP_009144394.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Brassica 
rapa]
 ref|XP_009144395.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Brassica 
rapa]
 emb|CDY45430.1| BnaA05g12710D [Brassica napus]
Length=839

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGT+ADQDTRFSNKQAKL+KSQKFA ELE LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTTADQDTRFSNKQAKLMKSQKFASELETLVDVSKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K VNGKE+QI +TGFME+NT KFMKELW+LLLSAQ+N+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDNKVVNGKEIQIAITGFMEKNTVKFMKELWTLLLSAQSNSSGVPQ  120

Query  469  QFLDAKEEET  498
            QFLDA   ET
Sbjct  121  QFLDASVAET  130



>ref|XP_010920517.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Elaeis guineensis]
Length=774

 Score =   223 bits (567),  Expect = 8e-65, Method: Composition-based stats.
 Identities = 110/132 (83%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQD+RFSNKQAKLLK+QKFA EL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDSRFSNKQAKLLKTQKFASELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EET K
Sbjct  121  QFLDAKKEETDK  132



>gb|KHN21923.1| Serine/arginine repetitive matrix protein 1 [Glycine soja]
Length=907

 Score =   223 bits (569),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE  K
Sbjct  121  QFLDAKEEELLK  132



>ref|XP_010920514.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Elaeis guineensis]
 ref|XP_010920515.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Elaeis guineensis]
Length=876

 Score =   223 bits (568),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 110/132 (83%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQD+RFSNKQAKLLK+QKFA EL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDSRFSNKQAKLLKTQKFASELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAK+EET K
Sbjct  121  QFLDAKKEETDK  132



>emb|CDY65665.1| BnaC04g54780D [Brassica napus]
Length=817

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGT+ADQDTRFSNKQAKL+KSQKFA ELE LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTTADQDTRFSNKQAKLMKSQKFASELETLVDVSKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K VNGKE+QI +TGFME+NT KFMKELW+LLLSAQ+N+SG+PQ
Sbjct  61   GFEDEVLINFIYGLLDKKVVNGKEIQIAITGFMEKNTVKFMKELWTLLLSAQSNSSGIPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDA   ET++
Sbjct  121  QFLDATVAETKR  132



>ref|XP_003539073.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Glycine max]
Length=916

 Score =   223 bits (567),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE  K
Sbjct  121  QFLDAKEEELLK  132



>gb|ABW81077.1| Prp9 [Cleome spinosa]
Length=919

 Score =   220 bits (560),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +1

Query  124  FRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDE  303
            F+GTSA+QDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+G EDE
Sbjct  31   FQGTSAEQDTRFSNKQAKLLKTQKFAPELEHLVDMAKVKMDVMKPWIANRVTELLGFEDE  90

Query  304  VLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQFLDA  483
            VLINFIY LL+GK VNGKE+QI LTGFME+NT KFMKELW+LLLSAQ NASGVPQQFLDA
Sbjct  91   VLINFIYGLLDGKVVNGKEIQISLTGFMEKNTTKFMKELWTLLLSAQKNASGVPQQFLDA  150

Query  484  KEEETRK  504
            KE ETRK
Sbjct  151  KEAETRK  157



>ref|XP_008681504.1| PREDICTED: uncharacterized protein LOC100304415 isoform X3 [Zea 
mays]
Length=900

 Score =   218 bits (555),  Expect = 7e-63, Method: Composition-based stats.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLD KE E ++
Sbjct  121  QFLDEKEAEIQQ  132



>ref|XP_008681507.1| PREDICTED: uncharacterized protein LOC100304415 isoform X4 [Zea 
mays]
 tpg|DAA44609.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=895

 Score =   218 bits (555),  Expect = 7e-63, Method: Composition-based stats.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLD KE E ++
Sbjct  121  QFLDEKEAEIQQ  132



>ref|XP_008681486.1| PREDICTED: uncharacterized protein LOC100304415 isoform X1 [Zea 
mays]
Length=906

 Score =   218 bits (555),  Expect = 8e-63, Method: Composition-based stats.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLD KE E ++
Sbjct  121  QFLDEKEAEIQQ  132



>ref|XP_008681498.1| PREDICTED: uncharacterized protein LOC100304415 isoform X2 [Zea 
mays]
 tpg|DAA44608.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=901

 Score =   218 bits (554),  Expect = 9e-63, Method: Composition-based stats.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLDAKEEETRK  504
            QFLD KE E ++
Sbjct  121  QFLDEKEAEIQQ  132



>ref|XP_002973816.1| hypothetical protein SELMODRAFT_100233 [Selaginella moellendorffii]
 ref|XP_002983574.1| hypothetical protein SELMODRAFT_118260 [Selaginella moellendorffii]
 gb|EFJ15475.1| hypothetical protein SELMODRAFT_118260 [Selaginella moellendorffii]
 gb|EFJ24771.1| hypothetical protein SELMODRAFT_100233 [Selaginella moellendorffii]
Length=211

 Score =   202 bits (514),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTS +QDTRFSNK AKLLK+QKFA EL+  +DM KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSTEQDTRFSNKMAKLLKTQKFASELDQPIDMSKVNMDVMRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K  +GK +QIQLTGFME+NTG+FMKELW LL SAQ+NASG+PQ
Sbjct  61   GFEDEVLINFIYGLLDVKVGDGKHIQIQLTGFMEKNTGRFMKELWGLLASAQSNASGIPQ  120

Query  469  QFLDAKEEETR  501
              LD K  ET+
Sbjct  121  ALLDKKALETQ  131



>ref|XP_009419742.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Musa 
acuminata subsp. malaccensis]
Length=838

 Score =   214 bits (546),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 108/132 (82%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLK+QKFAP L+H VD+ KVKMDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAPVLDHPVDVTKVKMDVIRPWIATRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK V+GK++QIQLTGF+E+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGK-VDGKQIQIQLTGFLEKNTGKFMKELWGLLLSAQNNASGVPQ  119

Query  469  QFLDAKEEETRK  504
            QFLDAKEEE +K
Sbjct  120  QFLDAKEEELKK  131



>gb|EPB85601.1| hypothetical protein HMPREF1544_07594 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=175

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD+RFSNK+ KLLKS  F PE +  VDM KV +DV++PWI+ R+TEL+G 
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKSMSFPPEFDQKVDMKKVNLDVIKPWISNRITELLGF  63

Query  295  EDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            EDEV+I++  SLLE KD + K +QI LTGF+E  T  F+ ELW+LLLSAQN+  G+P +F
Sbjct  64   EDEVVIDYTCSLLEEKDQDPKRMQINLTGFLESKTQAFLSELWNLLLSAQNSVGGIPTEF  123

Query  475  LDAKEEETRK  504
            ++ K++E R+
Sbjct  124  IEQKKQELRR  133



>emb|CDS13551.1| hypothetical protein LRAMOSA05727 [Absidia idahoensis var. thermophila]
Length=337

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD+RFSNK+ KLLKS  F PE +  V+M KVK+DV++PW+ +R+TEL+G+
Sbjct  27   AGFFKGTSADQDSRFSNKEKKLLKSMSFPPEFDQKVNMKKVKLDVIKPWMTQRITELLGV  86

Query  295  EDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            EDE++I+F + LLE KD + K +QI LTGF+E+NT +F+ ELW LLLSAQ++ SG+P+QF
Sbjct  87   EDELVIDFAFGLLEEKDPDPKLMQINLTGFLEKNTQQFILELWKLLLSAQDSVSGIPKQF  146

Query  475  LDAKEEE  495
            L+ K++E
Sbjct  147  LEQKKQE  153



>emb|CDH50351.1| pwi domain-containing protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=324

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD+RFSNK+ KLLKS  F PE +  V+M KVK+DV++PW+ +R+TEL+G+
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKSMSFPPEFDQKVNMKKVKLDVIKPWMTQRITELLGV  63

Query  295  EDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            EDE++I+F + LLE KD + K +QI LTGF+E+NT +F+ ELW LLLSAQ++ SG+P+QF
Sbjct  64   EDELVIDFAFGLLEEKDPDPKLMQINLTGFLEKNTQQFILELWKLLLSAQDSVSGIPKQF  123

Query  475  LDAKEEE  495
            L+ K++E
Sbjct  124  LEQKKQE  130



>emb|CEG73501.1| Putative PWI domain-containing protein [Rhizopus microsporus]
 emb|CEI87964.1| Putative PWI domain-containing protein [Rhizopus microsporus]
Length=228

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD+RFSNK+ KLLK+  F PE +  VDM KV +DV+RPWIA +VTEL+G 
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKTMSFPPEFDKKVDMKKVNLDVIRPWIANKVTELLGF  63

Query  295  EDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            EDEV+ ++  SLLE ++++ K +QI LTGF+E N   F+KELW+LLLSAQN+  G+P  F
Sbjct  64   EDEVVADYAASLLEEENIDPKMMQINLTGFLENNAKVFVKELWNLLLSAQNSVGGIPAIF  123

Query  475  LDAKEEETRK  504
            ++ K+EE RK
Sbjct  124  IEQKKEELRK  133



>dbj|GAN09279.1| PWI domain-containing protein [Mucor ambiguus]
Length=258

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD+RFSNK+ KLLKS  F  E +  VDM KV +DV++PWI+ R+TEL+G 
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKSMSFPSEFDQKVDMKKVNLDVIKPWISNRITELLGF  63

Query  295  EDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            EDEV+I++  SLLE KD + K +QI LTGF+E  T  F+ ELW+LLLSAQN+  G+P +F
Sbjct  64   EDEVVIDYTCSLLEEKDQDPKRMQINLTGFLESKTQAFLSELWNLLLSAQNSVGGIPTEF  123

Query  475  LDAKEEETRK  504
            ++ K++E R+
Sbjct  124  IEQKKQELRR  133



>gb|KDQ07409.1| hypothetical protein BOTBODRAFT_120067, partial [Botryobasidium 
botryosum FD-172 SS1]
Length=159

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 97/131 (74%), Gaps = 3/131 (2%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTS DQD RFS+K+++LLKS KF PE +  VDM KV + VMRPWIAKRV EL+G E
Sbjct  29   GFFKGTSTDQDRRFSDKESRLLKSMKFPPEFDQKVDMRKVNLQVMRPWIAKRVVELIGFE  88

Query  298  DEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            DEV++ +   LLE K     + K +QI LTGF+E  T +FM  LW+LL+SAQ++  GVPQ
Sbjct  89   DEVVVEYAMGLLEDKSKPTPDPKLMQINLTGFLESKTPEFMSSLWTLLISAQSSIGGVPQ  148

Query  469  QFLDAKEEETR  501
            QFLD K+EE R
Sbjct  149  QFLDEKKEELR  159



>emb|CEP13732.1| hypothetical protein [Parasitella parasitica]
Length=251

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD+RFSNK+ KLLK+  F  E +  VDM KV +DV++PWI+ R+TEL+G 
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKTMTFPSEFDQKVDMKKVNLDVIKPWISNRITELLGF  63

Query  295  EDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            EDEV+I++  SLLE KD + K +QI LTGF+E  T  F+ ELW LLLSAQN+  G+P +F
Sbjct  64   EDEVVIDYTCSLLEEKDQDPKRMQINLTGFLEGKTQAFLGELWKLLLSAQNSVGGIPVEF  123

Query  475  LDAKEEETRK  504
            ++ K++E R+
Sbjct  124  IEQKKQELRR  133



>gb|KDD75666.1| hypothetical protein H632_c561p1 [Helicosporidium sp. ATCC 50920]
Length=141

 Score =   153 bits (386),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 98/131 (75%), Gaps = 1/131 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSG  FRG SA+QD RF +K+ KL+ S +F  E +  V++  V   VM+PWIA RVTEL+
Sbjct  1    MSGNGFRGVSAEQDGRFKDKERKLMASMRFPREFDTKVNLVAVNWTVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKD-VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            GIED+VLI +IY+ LEGK  +N +++QI LTGF+E+N   F KELWSLL+SA++N +G+P
Sbjct  61   GIEDDVLIEYIYAQLEGKQTINPRQLQINLTGFLEQNAASFCKELWSLLMSAESNGTGIP  120

Query  466  QQFLDAKEEET  498
            Q+FLD K EE 
Sbjct  121  QRFLDEKAEEV  131



>gb|KJB83750.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
 gb|KJB83754.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=823

 Score =   162 bits (411),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +1

Query  226  MGKVKMDVMRPWIAKRVTELVGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGK  405
            M KVKMDV+RPWIA RVTEL+G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGK
Sbjct  1    MTKVKMDVIRPWIATRVTELLGFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGK  60

Query  406  FMKELWSLLLSAQNNASGVPQQFLDAKEEETRK  504
            FMKELWSLLLSAQ NASGVPQQFLDAKEEETRK
Sbjct  61   FMKELWSLLLSAQRNASGVPQQFLDAKEEETRK  93



>emb|CDH50352.1| pwi domain-containing protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=330

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 104/133 (78%), Gaps = 6/133 (5%)
 Frame = +1

Query  115  GGFFRGT------SADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRV  276
             GFF+ +      +ADQD+RFSNK+ KLLKS  F PE +  V+M KVK+DV++PW+ +R+
Sbjct  4    AGFFKSSVLAHFLAADQDSRFSNKEKKLLKSMSFPPEFDQKVNMKKVKLDVIKPWMTQRI  63

Query  277  TELVGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAS  456
            TEL+G+EDE++I+F + LLE KD + K +QI LTGF+E+NT +F+ ELW LLLSAQ++ S
Sbjct  64   TELLGVEDELVIDFAFGLLEEKDPDPKLMQINLTGFLEKNTQQFILELWKLLLSAQDSVS  123

Query  457  GVPQQFLDAKEEE  495
            G+P+QFL+ K++E
Sbjct  124  GIPKQFLEQKKQE  136



>gb|KDO66638.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=807

 Score =   160 bits (406),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 79/93 (85%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  226  MGKVKMDVMRPWIAKRVTELVGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGK  405
            M KVKMDVM+PWIA RVTEL+G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T K
Sbjct  1    MTKVKMDVMKPWIATRVTELLGFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAK  60

Query  406  FMKELWSLLLSAQNNASGVPQQFLDAKEEETRK  504
            FMKELW+LLLSAQ NASGVPQQFLDAKEEE RK
Sbjct  61   FMKELWTLLLSAQKNASGVPQQFLDAKEEEARK  93



>gb|KDQ31993.1| hypothetical protein PLEOSDRAFT_1025753, partial [Pleurotus ostreatus 
PC15]
Length=136

 Score =   149 bits (375),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 97/134 (72%), Gaps = 5/134 (4%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTSA+QD RFS+K+ KLLKS KF PE +  VDM KV ++V+RPW+AK+VTELVG E
Sbjct  1    GFFKGTSAEQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNLEVIRPWVAKKVTELVGFE  60

Query  298  DEVLINFIYSLLEGKD-----VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGV  462
            DEV++ +   LLE +       + K++QI LTGF+ ++T  FM  LW LLL AQ   SGV
Sbjct  61   DEVVVEYAMGLLEDQKQSPQFPDPKKMQINLTGFLTKDTPAFMLALWKLLLEAQEEVSGV  120

Query  463  PQQFLDAKEEETRK  504
            P+ FL+ K+EE RK
Sbjct  121  PRTFLEEKKEEMRK  134



>gb|KIJ61599.1| hypothetical protein HYDPIDRAFT_137559 [Hydnomerulius pinastri 
MD-312]
Length=279

 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV + V++PWIAK+VTELVG+
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMKKVNLQVIKPWIAKKVTELVGL  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE  +    + K++QI LTGF+  +T  FM  LW+LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEDPNHTHPDPKKMQINLTGFLTSSTPTFMTALWTLLLEAQESPAGVP  123

Query  466  QQFLDAKEEETRK  504
            + F++ K+EE RK
Sbjct  124  KTFVEEKKEEMRK  136



>ref|XP_006409967.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
 gb|ESQ51420.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
Length=804

 Score =   159 bits (402),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 78/95 (82%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +1

Query  220  VDMGKVKMDVMRPWIAKRVTELVGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNT  399
            VD+ KVKMDVM+PWIA RVTEL+G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NT
Sbjct  11   VDVTKVKMDVMKPWIATRVTELLGFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNT  70

Query  400  GKFMKELWSLLLSAQNNASGVPQQFLDAKEEETRK  504
            GKFMKELW+LL+SAQNN+SGVPQQFLDAKE ET+K
Sbjct  71   GKFMKELWTLLISAQNNSSGVPQQFLDAKEAETKK  105



>gb|KIM46751.1| hypothetical protein M413DRAFT_40460, partial [Hebeloma cylindrosporum 
h7]
Length=144

 Score =   146 bits (369),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = +1

Query  127  RGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDEV  306
            +GTSADQD RFS+K+ KLLKS KF PE E  VDM KV ++V+RPWIAK++TEL+G EDEV
Sbjct  1    KGTSADQDRRFSDKEVKLLKSMKFPPEFEKKVDMRKVNLNVIRPWIAKKITELIGFEDEV  60

Query  307  LINFIYSLLEGK---DVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQFL  477
            ++ +   LLE +   + + K++QI LTGF+ ++T  FM  LW LLL AQ + +GVP+ FL
Sbjct  61   VVEYAMGLLEDEQQPNPDPKKMQINLTGFLNKDTPVFMDALWKLLLEAQEDVTGVPRTFL  120

Query  478  DAKEEETRK  504
            + K+EE RK
Sbjct  121  EQKKEEMRK  129



>gb|KIM70671.1| hypothetical protein SCLCIDRAFT_76017, partial [Scleroderma citrinum 
Foug A]
Length=134

 Score =   146 bits (368),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV +++++PWIAK+VTELVG E
Sbjct  1    GFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMKKVNLEIIKPWIAKKVTELVGFE  60

Query  298  DEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            DEV+I +   LLE       + K++QI LTGF+  +T  FM  LW LLL +Q++  GVP 
Sbjct  61   DEVVIEYAMGLLEDPHQTTPDPKKMQINLTGFLTSSTPAFMTALWDLLLESQDSPGGVPT  120

Query  469  QFLDAKEEETRK  504
              ++AK+EE R+
Sbjct  121  SMVEAKKEELRR  132



>ref|XP_009549905.1| hypothetical protein HETIRDRAFT_243565, partial [Heterobasidion 
irregulare TC 32-1]
 gb|ETW77888.1| hypothetical protein HETIRDRAFT_243565, partial [Heterobasidion 
irregulare TC 32-1]
Length=134

 Score =   145 bits (367),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV ++V+RPW+AK+V ELVG E
Sbjct  1    GFFKGTSADQDRRFSDKELKLLKSIKFPPEFDKKVDMRKVNIEVIRPWVAKKVVELVGFE  60

Query  298  DEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            DEV++ +   LLE +     + K++QI LTGF+  +T  FM  LW+LLL AQ + +G+P+
Sbjct  61   DEVVVEYAMGLLEDESQPTPDPKKMQINLTGFLTASTPAFMSALWALLLEAQESPAGIPK  120

Query  469  QFLDAKEEETRK  504
             F++ K+EE R+
Sbjct  121  TFVEEKKEEFRR  132



>ref|XP_007366678.1| PWI domain-containing protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60539.1| PWI domain-containing protein [Dichomitus squalens LYAD-421 SS1]
Length=215

 Score =   148 bits (373),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFF+GTSADQD RFS+K+ KLLK+ KF PE +  VDM KV + V+RPWI K+V ELV
Sbjct  1    MCSGFFKGTSADQDRRFSDKELKLLKTMKFPPEFDKKVDMRKVNLAVIRPWIVKKVVELV  60

Query  289  GIEDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASG  459
            G EDEV++ +   LLE       + + +QI LTGF+ +NT  FM  LW+LLL AQ + +G
Sbjct  61   GFEDEVVVEYAMGLLEDDSQPTPDPRRMQINLTGFLTKNTPAFMSALWNLLLEAQESPAG  120

Query  460  VPQQFLDAKEEETRK  504
            VP+ F++ K+EE R+
Sbjct  121  VPRTFVEEKKEEMRQ  135



>emb|CCO26855.1| PWI domain-containing protein C825,05c [Rhizoctonia solani AG-1 
IB]
Length=274

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 2/132 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSA+QD RF++K+ +LLKS KF PE +  VDM KV++ VMRPWI K+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFADKEHRLLKSMKFPPEFDRKVDMRKVELSVMRPWITKKVVELVGF  63

Query  295  EDEVLINFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            EDEV++ ++  LLE   K  + K +QI LTGF+E  T  FM  LW+LLL AQ++ +GVP 
Sbjct  64   EDEVVVEYVMGLLEDRSKPPDPKLMQINLTGFLESKTPAFMSSLWALLLEAQDSPAGVPA  123

Query  469  QFLDAKEEETRK  504
             F+  K+EE R+
Sbjct  124  SFVQEKKEELRQ  135



>gb|KII87767.1| hypothetical protein PLICRDRAFT_112049 [Plicaturopsis crispa 
FD-325 SS-3]
Length=330

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 100/146 (68%), Gaps = 5/146 (3%)
 Frame = +1

Query  79   TIRILHKP*EMS--GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVM  252
            + R  H+P   S   GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV + V+
Sbjct  3    SFRPTHRPPFCSPIAGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNLQVI  62

Query  253  RPWIAKRVTELVGIEDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELW  423
            RPWIAK++ ELVG EDEV++ +   LLE K     + K++QI LTGF+  +T  FM  LW
Sbjct  63   RPWIAKKIIELVGFEDEVVVEYAMGLLEDKQQPTPDPKKMQINLTGFLTNSTPSFMTSLW  122

Query  424  SLLLSAQNNASGVPQQFLDAKEEETR  501
            +LLL AQ + +GVP+ FL+ K+ E R
Sbjct  123  NLLLEAQESEAGVPRTFLEEKKAEMR  148



>ref|XP_002124610.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Ciona intestinalis]
 ref|XP_009861959.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Ciona intestinalis]
Length=197

 Score =   146 bits (369),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTS DQD RF+NKQ KLLKS KFA  L   VDM K+++D ++PWI+KR+TE++
Sbjct  1    MDAGFFRGTSTDQDNRFANKQKKLLKSMKFADGLGVKVDMRKIQLDTIKPWISKRITEML  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I F+Y+ LE +  + K +QI LTGF+  +N+  F+ ELW  L SAQ+N  G+P
Sbjct  61   GFEDDVVIAFVYNSLEEQFPDPKVLQINLTGFLNGKNSRIFLGELWEHLASAQDNDMGIP  120

Query  466  QQFLDAKEEETRK  504
            Q FL+ K+EE RK
Sbjct  121  QVFLEEKKEEIRK  133



>ref|XP_002124674.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Ciona intestinalis]
Length=233

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTS DQD RF+NKQ KLLKS KFA  L   VDM K+++D ++PWI+KR+TE++
Sbjct  37   MDAGFFRGTSTDQDNRFANKQKKLLKSMKFADGLGVKVDMRKIQLDTIKPWISKRITEML  96

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I F+Y+ LE +  + K +QI LTGF+  +N+  F+ ELW  L SAQ+N  G+P
Sbjct  97   GFEDDVVIAFVYNSLEEQFPDPKVLQINLTGFLNGKNSRIFLGELWEHLASAQDNDMGIP  156

Query  466  QQFLDAKEEETRK  504
            Q FL+ K+EE RK
Sbjct  157  QVFLEEKKEEIRK  169



>gb|KIK98909.1| hypothetical protein PAXRUDRAFT_618522 [Paxillus rubicundulus 
Ve08.2h10]
Length=210

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTS DQD RFS+K+ KLLKS KF PE +  VDM KV + V++PWIAK+VTELVG 
Sbjct  4    AGFFKGTSTDQDRRFSDKELKLLKSMKFPPEFDKKVDMKKVNLQVIKPWIAKKVTELVGF  63

Query  295  EDEVLINFIYSLLEGKDV---NGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE  +    + K++QI LTGF+  +T  FM  LW LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEDPNYTTPDPKKMQINLTGFLTSSTPTFMTALWKLLLEAQESLAGVP  123

Query  466  QQFLDAKEEETRK  504
            Q F++ K+EE RK
Sbjct  124  QTFVEEKKEEMRK  136



>gb|KIK68799.1| hypothetical protein GYMLUDRAFT_68631 [Gymnopus luxurians FD-317 
M1]
Length=408

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV + V+RPWIAK+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNLTVIRPWIAKKVVELVGF  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE K     + +++QI LTGF+ ++T  FM  LW LLL AQ++ +GVP
Sbjct  64   EDEVVVEYAMGLLEDKQELFPDPRKMQINLTGFLTKDTPAFMSALWKLLLEAQSDMTGVP  123

Query  466  QQFLDAKEEETRK  504
            + F++ K+EE RK
Sbjct  124  RTFVEEKKEELRK  136



>ref|XP_005988815.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Latimeria chalumnae]
Length=927

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLEQKKEE  130



>gb|KIK21297.1| hypothetical protein PISMIDRAFT_66449, partial [Pisolithus microcarpus 
441]
Length=143

 Score =   144 bits (362),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 96/141 (68%), Gaps = 12/141 (9%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEH---------LVDMGKVKMDVMRPWIAK  270
            GFF+GTSADQD RFS+K+ KLLKS KF PE E           VDM KV M+++RPWIAK
Sbjct  1    GFFKGTSADQDRRFSDKELKLLKSMKFPPEFEKKVPCRLLPVRVDMKKVNMEIIRPWIAK  60

Query  271  RVTELVGIEDEVLINFIYSLLEGKDV---NGKEVQIQLTGFMERNTGKFMKELWSLLLSA  441
            +VTELVG EDEV+I +   LLE  +    + K++QI L GF+  +T  FMK LW LLL +
Sbjct  61   KVTELVGFEDEVVIEYAMGLLEDPNYTTPDPKKMQINLMGFLTSSTPAFMKALWDLLLES  120

Query  442  QNNASGVPQQFLDAKEEETRK  504
            Q++  GVP   ++AK+EE RK
Sbjct  121  QDSPGGVPVSMVEAKKEELRK  141



>ref|XP_005988814.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Latimeria chalumnae]
Length=923

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLEQKKEE  130



>gb|KIO14306.1| hypothetical protein M404DRAFT_992582 [Pisolithus tinctorius 
Marx 270]
Length=507

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLKS KF PE E  VDM KV M+++RPWIAK+VTELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFEKKVDMKKVNMEIIRPWIAKKVTELVGF  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV+I +   LLE  +    + K++QI L GF+  +T  FMK LW LLL +Q++  GVP
Sbjct  64   EDEVVIEYAMGLLEDPNHTTPDPKKMQINLMGFLTSSTPAFMKALWDLLLESQDSPGGVP  123

Query  466  QQFLDAKEEETRK  504
               ++AK+EE RK
Sbjct  124  TSMVEAKKEELRK  136



>ref|XP_007852080.1| hypothetical protein Moror_3102 [Moniliophthora roreri MCA 2997]
 gb|ESK88604.1| hypothetical protein Moror_3102 [Moniliophthora roreri MCA 2997]
Length=460

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLK+ KF PE +  VDM KV ++V++PWI K+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPPEFDKKVDMRKVNLNVIKPWITKKVVELVGF  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE K     + K++QI LTGF+ ++T  FM  LW+LLL AQN+ +GVP
Sbjct  64   EDEVVVEYAMGLLEDKSQPTPDPKKMQINLTGFLTKDTPAFMSALWNLLLEAQNDVTGVP  123

Query  466  QQFLDAKEEETRK  504
            + F++ K+EE RK
Sbjct  124  RTFVEEKKEELRK  136



>gb|KIO25371.1| hypothetical protein M407DRAFT_25274 [Tulasnella calospora MUT 
4182]
Length=418

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 97/131 (74%), Gaps = 2/131 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD+RFSNK  +L K  KF PE +  VDM KV++ V +PWI KRVTE++G+
Sbjct  4    AGFFKGTSADQDSRFSNKDQRLRKQIKFPPEFDQKVDMKKVELSVFKPWIYKRVTEIIGL  63

Query  295  EDEVLINFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            EDEV+I ++   LE  GK  + K++QI+LTGF+   TG+FM +LW LLLSAQ +  GVP 
Sbjct  64   EDEVVIEYVNEQLEQSGKSPDPKDIQIKLTGFLGSKTGEFMLQLWKLLLSAQVSPGGVPA  123

Query  469  QFLDAKEEETR  501
            +F++AK+ E R
Sbjct  124  EFIEAKKLELR  134



>gb|KIP02407.1| hypothetical protein PHLGIDRAFT_112065 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=211

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 96/134 (72%), Gaps = 5/134 (4%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLKS KF PE E  VDM KV + V+RPWI  +V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFEKKVDMRKVNLTVIRPWIVSKVVELVGF  63

Query  295  EDEVLINFIYSLLEGKDV----NGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGV  462
            EDEV++ +   LLE  DV    + +++QI LTGF+ ++T  FM  LW+LLL AQ + +GV
Sbjct  64   EDEVVVEYAMGLLE-DDVQPTPDPRKMQINLTGFLTKDTPTFMSALWTLLLEAQESPAGV  122

Query  463  PQQFLDAKEEETRK  504
            P+  ++AK+EE R+
Sbjct  123  PRSMVEAKKEEMRQ  136



>gb|AHH81768.1| serine/arginine repetitive matrix protein 1-like protein, partial 
[Biomphalaria glabrata]
Length=307

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
            + GFFRGT+A QDTRFS+K+ KL+K+ KF   LE  VDM KV +D ++PWIA+R+TEL+G
Sbjct  2    NAGFFRGTTAQQDTRFSDKRKKLMKTMKFGEGLERKVDMTKVNVDSLKPWIAQRITELLG  61

Query  292  IEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVPQ  468
            +ED+V++ F+Y+ LE +  + KE+QI +TGF+  +N   F+ ELW  L SAQ N +G+P 
Sbjct  62   MEDDVVVEFVYNQLEERHPDAKEMQINITGFLNGKNARIFLSELWDHLCSAQENVTGIPN  121

Query  469  QFLDAKEEE  495
            QFL+ K+ E
Sbjct  122  QFLEQKKNE  130



>ref|XP_008041955.1| PWI domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW54865.1| PWI domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=285

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLK+ KF PE E  VDM KV + V+RPWI K+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPPEFEKKVDMRKVNLSVIRPWIVKKVIELVGF  63

Query  295  EDEVLINFIYSLLE---GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE       + + +QI LTGF+ ++T  FM  LW LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEDDAAPTPDPRRMQINLTGFLTKSTPAFMSALWQLLLEAQESPAGVP  123

Query  466  QQFLDAKEEETRK  504
            + F++ K+ E R+
Sbjct  124  RTFVEEKKAEMRQ  136



>emb|CDO71127.1| hypothetical protein BN946_scf184844.g131 [Trametes cinnabarina]
Length=339

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLK+ KF PE +  VDM KV + V+RPWI K+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPPEFDKKVDMRKVNLSVIRPWIVKKVVELVGF  63

Query  295  EDEVLINFIYSLLEG---KDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE       + + +QI LTGF+  NT  FM  LW LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEDDSQPTPDPRRMQINLTGFLTNNTPAFMSALWKLLLEAQESPAGVP  123

Query  466  QQFLDAKEEETRK  504
            + F++ K+EE R+
Sbjct  124  RTFVEEKKEEMRQ  136



>gb|ELU41649.1| SR-rich pre-mRNA splicing activator [Rhizoctonia solani AG-1 
IA]
Length=430

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 2/132 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSA+QD RF++K+ +LLKS KF PE +  VDM KV++ VMRPWI K+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFADKEHRLLKSIKFPPEFDRKVDMRKVELSVMRPWITKKVVELVGF  63

Query  295  EDEVLINFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            EDEV++ ++  LLE   K  + K +QI LTGF+E  T  FM  LW+LLL AQ++ +GVP 
Sbjct  64   EDEVVVEYVMGLLEDRSKPPDPKVMQINLTGFLESKTPAFMSSLWALLLEAQDSPAGVPA  123

Query  469  QFLDAKEEETRK  504
             F+  K+EE R+
Sbjct  124  SFVQEKKEELRQ  135



>gb|EMS22473.1| SR-rich pre-mRNA splicing activator [Rhodosporidium toruloides 
NP11]
 emb|CDR46859.1| RHTO0S13e02630g1_1 [Rhodosporidium toruloides]
Length=417

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 3/134 (2%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M   FFRGTS DQD RF +KQ+ LL+  +F P  +  VDM KV+M VM+PWI K+V EL+
Sbjct  1    MGSNFFRGTSLDQDPRFKDKQSALLRKTQFPPSFDTKVDMRKVEMGVMKPWITKKVIELL  60

Query  289  GIEDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASG  459
            G ED+VLI +IYSLLE  +   V+GK +QI LTGF+E  T  FM  LW LLLSAQ+N   
Sbjct  61   GFEDDVLIEYIYSLLEDPENPVVDGKNMQILLTGFLESKTAAFMNHLWDLLLSAQSNPLR  120

Query  460  VPQQFLDAKEEETR  501
            VP + L+ K+ E R
Sbjct  121  VPTELLEEKKREMR  134



>gb|EXX63474.1| hypothetical protein RirG_151940 [Rhizophagus irregularis DAOM 
197198w]
Length=369

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 96/130 (74%), Gaps = 0/130 (0%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
            GGFF+GTS +QD+RFS+KQ KLLKS  F  E    VD+ KV + V+RPW+A+++ EL+G 
Sbjct  4    GGFFKGTSLEQDSRFSDKQKKLLKSMNFPSEFNQKVDLKKVNLTVIRPWVAQKIVELLGG  63

Query  295  EDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            EDEV++N+++ LLE  D++ + +QI LTGF+E+N   F+ ELW LLLSAQ   +G+P  F
Sbjct  64   EDEVVVNYVFGLLEEPDLDPRMMQINLTGFLEKNAPIFVTELWKLLLSAQEGENGIPAIF  123

Query  475  LDAKEEETRK  504
            L+ K E+ R+
Sbjct  124  LEQKMEQIRR  133



>gb|EUC66839.1| serine/arginine repetitive matrix-like protein, putative [Rhizoctonia 
solani AG-3 Rhs1AP]
Length=466

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSA+QD RF++K+ +LLKS KF PE +  VDM KV + VMRPWI K+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFADKEHRLLKSMKFPPEFDRKVDMRKVNLQVMRPWITKKVVELVGF  63

Query  295  EDEVLINFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            EDEV++ +   LLE   K  + K +QI LTGF+E  T  FM  LW+LLL AQN+ +GVP 
Sbjct  64   EDEVVVEYAMGLLEDQSKPPDPKVMQINLTGFLESKTPAFMSALWTLLLEAQNSPAGVPA  123

Query  469  QFLDAKEEETRK  504
             F+  K+EE R+
Sbjct  124  SFVQEKKEELRQ  135



>ref|XP_007869448.1| PWI domain-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ52281.1| PWI domain-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=301

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSA+QD RFS+K+ KLLK+ KF    +  VDM KV +DV+RPWIAK+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFSDKEMKLLKTMKFPATFDKKVDMRKVNLDVIRPWIAKKVVELVGF  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE       + K++QI LTGF+  +T +FM  LW LLL AQ++  GVP
Sbjct  64   EDEVVVEYAMGLLEDPSQPTPDPKKMQINLTGFLTNHTAEFMSALWELLLEAQDSLGGVP  123

Query  466  QQFLDAKEEETRK  504
            ++FL+ K+EE RK
Sbjct  124  KRFLEEKKEEMRK  136



>dbj|BAB25575.1| unnamed protein product [Mus musculus]
Length=265

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEETRK  504
              FL+ K+EE ++
Sbjct  121  SAFLELKKEEIKQ  133



>gb|KDR80213.1| hypothetical protein GALMADRAFT_242506 [Galerina marginata CBS 
339.88]
Length=514

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 96/133 (72%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLKS KF PE E  VDM KV + V+RPWIAK++ EL+G 
Sbjct  4    AGFFKGTSADQDRRFSDKEVKLLKSMKFPPEFEKKVDMRKVNLAVIRPWIAKKIIELIGF  63

Query  295  EDEVLINFIYSLLEGK---DVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE +   + + +++QI LTGF+ + T  FM+ LW LLL AQ   +GVP
Sbjct  64   EDEVVVEYAMGLLEDEQQHNPDPRKMQINLTGFLTKETAPFMEALWKLLLEAQQEVTGVP  123

Query  466  QQFLDAKEEETRK  504
            + F++ K+EE RK
Sbjct  124  RTFVEQKKEEMRK  136



>gb|KJA25476.1| hypothetical protein HYPSUDRAFT_64668 [Hypholoma sublateritium 
FD-334 SS-4]
Length=485

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLK+ KF  + +  VDM KV ++V+RPWIAK++TEL+G 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPADFDKKVDMRKVNLNVIRPWIAKKITELIGF  63

Query  295  EDEVLINFIYSLLEGK---DVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE +   +   K++QI LTGF+ R+T  FM+ LW LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEDEQQPNPEPKKMQINLTGFLARDTPAFMEALWKLLLEAQQDVTGVP  123

Query  466  QQFLDAKEEETRK  504
            + F++ K+EE RK
Sbjct  124  RSFVEQKKEEMRK  136



>gb|KIK37574.1| hypothetical protein CY34DRAFT_451867 [Suillus luteus UH-Slu-Lm8-n1]
Length=273

 Score =   142 bits (359),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 99/152 (65%), Gaps = 23/152 (15%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPE--------------------LEHLVDMGKV  237
            GFF+GTSADQD RFS+K+ KLLKS KF PE                    L   VD+ KV
Sbjct  3    GFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVCHRSQAAPCSKLNFYLVPQVDLKKV  62

Query  238  KMDVMRPWIAKRVTELVGIEDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKF  408
             ++V+RPWIAK+VTELVG+EDEV++ +   LL+  +    + K++QI LTGF+  +T  F
Sbjct  63   NLNVIRPWIAKKVTELVGLEDEVVVEYAMGLLDDPNHTTPDPKKMQINLTGFLTASTPSF  122

Query  409  MKELWSLLLSAQNNASGVPQQFLDAKEEETRK  504
            M  LWSLLL AQ + +GVPQ F++ K+EE RK
Sbjct  123  MTALWSLLLEAQEHPAGVPQTFVEEKKEEMRK  154



>gb|KIJ11168.1| hypothetical protein PAXINDRAFT_15897 [Paxillus involutus ATCC 
200175]
Length=511

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTS DQD RFS+K+ KLLKS KF PE +  VDM KV + V++PWIAK+VTELVG E
Sbjct  5    GFFKGTSTDQDRRFSDKEVKLLKSMKFPPEFDKKVDMKKVNLQVIKPWIAKKVTELVGFE  64

Query  298  DEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            DEV++ +   LL+  +    + K++QI LTGF+  +T  FM  LW LLL AQ + +GVPQ
Sbjct  65   DEVVVEYAMGLLDDPNHTTPDPKKMQINLTGFLTSSTPTFMTALWKLLLEAQESLAGVPQ  124

Query  469  QFLDAKEEETRK  504
             F++ K+EE RK
Sbjct  125  TFVEEKKEEMRK  136



>gb|KIM86657.1| hypothetical protein PILCRDRAFT_311079 [Piloderma croceum F 1598]
Length=425

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTSADQD RFS+K+ KLLKS KF  E +  VDM KV + V+RPWIAK+V ELVG+E
Sbjct  5    GFFKGTSADQDRRFSDKEVKLLKSIKFPAEFDKKVDMRKVNLQVIRPWIAKKVVELVGLE  64

Query  298  DEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            DEV++ +   LLE K     + K++QI LTGF+  +T  FM  LWSLLL AQ++ +GVP+
Sbjct  65   DEVVVEYAMGLLEDKQQPTPDPKKMQINLTGFLTNSTPGFMIALWSLLLEAQDSPAGVPR  124

Query  469  QFLDAKEEETRK  504
             F++ K+EE RK
Sbjct  125  TFVEEKKEEMRK  136



>ref|XP_007392708.1| hypothetical protein PHACADRAFT_26227 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM57568.1| hypothetical protein PHACADRAFT_26227 [Phanerochaete carnosa 
HHB-10118-sp]
Length=452

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLK+ KF PE +  VDM KV M V+RPW+  ++ EL+G 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTGKFPPEFDKKVDMRKVNMTVLRPWLVSKIVELLGF  63

Query  295  EDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            EDE+L+ + + LLE  + + +++QI LTGF+ ++   FM +LW LLL AQ + +GVP+  
Sbjct  64   EDELLVEYAFGLLEDSNPDPRKMQINLTGFLAKDAATFMTDLWKLLLEAQESEAGVPRSM  123

Query  475  LDAKEEETRK  504
            ++AK+EE R+
Sbjct  124  VEAKKEEMRR  133



>emb|CEL57689.1| protein phosphatase 2 (formerly 2A), regulatory subunit A [Rhizoctonia 
solani AG-1 IB]
Length=832

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 2/132 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSA+QD RF++K+ +LLKS KF PE +  VDM KV++ VMRPWI K+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFADKEHRLLKSMKFPPEFDRKVDMRKVELSVMRPWITKKVVELVGF  63

Query  295  EDEVLINFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            EDEV++ ++  LLE   K  + K +QI LTGF+E  T  FM  LW+LLL AQ++ +GVP 
Sbjct  64   EDEVVVEYVMGLLEDRSKPPDPKLMQINLTGFLESKTPAFMSSLWALLLEAQDSPAGVPA  123

Query  469  QFLDAKEEETRK  504
             F+  K+EE R+
Sbjct  124  SFVQEKKEELRQ  135



>gb|EPT02135.1| hypothetical protein FOMPIDRAFT_1048148 [Fomitopsis pinicola 
FP-58527 SS1]
Length=352

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLK+ KF PE E  VDM KV + V+RPW+ K++ ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPPEFEKKVDMRKVNLSVIRPWVVKKIVELVGF  63

Query  295  EDEVLINFIYSLLEG---KDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE       + +++QI LTGF+ ++T +FM  LW LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEDDSQPTPDPRKMQINLTGFLTKHTVEFMSSLWKLLLEAQESPAGVP  123

Query  466  QQFLDAKEEETRK  504
            Q F++ K+ E R+
Sbjct  124  QTFVEEKKAEMRQ  136



>ref|XP_007771072.1| PWI domain-containing protein, partial [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW78454.1| PWI domain-containing protein, partial [Coniophora puteana RWD-64-598 
SS2]
Length=145

 Score =   138 bits (347),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 92/143 (64%), Gaps = 14/143 (10%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEH-----------LVDMGKVKMDVMRPWI  264
            GFF+GTSADQD RFS+K+ KLLKS KF PE +            +VDM KV + V+RPWI
Sbjct  1    GFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVHPLPSSSCLIVDMRKVNIQVIRPWI  60

Query  265  AKRVTELVGIEDEVLINFIYSLLEGKDV---NGKEVQIQLTGFMERNTGKFMKELWSLLL  435
             K+V E VG EDEV++ +   LLE  D    + K++QI LTGF+   T  FM  LW LL+
Sbjct  61   VKKVIECVGFEDEVVVEYAMGLLEDPDTPTPDPKKMQINLTGFLTSQTTTFMTALWKLLI  120

Query  436  SAQNNASGVPQQFLDAKEEETRK  504
             AQ + +GVPQ F++ K+ E R+
Sbjct  121  EAQESPAGVPQTFVEEKKAEMRR  143



>gb|AAL89660.1|AF411956_1 SRm160/300 splicing coactivator, partial [Takifugu rubripes]
Length=153

 Score =   138 bits (347),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 99/133 (74%), Gaps = 1/133 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  L+  VDM KV ++V++PWI KRV +++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLDKKVDMTKVNLEVIKPWITKRVNDIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K  + K +QI LTGF+  +N  +F+K+LW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEEKHPDAKMMQINLTGFLNGKNAREFLKDLWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEETRK  504
              FL+ K+EE R+
Sbjct  121  SVFLEQKKEEIRQ  133



>ref|XP_006752139.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Leptonychotes 
weddellii]
Length=347

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEETRK  504
              FL+ K+EE ++
Sbjct  121  SAFLELKKEEIKQ  133



>ref|XP_006463501.1| hypothetical protein AGABI2DRAFT_194307 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV45358.1| hypothetical protein AGABI2DRAFT_194307 [Agaricus bisporus var. 
bisporus H97]
Length=479

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSA+QD RFS+K+ KLLKS KF PE +  VDM KV M+V+RPW+AK++ ELVG 
Sbjct  4    AGFFKGTSAEQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNMNVIRPWVAKKIVELVGF  63

Query  295  EDEVLINFIYSLLEGKDV---NGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE + +   + K++QI LTGF+ ++T  FM  LW LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEEESLRTPDPKKMQINLTGFLTKHTPTFMSALWKLLLEAQEDVTGVP  123

Query  466  QQFLDAKEEETRK  504
            +  ++ K++E RK
Sbjct  124  RTMVEEKKQEMRK  136



>gb|KIY47475.1| PWI domain-containing protein, partial [Fistulina hepatica ATCC 
64428]
Length=147

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 92/130 (71%), Gaps = 3/130 (2%)
 Frame = +1

Query  124  FRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDE  303
            F+GT+ADQD RFS+K+ KLL++ KF PE E  VDM KV + V+RPW+ K+V ELVG EDE
Sbjct  1    FKGTAADQDRRFSDKEQKLLRTLKFPPEFEKKVDMRKVNLTVIRPWVTKKVVELVGFEDE  60

Query  304  VLINFIYSLLEGKDV---NGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            V++ +   LLE   +   + +++QI LTGF+ ++T  FM  LW LLL AQ   +GVP+ F
Sbjct  61   VVVEYAMGLLEDPALPTPDPRKMQINLTGFLTKDTPTFMSALWKLLLEAQEEVTGVPRTF  120

Query  475  LDAKEEETRK  504
            ++ K+EE R+
Sbjct  121  VEEKKEELRR  130



>ref|XP_007334057.1| hypothetical protein AGABI1DRAFT_116472 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM75364.1| hypothetical protein AGABI1DRAFT_116472 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=481

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 97/133 (73%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSA+QD RFS+K+ KLLKS KF PE +  VDM KV M+V+RPW+AK++ ELVG 
Sbjct  4    AGFFKGTSAEQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNMNVIRPWVAKKIVELVGF  63

Query  295  EDEVLINFIYSLLEGKDV---NGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE + +   + K++QI LTGF+ ++T  FM  LW LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEEESLRTPDPKKMQINLTGFLTKHTPTFMSALWKLLLEAQEDVTGVP  123

Query  466  QQFLDAKEEETRK  504
            +  ++ K++E RK
Sbjct  124  RTMVEEKKQEMRK  136



>ref|XP_007270525.1| hypothetical protein FOMMEDRAFT_136573 [Fomitiporia mediterranea 
MF3/22]
 gb|EJC99206.1| hypothetical protein FOMMEDRAFT_136573 [Fomitiporia mediterranea 
MF3/22]
Length=499

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 94/131 (72%), Gaps = 3/131 (2%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTSADQD+RFS+K+ KLLK+ KF PE    VDM KV + VMRPWIA +VTELVG+E
Sbjct  5    GFFKGTSADQDSRFSDKEMKLLKTLKFPPEFSEKVDMRKVNLQVMRPWIANKVTELVGLE  64

Query  298  DEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            DEV++ +   LLE       + +++QI LTGF+   T +FM  LW LLL AQ++  G+P+
Sbjct  65   DEVVVEYAMGLLEDPSKPLPDPRKMQINLTGFLTSKTPEFMIALWKLLLEAQSSPGGIPK  124

Query  469  QFLDAKEEETR  501
             F++ K+EE R
Sbjct  125  TFVEEKKEEMR  135



>gb|EMD35594.1| hypothetical protein CERSUDRAFT_85538 [Ceriporiopsis subvermispora 
B]
Length=405

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTSADQD RFS+K+ KLLK+ KF PE E  VDM KV + V+RPWI K+V ELVG E
Sbjct  5    GFFKGTSADQDRRFSDKELKLLKTMKFPPEFEKKVDMRKVNLSVIRPWIVKKVVELVGFE  64

Query  298  DEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            DEV++ +   LLE       + + +QI LTGF+  +T +FM  LW+LL+ AQ++ +GVP+
Sbjct  65   DEVVVEYAMGLLEDNSQPTPDPRRMQINLTGFLTNSTPQFMSALWNLLIEAQDSPAGVPR  124

Query  469  QFLDAKEEETRK  504
             F++ K+EE R+
Sbjct  125  TFVEEKKEEMRQ  136



>ref|XP_007346622.1| PWI domain-containing protein [Auricularia delicata TFB-10046 
SS5]
 gb|EJD45432.1| PWI domain-containing protein [Auricularia delicata TFB-10046 
SS5]
Length=227

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 98/135 (73%), Gaps = 3/135 (2%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFF+GTS++QDTRFS+K+ KLLK+ KF PE +  VDM KV + V+RPWIAKRV EL 
Sbjct  1    MDAGFFKGTSSEQDTRFSDKELKLLKTLKFPPEFDKKVDMRKVNLQVIRPWIAKRVVELS  60

Query  289  GIEDEVLINFIYSLLEG---KDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASG  459
            G EDEV+I +   LLE       + K +Q+ LTGF+  NT KF+ ELW+LLL AQ++ +G
Sbjct  61   GFEDEVVIEYAMGLLEDAAKPTPDPKRIQVALTGFLTSNTPKFVLELWTLLLEAQDSPAG  120

Query  460  VPQQFLDAKEEETRK  504
            +P  F++AK+EE R+
Sbjct  121  IPTSFVEAKKEEMRR  135



>gb|KIJ98811.1| hypothetical protein K443DRAFT_195324 [Laccaria amethystina LaAM-08-1]
Length=458

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLKS KF    E  VDM K+ + V+RPWIAK++ ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKEVKLLKSMKFPAHFEKKVDMRKINLTVIRPWIAKKIIELVGF  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE +     + K++QI LTGF+ ++T  FM  LW LLL AQ   SGVP
Sbjct  64   EDEVVVEYAMGLLEDEQQPTPDPKKMQINLTGFLTKDTPAFMSALWKLLLEAQEEVSGVP  123

Query  466  QQFLDAKEEETRK  504
            + F++ K+EE R+
Sbjct  124  RTFVEMKKEEMRR  136



>gb|ERZ98846.1| hypothetical protein GLOINDRAFT_70246, partial [Rhizophagus irregularis 
DAOM 181602]
Length=141

 Score =   137 bits (344),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +1

Query  130  GTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDEVL  309
            GTS +QD+RFS+KQ KLLKS  F  E    VD+ KV + V+RPW+A+++ EL+G EDEV+
Sbjct  1    GTSLEQDSRFSDKQKKLLKSMNFPSEFNQKVDLKKVNLTVIRPWVAQKIVELLGGEDEVV  60

Query  310  INFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQFLDAKE  489
            +N+++ LLE  D++ + +QI LTGF+E+N   F+ ELW LLLSAQ   +G+P  FL+ K 
Sbjct  61   VNYVFGLLEEPDLDPRMMQINLTGFLEKNAPIFVTELWKLLLSAQEGENGIPAIFLEQKM  120

Query  490  EETRK  504
            E+ R+
Sbjct  121  EQIRR  125



>emb|CAJ83937.1| serine/arginine repetitive matrix 1 [Xenopus (Silurana) tropicalis]
Length=816

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_009046201.1| hypothetical protein LOTGIDRAFT_137917 [Lottia gigantea]
 gb|ESP03151.1| hypothetical protein LOTGIDRAFT_137917 [Lottia gigantea]
Length=138

 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
              GFF+GT+A+QDTRF++K+ KL+KS KF   LE+ VDM KV +D ++PWIA+R+TEL+G
Sbjct  3    DAGFFKGTTAEQDTRFADKKKKLMKSMKFGDSLENKVDMTKVNVDTLKPWIAQRITELLG  62

Query  292  IEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVPQ  468
            IED+V++ F+Y+ LE +  + K++QI LTGF+  +N   F++ELW LL+SAQ N +G+P 
Sbjct  63   IEDDVVVEFVYNQLEERFPDPKDMQINLTGFLNPKNARIFLQELWELLVSAQENIAGIPS  122

Query  469  QFLDAKEEETRK  504
            +FL+ K+EE +K
Sbjct  123  KFLEQKKEEIKK  134



>ref|NP_001005645.1| serine/arginine repetitive matrix 1 [Xenopus (Silurana) tropicalis]
 gb|AAH74646.1| serine/arginine repetitive matrix 1 [Xenopus (Silurana) tropicalis]
Length=874

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_007301834.1| hypothetical protein STEHIDRAFT_154602 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM88888.1| hypothetical protein STEHIDRAFT_154602 [Stereum hirsutum FP-91666 
SS1]
Length=501

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV + V+RPW+ K+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNLTVIRPWVTKKVIELVGF  63

Query  295  EDEVLINFIYSLLE---GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE       + K++QI LTGF+ ++T  FM  LW+LLL AQ + +G+P
Sbjct  64   EDEVVVEYAMGLLEDESSPTPDPKKMQINLTGFLTKSTASFMSALWALLLEAQESHAGIP  123

Query  466  QQFLDAKEEETRK  504
            + F++ K+ E R+
Sbjct  124  KTFVEEKKAEMRQ  136



>gb|AAH77771.1| LOC445881 protein, partial [Xenopus laevis]
Length=734

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VD GKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDTGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
             +FL+ K+EE
Sbjct  121  SEFLELKKEE  130



>gb|EIE88227.1| hypothetical protein RO3G_12938 [Rhizopus delemar RA 99-880]
Length=910

 Score =   146 bits (369),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 70/127 (55%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +1

Query  124  FRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDE  303
             +GTSADQD+RFSNK+ KLLK+  F PE +  VDM KV  DV+ PWI+ ++TEL+G EDE
Sbjct  689  LQGTSADQDSRFSNKEKKLLKTMSFPPEFDQKVDMKKVNFDVINPWISNKITELLGFEDE  748

Query  304  VLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQFLDA  483
            V+ ++  SLLE + ++ K +QI LTGF+E N   F+KELW+LLLSAQN+  G+P  F++ 
Sbjct  749  VVSDYASSLLEEESIDPKMMQINLTGFLESNAKVFVKELWNLLLSAQNSVGGIPAIFIEQ  808

Query  484  KEEETRK  504
            K+EE RK
Sbjct  809  KKEELRK  815



>ref|XP_004592301.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Ochotona princeps]
Length=902

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>gb|EDL80753.1| serine/arginine repetitive matrix 1 (predicted), isoform CRA_b 
[Rattus norvegicus]
Length=503

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_004592299.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Ochotona princeps]
Length=914

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_004592300.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Ochotona princeps]
Length=911

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_004592298.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Ochotona princeps]
Length=916

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>dbj|BAK63562.1| serine/arginine repetitive matrix protein 1 [Pan troglodytes]
Length=508

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEETRK  504
              FL+ K+EE ++
Sbjct  121  SAFLELKKEEIKQ  133



>gb|AAH97656.1| LOC494754 protein [Xenopus laevis]
Length=798

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VD GKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDTGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_004341588.1| PWI domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR19502.1| PWI domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=457

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
            +GGFFRGTS +QD RFS+K  K +  +KF PE +  VD+ KV MD ++PW+A R+T+L+G
Sbjct  4    AGGFFRGTSTEQDARFSDKYKKYVAGRKFPPEFDLKVDLRKVAMDAIKPWVASRITQLLG  63

Query  292  IEDEVLINFIYSLLEGKD-VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
             EDEVLI F + LL+ K+ +N KE+Q+ L GF+E ++ +F+ +LW LLLSAQ +  G+P 
Sbjct  64   FEDEVLIGFAFGLLDDKESLNPKELQLNLDGFLEADSPQFVADLWKLLLSAQASPGGIPA  123

Query  469  QFLDAKEEETRK  504
            +FL+ K+ + R+
Sbjct  124  EFLEQKKAQLRQ  135



>ref|XP_007424155.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X6 [Python bivittatus]
Length=746

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_005988816.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X4 [Latimeria chalumnae]
Length=901

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M G  + GTSA+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MEGPRWPGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLEQKKEE  130



>gb|ETS63133.1| hypothetical protein PaG_02911 [Pseudozyma aphidis DSM 70725]
Length=306

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M    ++G SA QD+RF++K+A LL+  KF    +  VDM KV++ VM+PWIA+R+TEL+
Sbjct  1    MGDSSYKGVSASQDSRFTDKEASLLRKLKFPRHFDTKVDMHKVELSVMKPWIARRITELL  60

Query  289  GIEDEVLINFIYSLL-EGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            G EDEV++ +   +L EG+  + K++QIQLTGF+E +T +FM ELW LL+SAQ +  GVP
Sbjct  61   GFEDEVVLEYAVGMLEEGRYPDAKKMQIQLTGFLEASTAEFMAELWELLISAQASPGGVP  120

Query  466  QQFLDAKEEETR  501
            Q+F++ K++E R
Sbjct  121  QRFVEEKKQELR  132



>ref|XP_005988813.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Latimeria chalumnae]
Length=923

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 96/130 (74%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M G  + GTSA+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MEGPRWPGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLEQKKEE  130



>ref|NP_001086440.1| serine/arginine repetitive matrix 1 [Xenopus laevis]
 gb|AAH94091.1| LOC445881 protein [Xenopus laevis]
Length=872

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VD GKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDTGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
             +FL+ K+EE
Sbjct  121  SEFLELKKEE  130



>ref|XP_011060800.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Acromyrmex 
echinatior]
Length=148

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +1

Query  124  FRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDE  303
            + GT+A QDTRFS+K+ KLLK  KF   L   VDM KVK+DV++PWI  ++T+++G+ED+
Sbjct  2    YTGTTASQDTRFSDKEKKLLKQMKFGDSLTQKVDMSKVKLDVIKPWITTKITQILGMEDD  61

Query  304  VLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVPQQFLD  480
            V++ F+Y+ LE K  + +++QI LTGF+  RN   FM ELW LL+SAQ + +G+P+ FL 
Sbjct  62   VVVEFVYNQLEEKFPDPRKMQINLTGFLNGRNARSFMGELWDLLVSAQESVTGIPEAFLQ  121

Query  481  AKEEETRK  504
             K+++ +K
Sbjct  122  QKKDQIKK  129



>ref|XP_010824971.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Bos taurus]
 ref|XP_010800937.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Bos taurus]
Length=746

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_003027506.1| hypothetical protein SCHCODRAFT_17474 [Schizophyllum commune 
H4-8]
 gb|EFI92603.1| hypothetical protein SCHCODRAFT_17474 [Schizophyllum commune 
H4-8]
Length=308

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV + V+RPW+ K++TEL GI
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDQKVDMRKVNLQVIRPWVFKKITELNGI  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDE++  +   LLE +     + K + I L GF+ +NT +FM  LW LLL AQ   SGVP
Sbjct  64   EDELVGEYCMGLLEDESQPTPDPKRMTINLQGFLNKNTKEFMVALWKLLLEAQAEVSGVP  123

Query  466  QQFLDAKEEETRK  504
            + F++ K+EE RK
Sbjct  124  RTFVEEKKEELRK  136



>ref|XP_007424152.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Python bivittatus]
Length=873

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_007424151.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Python bivittatus]
Length=892

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_003227241.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Anolis carolinensis]
Length=887

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_007424150.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Python bivittatus]
Length=906

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_008118563.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Anolis carolinensis]
Length=901

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_004394850.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Odobenus 
rosmarus divergens]
Length=803

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_003482044.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoformX2 
[Sus scrofa]
Length=874

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_007121181.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X4 [Physeter catodon]
Length=902

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_011282836.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Felis catus]
Length=874

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_011282833.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Felis catus]
Length=903

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>gb|ACN10942.1| Serine/arginine repetitive matrix protein 1 [Salmo salar]
Length=655

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K  + K +QI LTGF+  +N  +FM++LW LLLSAQ+N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEEKHPDSKMMQINLTGFLNGKNAREFMRDLWPLLLSAQDNIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLEQKKEE  130



>ref|XP_011282835.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Felis catus]
Length=896

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_005665158.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Sus scrofa]
Length=915

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>dbj|GAC76886.1| splicing coactivator SRm160/300, subunit SRm160 [Pseudozyma antarctica 
T-34]
Length=306

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M    ++G SA QD+RF++K+A LL+  KF    +  VDM KV++ VM+PWIA+R+TEL+
Sbjct  1    MGDSSYKGVSASQDSRFTDKEASLLRKLKFPRHFDTKVDMHKVELSVMKPWIARRITELL  60

Query  289  GIEDEVLINFIYSLL-EGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            G EDEV++ +   +L EG+  + K++QIQLTGF+E +T +FM ELW LL+SAQ +  GVP
Sbjct  61   GFEDEVVLEYAMGMLEEGRYPDAKKMQIQLTGFLEASTQEFMAELWELLISAQASPGGVP  120

Query  466  QQFLDAKEEETR  501
            Q+F++ K++E R
Sbjct  121  QRFVEEKKQELR  132



>ref|XP_004425801.1| PREDICTED: uncharacterized protein LOC101387536 isoform 3 [Ceratotherium 
simum simum]
Length=873

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_005665157.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Sus scrofa]
Length=916

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_010343877.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Saimiri 
boliviensis boliviensis]
Length=863

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_006862351.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Chrysochloris asiatica]
Length=902

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_007121180.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Physeter catodon]
Length=904

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_011282832.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Felis catus]
Length=904

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>gb|AAP97290.1|AF419855_1 Ser/Arg-related nuclear matrix protein [Homo sapiens]
 gb|AAC09321.1| Ser/Arg-related nuclear matrix protein [Homo sapiens]
Length=820

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_011282834.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Felis catus]
Length=902

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_008573197.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Galeopterus variegatus]
Length=904

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_003415444.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Loxodonta africana]
Length=902

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>emb|CCM00237.1| predicted protein [Fibroporia radiculosa]
Length=528

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 94/133 (71%), Gaps = 3/133 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLKS KF P+ E  VDM KV + V+RPW+ K++ ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPDFEKKVDMRKVNLTVIRPWVVKKIIELVGF  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE       + +++QI LTGF+  +T  FM  LW LLL AQ++ +GVP
Sbjct  64   EDEVVVEYAMGLLEDDSQPTPDPRKMQINLTGFLTNHTPAFMTALWKLLLEAQDSPAGVP  123

Query  466  QQFLDAKEEETRK  504
            + F++ K+EE R+
Sbjct  124  RTFVEEKKEEMRQ  136



>dbj|GAA99222.1| hypothetical protein E5Q_05915 [Mixia osmundae IAM 14324]
 gb|KEI39847.1| hypothetical protein L969DRAFT_47755 [Mixia osmundae IAM 14324]
Length=530

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 92/127 (72%), Gaps = 3/127 (2%)
 Frame = +1

Query  124  FRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDE  303
             RGT+ +QD RF++K  +LLK+ KF  E    VDM KV+M VMRPWIA+RVTEL+G+EDE
Sbjct  4    MRGTTFEQDIRFADKDKQLLKTMKFPAEFAQRVDMRKVEMSVMRPWIARRVTELLGMEDE  63

Query  304  VLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            V+I ++  LLE K    V+ K++QI LTGF+ER T  FM ELW+LLLSAQ +   VP QF
Sbjct  64   VVIEYVNGLLEDKAAPLVDPKKMQISLTGFLERKTAPFMIELWNLLLSAQASPVKVPAQF  123

Query  475  LDAKEEE  495
            ++ K+ E
Sbjct  124  IEEKKRE  130



>ref|XP_007933924.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Orycteropus 
afer afer]
Length=914

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_004850657.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Heterocephalus glaber]
Length=900

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_010593392.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Loxodonta africana]
Length=914

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_005665155.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Sus scrofa]
Length=918

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_004425799.1| PREDICTED: uncharacterized protein LOC101387536 isoform 1 [Ceratotherium 
simum simum]
Length=915

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_004465431.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
7 [Dasypus novemcinctus]
Length=900

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_004850656.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Heterocephalus glaber]
Length=912

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_010593393.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Loxodonta africana]
Length=886

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_008961404.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Pan paniscus]
Length=902

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_006078051.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X5 [Bubalus bubalis]
Length=899

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_007121179.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Physeter catodon]
Length=916

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_005245778.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Homo sapiens]
 ref|XP_009449178.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X7 [Pan troglodytes]
Length=902

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_007121183.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X6 [Physeter catodon]
Length=881

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_002716019.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Oryctolagus cuniculus]
Length=905

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_007121182.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X5 [Physeter catodon]
Length=888

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_008998898.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Callithrix jacchus]
Length=902

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_011226923.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine repetitive matrix 
protein 1 [Ailuropoda melanoleuca]
Length=906

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_004425800.1| PREDICTED: uncharacterized protein LOC101387536 isoform 2 [Ceratotherium 
simum simum]
Length=903

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_010828369.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Bison bison bison]
Length=901

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_005353112.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X5 [Microtus ochrogaster]
Length=900

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_005665156.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Sus scrofa]
Length=917

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_009200129.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Papio anubis]
Length=902

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



>ref|XP_007978194.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Chlorocebus sabaeus]
Length=902

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLDAKEEE  495
              FL+ K+EE
Sbjct  121  SAFLELKKEE  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905