BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M05

Length=533
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774504.1|  PREDICTED: probable isoaspartyl peptidase/L-...    301   6e-99   Nicotiana sylvestris
ref|XP_009586844.1|  PREDICTED: probable isoaspartyl peptidase/L-...    299   2e-98   Nicotiana tomentosiformis
ref|XP_010270964.1|  PREDICTED: probable isoaspartyl peptidase/L-...    298   7e-98   Nelumbo nucifera [Indian lotus]
ref|XP_010101665.1|  putative isoaspartyl peptidase/L-asparaginase 2    296   4e-97   Morus notabilis
ref|XP_004238125.1|  PREDICTED: probable isoaspartyl peptidase/L-...    295   1e-96   
ref|XP_006354842.1|  PREDICTED: probable isoaspartyl peptidase/L-...    295   1e-96   Solanum tuberosum [potatoes]
gb|EPS68558.1|  hypothetical protein M569_06206                         295   1e-96   Genlisea aurea
gb|KJB59852.1|  hypothetical protein B456_009G276200                    294   2e-96   Gossypium raimondii
dbj|BAC66615.1|  L-asparaginase                                         293   3e-96   Glycine max [soybeans]
pdb|4PU6|A  Chain A, Crystal Structure Of Potassium-dependent Pla...    288   6e-96   Phaseolus vulgaris [French bean]
ref|XP_007017138.1|  N-terminal nucleophile aminohydrolases (Ntn ...    293   7e-96   Theobroma cacao [chocolate]
emb|CDP01286.1|  unnamed protein product                                293   7e-96   Coffea canephora [robusta coffee]
ref|XP_003550318.1|  PREDICTED: probable isoaspartyl peptidase/L-...    291   2e-95   Glycine max [soybeans]
gb|ACF74335.1|  L-asparaginase                                          288   3e-95   Arachis hypogaea [goober]
ref|NP_001236606.1|  L-asparaginase                                     291   3e-95   
gb|KDP41685.1|  hypothetical protein JCGZ_16092                         291   4e-95   Jatropha curcas
ref|XP_007222672.1|  hypothetical protein PRUPE_ppa008583mg             290   6e-95   Prunus persica
ref|XP_008220275.1|  PREDICTED: probable isoaspartyl peptidase/L-...    290   6e-95   Prunus mume [ume]
ref|XP_002320760.2|  L-asparaginase family protein                      290   6e-95   
ref|XP_011029297.1|  PREDICTED: probable isoaspartyl peptidase/L-...    290   7e-95   Populus euphratica
ref|XP_007160884.1|  hypothetical protein PHAVU_001G025000g             290   9e-95   Phaseolus vulgaris [French bean]
gb|AGZ15413.1|  L-asparaginase                                          290   1e-94   Phaseolus vulgaris [French bean]
emb|CDY28378.1|  BnaC01g35480D                                          290   1e-94   Brassica napus [oilseed rape]
ref|XP_010556428.1|  PREDICTED: probable isoaspartyl peptidase/L-...    290   1e-94   Tarenaya hassleriana [spider flower]
gb|KHG16262.1|  hypothetical protein F383_23830                         289   2e-94   Gossypium arboreum [tree cotton]
ref|XP_009360082.1|  PREDICTED: probable isoaspartyl peptidase/L-...    289   2e-94   Pyrus x bretschneideri [bai li]
ref|XP_009114923.1|  PREDICTED: probable isoaspartyl peptidase/L-...    289   2e-94   Brassica rapa
ref|XP_009146165.1|  PREDICTED: probable isoaspartyl peptidase/L-...    289   2e-94   Brassica rapa
ref|XP_008360985.1|  PREDICTED: probable isoaspartyl peptidase/L-...    289   2e-94   Malus domestica [apple tree]
ref|XP_002510160.1|  l-asparaginase, putative                           289   2e-94   Ricinus communis
ref|XP_008377997.1|  PREDICTED: LOW QUALITY PROTEIN: probable iso...    289   3e-94   Malus domestica [apple tree]
ref|XP_010244253.1|  PREDICTED: probable isoaspartyl peptidase/L-...    289   3e-94   Nelumbo nucifera [Indian lotus]
ref|XP_010503884.1|  PREDICTED: probable isoaspartyl peptidase/L-...    289   3e-94   Camelina sativa [gold-of-pleasure]
ref|XP_009354155.1|  PREDICTED: probable isoaspartyl peptidase/L-...    288   3e-94   Pyrus x bretschneideri [bai li]
ref|XP_010465623.1|  PREDICTED: probable isoaspartyl peptidase/L-...    288   5e-94   Camelina sativa [gold-of-pleasure]
ref|XP_002882982.1|  hypothetical protein ARALYDRAFT_479069             288   5e-94   
ref|XP_006434701.1|  hypothetical protein CICLE_v10001812mg             288   5e-94   Citrus clementina [clementine]
emb|CDY30139.1|  BnaC05g37230D                                          288   6e-94   Brassica napus [oilseed rape]
emb|CDY20183.1|  BnaA01g28190D                                          288   6e-94   Brassica napus [oilseed rape]
ref|XP_010487465.1|  PREDICTED: probable isoaspartyl peptidase/L-...    288   7e-94   Camelina sativa [gold-of-pleasure]
ref|XP_006298133.1|  hypothetical protein CARUB_v10014177mg             287   9e-94   Capsella rubella
gb|KDO84066.1|  hypothetical protein CISIN_1g020250mg                   287   1e-93   Citrus sinensis [apfelsine]
gb|KJB29444.1|  hypothetical protein B456_005G101000                    286   2e-93   Gossypium raimondii
emb|CBI19471.3|  unnamed protein product                                286   2e-93   Vitis vinifera
ref|XP_002285006.1|  PREDICTED: probable isoaspartyl peptidase/L-...    286   4e-93   Vitis vinifera
ref|NP_566536.1|  probable isoaspartyl peptidase/L-asparaginase 2       286   4e-93   Arabidopsis thaliana [mouse-ear cress]
gb|KJB58572.1|  hypothetical protein B456_009G215700                    285   5e-93   Gossypium raimondii
gb|KHG29402.1|  hypothetical protein F383_14115                         285   5e-93   Gossypium arboreum [tree cotton]
gb|KHG11184.1|  hypothetical protein F383_13364                         285   6e-93   Gossypium arboreum [tree cotton]
ref|XP_006473269.1|  PREDICTED: probable isoaspartyl peptidase/L-...    285   6e-93   Citrus sinensis [apfelsine]
ref|XP_003589126.1|  L-asparaginase                                     285   8e-93   Medicago truncatula
ref|XP_004499019.1|  PREDICTED: probable isoaspartyl peptidase/L-...    284   1e-92   Cicer arietinum [garbanzo]
ref|XP_002302429.1|  L-asparaginase family protein                      284   2e-92   
gb|KJB63904.1|  hypothetical protein B456_010G023000                    284   3e-92   Gossypium raimondii
ref|XP_011017156.1|  PREDICTED: probable isoaspartyl peptidase/L-...    283   7e-92   Populus euphratica
ref|XP_006406871.1|  hypothetical protein EUTSA_v10021131mg             282   9e-92   Eutrema salsugineum [saltwater cress]
ref|XP_004501550.1|  PREDICTED: probable isoaspartyl peptidase/L-...    282   1e-91   Cicer arietinum [garbanzo]
gb|KFK38965.1|  hypothetical protein AALP_AA3G183000                    282   1e-91   Arabis alpina [alpine rockcress]
gb|ABC01060.1|  L-asparaginase 2                                        281   2e-91   Phaseolus vulgaris [French bean]
ref|XP_004291067.1|  PREDICTED: probable isoaspartyl peptidase/L-...    280   6e-91   Fragaria vesca subsp. vesca
ref|XP_010688589.1|  PREDICTED: probable isoaspartyl peptidase/L-...    280   7e-91   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010061715.1|  PREDICTED: probable isoaspartyl peptidase/L-...    280   1e-90   Eucalyptus grandis [rose gum]
ref|XP_007136713.1|  hypothetical protein PHAVU_009G067800g             280   1e-90   Phaseolus vulgaris [French bean]
ref|XP_010927509.1|  PREDICTED: probable isoaspartyl peptidase/L-...    277   1e-89   Elaeis guineensis
ref|XP_008796480.1|  PREDICTED: probable isoaspartyl peptidase/L-...    275   5e-89   Phoenix dactylifera
ref|XP_010932217.1|  PREDICTED: probable isoaspartyl peptidase/L-...    275   9e-89   Elaeis guineensis
ref|XP_003525910.1|  PREDICTED: probable isoaspartyl peptidase/L-...    275   1e-88   Glycine max [soybeans]
gb|KHN04475.1|  Putative isoaspartyl peptidase/L-asparaginase 2         274   2e-88   Glycine soja [wild soybean]
ref|XP_003603098.1|  L-asparaginase                                     273   5e-88   Medicago truncatula
gb|AES62108.2|  isoaspartyl peptidase/L-asparaginase                    271   2e-87   Medicago truncatula
ref|XP_008796739.1|  PREDICTED: LOW QUALITY PROTEIN: probable iso...    271   3e-87   
ref|NP_001276238.1|  probable isoaspartyl peptidase/L-asparaginas...    268   3e-86   
ref|XP_009413335.1|  PREDICTED: probable isoaspartyl peptidase/L-...    267   1e-85   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAC09349.1|  H0212B02.13                                            267   1e-85   Oryza sativa [red rice]
gb|EAZ32226.1|  hypothetical protein OsJ_16431                          266   2e-85   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04504.1|  OSJNBb0059K02.14                                       266   2e-85   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008452604.1|  PREDICTED: probable isoaspartyl peptidase/L-...    263   4e-84   Cucumis melo [Oriental melon]
ref|XP_004977053.1|  PREDICTED: probable isoaspartyl peptidase/L-...    263   5e-84   Setaria italica
gb|AAG28786.1|AF308474_1  asparaginase                                  262   1e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004141273.1|  PREDICTED: probable isoaspartyl peptidase/L-...    261   2e-83   Cucumis sativus [cucumbers]
ref|XP_003580704.1|  PREDICTED: probable isoaspartyl peptidase/L-...    261   3e-83   Brachypodium distachyon [annual false brome]
ref|XP_009418804.1|  PREDICTED: probable isoaspartyl peptidase/L-...    260   4e-83   
ref|XP_002447227.1|  hypothetical protein SORBIDRAFT_06g030910          260   5e-83   Sorghum bicolor [broomcorn]
ref|XP_008668775.1|  PREDICTED: probable isoaspartyl peptidase/L-...    260   8e-83   
dbj|BAJ94612.1|  predicted protein                                      259   9e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ99727.1|  predicted protein                                      258   3e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003591857.1|  L-asparaginase                                     258   3e-82   
gb|AGV54259.1|  isoaspartyl peptidase/L-asparaginase 2                  254   1e-80   Phaseolus vulgaris [French bean]
ref|XP_006652926.1|  PREDICTED: probable isoaspartyl peptidase/L-...    250   5e-79   Oryza brachyantha
gb|EMT11957.1|  Putative isoaspartyl peptidase/L-asparaginase 2         247   1e-77   
gb|ABK22246.1|  unknown                                                 246   5e-77   Picea sitchensis
emb|CAK22360.1|  L-asparaginase                                         242   2e-75   Pinus sylvestris [Scotch pine]
ref|XP_006828602.1|  hypothetical protein AMTR_s00129p00062240          233   1e-72   Amborella trichopoda
ref|XP_006855727.1|  hypothetical protein AMTR_s00044p00154340          219   2e-69   
gb|KGN55235.1|  L-asparaginase                                          220   6e-68   Cucumis sativus [cucumbers]
tpg|DAA35670.1|  TPA: L-asparaginase-like family protein                209   4e-65   
gb|KFK23966.1|  hypothetical protein AALP_AAs39002U000300               202   5e-62   Arabis alpina [alpine rockcress]
ref|XP_002266571.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    203   5e-61   Vitis vinifera
ref|XP_006485703.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    196   6e-60   
dbj|BAK02243.1|  predicted protein                                      200   7e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN82634.1|  hypothetical protein VITISV_007448                     199   2e-59   Vitis vinifera
ref|XP_006440815.1|  hypothetical protein CICLE_v10021205mg             199   3e-59   Citrus clementina [clementine]
ref|XP_010546212.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    198   4e-59   Tarenaya hassleriana [spider flower]
gb|KEH32053.1|  isoaspartyl peptidase/L-asparaginase                    199   4e-59   Medicago truncatula
ref|NP_001241157.1|  uncharacterized protein LOC100799400               198   4e-59   Glycine max [soybeans]
ref|XP_008450657.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    197   8e-59   Cucumis melo [Oriental melon]
emb|CDO98550.1|  unnamed protein product                                197   1e-58   Coffea canephora [robusta coffee]
ref|XP_004508653.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    197   2e-58   Cicer arietinum [garbanzo]
gb|EPS61830.1|  hypothetical protein M569_12962                         196   2e-58   Genlisea aurea
ref|XP_006434700.1|  hypothetical protein CICLE_v10001812mg             196   3e-58   
ref|XP_009387638.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    196   5e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO84067.1|  hypothetical protein CISIN_1g020250mg                   194   6e-58   Citrus sinensis [apfelsine]
ref|XP_004135623.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    195   6e-58   Cucumis sativus [cucumbers]
gb|KEH32051.1|  isoaspartyl peptidase/L-asparaginase                    196   6e-58   Medicago truncatula
ref|XP_004166036.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    195   7e-58   
ref|XP_007209366.1|  hypothetical protein PRUPE_ppa008761mg             194   2e-57   Prunus persica
ref|XP_003562316.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    194   2e-57   Brachypodium distachyon [annual false brome]
ref|XP_011086915.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    194   2e-57   Sesamum indicum [beniseed]
ref|NP_196427.1|  asparaginase                                          193   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010257935.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    193   5e-57   Nelumbo nucifera [Indian lotus]
gb|AFK38769.1|  unknown                                                 192   1e-56   Medicago truncatula
ref|XP_007155205.1|  hypothetical protein PHAVU_003G182400g             192   1e-56   Phaseolus vulgaris [French bean]
emb|CAA84367.1|  asparaginase                                           192   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008240074.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    192   2e-56   Prunus mume [ume]
ref|XP_002873339.1|  L-asparaginase                                     191   2e-56   Arabidopsis lyrata subsp. lyrata
sp|P30364.1|ASPG_LUPAN  RecName: Full=Isoaspartyl peptidase/L-asp...    192   2e-56   Lupinus angustifolius
ref|XP_008811641.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    191   2e-56   Phoenix dactylifera
ref|XP_009631666.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    191   2e-56   Nicotiana tomentosiformis
pdb|2GEZ|A  Chain A, Crystal Structure Of Potassium-Independent P...    187   2e-56   Lupinus luteus
ref|XP_006828428.1|  hypothetical protein AMTR_s00060p00098750          186   3e-56   
ref|XP_006399296.1|  hypothetical protein EUTSA_v10014145mg             191   3e-56   Eutrema salsugineum [saltwater cress]
gb|EMT01892.1|  Isoaspartyl peptidase/L-asparaginase                    199   3e-56   
gb|EYU23631.1|  hypothetical protein MIMGU_mgv1a010176mg                191   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_010491430.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    190   6e-56   Camelina sativa [gold-of-pleasure]
emb|CDY21509.1|  BnaC09g47830D                                          190   6e-56   Brassica napus [oilseed rape]
ref|XP_008450655.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    190   8e-56   
ref|XP_010423136.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    190   8e-56   Camelina sativa [gold-of-pleasure]
ref|XP_006289635.1|  hypothetical protein CARUB_v10003195mg             189   9e-56   Capsella rubella
ref|XP_001776678.1|  predicted protein                                  189   1e-55   
ref|XP_009122419.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    189   1e-55   Brassica rapa
ref|XP_011014964.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    189   2e-55   Populus euphratica
ref|XP_001771151.1|  predicted protein                                  189   2e-55   
emb|CDX69978.1|  BnaA10g23270D                                          189   2e-55   
gb|ACN32623.1|  L-asparaginase                                          187   2e-55   Withania somnifera [ashwagandha]
ref|XP_004241610.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    188   2e-55   Solanum lycopersicum
ref|XP_004299276.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    189   3e-55   Fragaria vesca subsp. vesca
ref|XP_010452785.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    188   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006376770.1|  hypothetical protein POPTR_0012s06250g             188   4e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002514609.1|  l-asparaginase, putative                           188   4e-55   Ricinus communis
gb|KFK25178.1|  hypothetical protein AALP_AA8G076700                    188   4e-55   Arabis alpina [alpine rockcress]
emb|CDY21508.1|  BnaC09g47840D                                          187   6e-55   Brassica napus [oilseed rape]
ref|XP_009122418.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    187   6e-55   Brassica rapa
ref|XP_006345098.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    187   7e-55   Solanum tuberosum [potatoes]
ref|XP_010678369.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    187   8e-55   Beta vulgaris subsp. vulgaris [field beet]
sp|Q9ZSD6.1|ASPG_LUPLU  RecName: Full=Isoaspartyl peptidase/L-asp...    187   8e-55   Lupinus luteus
gb|KJB51088.1|  hypothetical protein B456_008G200400                    187   1e-54   Gossypium raimondii
gb|KJB51085.1|  hypothetical protein B456_008G200400                    187   1e-54   Gossypium raimondii
gb|KJB51084.1|  hypothetical protein B456_008G200400                    187   1e-54   Gossypium raimondii
ref|XP_006650293.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    187   1e-54   Oryza brachyantha
ref|XP_010906197.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    187   2e-54   
ref|XP_002990172.1|  hypothetical protein SELMODRAFT_160700             186   2e-54   Selaginella moellendorffii
ref|XP_008374666.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    186   3e-54   Malus domestica [apple tree]
ref|XP_010101648.1|  Isoaspartyl peptidase/L-asparaginase 1             186   4e-54   Morus notabilis
ref|XP_004982477.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    186   5e-54   Setaria italica
gb|KJB39962.1|  hypothetical protein B456_007G040100                    185   5e-54   Gossypium raimondii
ref|XP_010031115.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    185   5e-54   Eucalyptus grandis [rose gum]
ref|XP_008240025.1|  PREDICTED: LOW QUALITY PROTEIN: isoaspartyl ...    185   6e-54   Prunus mume [ume]
ref|XP_009596886.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    184   8e-54   Nicotiana tomentosiformis
sp|P50288.1|ASPG_LUPAL  RecName: Full=Isoaspartyl peptidase/L-asp...    185   9e-54   Lupinus albus
ref|XP_010031103.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    184   9e-54   Eucalyptus grandis [rose gum]
gb|KDP31384.1|  hypothetical protein JCGZ_11760                         184   1e-53   Jatropha curcas
ref|NP_001050607.1|  Os03g0597600                                       184   1e-53   
ref|XP_008374665.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    184   1e-53   
gb|EEC75690.1|  hypothetical protein OsI_12500                          184   1e-53   Oryza sativa Indica Group [Indian rice]
gb|KHF98766.1|  hypothetical protein F383_16974                         184   2e-53   Gossypium arboreum [tree cotton]
ref|XP_009346253.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    184   2e-53   Pyrus x bretschneideri [bai li]
ref|NP_001149875.1|  transposon protein                                 184   2e-53   Zea mays [maize]
gb|AAO59983.1|  putative L-asparaginase                                 182   5e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001753813.1|  predicted protein                                  182   5e-53   
ref|XP_009346265.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    182   5e-53   Pyrus x bretschneideri [bai li]
ref|XP_007037644.1|  N-terminal nucleophile aminohydrolases (Ntn ...    182   6e-53   Theobroma cacao [chocolate]
ref|XP_009785994.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    182   7e-53   Nicotiana sylvestris
ref|XP_010232895.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    182   1e-52   
ref|XP_002992515.1|  hypothetical protein SELMODRAFT_236523             181   2e-52   Selaginella moellendorffii
gb|KJB51090.1|  hypothetical protein B456_008G200400                    181   3e-52   Gossypium raimondii
gb|KJB51083.1|  hypothetical protein B456_008G200400                    181   3e-52   Gossypium raimondii
ref|XP_004236074.1|  PREDICTED: isoaspartyl peptidase/L-asparaginase    180   4e-52   Solanum lycopersicum
gb|EMS66458.1|  putative isoaspartyl peptidase/L-asparaginase 2         168   2e-49   Triticum urartu
sp|P30362.1|ASPG_LUPAR  RecName: Full=Isoaspartyl peptidase/L-asp...    169   5e-48   Lupinus arboreus
ref|XP_004982478.1|  PREDICTED: isoaspartyl peptidase/L-asparagin...    159   5e-44   
ref|XP_011074409.1|  PREDICTED: probable isoaspartyl peptidase/L-...    155   2e-43   Sesamum indicum [beniseed]
ref|XP_004352518.1|  asparaginase                                       158   3e-43   Acanthamoeba castellanii str. Neff
ref|XP_007210207.1|  hypothetical protein PRUPE_ppa016260mg             155   6e-43   
gb|KJB29446.1|  hypothetical protein B456_005G101000                    150   2e-41   Gossypium raimondii
gb|KJB63905.1|  hypothetical protein B456_010G023000                    148   1e-40   Gossypium raimondii
gb|ABF91922.1|  asparaginase family protein                             150   2e-40   Myxococcus xanthus DK 1622
ref|XP_009406526.1|  PREDICTED: probable isoaspartyl peptidase/L-...    148   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_020478257.1|  asparaginase                                       150   3e-40   Myxococcus xanthus
gb|EMT27934.1|  Putative isoaspartyl peptidase/L-asparaginase 2         145   4e-39   
ref|WP_013935658.1|  asparaginase                                       147   6e-39   Myxococcus macrosporus
gb|EMS61236.1|  Isoaspartyl peptidase/L-asparaginase                    142   4e-37   Triticum urartu
ref|WP_002635219.1|  asparaginase                                       141   1e-36   Myxococcus hansupus
ref|XP_006856300.1|  hypothetical protein AMTR_s00047p00122380          139   1e-36   
ref|WP_019515461.1|  hypothetical protein                               139   2e-36   Sphingomonas sp. Mn802worker
ref|WP_002629379.1|  Isoaspartyl aminopeptidase                         140   2e-36   Cystobacter fuscus
ref|WP_008597184.1|  isoaspartyl peptidase                              138   3e-36   Nitratireductor pacificus
ref|WP_012285180.1|  asparaginase                                       137   2e-35   Caulobacter sp. K31
ref|WP_015346819.1|  asparaginase family protein                        137   2e-35   Myxococcus stipitatus
ref|WP_022824798.1|  asparaginase                                       136   4e-35   Hymenobacter norwichensis
gb|KCW83769.1|  hypothetical protein EUGRSUZ_B00638                     135   4e-35   Eucalyptus grandis [rose gum]
gb|KCW83768.1|  hypothetical protein EUGRSUZ_B00637                     138   5e-35   Eucalyptus grandis [rose gum]
ref|WP_014681491.1|  asparaginase                                       135   1e-34   Solitalea canadensis
ref|WP_035017313.1|  asparaginase                                       135   1e-34   Caulobacter vibrioides
gb|ENZ81746.1|  asparaginase                                            135   2e-34   Caulobacter vibrioides OR37
ref|WP_036514883.1|  asparaginase                                       135   2e-34   Oceanicaulis sp. HL-87
ref|WP_036969594.1|  isoaspartyl peptidase                              134   2e-34   Pseudoalteromonas
ref|WP_038129740.1|  isoaspartyl peptidase                              134   3e-34   
ref|WP_007139073.1|  asparaginase                                       134   3e-34   Flavobacterium frigoris
ref|WP_026947825.1|  isoaspartyl peptidase                              134   3e-34   Algoriphagus marincola
ref|WP_007674727.1|  asparaginase                                       133   5e-34   Caulobacter sp. AP07
ref|WP_014855981.1|  asparaginase                                       133   6e-34   Melioribacter roseus
gb|KIX22183.1|  isoaspartyl peptidase                                   133   6e-34   Flavobacterium sp. 316
ref|WP_028786727.1|  hypothetical protein                               133   8e-34   Terrimonas ferruginea
ref|WP_008666718.1|  isoaspartyl aminopeptidase                         134   1e-33   Rhodopirellula europaea
ref|WP_009099500.1|  peptidase T2 asparaginase 2                        134   1e-33   Rhodopirellula sp. SWK7
ref|WP_034813444.1|  asparaginase                                       132   1e-33   Hyphomonas sp. L-53-1-40
ref|WP_033023212.1|  isoaspartyl peptidase                              132   1e-33   Pseudoalteromonas sp. Bsw20308
ref|WP_043406432.1|  asparaginase                                       133   1e-33   Archangium violaceum
ref|WP_012566613.1|  asparaginase                                       132   1e-33   Rhodospirillum centenum
ref|WP_008172390.1|  asparaginase                                       132   1e-33   Pseudoalteromonas sp. BSi20652
ref|WP_008222778.1|  asparaginase                                       132   1e-33   Rheinheimera nanhaiensis
ref|WP_008991605.1|  asparaginase                                       132   1e-33   Galbibacter marinus
ref|WP_040006961.1|  isoaspartyl peptidase                              132   2e-33   Fibrisoma limi
emb|CCH56729.1|  beta-aspartyl-peptidase (threonine type)               132   2e-33   Fibrisoma limi BUZ 3
ref|WP_024283520.1|  isoaspartyl peptidase                              132   2e-33   Algoriphagus marincola
ref|WP_007339179.1|  asparaginase family protein                        133   3e-33   Rhodopirellula baltica
gb|EKS14063.1|  beta-aspartyl-peptidase                                 132   3e-33   
ref|WP_010161672.1|  asparaginase                                       130   3e-33   Sphingomonas sp. PAMC 26617
ref|WP_039963566.1|  asparaginase                                       132   4e-33   Rhodopirellula europaea
gb|EMB13625.1|  Asparaginase family protein                             132   4e-33   Rhodopirellula europaea 6C
ref|WP_036968277.1|  isoaspartyl peptidase                              131   4e-33   Providencia alcalifaciens
ref|WP_006658094.1|  asparaginase                                       131   4e-33   Providencia alcalifaciens
ref|WP_010214369.1|  asparaginase                                       130   4e-33   Sphingomonas sp. PAMC 26621
ref|WP_033038482.1|  isoaspartyl peptidase                              131   5e-33   Pseudoalteromonas
gb|KDC55075.1|  isoaspartyl peptidase                                   130   5e-33   Pseudoalteromonas sp. S3431
ref|WP_004242876.1|  asparaginase                                       130   5e-33   Proteus
ref|WP_008487330.1|  asparaginase                                       130   5e-33   Idiomarina xiamenensis
ref|WP_033015518.1|  isoaspartyl peptidase                              130   5e-33   Pseudoalteromonas sp. BSi20495
ref|WP_039487338.1|  MULTISPECIES: isoaspartyl peptidase                130   6e-33   Pseudoalteromonas distincta
ref|WP_011121656.1|  asparaginase                                       132   6e-33   Rhodopirellula baltica
ref|WP_022699204.1|  asparaginase                                       130   6e-33   Euryhalocaulis caribicus
ref|WP_007326981.1|  asparaginase                                       132   6e-33   Rhodopirellula baltica
ref|WP_036971955.1|  isoaspartyl peptidase                              130   7e-33   Proteus mirabilis
ref|WP_038554056.1|  isoaspartyl peptidase                              130   8e-33   Draconibacterium orientale
ref|WP_027585210.1|  hypothetical protein                               130   8e-33   Prolixibacter bellariivorans
ref|WP_002610750.1|  asparaginase                                       131   9e-33   
ref|WP_033031341.1|  isoaspartyl peptidase                              130   9e-33   Pseudoalteromonas fuliginea
gb|ADO69581.1|  Asparaginase family protein                             131   1e-32   Stigmatella aurantiaca DW4/3-1
ref|WP_026759123.1|  isoaspartyl peptidase                              129   1e-32   Sediminimonas qiaohouensis
gb|KDC49414.1|  isoaspartyl peptidase                                   130   1e-32   Pseudoalteromonas fuliginea
ref|WP_013480754.1|  peptidase T                                        132   1e-32   Asticcacaulis excentricus
dbj|GAA79196.1|  beta-aspartyl-peptidase                                130   1e-32   Pseudoalteromonas sp. BSi20495
ref|WP_029752414.1|  isoaspartyl peptidase                              129   1e-32   Pseudoalteromonas
ref|WP_029753367.1|  isoaspartyl peptidase                              129   2e-32   Pseudoalteromonas
ref|WP_028379843.1|  asparaginase                                       129   2e-32   Legionella cherrii
ref|WP_023582143.1|  exported L-asparaginase                            129   2e-32   Proteus hauseri
ref|WP_041374310.1|  asparaginase                                       129   2e-32   
ref|WP_014066800.1|  asparaginase                                       129   2e-32   Rhodothermus marinus
ref|XP_005705424.1|  L-asparaginase                                     129   2e-32   Galdieria sulphuraria
gb|ACG79241.1|  asparaginase family protein                             129   2e-32   Phenylobacterium zucineum HLK1
ref|WP_044625442.1|  isoaspartyl peptidase                              130   2e-32   Tamlana nanhaiensis
ref|XP_003284830.1|  hypothetical protein DICPUDRAFT_86450              129   2e-32   Dictyostelium purpureum
ref|WP_022822368.1|  asparaginase                                       130   2e-32   Hymenobacter norwichensis
gb|ACN73030.1|  COSII_At3g16150                                         121   3e-32   Solanum cheesmaniae
dbj|GAM97716.1|  isoaspartyl aminopeptidase                             129   3e-32   alpha proteobacterium U9-1i
ref|WP_035322351.1|  asparaginase                                       128   3e-32   Dyella
ref|WP_014509429.1|  asparaginase                                       129   3e-32   
ref|WP_017827805.1|  asparaginase                                       129   3e-32   Proteus mirabilis
ref|WP_016707502.1|  asparaginase                                       129   3e-32   Pseudoalteromonas
ref|WP_010555079.1|  MULTISPECIES: asparaginase                         129   3e-32   
ref|WP_036951074.1|  isoaspartyl peptidase                              129   3e-32   
ref|WP_007581062.1|  asparaginase                                       129   3e-32   
ref|WP_036894904.1|  isoaspartyl peptidase                              129   3e-32   
ref|WP_036936784.1|  isoaspartyl peptidase                              129   3e-32   
ref|WP_034246514.1|  isoaspartyl peptidase                              129   4e-32   
ref|WP_035979508.1|  asparaginase                                       127   4e-32   
ref|WP_044400909.1|  isoaspartyl peptidase                              128   4e-32   
ref|WP_012844109.1|  asparaginase                                       128   5e-32   
ref|WP_013869538.1|  asparaginase                                       129   5e-32   
ref|WP_025665825.1|  isoaspartyl peptidase                              128   5e-32   
ref|WP_019386848.1|  hypothetical protein                               128   5e-32   
ref|WP_026359875.1|  asparaginase                                       127   5e-32   
ref|WP_022944031.1|  asparaginase                                       128   5e-32   
ref|WP_038268736.1|  isoaspartyl peptidase                              128   5e-32   
ref|WP_028786895.1|  isoaspartyl peptidase                              127   6e-32   
ref|WP_029315489.1|  L-asparaginase                                     127   6e-32   
ref|WP_029685647.1|  isoaspartyl peptidase                              127   6e-32   
ref|WP_017980664.1|  hypothetical protein                               127   7e-32   
ref|WP_008611744.1|  asparaginase                                       128   7e-32   
gb|EKJ99939.1|  peptidase T2 asparaginase 2                             129   8e-32   
ref|WP_034729656.1|  isoaspartyl peptidase                              127   8e-32   
ref|WP_037201211.1|  asparaginase                                       129   8e-32   
ref|WP_033477852.1|  asparaginase                                       124   8e-32   
ref|WP_024769959.1|  isoaspartyl peptidase                              128   8e-32   
ref|WP_039855112.1|  isoaspartyl peptidase                              127   9e-32   
ref|WP_040606025.1|  hypothetical protein                               127   9e-32   
ref|WP_038665086.1|  asparaginase                                       127   1e-31   
ref|WP_035385497.1|  isoaspartyl peptidase                              127   1e-31   
ref|WP_029035777.1|  isoaspartyl peptidase                              127   1e-31   
ref|WP_027879689.1|  isoaspartyl peptidase                              127   1e-31   
ref|WP_026443156.1|  asparaginase                                       127   1e-31   
ref|WP_021698251.1|  isoaspartyl aminopeptidase / Asp-X dipeptidase     127   1e-31   
gb|EFB72147.1|  asparaginase                                            127   1e-31   
ref|WP_042486626.1|  asparaginase                                       126   1e-31   
ref|WP_019028649.1|  asparaginase                                       127   1e-31   
ref|WP_040966178.1|  asparaginase                                       127   1e-31   
ref|WP_006457273.1|  L-asparaginase                                     126   1e-31   
ref|WP_042056129.1|  asparaginase                                       126   1e-31   
gb|KCZ93272.1|  putative asparaginase                                   127   2e-31   
ref|WP_043459475.1|  asparaginase                                       126   2e-31   
ref|WP_039280308.1|  asparaginase                                       126   2e-31   
ref|WP_014111991.1|  isoaspartyl peptidase                              126   2e-31   
ref|WP_035595543.1|  asparaginase                                       126   2e-31   
gb|ACN73040.1|  COSII_At3g16150                                         119   2e-31   
ref|WP_008113022.1|  MULTISPECIES: asparaginase                         126   2e-31   
ref|WP_036954298.1|  isoaspartyl peptidase                              126   2e-31   
ref|WP_024939027.1|  asparaginase                                       126   2e-31   
gb|ACI52961.1|  peptidase T2 asparaginase 2                             126   2e-31   
ref|WP_040940369.1|  asparaginase                                       126   2e-31   
ref|WP_035708700.1|  asparaginase                                       126   2e-31   
ref|WP_020912862.1|  Peptidase T2, asparaginase 2                       126   2e-31   
ref|WP_035464286.1|  isoaspartyl peptidase                              126   2e-31   
ref|WP_039517670.1|  asparaginase                                       126   2e-31   
dbj|GAJ27960.1|  isoaspartyl peptidase/peptidase T2/asparaginase 2      127   2e-31   
ref|WP_010388498.1|  asparaginase                                       126   2e-31   
ref|WP_007235857.1|  asparaginase                                       126   2e-31   
ref|WP_033083269.1|  isoaspartyl peptidase                              126   3e-31   
ref|WP_029772489.1|  isoaspartyl peptidase                              126   3e-31   
ref|WP_013465240.1|  MULTISPECIES: asparaginase                         126   3e-31   
ref|WP_017462721.1|  hypothetical protein                               126   3e-31   
ref|WP_028835034.1|  MULTISPECIES: isoaspartyl peptidase                126   3e-31   
ref|WP_019961999.1|  hypothetical protein                               126   3e-31   
ref|WP_015551865.1|  L-asparaginase                                     125   3e-31   
ref|WP_043359343.1|  hypothetical protein                               125   3e-31   
ref|WP_041878371.1|  isoaspartyl peptidase                              126   3e-31   
gb|ADN75645.1|  peptidase T2 asparaginase 2                             126   3e-31   
ref|WP_039529035.1|  asparaginase                                       125   3e-31   
ref|WP_041258700.1|  isoaspartyl peptidase                              126   3e-31   
ref|WP_023902160.1|  asparaginase precursor                             125   3e-31   
ref|WP_041251581.1|  isoaspartyl peptidase                              125   3e-31   
ref|WP_027411612.1|  isoaspartyl peptidase                              126   4e-31   
ref|WP_002961445.1|  asparaginase                                       125   4e-31   
ref|WP_035564370.1|  isoaspartyl peptidase                              125   4e-31   
ref|WP_033092416.1|  isoaspartyl peptidase                              125   4e-31   
ref|WP_011035484.1|  asparaginase                                       125   4e-31   
ref|WP_029286785.1|  isoaspartyl peptidase                              125   4e-31   
ref|WP_016944691.1|  asparaginase                                       125   4e-31   
ref|WP_042596737.1|  asparaginase                                       125   4e-31   
ref|WP_024034216.1|  asparaginase                                       125   5e-31   
ref|WP_039972476.1|  isoaspartyl peptidase                              125   5e-31   
ref|WP_011327829.1|  asparaginase                                       125   5e-31   
ref|WP_028657374.1|  asparaginase                                       125   5e-31   
ref|WP_029750625.1|  isoaspartyl peptidase                              125   5e-31   
ref|WP_044559102.1|  asparaginase                                       125   5e-31   
ref|WP_026942775.1|  hypothetical protein                               125   5e-31   
ref|WP_037536116.1|  asparaginase                                       125   5e-31   
ref|WP_031527268.1|  isoaspartyl peptidase                              125   5e-31   
ref|WP_013929901.1|  asparaginase                                       125   5e-31   
gb|KGK58524.1|  asparaginase                                            125   5e-31   
ref|WP_017010453.1|  hypothetical protein                               124   6e-31   
ref|WP_036982238.1|  isoaspartyl peptidase                              125   6e-31   
ref|WP_027127568.1|  isoaspartyl peptidase                              125   6e-31   
dbj|BAK67233.1|  isoaspartyl peptidase                                  125   6e-31   
gb|ENN97369.1|  L-asparaginase                                          125   6e-31   
ref|WP_038615622.1|  asparaginase                                       125   6e-31   
ref|WP_024592370.1|  isoaspartyl peptidase                              125   6e-31   
ref|WP_026166607.1|  isoaspartyl peptidase                              125   7e-31   
ref|WP_025145785.1|  isoaspartyl peptidase                              125   7e-31   
ref|WP_034789999.1|  asparaginase                                       125   7e-31   
ref|WP_040152191.1|  asparaginase                                       123   7e-31   
ref|WP_034955854.1|  asparaginase                                       125   7e-31   
ref|WP_014393966.1|  asparaginase                                       126   7e-31   
ref|WP_043579330.1|  isoaspartyl peptidase                              124   7e-31   
ref|WP_022701953.1|  asparaginase                                       125   8e-31   
ref|WP_008269736.1|  asparaginase                                       125   8e-31   
ref|WP_041249860.1|  asparaginase                                       124   8e-31   
ref|WP_028883974.1|  isoaspartyl peptidase                              124   8e-31   
ref|WP_041399821.1|  hypothetical protein                               124   8e-31   
ref|WP_004156834.1|  isoaspartyl peptidase                              124   8e-31   
gb|ADY60562.1|  Beta-aspartyl-peptidase                                 124   8e-31   
emb|CBX80145.1|  putative asparaginase                                  124   9e-31   
ref|WP_004911503.1|  exported L-asparaginase                            124   9e-31   
ref|WP_043316839.1|  isoaspartyl peptidase                              125   9e-31   
ref|WP_034827162.1|  asparaginase                                       124   1e-30   
ref|WP_023401538.1|  asparaginase                                       124   1e-30   
gb|KEO86401.1|  asparaginase                                            125   1e-30   
ref|WP_022557920.1|  Asparaginase                                       124   1e-30   
gb|KJF43322.1|  isoaspartyl peptidase                                   124   1e-30   
ref|WP_022826191.1|  asparaginase                                       125   1e-30   
ref|WP_008236582.1|  asparaginase                                       124   1e-30   
gb|ETZ19905.1|  asparaginase                                            124   1e-30   
ref|WP_038017471.1|  isoaspartyl peptidase                              124   1e-30   
gb|EFF43435.1|  asparaginase                                            124   1e-30   
ref|WP_029919270.1|  isoaspartyl peptidase                              124   1e-30   
ref|WP_014089020.1|  asparaginase                                       124   1e-30   
ref|WP_037089882.1|  asparaginase                                       124   2e-30   
ref|WP_024303192.1|  isoaspartyl peptidase                              123   2e-30   
ref|WP_006449815.1|  asparaginase                                       124   2e-30   
gb|AAM35140.1|  asparaginase                                            123   2e-30   
ref|WP_011708661.1|  asparaginase                                       123   2e-30   
ref|WP_024107744.1|  isoaspartyl peptidase                              124   2e-30   
ref|WP_039479951.1|  isoaspartyl peptidase                              124   2e-30   
dbj|GAL14163.1|  isoaspartyl aminopeptidase                             123   2e-30   
ref|WP_033568050.1|  isoaspartyl peptidase                              123   2e-30   
ref|WP_029279047.1|  isoaspartyl peptidase                              124   2e-30   
gb|ACN73046.1|  COSII_At3g16150                                         117   2e-30   
ref|WP_007647161.1|  Isoaspartyl aminopeptidase                         124   2e-30   
ref|WP_004169308.1|  putative asparaginase                              123   2e-30   
ref|WP_035591802.1|  MULTISPECIES: asparaginase                         124   2e-30   
emb|CCG99639.1|  beta-aspartyl-peptidase (threonine type)               125   2e-30   
ref|WP_039515634.1|  asparaginase                                       124   2e-30   
dbj|GAN45271.1|  asparaginase                                           123   2e-30   
ref|WP_019464743.1|  asparaginase                                       123   2e-30   
gb|ACN73048.1|  COSII_At3g16150                                         116   2e-30   
ref|WP_024565815.1|  isoaspartyl peptidase                              123   2e-30   
dbj|GAE56417.1|  hypothetical protein XPR_3052                          123   2e-30   
ref|WP_003488951.1|  MULTISPECIES: asparaginase                         123   2e-30   
ref|WP_013663838.1|  asparaginase                                       124   2e-30   
emb|CAP57081.1|  putative L-asparaginase precursor                      124   2e-30   
gb|ACN73047.1|  COSII_At3g16150                                         116   2e-30   
ref|WP_033076433.1|  isoaspartyl peptidase                              123   3e-30   
ref|WP_033485853.1|  asparaginase                                       123   3e-30   
ref|WP_016902022.1|  asparaginase                                       123   3e-30   
gb|ACN73039.1|  COSII_At3g16150                                         116   3e-30   
ref|WP_015462754.1|  MULTISPECIES: asparaginase                         123   3e-30   
ref|WP_042675825.1|  asparaginase                                       123   3e-30   
ref|WP_027273935.1|  isoaspartyl peptidase                              123   3e-30   
ref|WP_007506995.1|  asparaginase                                       123   3e-30   
ref|WP_015671613.1|  asparaginase                                       123   3e-30   
ref|WP_008897340.1|  asparaginase                                       123   3e-30   
gb|KGK00177.1|  Beta-aspartyl-peptidase                                 123   3e-30   
ref|WP_039570199.1|  asparaginase                                       123   3e-30   
ref|WP_010654453.1|  asparaginase                                       122   3e-30   
dbj|GAM77174.1|  isoaspartyl aminopeptidase                             120   3e-30   
ref|WP_029418092.1|  asparaginase                                       123   3e-30   
ref|WP_039730979.1|  asparaginase                                       123   3e-30   
ref|WP_034848059.1|  isoaspartyl peptidase                              123   3e-30   
ref|WP_019944047.1|  asparaginase                                       124   3e-30   
gb|KGT50942.1|  asparaginase                                            123   3e-30   
ref|WP_034869786.1|  isoaspartyl peptidase                              123   3e-30   
ref|WP_042861553.1|  isoaspartyl peptidase                              123   3e-30   
gb|KGT08938.1|  isoaspartyl peptidase                                   123   3e-30   
ref|WP_033478634.1|  asparaginase                                       123   3e-30   
ref|WP_011045447.1|  asparaginase                                       123   3e-30   
ref|WP_005928589.1|  asparaginase                                       123   3e-30   
ref|WP_009091805.1|  asparaginase                                       123   3e-30   
gb|EGD15105.1|  asparaginase                                            123   3e-30   
ref|WP_034742359.1|  asparaginase                                       123   3e-30   
ref|WP_038912839.1|  isoaspartyl peptidase                              123   3e-30   
ref|XP_005978139.1|  PREDICTED: putative isoaspartyl peptidase/L-...    123   3e-30   
ref|WP_038920578.1|  isoaspartyl peptidase                              122   3e-30   
ref|WP_019674186.1|  hypothetical protein                               123   3e-30   
ref|WP_029818286.1|  asparaginase                                       123   3e-30   
ref|WP_031420685.1|  asparaginase                                       123   3e-30   
ref|WP_027082000.1|  asparaginase                                       123   4e-30   
ref|WP_022972115.1|  asparaginase                                       123   4e-30   
ref|WP_026094699.1|  peptidase T                                        125   4e-30   
ref|WP_021347999.1|  asparaginase                                       123   4e-30   
ref|WP_019234302.1|  asparaginase                                       122   4e-30   
ref|WP_042083700.1|  hypothetical protein                               122   4e-30   
ref|WP_020856646.1|  isoaspartyl peptidase                              122   4e-30   
ref|WP_006792344.1|  asparaginase                                       123   4e-30   
ref|WP_022612615.1|  Isoaspartyl peptidase                              122   4e-30   
ref|WP_036195963.1|  asparaginase                                       122   4e-30   
ref|WP_021585728.1|  asparaginase                                       122   4e-30   
gb|KCZ83714.1|  putative asparaginase                                   122   5e-30   
ref|WP_008129776.1|  asparaginase                                       123   5e-30   
ref|WP_035552402.1|  asparaginase                                       122   5e-30   
ref|WP_027836318.1|  asparaginase                                       122   5e-30   
ref|WP_039341409.1|  isoaspartyl peptidase                              122   5e-30   
ref|WP_033737675.1|  isoaspartyl peptidase                              122   5e-30   
ref|WP_039578634.1|  asparaginase                                       122   5e-30   
dbj|GAL88905.1|  isoaspartyl aminopeptidase                             122   5e-30   
ref|WP_012525549.1|  asparaginase                                       122   6e-30   
ref|WP_010381695.1|  asparaginase                                       122   6e-30   
ref|WP_034482127.1|  isoaspartyl peptidase                              122   6e-30   
ref|WP_029218386.1|  asparaginase                                       122   6e-30   
ref|WP_010557558.1|  asparaginase                                       122   6e-30   
ref|WP_039036716.1|  isoaspartyl peptidase                              122   6e-30   
ref|WP_008637826.1|  asparaginase                                       122   6e-30   
ref|WP_022545686.1|  hypothetical protein                               122   6e-30   
ref|WP_038902967.1|  isoaspartyl peptidase                              122   6e-30   
ref|WP_011345966.1|  asparaginase                                       122   6e-30   
ref|WP_040487152.1|  isoaspartyl peptidase                              122   7e-30   
ref|WP_042178388.1|  isoaspartyl peptidase                              122   7e-30   
ref|WP_024373075.1|  isoaspartyl peptidase                              122   7e-30   
ref|WP_022599729.1|  Isoaspartyl peptidase                              122   7e-30   
ref|WP_041676669.1|  asparaginase                                       122   7e-30   
ref|WP_020336402.1|  hypothetical protein                               122   7e-30   
ref|WP_004399884.1|  peptidase                                          122   7e-30   



>ref|XP_009774504.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Nicotiana 
sylvestris]
Length=326

 Score =   301 bits (770),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQE+AK LLTRCLN+GISALRSSLPAIDVVELVVRELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEKAKQLLTRCLNIGISALRSSLPAIDVVELVVRELETDPI  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSGIT VKNP+SLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTANGTVEMEASIMDGDGRRCGAVSGITTVKNPISLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFAKQQGVEMA+NDYFITEDNVGMLKLAKEA  IL+D
Sbjct  124  GAEEFAKQQGVEMADNDYFITEDNVGMLKLAKEANTILYD  163



>ref|XP_009586844.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Nicotiana 
tomentosiformis]
Length=326

 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCLN+GISALRSSLPAIDVVELVV+ELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKQLLTRCLNIGISALRSSLPAIDVVELVVKELETDPI  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSGIT VKNP+SLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTANGTVEMEASIMDGDGRRCGAVSGITTVKNPISLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFAKQQGVEM +NDYFITEDNVGMLKLAKEA  IL+D
Sbjct  124  GAEEFAKQQGVEMVDNDYFITEDNVGMLKLAKEANTILYD  163



>ref|XP_010270964.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Nelumbo 
nucifera]
Length=329

 Score =   298 bits (763),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQE+AK LLTRCLNLGISALRSSLPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPQERQEQAKQLLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPRRRCGAVSGLTTVKNPVSLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ EN+YFITEDNVGMLKLAKEA  I+FD
Sbjct  124  GAEEFARQQGVELVENEYFITEDNVGMLKLAKEANKIVFD  163



>ref|XP_010101665.1| putative isoaspartyl peptidase/L-asparaginase 2 [Morus notabilis]
 gb|EXB89231.1| putative isoaspartyl peptidase/L-asparaginase 2 [Morus notabilis]
Length=326

 Score =   296 bits (758),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLTRCLNLGISALRS+LPAIDVVELVVRELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTRCLNLGISALRSNLPAIDVVELVVRELETDPI  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT +GTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEQGTVEMEASIMDGQKRRCGAVSGVTTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ +N YFIT++NVGMLKLAKEAK ILFD
Sbjct  124  GAEEFARQQGVEVVDNKYFITKENVGMLKLAKEAKTILFD  163



>ref|XP_004238125.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Solanum 
lycopersicum]
Length=325

 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ++AK LLTRCLN+GISALRSSLPAIDVVELVVRELE+DPL
Sbjct  4    WAIAVHGGAGVDPNLPDERQQQAKQLLTRCLNIGISALRSSLPAIDVVELVVRELESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSGI+ VKNP+SLARLVMD+SPHSYL FS
Sbjct  64   FNSGRGSALTANGTVEMEASIMDGDGRRCGAVSGISTVKNPISLARLVMDKSPHSYLGFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFAKQQGVEM +N+YFITEDNVGMLKLAKEA  ILFD
Sbjct  124  GAEEFAKQQGVEMVDNEYFITEDNVGMLKLAKEANTILFD  163



>ref|XP_006354842.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Solanum tuberosum]
Length=325

 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ++AK LLTRCLN+GISALRSSLPAIDVVELVVRELE+DPL
Sbjct  4    WAIAVHGGAGVDPNLPAERQKQAKELLTRCLNIGISALRSSLPAIDVVELVVRELESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSGI+ VKNP+SLARL+MD+SPHSYL FS
Sbjct  64   FNSGRGSALTANGTVEMEASIMDGDGRRCGAVSGISTVKNPISLARLIMDKSPHSYLGFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFAKQQGVEM +N+YFITEDNVGMLKLAKEA  ILFD
Sbjct  124  GAEEFAKQQGVEMVDNEYFITEDNVGMLKLAKEANTILFD  163



>gb|EPS68558.1| hypothetical protein M569_06206 [Genlisea aurea]
Length=323

 Score =   295 bits (755),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQEEAK LLTRCLNLGISALR+   A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPMERQEEAKKLLTRCLNLGISALRTGASAVDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT + TVEMEASIMDGHGRRCGAVSG+TKVKNPVSLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTERATVEMEASIMDGHGRRCGAVSGLTKVKNPVSLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FAKQQGVEM ENDYFITE+NV MLKLAKE  +ILFD
Sbjct  124  GAEDFAKQQGVEMVENDYFITEENVAMLKLAKETNSILFD  163



>gb|KJB59852.1| hypothetical protein B456_009G276200 [Gossypium raimondii]
Length=325

 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCL++GISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQEEAKRLLTRCLDIGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPVSLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFAK+QGVEM +N+YFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFAKKQGVEMVDNEYFITEDNVGMLKLAKEANSILFD  163



>dbj|BAC66615.1| L-asparaginase [Glycine max]
Length=325

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLTRCLNLGISAL S+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTRCLNLGISALNSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ +N+YFIT DNVGMLKLAKEA  ILFD
Sbjct  124  GAEEFARQQGVEVVDNEYFITPDNVGMLKLAKEANTILFD  163



>pdb|4PU6|A Chain A, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With K+ Cations
 pdb|4PU6|C Chain C, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With K+ Cations
 pdb|4PV2|A Chain A, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With K+ And 
Na+ Cations
 pdb|4PV2|C Chain C, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With K+ And 
Na+ Cations
 pdb|4PV3|A Chain A, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With Na+ Cations
 pdb|4PV3|C Chain C, Crystal Structure Of Potassium-dependent Plant-type 
L-asparaginase From Phaseolus Vulgaris In Complex With Na+ Cations
Length=197

 Score =   288 bits (738),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP LPLERQEEAK LLTRCLNLGISAL S++PAIDVVELVVRELETDPL
Sbjct  6    WAIAVHGGAGVDPTLPLERQEEAKQLLTRCLNLGISALNSNVPAIDVVELVVRELETDPL  65

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSY+AFS
Sbjct  66   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKSPHSYIAFS  125

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ +N+YF+T DNVGMLKLAKEA  ILFD
Sbjct  126  GAEDFARQQGVEVVDNEYFVTPDNVGMLKLAKEANTILFD  165



>ref|XP_007017138.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
 gb|EOY14363.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
Length=325

 Score =   293 bits (749),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCLN+GISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQEEAKRLLTRCLNIGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPVSLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+ QGVE+ +N+YFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARNQGVELVDNEYFITEDNVGMLKLAKEANSILFD  163



>emb|CDP01286.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   293 bits (749),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQ+EAK LLTRCLNLGISALRSSLPAIDVVELVVR LE+DPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQDEAKQLLTRCLNLGISALRSSLPAIDVVELVVRALESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGVTTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFAKQQGVEM +N+YFITEDNVGMLKLAKEA +IL+D
Sbjct  124  GAEEFAKQQGVEMVDNEYFITEDNVGMLKLAKEANSILYD  163



>ref|XP_003550318.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Glycine max]
Length=326

 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLT CLNLGISAL S+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTHCLNLGISALNSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ +N+YFIT DNVGMLKLAKEA  ILFD
Sbjct  124  GAEEFARQQGVEVVDNEYFITPDNVGMLKLAKEANTILFD  163



>gb|ACF74335.1| L-asparaginase [Arachis hypogaea]
Length=237

 Score =   288 bits (737),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPL RQEEAK LLTRCLNLGISAL S+LPAIDVVEL+VRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLHRQEEAKQLLTRCLNLGISALNSNLPAIDVVELIVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPVSLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ +N+YFIT +NVGMLKLAKEA AILFD
Sbjct  124  GAEDFARQQGVEVVDNEYFITPENVGMLKLAKEANAILFD  163



>ref|NP_001236606.1| L-asparaginase [Glycine max]
 gb|AAM23265.1| L-asparaginase [Glycine max]
Length=326

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLE QEEAK LLTRCLNLGISAL S+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLEHQEEAKQLLTRCLNLGISALNSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ +N+YFIT DNVGMLKLAKEA  ILFD
Sbjct  124  GAEEFARQQGVEVVDNEYFITPDNVGMLKLAKEANTILFD  163



>gb|KDP41685.1| hypothetical protein JCGZ_16092 [Jatropha curcas]
Length=327

 Score =   291 bits (744),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP+LP +RQEEAK LL RCLNLGISALRS+LPAIDVVELVVRELE+DPL
Sbjct  4    WAIAVHGGAGVDPHLPQQRQEEAKQLLARCLNLGISALRSNLPAIDVVELVVRELESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMDRSPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPRRRCGAVSGLTTVKNPISLARLVMDRSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ +NDYFIT++NVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARQQGVELVQNDYFITDENVGMLKLAKEANSILFD  163



>ref|XP_007222672.1| hypothetical protein PRUPE_ppa008583mg [Prunus persica]
 gb|EMJ23871.1| hypothetical protein PRUPE_ppa008583mg [Prunus persica]
Length=326

 Score =   290 bits (743),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLAAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPQRRCGAVSGLTTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ EN+YFITE+NVGMLKLAKEA  ILFD
Sbjct  124  GAEDFARQQGVELVENEYFITEENVGMLKLAKEANTILFD  163



>ref|XP_008220275.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Prunus 
mume]
Length=326

 Score =   290 bits (743),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLAAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ EN+YFITE+NVGMLKLAKEA  ILFD
Sbjct  124  GAEDFARQQGVELVENEYFITEENVGMLKLAKEANTILFD  163



>ref|XP_002320760.2| L-asparaginase family protein [Populus trichocarpa]
 gb|EEE99075.2| L-asparaginase family protein [Populus trichocarpa]
Length=328

 Score =   290 bits (743),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCL +GISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPRERQEEAKKLLTRCLQIGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPVSLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ +NDYFITE+NVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARQQGVELVDNDYFITEENVGMLKLAKEANSILFD  163



>ref|XP_011029297.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Populus 
euphratica]
Length=328

 Score =   290 bits (743),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCL +GISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPRERQEEAKKLLTRCLQIGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPVSLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ +NDYFITE+NVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARQQGVELVDNDYFITEENVGMLKLAKEANSILFD  163



>ref|XP_007160884.1| hypothetical protein PHAVU_001G025000g [Phaseolus vulgaris]
 gb|ESW32878.1| hypothetical protein PHAVU_001G025000g [Phaseolus vulgaris]
Length=326

 Score =   290 bits (742),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLTRCLNLGISAL S++PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTRCLNLGISALNSNVPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSY+AFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKSPHSYIAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ +N+YF+T DNVGMLKLAKEA  ILFD
Sbjct  124  GAEDFARQQGVEVVDNEYFVTPDNVGMLKLAKEANTILFD  163



>gb|AGZ15413.1| L-asparaginase [Phaseolus vulgaris]
Length=326

 Score =   290 bits (742),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLTRCLNLGISAL S++PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTRCLNLGISALNSNVPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSY+AFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKSPHSYIAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ +N+YF+T DNVGMLKLAKEA  ILFD
Sbjct  124  GAEDFARQQGVEVVDNEYFVTPDNVGMLKLAKEANTILFD  163



>emb|CDY28378.1| BnaC01g35480D [Brassica napus]
Length=325

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQE+AK LLTRCLNLGI+ALRS++ AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGIAALRSNVSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE  +NDYF+TEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARKQGVETVDNDYFVTEDNVGMLKLAKEANSILFD  163



>ref|XP_010556428.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Tarenaya 
hassleriana]
Length=328

 Score =   290 bits (741),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCLNLGISAL S+  AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKQLLTRCLNLGISALESNASAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTRRRCGAVSGVTTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE FA+QQGVE+ EN+YFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEAFARQQGVELVENEYFITEDNVGMLKLAKEANSILFD  163



>gb|KHG16262.1| hypothetical protein F383_23830 [Gossypium arboreum]
Length=325

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCL++GISALRS+L AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQEEAKRLLTRCLDIGISALRSNLSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPVSLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFAK+QGVEM +N+YFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFAKKQGVEMVDNEYFITEDNVGMLKLAKEANSILFD  163



>ref|XP_009360082.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Pyrus 
x bretschneideri]
Length=325

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLAAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGPKRRCGAVSGLTTVKNPVSLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ +N+YFITE+NVGMLKLAKEA  ILFD
Sbjct  124  GAEDFARQQGVELVDNEYFITEENVGMLKLAKEANTILFD  163



>ref|XP_009114923.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Brassica 
rapa]
Length=325

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQE+AK LLTRCLNLG++ALRS++ AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGVAALRSNVSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE  +NDYF+TEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARKQGVETVDNDYFVTEDNVGMLKLAKEANSILFD  163



>ref|XP_009146165.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Brassica 
rapa]
 emb|CDX97726.1| BnaA05g23530D [Brassica napus]
Length=324

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQE+AK LLTRCLNLGI+ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGIAALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT +GTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEQGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE+ +NDYF+T+DNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARKQGVEIVDNDYFVTDDNVGMLKLAKEANSILFD  163



>ref|XP_008360985.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Malus 
domestica]
Length=325

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLAAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGPKRRCGAVSGLTTVKNPVSLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ +N+YFITE+NVGMLKLAKEA  ILFD
Sbjct  124  GAEDFARQQGVELVDNEYFITEENVGMLKLAKEANTILFD  163



>ref|XP_002510160.1| l-asparaginase, putative [Ricinus communis]
 gb|EEF52347.1| l-asparaginase, putative [Ricinus communis]
Length=327

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQEEAK LL RCLNLGISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEEAKQLLARCLNLGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGVTTVKNPISLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFAKQQGVE+  N+YFIT++N+GMLKLAKEA +ILFD
Sbjct  124  GAEEFAKQQGVELVTNEYFITQENMGMLKLAKEANSILFD  163



>ref|XP_008377997.1| PREDICTED: LOW QUALITY PROTEIN: probable isoaspartyl peptidase/L-asparaginase 
2 [Malus domestica]
Length=325

 Score =   289 bits (739),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLTAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGPKRRCGAVSGLTTVKNPVSLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ +N+YFITEDNVGMLKLAKEA  ILFD
Sbjct  124  GAEDFARQQGVEVVDNEYFITEDNVGMLKLAKEANTILFD  163



>ref|XP_010244253.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Nelumbo 
nucifera]
Length=329

 Score =   289 bits (739),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCLNLG SALRSSLPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPQERQEEAKQLLTRCLNLGTSALRSSLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGPRRRCGAVSGLTTVKNPVSLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA QQGVE+ +N+YFITE+N+GMLKLAKEA  I+FD
Sbjct  124  GAEEFAMQQGVEVVDNEYFITEENMGMLKLAKEANTIVFD  163



>ref|XP_010503884.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Camelina 
sativa]
Length=325

 Score =   289 bits (739),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKQLLTRCLNLGIVALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA++QGVE+ +NDYF+T+DNVGMLKLAKEA +ILFD
Sbjct  124  GAEDFARKQGVEIVDNDYFVTDDNVGMLKLAKEANSILFD  163



>ref|XP_009354155.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Pyrus 
x bretschneideri]
Length=325

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP+ERQE+AK LLTRCLNLGISALRS L AIDVVELVVRELE DP 
Sbjct  4    WAIAVHGGAGVDPNLPMERQEQAKQLLTRCLNLGISALRSDLAAIDVVELVVRELEADPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGPKRRCGAVSGLTTVKNPVSLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ +N+YFITEDNVGMLKLAKEA  ILFD
Sbjct  124  GAEDFARQQGVEVVDNEYFITEDNVGMLKLAKEANTILFD  163



>ref|XP_010465623.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Camelina 
sativa]
Length=325

 Score =   288 bits (737),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP ERQEEAK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPAERQEEAKQLLTRCLNLGIVALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA++QGVE+ +NDYF+T+DNVGMLKLAKEA +ILFD
Sbjct  124  GAEDFARKQGVEIVDNDYFVTDDNVGMLKLAKEANSILFD  163



>ref|XP_002882982.1| hypothetical protein ARALYDRAFT_479069 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59241.1| hypothetical protein ARALYDRAFT_479069 [Arabidopsis lyrata subsp. 
lyrata]
Length=325

 Score =   288 bits (737),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP ERQEEAK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPAERQEEAKQLLTRCLNLGIVALRSNISAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA++QGVE+ +NDYF+T+DNVGMLKLAKEA +ILFD
Sbjct  124  GAEDFARKQGVEIVDNDYFVTDDNVGMLKLAKEANSILFD  163



>ref|XP_006434701.1| hypothetical protein CICLE_v10001812mg [Citrus clementina]
 gb|ESR47941.1| hypothetical protein CICLE_v10001812mg [Citrus clementina]
Length=329

 Score =   288 bits (737),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP++RQE AK LLTRCLNLGISALRS+ PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ +N+YFITE+NVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARQQGVELVDNEYFITEENVGMLKLAKEANSILFD  163



>emb|CDY30139.1| BnaC05g37230D [Brassica napus]
Length=324

 Score =   288 bits (737),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQE+AK LLTRCLNLGI+ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGIAALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT +GTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEQGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE+ +N+YFIT+DNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARKQGVEIVDNEYFITDDNVGMLKLAKEANSILFD  163



>emb|CDY20183.1| BnaA01g28190D [Brassica napus]
Length=325

 Score =   288 bits (736),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQE+AK LLTRCLNLGI+ALRS++ AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGIAALRSNVSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE  +N+YF+TEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARKQGVETVDNEYFVTEDNVGMLKLAKEANSILFD  163



>ref|XP_010487465.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Camelina 
sativa]
Length=325

 Score =   288 bits (736),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQE+AK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPAERQEQAKQLLTRCLNLGIVALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA++QGVE+ +NDYF+T+DNVGMLKLAKEA +ILFD
Sbjct  124  GAEDFARKQGVEIVDNDYFVTDDNVGMLKLAKEANSILFD  163



>ref|XP_006298133.1| hypothetical protein CARUB_v10014177mg [Capsella rubella]
 gb|EOA31031.1| hypothetical protein CARUB_v10014177mg [Capsella rubella]
Length=325

 Score =   287 bits (735),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQE+AK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPAERQEDAKQLLTRCLNLGIVALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA++QGVE+ +NDYF+T+DNVGMLKLAKEA +ILFD
Sbjct  124  GAEDFARKQGVEIVDNDYFVTDDNVGMLKLAKEANSILFD  163



>gb|KDO84066.1| hypothetical protein CISIN_1g020250mg [Citrus sinensis]
Length=329

 Score =   287 bits (735),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP++RQE AK LLTRCLNLGISALRS+ PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPVQRQEAAKQLLTRCLNLGISALRSNCPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ +N+YFITE+NVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFD  163



>gb|KJB29444.1| hypothetical protein B456_005G101000 [Gossypium raimondii]
Length=326

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLT CL++GISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQEEAKRLLTHCLDIGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG++ VKNPVSLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTDNGTVEMEASIMDGPKRRCGAVSGLSTVKNPVSLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FAK+QGVE+ +N+YFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEDFAKKQGVELVDNEYFITEDNVGMLKLAKEANSILFD  163



>emb|CBI19471.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQEEAK LLTRCLNLGISALRSSLPAIDVVELVVRELE+DPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEEAKQLLTRCLNLGISALRSSLPAIDVVELVVRELESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSY+AF+
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKSPHSYMAFA  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGV + +N YFITE+NVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARRQGVALVDNQYFITEENVGMLKLAKEANSILFD  163



>ref|XP_002285006.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Vitis 
vinifera]
 emb|CAN81785.1| hypothetical protein VITISV_024290 [Vitis vinifera]
Length=329

 Score =   286 bits (731),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQEEAK LLTRCLNLGISALRSSLPAIDVVELVVRELE+DPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEEAKQLLTRCLNLGISALRSSLPAIDVVELVVRELESDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSY+AF+
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKSPHSYMAFA  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGV + +N YFITE+NVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARRQGVALVDNQYFITEENVGMLKLAKEANSILFD  163



>ref|NP_566536.1| probable isoaspartyl peptidase/L-asparaginase 2 [Arabidopsis 
thaliana]
 sp|Q8GXG1.2|ASPGB_ARATH RecName: Full=Probable isoaspartyl peptidase/L-asparaginase 2; 
AltName: Full=L-asparagine amidohydrolase 2; Contains: RecName: 
Full=Isoaspartyl peptidase/L-asparaginase 2 subunit alpha; 
Contains: RecName: Full=Isoaspartyl peptidase/L-asparaginase 
2 subunit beta; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB02681.1| l-asparaginase (l-asparagine amidohydrolase) [Arabidopsis thaliana]
 gb|AAM63335.1| putative L-asparaginase [Arabidopsis thaliana]
 gb|ABD59062.1| At3g16150 [Arabidopsis thaliana]
 gb|AEE75777.1| probable isoaspartyl peptidase/L-asparaginase 2 [Arabidopsis 
thaliana]
Length=325

 Score =   286 bits (731),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP ERQEEAK LLTRCLNLGI ALRS++ AIDVVELV+RELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPAERQEEAKQLLTRCLNLGIIALRSNVSAIDVVELVIRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA++QGVE+ +N+YF+T+DNVGMLKLAKEA +ILFD
Sbjct  124  GAEDFARKQGVEIVDNEYFVTDDNVGMLKLAKEANSILFD  163



>gb|KJB58572.1| hypothetical protein B456_009G215700 [Gossypium raimondii]
Length=323

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ+EAK LLTRCL++GISALRS++PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQDEAKRLLTRCLDIGISALRSNVPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVM++SPHSYL   
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLTTP  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFAK+QGVEM +NDYFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFAKKQGVEMVDNDYFITEDNVGMLKLAKEANSILFD  163



>gb|KHG29402.1| hypothetical protein F383_14115 [Gossypium arboreum]
Length=323

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ+EAK LLTRCL++GISALRS++PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPKERQDEAKRLLTRCLDIGISALRSNVPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVM++SPHSYL   
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLTTP  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFAK+QGVEM +NDYFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFAKKQGVEMVDNDYFITEDNVGMLKLAKEANSILFD  163



>gb|KHG11184.1| hypothetical protein F383_13364 [Gossypium arboreum]
Length=332

 Score =   285 bits (730),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LLTRCL++GISALRS+L AIDVVELVVRELETDPL
Sbjct  11   WAIAVHGGAGVDPNLPNERQEEAKRLLTRCLDIGISALRSNLSAIDVVELVVRELETDPL  70

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD++PHSYL F+
Sbjct  71   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKTPHSYLGFA  130

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE+ +N+YFITEDNVGMLKLAKEA +ILFD
Sbjct  131  GAEEFARKQGVELVDNEYFITEDNVGMLKLAKEANSILFD  170



>ref|XP_006473269.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Citrus sinensis]
Length=329

 Score =   285 bits (730),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP++RQE AK LLTRCLNLGIS LRS+ PAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPVQRQEAAKQLLTRCLNLGISGLRSNCPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ +N+YFITE+N+GMLKLAKEA +ILFD
Sbjct  124  GAEEFARQQGVELVDNEYFITEENLGMLKLAKEANSILFD  163



>ref|XP_003589126.1| L-asparaginase [Medicago truncatula]
 gb|ABD32614.1| Peptidase T2, asparaginase 2 [Medicago truncatula]
 gb|AES59377.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=325

 Score =   285 bits (729),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPL+RQEEAK LLTR LNLGISALRS+L AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLQRQEEAKQLLTRVLNLGISALRSNLSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSYLAF+
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKSPHSYLAFN  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ +N+YFIT DNVGMLKLAKEA  ILFD
Sbjct  124  GAEDFARQQGVEVLDNEYFITADNVGMLKLAKEANTILFD  163



>ref|XP_004499019.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Cicer arietinum]
Length=326

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPL RQEEAK LLTR LNLGISALRS+L AIDVVELVVRELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPLNRQEEAKQLLTRVLNLGISALRSNLSAIDVVELVVRELETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVMD+SPHSYLAF+
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPVSLARLVMDKSPHSYLAFN  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ +N+YFIT DNVGMLKLAKEA AILFD
Sbjct  124  GAEDFARQQGVEVVDNEYFITPDNVGMLKLAKEANAILFD  163



>ref|XP_002302429.1| L-asparaginase family protein [Populus trichocarpa]
 gb|EEE81702.1| L-asparaginase family protein [Populus trichocarpa]
Length=328

 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LL RCL+LGISALRS+LPAIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPQERQEEAKKLLARCLDLGISALRSNLPAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE  +N YFITE+N+GMLKLAKEA +ILFD
Sbjct  124  GAEEFARQQGVETVDNGYFITEENLGMLKLAKEANSILFD  163



>gb|KJB63904.1| hypothetical protein B456_010G023000 [Gossypium raimondii]
Length=325

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LL RCL++GISALRS+L AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPNERQEEAKRLLNRCLDIGISALRSNLSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD++PHSYL F+
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKTPHSYLGFA  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE+ +N+YFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARKQGVELVDNEYFITEDNVGMLKLAKEANSILFD  163



>ref|XP_011017156.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Populus 
euphratica]
Length=328

 Score =   283 bits (723),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK LL RCL+LGISALRS+LPAIDVVELVVR+LETDPL
Sbjct  4    WAIAVHGGAGVDPNLPQERQEEAKKLLARCLDLGISALRSNLPAIDVVELVVRDLETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVM++SPHSYLAFS
Sbjct  64   FNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE  +N YFITE+N+GMLKLAKEA +ILFD
Sbjct  124  GAEEFARQQGVETVDNGYFITEENLGMLKLAKEANSILFD  163



>ref|XP_006406871.1| hypothetical protein EUTSA_v10021131mg [Eutrema salsugineum]
 gb|ESQ48324.1| hypothetical protein EUTSA_v10021131mg [Eutrema salsugineum]
Length=325

 Score =   282 bits (722),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP+ERQEEAK LLTRCL+LGI+ALRS++ AIDVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPVERQEEAKQLLTRCLSLGIAALRSNVSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+S HSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTRRRCGAVSGITTVKNPISLARLVMDKSSHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA++QGVE  +N+YF+T+DNVGMLKLAKEA +ILFD
Sbjct  124  GAEDFARKQGVETVDNEYFVTDDNVGMLKLAKEANSILFD  163



>ref|XP_004501550.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Cicer arietinum]
Length=325

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQE+AK LLT CLN+GI+ALRS++ A+DVVELVVRELET+PL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEQAKQLLTHCLNIGITALRSNVSAVDVVELVVRELETNPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGTKRRCGAVSGLTTVKNPVSLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ EN+YFIT DNVGMLKLAKEA  ILFD
Sbjct  124  GAEEFARQQGVEVEENEYFITPDNVGMLKLAKEANTILFD  163



>gb|KFK38965.1| hypothetical protein AALP_AA3G183000 [Arabis alpina]
Length=325

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DPNLP ERQE+AK LLT CLNLGI+AL S++ AIDVVELVV+ELETDPL
Sbjct  4    WAIAVHGGAGIDPNLPAERQEQAKQLLTHCLNLGIAALSSNVSAIDVVELVVKELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA++QGVE+ +N+YF+TEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEDFARKQGVEIVDNEYFVTEDNVGMLKLAKEANSILFD  163



>gb|ABC01060.1| L-asparaginase 2 [Phaseolus vulgaris]
Length=326

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQE+AK LLTRCLNLGIS+LRS+  A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEQAKQLLTRCLNLGISSLRSNASALDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVMD+SPHSYLAF+
Sbjct  64   FNSGRGSALTDKGTVEMEASIMDGSNRRCGAVSGLTTVKNPVSLARLVMDKSPHSYLAFN  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGV++ EN+YF+T +NVGMLKLAKEA  ILFD
Sbjct  124  GAEEFARQQGVDVVENEYFVTPENVGMLKLAKEANTILFD  163



>ref|XP_004291067.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Fragaria 
vesca subsp. vesca]
Length=327

 Score =   280 bits (717),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQE+AK LLTRCLNLG SALR+ LPAIDVVELVVRELETDP 
Sbjct  4    WAIAVHGGAGVDPNLPLERQEQAKQLLTRCLNLGTSALRADLPAIDVVELVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSAL   G VEMEASIMDG  RRCGAVSG+T VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALNENGRVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAE-NDYFITEDNVGMLKLAKEAKAILFD  532
            GAE FA+QQGVE+ + NDYFITE+NVGMLKLAKEA  ILFD
Sbjct  124  GAESFARQQGVELVDNNDYFITEENVGMLKLAKEANTILFD  164



>ref|XP_010688589.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Beta 
vulgaris subsp. vulgaris]
Length=327

 Score =   280 bits (716),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLPL+RQEEAK LLTRCLNL ISALRS+  AIDVVELVVRELETDPL
Sbjct  4    WAIALHGGAGVDPNLPLQRQEEAKQLLTRCLNLAISALRSNHSAIDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSAL+ KGTVEMEASIMDG  RR GAVSG+T VKNPVSLARLVM++SPHSYLAF 
Sbjct  64   FNSGRGSALSEKGTVEMEASIMDGPKRRYGAVSGLTTVKNPVSLARLVMEKSPHSYLAFF  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGVE+ EN+YFIT+DNVGMLKLAKEA AILFD
Sbjct  124  GAEEFARQQGVELMENEYFITQDNVGMLKLAKEANAILFD  163



>ref|XP_010061715.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Eucalyptus 
grandis]
 gb|KCW68699.1| hypothetical protein EUGRSUZ_F02300 [Eucalyptus grandis]
Length=325

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP  RQEEAK +L RCLN+GISALRSSLPA+DVVELVVRELE+DP+
Sbjct  4    WAIAVHGGAGVDPNLPHHRQEEAKQVLARCLNMGISALRSSLPAVDVVELVVRELESDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGT EMEASIMDG GRRCGAVSG+T VKNP+SLARLVMD+SPHSYLAF+
Sbjct  64   FNSGRGSALTEKGTAEMEASIMDGVGRRCGAVSGVTTVKNPISLARLVMDKSPHSYLAFA  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+  G E+ +NDYFITEDN GMLKLAKEA  I+FD
Sbjct  124  GAEEFARLHGAEVVDNDYFITEDNKGMLKLAKEANTIMFD  163



>ref|XP_007136713.1| hypothetical protein PHAVU_009G067800g [Phaseolus vulgaris]
 gb|ESW08707.1| hypothetical protein PHAVU_009G067800g [Phaseolus vulgaris]
Length=326

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQE+AK LLTRCLNLGIS+LRS+  A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEQAKQLLTRCLNLGISSLRSNASALDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVM++SPHSYLAF+
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGSNRRCGAVSGLTTVKNPVSLARLVMEKSPHSYLAFN  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+QQGV++ EN+YF+T +NVGMLKLAKEA  ILFD
Sbjct  124  GAEEFARQQGVDVVENEYFVTPENVGMLKLAKEANTILFD  163



>ref|XP_010927509.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Elaeis 
guineensis]
Length=330

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK +L+RCLNLGI+ALR    A+DVVE VVRELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKRVLSRCLNLGIAALRGGCAAVDVVEQVVRELETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT +GTVEMEASIMDG GRRCGAVSG++ VKNPVSLARLVMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRRGTVEMEASIMDGRGRRCGAVSGLSTVKNPVSLARLVMDKSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE+ +N YFITE+NVGMLKLAKEA +ILFD
Sbjct  124  GAEEFAREQGVEVMDNSYFITEENVGMLKLAKEANSILFD  163



>ref|XP_008796480.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Phoenix 
dactylifera]
Length=330

 Score =   275 bits (704),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK +L RCL++GI+ALR    A+DVVE+VVR+LETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKGVLARCLHIGITALRGGAAAVDVVEMVVRQLETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT +GTVEMEASIMDGHGRRCGAVSG++ VKNPVSLARLVMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRRGTVEMEASIMDGHGRRCGAVSGLSTVKNPVSLARLVMDKSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE  +N YFITE+NVGML LAKEA +ILFD
Sbjct  124  GAEEFAREQGVETMDNSYFITEENVGMLNLAKEANSILFD  163



>ref|XP_010932217.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Elaeis 
guineensis]
Length=329

 Score =   275 bits (703),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK ++ RCL++GI+ALR    A+DVVE+VVRELETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKRVIARCLHIGITALRGGAAAVDVVEMVVRELETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT +GTVEMEASIMDGHGRRCGAVSG++ VKNPVSLARLVMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRRGTVEMEASIMDGHGRRCGAVSGLSTVKNPVSLARLVMDKSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE+ +N YF+TE+NVGML LAKEA +ILFD
Sbjct  124  GAEEFAREQGVEVMDNSYFVTEENVGMLNLAKEANSILFD  163



>ref|XP_003525910.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Glycine max]
Length=327

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQE+AK LLTR LNLGISALRS   A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPERQEQAKQLLTRVLNLGISALRSDASALDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRG+ALT KGT E+EASIMDG+ RRCGAVSG+T VKNP+SLARLVM++SPHSYLAF+
Sbjct  64   FNSGRGAALTEKGTAELEASIMDGYKRRCGAVSGVTTVKNPISLARLVMEKSPHSYLAFN  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ EN+YFIT +NVGMLKLAKEA  ILFD
Sbjct  124  GAEDFARQQGVEIVENEYFITPENVGMLKLAKEANTILFD  163



>gb|KHN04475.1| Putative isoaspartyl peptidase/L-asparaginase 2 [Glycine soja]
Length=325

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ++AK LLTR LNLGISALRS+  A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPERQDQAKQLLTRVLNLGISALRSNASALDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRG+ALT KGT E+EASIMDG  RRCGAVSG+T VKNP+SLARLVM+ SPHSYLAF+
Sbjct  64   FNSGRGAALTEKGTAELEASIMDGSNRRCGAVSGVTTVKNPISLARLVMENSPHSYLAFN  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+ EN+YFIT +NVGMLKLAKEA AILFD
Sbjct  124  GAEDFARQQGVEIVENEYFITPENVGMLKLAKEANAILFD  163



>ref|XP_003603098.1| L-asparaginase [Medicago truncatula]
 gb|AES73349.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=322

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP  RQ+EAK LLT CLNLGISALRS+  A+DVVELVVR+LETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPHRQQEAKQLLTECLNLGISALRSNASALDVVELVVRKLETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG++ VKNP+SLARLVM++SPHSYLA++
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGTKRRCGAVSGVSTVKNPISLARLVMEKSPHSYLAYT  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE  +N+YFIT DNVGMLKLAKEA  ILFD
Sbjct  124  GAEEFAREQGVETEDNEYFITPDNVGMLKLAKEANTILFD  163



>gb|AES62108.2| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=320

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP +RQEEAK LLT CLN+GI ALRS+  A+DVVELVVRELET+PL
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEEAKQLLTHCLNIGIFALRSNGSAVDVVELVVRELETNPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPVSLARLVM++SPHSYL FS
Sbjct  64   FNSGRGSALTAKGTVEMEASIMDGTKRRCGAVSGVTTVKNPVSLARLVMEKSPHSYLGFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+ QGV++ +N+YFIT DNVGMLKLAKEA  ILFD
Sbjct  124  GAEEFARDQGVDIEDNEYFITPDNVGMLKLAKEANTILFD  163



>ref|XP_008796739.1| PREDICTED: LOW QUALITY PROTEIN: probable isoaspartyl peptidase/L-asparaginase 
2 [Phoenix dactylifera]
Length=330

 Score =   271 bits (693),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQEEAK +L+RCL+LGI+ALR    A+DVVE+VVR LETDP+
Sbjct  4    WAIAVHGGAGVDPNLPAERQEEAKRVLSRCLHLGIAALRGGAAAVDVVEMVVRGLETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRG ALT +GTVEMEASIMDG GRRCGAVSG++ VKNP+SLARLVMD+SPHSYLAF 
Sbjct  64   FNSGRGXALTRRGTVEMEASIMDGRGRRCGAVSGLSTVKNPISLARLVMDKSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE+ +N YFITE+NVGMLKLAKEA +ILFD
Sbjct  124  GAEEFAREQGVEVIDNSYFITEENVGMLKLAKEANSILFD  163



>ref|NP_001276238.1| probable isoaspartyl peptidase/L-asparaginase 2-like [Glycine 
max]
 gb|AFA35112.1| asparaginase 2 [Glycine max]
Length=327

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLP ERQ++AK LLTR LNLGISALRS+  A+DVVELVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPPERQDQAKQLLTRVLNLGISALRSNASALDVVELVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRG+ALT KGT E+EASIMDG  RRCGAVSG+T VKNP+SLARLVM+ SPHSYLAF+
Sbjct  64   FNSGRGAALTEKGTAELEASIMDGSNRRCGAVSGVTTVKNPISLARLVMENSPHSYLAFN  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLK-LAKEAKAILFD  532
            GAE+FA+QQGVE+ EN+YFIT +NVGMLK LAKEA AILFD
Sbjct  124  GAEDFARQQGVEIVENEYFITPENVGMLKLLAKEANAILFD  164



>ref|XP_009413335.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Musa 
acuminata subsp. malaccensis]
Length=332

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP LP  RQEEA+ +L+RCL LG  AL++ L A+DVVE+VVRELETDP+
Sbjct  4    WAIAVHGGAGVDPCLPAVRQEEARRVLSRCLKLGAGALQAGLTAVDVVEMVVRELETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT +GTVEMEASIMDG GRRCGAVSG++ VKNPVSLARLVMDRSPHSYLAF 
Sbjct  64   FNSGRGSALTRRGTVEMEASIMDGRGRRCGAVSGLSTVKNPVSLARLVMDRSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA++QGVEM +N YFITE+NV MLKLAKEA +I+FD
Sbjct  124  GAEDFAREQGVEMVDNSYFITEENVSMLKLAKEANSIMFD  163



>emb|CAC09349.1| H0212B02.13 [Oryza sativa Indica Group]
 emb|CAJ86320.1| OSIGBa0113E10.3 [Oryza sativa Indica Group]
 gb|EAY95831.1| hypothetical protein OsI_17700 [Oryza sativa Indica Group]
Length=333

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+ ALRS   A+DVVE VVRELE+DP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDALRSGAAALDVVEAVVRELESDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSG++ VKNPVSLARLVMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRLGTVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARLVMDKSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+ QG+E+ +N YFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEQFARDQGLEVVDNSYFITEDNVGMLKLAKEANSILFD  163



>gb|EAZ32226.1| hypothetical protein OsJ_16431 [Oryza sativa Japonica Group]
Length=333

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+ ALRS   A+DVVE VVRELE+DP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDALRSGAAALDVVEAVVRELESDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSG++ VKNPVSLARLVMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRLGTVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARLVMDKSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+ QG+E+ +N YFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEQFARDQGLEVVDNSYFITEDNVGMLKLAKEANSILFD  163



>emb|CAE04504.1| OSJNBb0059K02.14 [Oryza sativa Japonica Group]
Length=333

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+ ALRS   A+DVVE VVRELE+DP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDALRSGAAALDVVEAVVRELESDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSG++ VKNPVSLARLVMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRLGTVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARLVMDKSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+ QG+E+ +N YFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEQFARDQGLEVVDNSYFITEDNVGMLKLAKEANSILFD  163



>ref|XP_008452604.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Cucumis 
melo]
Length=322

 Score =   263 bits (671),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPL RQ++AK  LTRCL+LGI ALRS+  AIDVVELVVRELE DPL
Sbjct  4    WAIAVHGGAGVDPNLPLHRQDDAKRFLTRCLDLGIHALRSNHSAIDVVELVVRELENDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+  VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEDGTVEMEASIMDGPKRRCGAVSGLVTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+  NDYFITE NV +L+LAKEA  I  D
Sbjct  124  GAEKFARQQGVELVSNDYFITEGNVELLQLAKEANGIWLD  163



>ref|XP_004977053.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Setaria italica]
Length=333

 Score =   263 bits (671),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL  G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQTGVDLLRAGATALDVVEAVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT +GTVEMEASIMDG GRRCGAVSG++ VKNPVSLAR VMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRRGTVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARRVMDKSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QG+E  +N YFITEDNVGMLKLAKEA  ILFD
Sbjct  124  GAEEFAREQGLETVDNSYFITEDNVGMLKLAKEAGTILFD  163



>gb|AAG28786.1|AF308474_1 asparaginase [Hordeum vulgare subsp. vulgare]
Length=333

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGATALDVVEAVVRELETDPC  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSG++ VKNPVSLAR VMDRSPHSYLAF 
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARRVMDRSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA++QG+E+ +N YFITE+NVGMLKLAKEA +ILFD
Sbjct  124  GAEDFAREQGLEVVDNSYFITEENVGMLKLAKEANSILFD  163



>ref|XP_004141273.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Cucumis sativus]
 ref|XP_004168272.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Cucumis sativus]
Length=323

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP+LPL RQ++AK  LTRCL+LGI ALRS+  AIDVVELVVRELE DPL
Sbjct  4    WAIAVHGGAGVDPDLPLHRQDDAKKFLTRCLDLGIHALRSNHSAIDVVELVVRELENDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+  VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEDGTVEMEASIMDGPKRRCGAVSGLVTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE+  NDYFITE NV +L+LAKEA  I  D
Sbjct  124  GAEKFARQQGVELVSNDYFITEGNVELLQLAKEANGIWLD  163



>ref|XP_003580704.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Brachypodium 
distachyon]
Length=335

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL LG+  LR+  PA+DVVE VVRELE+DP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQLGVDLLRAGTPALDVVEAVVRELESDPC  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSAL+  G+VEMEASIMDG GRRCGAVSG++ VKNPVSLAR VM++SPHSYLAF 
Sbjct  64   FNSGRGSALSRSGSVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARRVMEKSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QG+E+ +N YFITE+NVGMLKLAKEA +ILFD
Sbjct  124  GAEEFAREQGLEVVDNSYFITEENVGMLKLAKEANSILFD  163



>ref|XP_009418804.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Musa 
acuminata subsp. malaccensis]
Length=332

 Score =   260 bits (665),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP LP ERQEEA+ +L RCL +G + LR+ LPA+DVVE+VVRELETDP+
Sbjct  4    WAIAVHGGAGVDPKLPEERQEEARRVLRRCLGVGAAGLRAGLPAVDVVEMVVRELETDPV  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT +GTVEMEASIMDG GRRCG+VSG+T VKNPVSLARLVMDRSPHSYLAF 
Sbjct  64   FNSGRGSALTQEGTVEMEASIMDGRGRRCGSVSGLTTVKNPVSLARLVMDRSPHSYLAFH  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA++Q VE+ +N YFIT++NV MLKLAKEA  I++D
Sbjct  124  GAEDFAREQEVEVVDNSYFITDENVRMLKLAKEANRIVYD  163



>ref|XP_002447227.1| hypothetical protein SORBIDRAFT_06g030910 [Sorghum bicolor]
 gb|EES11555.1| hypothetical protein SORBIDRAFT_06g030910 [Sorghum bicolor]
Length=337

 Score =   260 bits (665),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP   QEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPQHSQEEAKRVLARCLQVGVDLLRAGAQALDVVEAVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSG++ VKNPVSLAR VMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARRVMDKSPHSYLAFH  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QG+E  +N YFITEDNVGMLKLAKEA  ILFD
Sbjct  124  GAEEFAREQGLETVDNSYFITEDNVGMLKLAKEAGTILFD  163



>ref|XP_008668775.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Zea 
mays]
Length=337

 Score =   260 bits (664),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGAQALDVVEAVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSG++ VKNPVSLAR VMD SPHSYLAF 
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARRVMDNSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+ QG+E  +N YFIT+DNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFARAQGLETVDNSYFITDDNVGMLKLAKEAGSILFD  163



>dbj|BAJ94612.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=334

 Score =   259 bits (663),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGATALDVVEAVVRELETDPC  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSG++ V+NPVSLAR VMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRCGAVSGVSTVRNPVSLARRVMDKSPHSYLAFH  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQG+E+ +N YFITE+N+GMLKLAKEA +ILFD
Sbjct  124  GAEDFARQQGLEVVDNSYFITEENIGMLKLAKEANSILFD  163



>dbj|BAJ99727.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=333

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGATALDVVEAVVRELETDPC  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSG++ V+NPVSLAR VMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRCGAVSGVSTVRNPVSLARRVMDKSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+ QG+E+ +N YFITE+NVGMLKLAKEA +ILFD
Sbjct  124  GAEDFARDQGLEVVDNSYFITEENVGMLKLAKEANSILFD  163



>ref|XP_003591857.1| L-asparaginase [Medicago truncatula]
Length=338

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 143/178 (80%), Gaps = 18/178 (10%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELV---------  205
            WAIAVHGGAGVDPNLP +RQEEAK LLT CLN+GI ALRS+  A+DVVEL          
Sbjct  4    WAIAVHGGAGVDPNLPPQRQEEAKQLLTHCLNIGIFALRSNGSAVDVVELCCMFSHSISL  63

Query  206  ---------VRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPV  358
                     VRELET+PLFNSGRGSALT KGTVEMEASIMDG  RRCGAVSG+T VKNPV
Sbjct  64   TLTNLYRDDVRELETNPLFNSGRGSALTAKGTVEMEASIMDGTKRRCGAVSGVTTVKNPV  123

Query  359  SLARLVMDRSPHSYLAFSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            SLARLVM++SPHSYL FSGAEEFA+ QGV++ +N+YFIT DNVGMLKLAKEA  ILFD
Sbjct  124  SLARLVMEKSPHSYLGFSGAEEFARDQGVDIEDNEYFITPDNVGMLKLAKEANTILFD  181



>gb|AGV54259.1| isoaspartyl peptidase/L-asparaginase 2 [Phaseolus vulgaris]
Length=327

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 141/164 (86%), Gaps = 7/164 (4%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDPNLPLERQEEAK LLT CLNLGISA  S++PA+DVV+LVVRELETDPL
Sbjct  4    WAIAVHGGAGVDPNLPLERQEEAKQLLTHCLNLGISAQNSNVPAVDVVKLVVRELETDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHG----RRCGAVSGITKVKNPVSLARLVMDRSPHSY  400
            FNSGRGSALT KGTVEMEASIMDG      RR G+       KNP+SLARLVMD+SPHSY
Sbjct  64   FNSGRGSALTEKGTVEMEASIMDGPKTALRRRFGSHH---PFKNPISLARLVMDKSPHSY  120

Query  401  LAFSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            +AFSGAE+FA+QQGVE+ +N+YF+T DNVGMLKLAKEA  ILFD
Sbjct  121  IAFSGAEDFARQQGVEVVDNEYFVTPDNVGMLKLAKEANTILFD  164



>ref|XP_006652926.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2-like 
[Oryza brachyantha]
Length=328

 Score =   250 bits (638),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+ ALR    A+DVVE VVRELE+DP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDALRGGAAAVDVVEAVVRELESDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSG++ VKNPVSLARLVMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRLGTVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARLVMDKSPHSYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGV++ +N YFITEDNVGMLKLAKEA +ILFD
Sbjct  124  GAEEFAREQGVDVVDNSYFITEDNVGMLKLAKEANSILFD  163



>gb|EMT11957.1| Putative isoaspartyl peptidase/L-asparaginase 2 [Aegilops tauschii]
Length=347

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 137/174 (79%), Gaps = 14/174 (8%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGATALDVVEAVVRELETDPC  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSG++ VKNPVSLAR VMD+SPHSYLAF 
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARRVMDKSPHSYLAFD  123

Query  413  GAEEFAKQQ--------------GVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE FA++Q              G+E+ +N YFITE+NV MLKLAKEA +ILFD
Sbjct  124  GAEHFAREQIHAYLSFRAPTENTGLEVVDNSYFITEENVSMLKLAKEANSILFD  177



>gb|ABK22246.1| unknown [Picea sitchensis]
Length=370

 Score =   246 bits (628),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP+LP+ERQ+EAK LL  CLNLG+SAL++S+PAIDVVEL+VRELET+P+
Sbjct  3    WAIAVHGGAGVDPSLPMERQQEAKDLLLHCLNLGVSALKASVPAIDVVELLVRELETNPV  62

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSAL+ KGTVEMEASIMDG   +CGAVSG++ VKNP+SLARLVM++SPH YLAF+
Sbjct  63   FNSGRGSALSTKGTVEMEASIMDGFRNKCGAVSGLSTVKNPISLARLVMEKSPHVYLAFN  122

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA++QGVE+ + +YFIT +N   L+ AK A +I FD
Sbjct  123  GAEEFAREQGVEIVDTNYFITAENKERLEQAKSANSIQFD  162



>emb|CAK22360.1| L-asparaginase [Pinus sylvestris]
Length=375

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP LP+ERQ+EAK LL  CLNLG+SAL++S+PAIDVVEL+VRELET+P+
Sbjct  3    WAIAVHGGAGVDPCLPMERQQEAKDLLLHCLNLGVSALKASVPAIDVVELLVRELETNPV  62

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSAL+ KGTVEMEASIMDG   +CGAVSG++ VKNP+SLARLVM+RSPH YLAF+
Sbjct  63   FNSGRGSALSAKGTVEMEASIMDGFRNKCGAVSGLSTVKNPISLARLVMERSPHVYLAFN  122

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAEEFA+ QGVE+ +  YFIT +N   L+ AK   +I FD
Sbjct  123  GAEEFARAQGVEIVDTSYFITAENKERLEQAKSVNSIQFD  162



>ref|XP_006828602.1| hypothetical protein AMTR_s00129p00062240 [Amborella trichopoda]
 gb|ERM96018.1| hypothetical protein AMTR_s00129p00062240 [Amborella trichopoda]
Length=326

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 134/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAG+DP+LPL+RQEEA   L   L+LGISALRS+  A+DVVELVVRELE +PL
Sbjct  4    WAIAVHGGAGIDPSLPLQRQEEACQALLSALHLGISALRSASSAVDVVELVVRELELNPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSG GSALT +GTVEM+ASIMDG  R+CGAVSG++ VKNP+SLARLVMD+SPH+YLAF 
Sbjct  64   FNSGCGSALTAQGTVEMDASIMDGSTRKCGAVSGLSTVKNPISLARLVMDKSPHAYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE FA+Q G E+ +  +FI E+NV  LK AKEAK+I FD
Sbjct  124  GAEAFARQHGAEIVDTSFFIIEENVIRLKQAKEAKSIQFD  163



>ref|XP_006855727.1| hypothetical protein AMTR_s00044p00154340 [Amborella trichopoda]
 gb|ERN17194.1| hypothetical protein AMTR_s00044p00154340 [Amborella trichopoda]
Length=161

 Score =   219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 128/154 (83%), Gaps = 2/154 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGG G+DP+LPL+ QEEA   L   L+LGISALRS+  A+DVVELVVRELE +PL
Sbjct  4    WAIAIHGGVGIDPSLPLQCQEEACQALLSALHLGISALRSASSAVDVVELVVRELELNPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT +GTVEM+ASIMDG  R+CG VSGI+ VKNP+SLARLVMD+SPH+YLAF 
Sbjct  64   FNSGRGSALTAQGTVEMDASIMDGSTRKCGVVSGISTVKNPISLARLVMDKSPHAYLAFD  123

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEA  514
            GAE FA+Q G E+ +  +FITE+NV  ++L KEA
Sbjct  124  GAEAFARQHGTEIVDTIFFITEENV--IRLKKEA  155



>gb|KGN55235.1| L-asparaginase [Cucumis sativus]
Length=294

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIAVHGGAGVDP+LPL RQ++AK  LTRCL+LGI ALRS+  AIDVVELVVRELE DPL
Sbjct  4    WAIAVHGGAGVDPDLPLHRQDDAKKFLTRCLDLGIHALRSNHSAIDVVELVVRELENDPL  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+  VKNP+SLARLVMD+SPHSYLAFS
Sbjct  64   FNSGRGSALTEDGTVEMEASIMDGPKRRCGAVSGLVTVKNPISLARLVMDKSPHSYLAFS  123

Query  413  GAEEFAKQQ  439
            GAE+FA+QQ
Sbjct  124  GAEKFARQQ  132



>tpg|DAA35670.1| TPA: L-asparaginase-like family protein [Zea mays]
Length=170

 Score =   209 bits (531),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGVDPNLP  RQEEAK +L RCL +G+  LR+   A+DVVE VVRELETDP 
Sbjct  4    WAIAIHGGAGVDPNLPEHRQEEAKRVLARCLQVGVDLLRAGAQALDVVEAVVRELETDPF  63

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FNSGRGSALT  GTVEMEASIMDG GRRCGAVSG++ VKNPVSLAR VMD SPHSYLAF 
Sbjct  64   FNSGRGSALTRAGTVEMEASIMDGRGRRCGAVSGVSTVKNPVSLARRVMDNSPHSYLAFD  123

Query  413  GAEEFAKQQ  439
            GAEEFA+ Q
Sbjct  124  GAEEFARAQ  132



>gb|KFK23966.1| hypothetical protein AALP_AAs39002U000300 [Arabis alpina]
Length=222

 Score =   202 bits (515),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 117/153 (76%), Gaps = 27/153 (18%)
 Frame = +2

Query  149  LGISALRSSLPAIDVVELVVR---------------------------ELETDPLFNSGR  247
            L I+AL S++ AIDVVELVVR                           ELETDPLFNSGR
Sbjct  17   LRIAALSSNVSAIDVVELVVRYSSLTIVLFLISSSVFVDFVFLTTQVKELETDPLFNSGR  76

Query  248  GSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFSGAEEF  427
            GSALT KGTVEMEASIMDG  RRCGAVSGIT VKNP+SLARLVMD+SPHSYLAFSGAE+F
Sbjct  77   GSALTEKGTVEMEASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFSGAEDF  136

Query  428  AKQQGVEMAENDYFITEDNVGMLKLAKEAKAIL  526
            A++QGVE+ +N+YF+TEDNVGMLKLAKEA +IL
Sbjct  137  ARKQGVEIVDNEYFVTEDNVGMLKLAKEANSIL  169



>ref|XP_002266571.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Vitis vinifera]
 emb|CBI15348.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LPLER+E  +A L  CL +G++AL++  P +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPLSLPLERREPREAALRHCLQIGVAALQTKRPPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEA IMDG+ ++CGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   NFNAGRGSVLTTDGTVEMEACIMDGNTKKCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  +  +FIT +N+  LK AKEA  +  D
Sbjct  123  DGAEAFAREQGVETVDASHFITPENIERLKQAKEANRVQID  163



>ref|XP_006485703.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Citrus 
sinensis]
Length=199

 Score =   196 bits (499),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 125/158 (79%), Gaps = 1/158 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  +P ER++  +A L  CL++G+ AL+S   A+DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPVTMPPERRQPREAALRHCLDIGVDALKSQKHALDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT+ GTVEMEA IMDG+ +RCGAVSG+T V NP+SL+RLVM+++PH YLAF
Sbjct  63   NFNAGKGSVLTNAGTVEMEACIMDGNTKRCGAVSGLTTVINPISLSRLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAI  523
             GAE FA++QGVE  ++ +FIT +N+  LK AKEAK +
Sbjct  123  DGAEAFAREQGVETIDSSHFITPENIERLKQAKEAKRV  160



>dbj|BAK02243.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  LP ER+E   A L RCL+LG +ALR+   A+DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPRTLPPERREPRLATLRRCLDLGAAALRAGRSALDVVELVVRELEDCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEAS+MDG G RCGAVSG++ V NP+SLARL+M+++PH YLAF
Sbjct  63   HFNAGKGSVLTSDGTVEMEASVMDGAGMRCGAVSGLSTVVNPISLARLIMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA+ QGVE+ + ++FITE+N+  L+ AKEA  +  D
Sbjct  123  DGAEAFARDQGVEVRDQNHFITEENIDRLRNAKEANRVQID  163



>emb|CAN82634.1| hypothetical protein VITISV_007448 [Vitis vinifera]
Length=310

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+E  +A L  CL +G++AL++  P +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPLSLPXERREPREAALRHCLQIGVAALQTKRPPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEA IMDG+ ++CGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   NFNAGRGSVLTTDGTVEMEACIMDGNTKKCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAI  523
             GAE FA++QGVE  +  +FIT +N+  LK AKEA  +
Sbjct  123  DGAEAFAREQGVETVDASHFITPENIERLKQAKEANRV  160



>ref|XP_006440815.1| hypothetical protein CICLE_v10021205mg [Citrus clementina]
 gb|ESR54055.1| hypothetical protein CICLE_v10021205mg [Citrus clementina]
Length=320

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  +P ER++  +A L  CL++G+ AL+S   A+DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPVTMPPERRQPREAALRHCLDIGVDALKSQKHALDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT+ GTVEMEA IMDG+ +RCGAVSG+T V NP+SL+RLVM+++PH YLAF
Sbjct  63   NFNAGKGSVLTNAGTVEMEACIMDGNTKRCGAVSGLTTVINPISLSRLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE   + +FIT +N+  LK AKEAK +  D
Sbjct  123  DGAEAFAREQGVETINSSHFITPENIERLKQAKEAKRVQID  163



>ref|XP_010546212.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Tarenaya hassleriana]
Length=318

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P NLP+ER+   +A L  CL+LG+S+L+S    +DVVELVVRELE  P
Sbjct  4    WAIALHGGAGDIPVNLPVERRVPREAALRHCLDLGVSSLKSGKHPLDVVELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G GS LT +GTVEMEA IMDG  +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  64   NFNAGVGSVLTTQGTVEMEACIMDGKTKRCGAVSGLTSVVNPISLARLVMEKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  E+ +FIT +N+  LK AKEA  +  D
Sbjct  124  DGAEAFAREQGVETVESSHFITPENIERLKQAKEANRVQID  164



>gb|KEH32053.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=325

 Score =   199 bits (505),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LPLER++  +  L  CL +G+ AL+S++  +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPYSLPLERRQPREEALRHCLQIGVKALKSNMAPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT+KGTVEMEASIMDG+  +CGAVSG+T V N VSLARLVMD +PH YLAF
Sbjct  63   HFNAGRGSVLTNKGTVEMEASIMDGNTMKCGAVSGLTTVVNAVSLARLVMDNTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE+FA+QQGVE     +FIT +N+  L  AKEA  +  D
Sbjct  123  DGAEDFARQQGVETLHTSHFITPENIERLNQAKEANRVQID  163



>ref|NP_001241157.1| uncharacterized protein LOC100799400 [Glycine max]
 ref|XP_006579427.1| PREDICTED: uncharacterized protein LOC100799400 isoform X1 [Glycine 
max]
 ref|XP_006579428.1| PREDICTED: uncharacterized protein LOC100799400 isoform X2 [Glycine 
max]
 gb|ACU20315.1| unknown [Glycine max]
 gb|KHN15197.1| Isoaspartyl peptidase/L-asparaginase [Glycine soja]
Length=322

 Score =   198 bits (504),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER++  +  L  CL +G+ AL++ LP +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRQPREEALRHCLQIGVEALKAKLPPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT +GTVEMEASIMDG    CGAVSG+T V N +SLARLVM+ +PH YLAF
Sbjct  63   QFNAGRGSVLTCRGTVEMEASIMDGTTMNCGAVSGLTTVVNAISLARLVMENTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAEEFA+QQGVE  ++ +FIT++N+  LK AKEA  +  D
Sbjct  123  DGAEEFARQQGVETVDSSHFITKENIERLKQAKEANRVQID  163



>ref|XP_008450657.1| PREDICTED: isoaspartyl peptidase/L-asparaginase isoform X2 [Cucumis 
melo]
Length=319

 Score =   197 bits (502),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP +R++  +  L RCL +G+ AL+S  P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPSDRRQPREETLRRCLQIGVQALKSQKPPLDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT KGTVEMEASIMD   +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   HFNAGRGSVLTTKGTVEMEASIMDST-KRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ YFIT  N+  L+ AKEA  +  D
Sbjct  122  DGAETFAREQGVETIDSSYFITPQNIERLQQAKEANRVQID  162



>emb|CDO98550.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER++  +A L RCL +G++AL++   A+DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPKDLPPERRKPREATLRRCLEIGVAALKAHKSALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEAS+MDG  + CGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   HFNAGRGSVLTTDGTVEMEASVMDGKTKNCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT +N+  LK A+EA  +  D
Sbjct  123  DGAEAFAREQGVETVDSSHFITPENIERLKQAREANRVQID  163



>ref|XP_004508653.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Cicer arietinum]
Length=322

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER++  +  L  CL +G+ AL+S+ P ++VVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPYSLPPERRQPREEALLHCLQIGVKALKSNTPPLEVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT KGTVEMEASIMDG   +CGAVSG+T V N VSLARLVMD +PH YLAF
Sbjct  63   HFNAGRGSVLTTKGTVEMEASIMDGKTMKCGAVSGLTTVVNAVSLARLVMDNTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE+FA QQGVE  ++ YFIT +N+  L  AKEA  +  D
Sbjct  123  HGAEDFAAQQGVETLDSSYFITPENIERLNQAKEANRVQID  163



>gb|EPS61830.1| hypothetical protein M569_12962, partial [Genlisea aurea]
Length=307

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER+E  +A L RCL +G+ A+ S   ++DVVELVVRELE +P
Sbjct  3    WSIALHGGAGDIPRSLPPERREPREAALRRCLQIGVEAIESGRSSLDVVELVVRELEDNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG+ ++CGAVSG+ +VKN +SLARLVM+R+PH YLAF
Sbjct  63   HFNAGKGSVLTSNGTVEMEACIMDGNTKKCGAVSGVKRVKNAISLARLVMERTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAEEFA++QGVEM +   FIT +N+  L+ AKE   +  D
Sbjct  123  DGAEEFAREQGVEMVDPTEFITAENISRLQQAKEVDRVQID  163



>ref|XP_006434700.1| hypothetical protein CICLE_v10001812mg [Citrus clementina]
 gb|ESR47940.1| hypothetical protein CICLE_v10001812mg [Citrus clementina]
Length=293

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  206  VRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDR  385
            VRELETDPLFNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVM++
Sbjct  19   VRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEK  78

Query  386  SPHSYLAFSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            SPHSYLAFSGAEEFA+QQGVE+ +N+YFITE+NVGMLKLAKEA +ILFD
Sbjct  79   SPHSYLAFSGAEEFARQQGVELVDNEYFITEENVGMLKLAKEANSILFD  127



>ref|XP_009387638.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Musa acuminata 
subsp. malaccensis]
Length=324

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E +   +A L  CL LG++AL+++ P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPAEGRAPREAALRHCLELGVAALKANRPPLDVVELVVRELENSP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG+ ++CGAVSG++ V N +SLARLVM+R+PH YLAF
Sbjct  63   CFNAGKGSVLTTNGTVEMEACIMDGNTKKCGAVSGLSTVVNAISLARLVMERTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE A + +FIT +NV  LK AKEAK +  D
Sbjct  123  DGAEAFAREQGVETAHSSHFITPENVERLKNAKEAKRVQID  163



>gb|KDO84067.1| hypothetical protein CISIN_1g020250mg [Citrus sinensis]
Length=293

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  206  VRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDR  385
            VRELETDPLFNSGRGSALT  GTVEMEASIMDG  RRCGAVSG+T VKNP+SLARLVM++
Sbjct  19   VRELETDPLFNSGRGSALTENGTVEMEASIMDGPKRRCGAVSGLTTVKNPISLARLVMEK  78

Query  386  SPHSYLAFSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            SPHSYLAFSGAEEFA+QQGVE+ +N+YFITE+NVGMLKLAKEA +ILFD
Sbjct  79   SPHSYLAFSGAEEFARQQGVELFDNEYFITEENVGMLKLAKEANSILFD  127



>ref|XP_004135623.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Cucumis 
sativus]
 gb|KGN66085.1| hypothetical protein Csa_1G570100 [Cucumis sativus]
Length=319

 Score =   195 bits (496),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP +R++  +  L RCL +G+ AL+S  P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPSDRRQPREETLRRCLQIGVQALKSQKPPLDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT K TVEMEASIMD   +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   HFNAGRGSVLTTKATVEMEASIMDST-KRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ YFIT  N+  L+ AKEA  +  D
Sbjct  122  DGAEAFAREQGVETIDSSYFITPQNIERLQQAKEANRVQID  162



>gb|KEH32051.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=324

 Score =   196 bits (497),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 121/160 (76%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WA+A+HGGAGV  +LP E ++  +  L  CL +G+ AL+S++  +DVVELVVRELE  P 
Sbjct  3    WAVALHGGAGVPFSLPPEARQPREEALRHCLQIGVKALKSNMSPLDVVELVVRELENIPH  62

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FN+GRGS LT+KGTVEMEASIMDG+  +CGAVSG++ V N +SLARLVMD +PH YLAF 
Sbjct  63   FNAGRGSVLTNKGTVEMEASIMDGNTMKCGAVSGLSTVVNAISLARLVMDNTPHIYLAFD  122

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE  +  +FIT +N+  L  AKEA  +  D
Sbjct  123  GAEDFARQQGVETVDTSHFITPENIERLNQAKEADRVQID  162



>ref|XP_004166036.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Cucumis 
sativus]
Length=319

 Score =   195 bits (496),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP +R++  +  L RCL +G+ AL+S  P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPSDRRQPREETLRRCLQIGVQALKSQKPPLDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT K TVEMEASIMD   +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   HFNAGRGSVLTTKATVEMEASIMDST-KRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ YFIT  N+  L+ AKEA  +  D
Sbjct  122  DGAEAFAREQGVETIDSSYFITPQNIERLQQAKEANRVQID  162



>ref|XP_007209366.1| hypothetical protein PRUPE_ppa008761mg [Prunus persica]
 gb|EMJ10565.1| hypothetical protein PRUPE_ppa008761mg [Prunus persica]
Length=320

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L  CL++G+ AL++  PA+DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRLPREAGLRHCLHIGVEALKAKTPALDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEA IMDG  +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   HFNAGKGSVLTTQGTVEMEACIMDGT-KRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT +NV  LK AKEA  +  D
Sbjct  122  DGAEAFAREQGVETVDSSHFITPENVERLKQAKEANRVQID  162



>ref|XP_003562316.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Brachypodium 
distachyon]
Length=317

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+E   A L RCL+LG++AL++   A+DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPRSLPPERREPRLATLRRCLDLGVAALQAGRTALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEASIMDG    CGAVSG++ V N +SLARLVMD++PH YLAF
Sbjct  63   HFNAGRGSVLTTDGTVEMEASIMDGTTMGCGAVSGVSTVVNAISLARLVMDKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA+ QGVE  +  +FITE+N+  L+ AK+A  +  D
Sbjct  123  QGAEAFARDQGVETVDPSHFITEENIDRLRQAKQANRVQID  163



>ref|XP_011086915.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Sesamum indicum]
Length=321

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P ++P ER+E  +A L  CL +G+ A+++    +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPRSMPPERREPREAALRHCLQIGVDAIKAGRSPLDVVELVVRELEDNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG+ + CGAVSG+T VKN +SLARLVM+++PH YL F
Sbjct  63   NFNAGKGSVLTSNGTVEMEACIMDGNTKNCGAVSGVTTVKNAISLARLVMEKTPHIYLGF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            +GAE FA++QG+E  ++ YFIT +N+  LK AKEA  +  D
Sbjct  123  AGAEAFAREQGIETVDSSYFITPENIERLKQAKEANRVQID  163



>ref|NP_196427.1| asparaginase [Arabidopsis thaliana]
 sp|P50287.2|ASPGA_ARATH RecName: Full=Isoaspartyl peptidase/L-asparaginase 1; AltName: 
Full=L-asparagine amidohydrolase 1; Contains: RecName: Full=Isoaspartyl 
peptidase/L-asparaginase 1 subunit alpha; Contains: 
RecName: Full=Isoaspartyl peptidase/L-asparaginase 1 subunit 
beta; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB93711.1| asparaginase [Arabidopsis thaliana]
 gb|AAK62610.1| AT5g08100/T22D6_40 [Arabidopsis thaliana]
 gb|AAM10379.1| AT5g08100/T22D6_40 [Arabidopsis thaliana]
 gb|AED91247.1| asparaginase [Arabidopsis thaliana]
Length=315

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   ++ L  CL+LGISAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRESALRHCLDLGISALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIMDG  +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  64   DFNAGKGSVLTAQGTVEMEASIMDGKTKRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              AE FA+  GVE  ++ +FIT +N+  LK AKE   +  D
Sbjct  124  DAAEAFARAHGVETVDSSHFITPENIARLKQAKEFNRVQLD  164



>ref|XP_010257935.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Nelumbo nucifera]
Length=319

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L  CL LG++AL++  P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRAPREAALRHCLQLGVAALKAKQPPLDVVELVVRELENSP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEA IMDG+ + CGAVSG++ V N +SLARLVM+++PH YLAF
Sbjct  63   CFNAGKGSVLTTQGTVEMEACIMDGNTKNCGAVSGLSTVVNAISLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  +  +FIT +N+  LK AKEA  +  D
Sbjct  123  EGAEAFAREQGVETVDASHFITPENIERLKQAKEANRVQID  163



>gb|AFK38769.1| unknown [Medicago truncatula]
Length=324

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 120/160 (75%), Gaps = 0/160 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WA+A+HGGAGV  +LP E ++  +  L  CL +G+ AL+S++  +DVVELVVRELE  P 
Sbjct  3    WAVALHGGAGVPFSLPPEARQPREEALRHCLQIGVKALKSNMSPLDVVELVVRELENIPH  62

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FN+GRGS  T+KGTVEMEASIMDG+  +CGAVSG++ V N +SLARLVMD +PH YLAF 
Sbjct  63   FNAGRGSVPTNKGTVEMEASIMDGNTMKCGAVSGLSTVVNAISLARLVMDNTPHIYLAFD  122

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA+QQGVE  +  +FIT +N+  L  AKEA  +  D
Sbjct  123  GAEDFARQQGVETVDTSHFITPENIERLNQAKEADRVQID  162



>ref|XP_007155205.1| hypothetical protein PHAVU_003G182400g [Phaseolus vulgaris]
 gb|ESW27199.1| hypothetical protein PHAVU_003G182400g [Phaseolus vulgaris]
Length=322

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL +G+ AL++ LP +DVVE VVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRHPREEALRHCLQIGVEALKAKLPPLDVVERVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEASIMDG    CGAVSG+T V N +SLARLVM+++PH YLAF
Sbjct  63   QFNAGKGSVLTSNGTVEMEASIMDGTTMDCGAVSGLTTVVNAISLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAEEFA+QQGVE  ++ +FIT +N+  LK AKEA  +  D
Sbjct  123  DGAEEFARQQGVETLDSSHFITAENIERLKQAKEANRVQID  163



>emb|CAA84367.1| asparaginase [Arabidopsis thaliana]
Length=315

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   ++ L  CL+LGISAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRESALRHCLDLGISALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIMDG  +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  64   DFNAGKGSVLTAQGTVEMEASIMDGKTKRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              AE FA+  GVE   + +FIT +N+  LK AKE   +  D
Sbjct  124  DAAEAFARAHGVETVYSSHFITPENIARLKQAKEFNRVQLD  164



>ref|XP_008240074.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Prunus mume]
Length=320

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 124/161 (77%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L  CL++G+ AL+++ PA DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRLPREAGLRHCLHIGVEALKANTPASDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEA IMDG  +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   HFNAGKGSVLTTQGTVEMEACIMDGT-KRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT +NV  L+ AKEA  +  D
Sbjct  122  DGAEAFAREQGVETVDSSHFITPENVERLQQAKEANRVQID  162



>ref|XP_002873339.1| L-asparaginase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49598.1| L-asparaginase [Arabidopsis lyrata subsp. lyrata]
Length=315

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRHCLDLGVSALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIMDG+ +RCGAVSG+T V NPVSL RLVM+++PH YLAF
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMDGNTKRCGAVSGLTTVVNPVSLTRLVMEKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              AE FA+  GVE  ++ +FIT +N+  LK AKE   +  D
Sbjct  124  DAAEAFARAHGVETVDSSHFITPENIARLKQAKEFNRVQLD  164



>sp|P30364.1|ASPG_LUPAN RecName: Full=Isoaspartyl peptidase/L-asparaginase; AltName: 
Full=L-asparagine amidohydrolase; Contains: RecName: Full=Isoaspartyl 
peptidase/L-asparaginase subunit alpha; Contains: 
RecName: Full=Isoaspartyl peptidase/L-asparaginase subunit beta; 
Flags: Precursor [Lupinus angustifolius]
 emb|CAA43099.1| developing seed L-asparaginase [Lupinus angustifolius]
Length=325

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER++  +  L  CL +G+ AL+S  P +DVVELVVRELE   
Sbjct  4    WSIALHGGAGDIPFSLPPERRQPREEGLRHCLQIGVEALKSQKPPLDVVELVVRELENIQ  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G GS LT+ GTVEMEASIMDG   +CGAVSG++ V NP+SLARLVMD++PH YLAF
Sbjct  64   HFNAGIGSVLTNSGTVEMEASIMDGKTMKCGAVSGLSTVLNPISLARLVMDKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GA++FAKQQGVE  ++ +FIT +NV  LKLA EA  +  D
Sbjct  124  QGAQDFAKQQGVETVDSSHFITAENVERLKLAIEANRVQVD  164



>ref|XP_008811641.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Phoenix 
dactylifera]
Length=325

 Score =   191 bits (486),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER+   +A L +CL +G++AL++S P +DVVELVVRELE  P
Sbjct  3    WSIALHGGAGDIPYSLPPERRAPREAALRQCLAIGVAALKASRPPLDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG+ ++CGAVSG++ V N +SLARLVM+++PH YLAF
Sbjct  63   HFNAGKGSVLTTDGTVEMEACIMDGNTKKCGAVSGLSTVVNAISLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  + ++FIT +NV  LK AKEA  +  D
Sbjct  123  DGAEAFAREQGVETVDANHFITPENVERLKQAKEANRVQID  163



>ref|XP_009631666.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Nicotiana 
tomentosiformis]
Length=314

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E ++  +A L RCL +GI AL S    +DVVELVVRELE DP
Sbjct  3    WAIALHGGAGDIPRDLPPELRQPREACLHRCLQIGIDALNSHKSPLDVVELVVRELENDP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEA IMDG  ++CGAVSG+T V N VSLARLVM+++PH YLAF
Sbjct  63   HFNAGRGSVLTSNGTVEMEACIMDGSTKKCGAVSGLTTVVNAVSLARLVMEKTPHVYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA+++GVE  ++++FIT  N+  LK AK A  +  D
Sbjct  123  EGAEAFAREKGVETVDSNHFITPQNIERLKQAKAANRVQVD  163



>pdb|2GEZ|A Chain A, Crystal Structure Of Potassium-Independent Plant Asparaginase
 pdb|2GEZ|C Chain C, Crystal Structure Of Potassium-Independent Plant Asparaginase
 pdb|2GEZ|E Chain E, Crystal Structure Of Potassium-Independent Plant Asparaginase
 pdb|2GEZ|G Chain G, Crystal Structure Of Potassium-Independent Plant Asparaginase
Length=195

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER++  +  L  CL +G+ AL++  P +DVVELVVRELE   
Sbjct  7    WSIALHGGAGDIPFSLPPERRKPREEGLRHCLQIGVEALKAQKPPLDVVELVVRELENIE  66

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G GS LT+ GTVEMEASIMDG+  +CGAVSG++ V NP+SLARLVMD++PH YLAF
Sbjct  67   HFNAGIGSVLTNSGTVEMEASIMDGNTMKCGAVSGLSTVLNPISLARLVMDKTPHIYLAF  126

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GA++FAKQQGVE  ++ + IT +NV  LKLA EA  +  D
Sbjct  127  QGAQDFAKQQGVETVDSSHLITAENVERLKLAIEANRVQVD  167



>ref|XP_006828428.1| hypothetical protein AMTR_s00060p00098750 [Amborella trichopoda]
 gb|ERM95844.1| hypothetical protein AMTR_s00060p00098750 [Amborella trichopoda]
Length=148

 Score =   186 bits (471),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 115/144 (80%), Gaps = 2/144 (1%)
 Frame = +2

Query  83   VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLFNSGRGSALT  262
            ++P+LP +RQEEA       L+LGI ALRS+  A+DVVELVVRELE +PLFN G GSALT
Sbjct  1    MNPSLPRQRQEEACQAFLSALHLGIFALRSASSAVDVVELVVRELELNPLFNFGCGSALT  60

Query  263  HKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFSGAEEFAKQQG  442
             +GTVEM+ASIM+G  R+CGAVSGI+ VKNP+SLA LVMD+SPH+YL F GAE FA+Q G
Sbjct  61   AQGTVEMDASIMNGSTRKCGAVSGISTVKNPISLASLVMDKSPHAYLVFDGAEAFARQHG  120

Query  443  VEMAENDYFITEDNVGMLKLAKEA  514
            VE+ +  +FITE+NV  ++L KEA
Sbjct  121  VEIVDASFFITEENV--IRLKKEA  142



>ref|XP_006399296.1| hypothetical protein EUTSA_v10014145mg [Eutrema salsugineum]
 dbj|BAJ34155.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ40749.1| hypothetical protein EUTSA_v10014145mg [Eutrema salsugineum]
Length=315

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRENALRYCLDLGVSALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIMDG  +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMDGKTKRCGAVSGLTTVLNPISLARLVMEKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              AE FA+  G+E  E+ +FIT  N+  LK AKE   +  D
Sbjct  124  DAAEAFARAHGIETVESSHFITPQNIARLKQAKEFNRVQLD  164



>gb|EMT01892.1| Isoaspartyl peptidase/L-asparaginase [Aegilops tauschii]
Length=716

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  LP ER+E   A L RCL+LG +ALR+   A+DVVELVVRELE  P
Sbjct  403  WAIALHGGAGDIPRTLPPERREPRLATLRRCLDLGAAALRAGRSALDVVELVVRELEDCP  462

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEAS+MDG   RCGAVSG++ V NP+SLARLVMD++PH YLAF
Sbjct  463  HFNAGKGSVLTSDGTVEMEASVMDGTDMRCGAVSGLSTVVNPISLARLVMDKTPHIYLAF  522

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA+ QGVE+ +  +FITE+N+  L+ AKEA  +  D
Sbjct  523  DGAEAFARDQGVEIRDQSHFITEENIERLRNAKEANRVQID  563



>gb|EYU23631.1| hypothetical protein MIMGU_mgv1a010176mg [Erythranthe guttata]
Length=320

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P ++P ER+E  +A L  CL +G+ A+++    +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPRSMPPERREPREAALRHCLQIGVDAIKAGRSPLDVVELVVRELEDNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEA +M G  ++CGAVSG+T VKN VSLARLVM+++PH YL F
Sbjct  63   HFNAGRGSVLTSNGTVEMEACVMVGDTKKCGAVSGLTTVKNAVSLARLVMEKTPHIYLGF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE+FAK+QGVE  +  +FIT +NV  LK AKEA  +  D
Sbjct  123  DGAEQFAKEQGVETLDASHFITPENVDRLKQAKEANKVQID  163



>ref|XP_010491430.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Camelina sativa]
Length=316

 Score =   190 bits (483),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPEERRIPREIALRHCLDLGVSALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIM+G  +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMEGKTKRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              AE FA+  GVE  ++ +FIT +NV  LK AKE   +  D
Sbjct  124  DAAEAFARAHGVETVDSSHFITPENVARLKQAKEFNRVQLD  164



>emb|CDY21509.1| BnaC09g47830D [Brassica napus]
Length=315

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGG G  P +LP E +   +  L  CL+LG+SAL+S    +DV ELVVRELE  P
Sbjct  4    WAIALHGGGGDIPIDLPDELRIPRETALRHCLDLGVSALKSGKHPLDVTELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIMDG  +RCGAVSG+T V NPVSLARLVM+++PH YLAF
Sbjct  64   YFNAGKGSVLTAQGTVEMEASIMDGKTKRCGAVSGLTTVVNPVSLARLVMEKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              AE FA+  GVE AE+ YFIT +N+  LK AKE   +  D
Sbjct  124  DAAEAFARAHGVETAESTYFITPENIARLKQAKEFNRVQLD  164



>ref|XP_008450655.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 isoform X1 
[Cucumis melo]
Length=327

 Score =   190 bits (483),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 122/169 (72%), Gaps = 10/169 (6%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELV--------  205
            WAIA+HGGAG  P +LP +R++  +  L RCL +G+ AL+S  P +DVVELV        
Sbjct  3    WAIALHGGAGDIPLSLPSDRRQPREETLRRCLQIGVQALKSQKPPLDVVELVCREFVLVQ  62

Query  206  VRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDR  385
            VRELE  P FN+GRGS LT KGTVEMEASIMD   +RCGAVSG+T V NP+SLARLVM++
Sbjct  63   VRELENCPHFNAGRGSVLTTKGTVEMEASIMDST-KRCGAVSGLTTVVNPISLARLVMEK  121

Query  386  SPHSYLAFSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            +PH YLAF GAE FA++QGVE  ++ YFIT  N+  L+ AKEA  +  D
Sbjct  122  TPHIYLAFDGAETFAREQGVETIDSSYFITPQNIERLQQAKEANRVQID  170



>ref|XP_010423136.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Camelina 
sativa]
Length=316

 Score =   190 bits (482),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRHCLDLGVSALKSGEPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIM+G  +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMEGKTKRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              AE FA+  GVE  ++ +FIT +N+  LK AKE   +  D
Sbjct  124  DAAEAFARAHGVETVDSSHFITPENIARLKQAKEFNRVQLD  164



>ref|XP_006289635.1| hypothetical protein CARUB_v10003195mg [Capsella rubella]
 gb|EOA22533.1| hypothetical protein CARUB_v10003195mg [Capsella rubella]
Length=316

 Score =   189 bits (481),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRHCLDLGVSALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIM+G+ +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMEGNTKRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              AE FA+  GVE  +  +FIT +N+  LK AKE   +  D
Sbjct  124  DAAEAFARAHGVETVDPSHFITPENIARLKQAKEFNRVQLD  164



>ref|XP_001776678.1| predicted protein [Physcomitrella patens]
 gb|EDQ58514.1| predicted protein [Physcomitrella patens]
Length=307

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W IA+HGGAG +  +LP  R+E  +A L +CL LG+SAL SS  A+DV ELVV+ELE +P
Sbjct  3    WGIALHGGAGDISKDLPRARKEAVEACLAQCLRLGVSALESSHAALDVAELVVKELEANP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            +FN+GRGS LT  GTVEMEA IMDG    CGAVSG++ V +P+SLARLVM+R+PH YLAF
Sbjct  63   VFNAGRGSVLTTDGTVEMEACIMDGPTMNCGAVSGLSTVVHPISLARLVMERTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA+QQG+E  E  YFIT++N   L  A+E   +  D
Sbjct  123  EGAEAFARQQGLETKEPSYFITKENQERLARAQEKSLVQQD  163



>ref|XP_009122419.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Brassica 
rapa]
 emb|CDX69977.1| BnaA10g23260D [Brassica napus]
Length=314

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGG G  P +LP E +   +  L  CL+LG+SAL+S    +DV ELVVRELE  P
Sbjct  3    WAIALHGGGGDIPIDLPDELRIPRETALRHCLDLGVSALKSGKHPLDVTELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GT+EMEASIMDG  +RCGAVSG+T V NPVSLARLVM+++PH YLAF
Sbjct  63   YFNAGKGSVLTAQGTIEMEASIMDGKTKRCGAVSGLTTVVNPVSLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            + AE FA+  GVE AE+ YFIT +N+  LK AKE   +  D
Sbjct  123  NAAEAFARAHGVETAESTYFITPENIERLKQAKEFNRVQLD  163



>ref|XP_011014964.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Populus euphratica]
Length=320

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG +  +LP ER+   +A L  CL LG++AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDISLSLPAERRLPREAALHHCLQLGVAALKAQKHPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEA IMDG+ ++CGAVSG+T V N +SLARLVMD +PH YL F
Sbjct  63   NFNAGKGSVLTSRGTVEMEACIMDGNSKKCGAVSGLTTVVNAISLARLVMDNTPHIYLGF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT +N+  LK AKEA  +  D
Sbjct  123  DGAEAFAREQGVETVDSSHFITPENIERLKQAKEADRVQMD  163



>ref|XP_001771151.1| predicted protein [Physcomitrella patens]
 gb|EDQ64000.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 122/159 (77%), Gaps = 2/159 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            WAIA+HGGAG+     +  + ++  +A L   L++GI+ALR+SLPA++ VELVVR LE +
Sbjct  4    WAIALHGGAGMIAKEKMTADWKKRTEAALNEILDVGIAALRNSLPAVEAVELVVRALEDN  63

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
             LFN+G+GS LT+KGTVEMEASIMDG  + CGAVSGI+ V +PVSLARLVMD SPH YLA
Sbjct  64   TLFNAGKGSVLTNKGTVEMEASIMDGRSKNCGAVSGISTVVHPVSLARLVMDNSPHVYLA  123

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAI  523
            F GAEEFA+QQGVE  + + FITE+N   L+ AK+  ++
Sbjct  124  FDGAEEFARQQGVETVDTNTFITEENREKLENAKKTNSV  162



>emb|CDX69978.1| BnaA10g23270D [Brassica napus]
Length=315

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S    +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRNCLDLGVSALKSGKHPLDVTELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIMDG  +RCGAVSG+T V NP+S+ARLVM+++PH YL F
Sbjct  64   DFNAGKGSVLTAQGTVEMEASIMDGKTKRCGAVSGLTTVVNPISVARLVMEKTPHIYLGF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA+  GVE  E+ +FIT +N+  LK AKE   +  D
Sbjct  124  DGAEAFARAHGVETVESSHFITPENIARLKQAKEFNRVQLD  164



>gb|ACN32623.1| L-asparaginase [Withania somnifera]
Length=280

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER++  +  L  CL +G+ AL++  P +DVVELVVRELE   
Sbjct  4    WSIALHGGAGDIPFSLPPERRKPREEGLRHCLQIGVEALKAQKPPLDVVELVVRELENIE  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G GS LT+ GTVEMEASIMDG+  +CGAVSG++ V NP+SLARLVMD++PH YLAF
Sbjct  64   HFNAGIGSVLTNSGTVEMEASIMDGNTMKCGAVSGLSTVLNPISLARLVMDKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GA++FAKQQGVE  ++ + IT +NV  LKLA EA  +  D
Sbjct  124  QGAQDFAKQQGVETVDSSHLITAENVERLKLAIEANRVQVD  164



>ref|XP_004241610.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Solanum 
lycopersicum]
Length=314

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E ++  ++ L RCL++ I AL S    +DVVELVVRELE DP
Sbjct  3    WAIALHGGAGDIPRDLPPELRQLRESCLRRCLDIAIDALNSHKSPLDVVELVVRELENDP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT+ GTVEMEA IMDG  + CGAVSG+T V N VSLARLVM+++PH YLAF
Sbjct  63   HFNAGRGSVLTNNGTVEMEACIMDGGTKNCGAVSGLTTVVNAVSLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT  N+  LK AK A ++  D
Sbjct  123  EGAEAFAREQGVETVDSSHFITPQNIERLKQAKAANSVQVD  163



>ref|XP_004299276.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +L  ER++  +A L  CL +G+ AL+++ P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLSPERRQPREAALRHCLQIGVEALKANKPPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            +FN+G+GS LT  GTVEMEA IMDG  +RCGAVSG+T V NP+SLARLVM+ +PH YLAF
Sbjct  63   VFNAGKGSVLTSNGTVEMEACIMDGT-KRCGAVSGLTTVVNPISLARLVMENTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE A+ + FIT +NV  LK A EA  +  D
Sbjct  122  DGAEAFAREQGVETADANSFITPENVERLKQAIEANRVQID  162



>ref|XP_010452785.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Camelina sativa]
Length=316

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S  P +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRHCLDLGVSALKSGKPPLDVAELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIM+G  +RCGAVSG+T V NP+SLARLV++++PH YLAF
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMEGKTKRCGAVSGLTTVVNPISLARLVVEKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              AE FA+  GVE  ++ +FIT +N+  LK AKE   +  D
Sbjct  124  DAAEAFARAHGVETVDSSHFITPENIARLKQAKEFNRVQLD  164



>ref|XP_006376770.1| hypothetical protein POPTR_0012s06250g [Populus trichocarpa]
 gb|ERP54567.1| hypothetical protein POPTR_0012s06250g [Populus trichocarpa]
Length=320

 Score =   188 bits (478),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG +  +LP ER+   +A L  CL +G++AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDISLSLPAERRLPREAALHHCLQIGVAALKAQKHPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEA IMDG+ ++CGAVSG+T V N +SLARLVMD +PH YL F
Sbjct  63   NFNAGKGSVLTSRGTVEMEACIMDGNSKKCGAVSGLTTVVNAISLARLVMDNTPHIYLGF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT +N+  LK AKEA  +  D
Sbjct  123  DGAEAFAREQGVETVDSSHFITPENIERLKQAKEADRVQMD  163



>ref|XP_002514609.1| l-asparaginase, putative [Ricinus communis]
 gb|EEF47715.1| l-asparaginase, putative [Ricinus communis]
Length=321

 Score =   188 bits (478),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P NLP ER+   +A L  CL +G++AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLNLPPERRLPREAALRHCLEIGVAALQAQKHPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEA IMDG  ++CGAVSG+T V N +SLARLVM+++PH YLAF
Sbjct  63   NFNAGKGSVLTTEGTVEMEACIMDGKTKKCGAVSGLTTVVNAISLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++  F+T +NV  LK AKEA  +  D
Sbjct  123  DGAEAFAREQGVETVDSSQFVTPENVERLKQAKEANRVQID  163



>gb|KFK25178.1| hypothetical protein AALP_AA8G076700 [Arabis alpina]
Length=315

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL++G+SAL+S    +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPREIALRHCLDIGVSALKSGKSPLDVTELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIMDG  +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  64   DFNAGKGSVLTTEGTVEMEASIMDGKTKRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              AE FA+  GVE  E+ +FIT +N+  LK AKE   +  D
Sbjct  124  DAAEAFARANGVETVESSHFITPENIARLKQAKEFNRVQLD  164



>emb|CDY21508.1| BnaC09g47840D [Brassica napus]
Length=315

 Score =   187 bits (476),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S    +DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPMDLPDERRIPRETALRHCLDLGVSALKSGRHPLDVTELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIMDG  +RCGAVSG+T V NP+S+ARLVM+++PH YL F
Sbjct  64   DFNAGKGSVLTTQGTVEMEASIMDGKTKRCGAVSGLTTVVNPISVARLVMEKTPHIYLGF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA   GVE  E+ +F+T +N+  LK AKE   +  D
Sbjct  124  DGAEAFATAHGVETVESSHFVTPENIARLKQAKEFNRVQLD  164



>ref|XP_009122418.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Brassica rapa]
Length=315

 Score =   187 bits (476),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +  L  CL+LG+SAL+S     DV ELVVRELE  P
Sbjct  4    WAIALHGGAGDIPIDLPDERRIPRETALRNCLDLGVSALKSGKHPPDVTELVVRELENHP  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT +GTVEMEASIMDG  +RCGAVSG+T V NP+S+ARLVM+++PH YL F
Sbjct  64   DFNAGKGSVLTAQGTVEMEASIMDGKTKRCGAVSGLTTVVNPISVARLVMEKTPHIYLGF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA+  GVE  E+ +FIT +N+  LK AKE   +  D
Sbjct  124  DGAEAFARAHGVETVESSHFITPENIARLKQAKEFNRVQLD  164



>ref|XP_006345098.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Solanum 
tuberosum]
Length=315

 Score =   187 bits (476),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E +E  +A L  CL +G+ A+++    +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPKDLPPELREPREASLRYCLQIGVDAIKAQKSPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEA IMDG+ + CGAVSG+T V N +SLA+LVM+++PH YLAF
Sbjct  63   YFNAGRGSVLTSNGTVEMEACIMDGNTKNCGAVSGLTAVVNAISLAKLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT  N+  LK AKEA  +  D
Sbjct  123  EGAEAFAREQGVETTDSSHFITPRNIERLKQAKEANKVQVD  163



>ref|XP_010678369.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Beta vulgaris 
subsp. vulgaris]
Length=316

 Score =   187 bits (475),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P NLP   +E  +  L  CL++G++AL+++   +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLNLPQHEKEGRETALQHCLDIGVTALKAAHSPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            LFN+GRGS L  +G VEMEA IMDG+ ++CGAVSG+  V N VSLARLVM+++PH YL F
Sbjct  63   LFNAGRGSVLNTEGNVEMEACIMDGNTKKCGAVSGLKTVVNAVSLARLVMEKTPHIYLGF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FAK+QGVE  E  +FIT  N+  LK AKEA  +  D
Sbjct  123  EGAEAFAKEQGVETQEPSHFITPANIERLKQAKEANRVQLD  163



>sp|Q9ZSD6.1|ASPG_LUPLU RecName: Full=Isoaspartyl peptidase/L-asparaginase; Short=LlA; 
AltName: Full=L-asparagine amidohydrolase; AltName: Full=Potassium-independent 
L-asparaginase; Contains: RecName: Full=Isoaspartyl 
peptidase/L-asparaginase subunit alpha; Contains: 
RecName: Full=Isoaspartyl peptidase/L-asparaginase subunit 
beta; Flags: Precursor [Lupinus luteus]
 gb|AAD03742.1| L-asparaginase [Lupinus luteus]
Length=325

 Score =   187 bits (476),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER++  +  L  CL +G+ AL++  P +DVVELVVRELE   
Sbjct  4    WSIALHGGAGDIPFSLPPERRKPREEGLRHCLQIGVEALKAQKPPLDVVELVVRELENIE  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G GS LT+ GTVEMEASIMDG+  +CGAVSG++ V NP+SLARLVMD++PH YLAF
Sbjct  64   HFNAGIGSVLTNSGTVEMEASIMDGNTMKCGAVSGLSTVLNPISLARLVMDKTPHIYLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GA++FAKQQGVE  ++ + IT +NV  LKLA EA  +  D
Sbjct  124  QGAQDFAKQQGVETVDSSHLITAENVERLKLAIEANRVQVD  164



>gb|KJB51088.1| hypothetical protein B456_008G200400 [Gossypium raimondii]
Length=320

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIAVHGGAG  P +LP E++   +A L RCL++GI+AL++    +DVVELVVRELE +P
Sbjct  3    WAIAVHGGAGDIPLSLPPEKRLPREAGLRRCLDVGIAALKAHNHPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG   +CGAVSG++ V N +SLARLVMD++PH YLAF
Sbjct  63   HFNAGKGSVLTTSGTVEMEACIMDGKTMKCGAVSGVSTVVNAISLARLVMDKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QG+E  E  +FIT +N+  LK A+EA  +  D
Sbjct  123  DGAEAFAREQGLETVEMSHFITPENIERLKQAQEADRVQLD  163



>gb|KJB51085.1| hypothetical protein B456_008G200400 [Gossypium raimondii]
Length=320

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIAVHGGAG  P +LP E++   +A L RCL++GI+AL++    +DVVELVVRELE +P
Sbjct  3    WAIAVHGGAGDIPLSLPPEKRLPREAGLRRCLDVGIAALKAHNHPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG   +CGAVSG++ V N +SLARLVMD++PH YLAF
Sbjct  63   HFNAGKGSVLTTSGTVEMEACIMDGKTMKCGAVSGVSTVVNAISLARLVMDKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QG+E  E  +FIT +N+  LK A+EA  +  D
Sbjct  123  DGAEAFAREQGLETVEMSHFITPENIERLKQAQEADRVQLD  163



>gb|KJB51084.1| hypothetical protein B456_008G200400 [Gossypium raimondii]
Length=320

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIAVHGGAG  P +LP E++   +A L RCL++GI+AL++    +DVVELVVRELE +P
Sbjct  3    WAIAVHGGAGDIPLSLPPEKRLPREAGLRRCLDVGIAALKAHNHPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG   +CGAVSG++ V N +SLARLVMD++PH YLAF
Sbjct  63   HFNAGKGSVLTTSGTVEMEACIMDGKTMKCGAVSGVSTVVNAISLARLVMDKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QG+E  E  +FIT +N+  LK A+EA  +  D
Sbjct  123  DGAEAFAREQGLETVEMSHFITPENIERLKQAQEADRVQLD  163



>ref|XP_006650293.1| PREDICTED: isoaspartyl peptidase/L-asparaginase-like [Oryza brachyantha]
Length=323

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP  R++   A L RCL+LG +ALR+  PA+DVVELVVRE+E  P
Sbjct  3    WAIALHGGAGDIPRSLPPHRRDPRLATLRRCLDLGTAALRAGHPALDVVELVVREMEDCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G GS LT  GTVEMEA +MDG+  RCGAVSG++ V N VSLARLVM+++PH YLAF
Sbjct  63   HFNAGVGSVLTTDGTVEMEACVMDGNTMRCGAVSGLSTVVNAVSLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  +  +FITE+N   L+ A+EA  +  D
Sbjct  123  HGAEAFAREQGVETRDPSHFITEENKERLRQAREANRVQID  163



>ref|XP_010906197.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1 [Elaeis guineensis]
Length=364

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L  CL +G++AL++S   +DVVELVVRELE  P
Sbjct  38   WAIALHGGAGDIPYSLPPERRAPREAALRHCLAVGVAALKASRSPLDVVELVVRELENCP  97

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEA IMDG+ ++CGAVSG++ V N +SLARLVM+++PH YLAF
Sbjct  98   HFNAGRGSVLTTSGTVEMEACIMDGNTKKCGAVSGLSTVVNAISLARLVMEKTPHIYLAF  157

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGV   + ++FIT +NV  LK AKEA  +  D
Sbjct  158  DGAEAFAREQGVATVDANHFITPENVERLKQAKEANRVQID  198



>ref|XP_002990172.1| hypothetical protein SELMODRAFT_160700 [Selaginella moellendorffii]
 gb|EFJ08732.1| hypothetical protein SELMODRAFT_160700 [Selaginella moellendorffii]
Length=298

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 119/160 (74%), Gaps = 2/160 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WA+A+HGGAG D     ER E A+++L  CL+LG++ L S   A+DVVELVVR LE + +
Sbjct  3    WALALHGGAG-DIKRS-ERTEAAESVLLECLSLGVAELESGRCALDVVELVVRALENNEM  60

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FN+G+GS LT +GTVEMEASIMDG    CGAVSG+T V NP+SLARLVM+++PH YLAF 
Sbjct  61   FNAGKGSVLTAEGTVEMEASIMDGATGDCGAVSGLTTVVNPISLARLVMEKTPHIYLAFD  120

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE FA+QQGVE A+  YF+TE N+  L+  KE + +  D
Sbjct  121  GAEAFARQQGVETADPGYFVTERNIQRLRQTKETQTVQID  160



>ref|XP_008374666.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Malus 
domestica]
Length=326

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 122/161 (76%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L R L++G+ AL+++ P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRLPREAGLRRSLHIGVEALKANTPPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMD   +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   HFNAGKGSVLTTDGTVEMEACIMDDK-KRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT +NV  L  AKEAK +  D
Sbjct  122  DGAEAFAREQGVETLDSSHFITPENVERLSQAKEAKRVQID  162



>ref|XP_010101648.1| Isoaspartyl peptidase/L-asparaginase 1 [Morus notabilis]
 gb|EXB89117.1| Isoaspartyl peptidase/L-asparaginase 1 [Morus notabilis]
Length=316

 Score =   186 bits (471),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  LP +R+   +  L  CL+LG+ AL++   A+DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPLTLPPDRRLPREEALHHCLHLGVQALKAGNSALDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             +N+G+GS LT +GTVEMEA IMDG  ++CGAVSG+  V N +SLARLVM+++PH YLAF
Sbjct  63   HYNAGKGSVLTSEGTVEMEACIMDGKTKKCGAVSGLKTVVNAISLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT +N+  LK AKEA  I  D
Sbjct  123  DGAEAFAREQGVETVDSSHFITAENIERLKQAKEANRIQLD  163



>ref|XP_004982477.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like isoform 
X1 [Setaria italica]
Length=332

 Score =   186 bits (471),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P  LP E +E   A L RCL+LG +ALR    A+DVVELVVRELE  P
Sbjct  3    WALALHGGAGDVPRTLPPETREPRLAALRRCLDLGAAALRDGRAALDVVELVVRELEDCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEA +M+G   RCGAV+G++ V N VSLARLVM+++PH YLAF
Sbjct  63   HFNAGRGSVLTADGTVEMEACVMEGATLRCGAVAGLSTVANAVSLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  +  +FITE N+  L+ AKEA  +  D
Sbjct  123  DGAEAFAREQGVETKDPSHFITEQNIERLRQAKEANRVQID  163



>gb|KJB39962.1| hypothetical protein B456_007G040100 [Gossypium raimondii]
Length=321

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPN-LPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P+ LP +R+   +A L  CL++GI+AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPHSLPPDRRLPREAGLRHCLDVGIAALKAHKHPLDVVELVVRELENYP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEASIMDG  ++CGAVSG++ V N VSLARLVM+++PH YL F
Sbjct  63   HFNAGKGSVLTSSGTVEMEASIMDGKSKKCGAVSGLSTVVNAVSLARLVMEKTPHIYLGF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE A+  YFIT +N+  LK A++A  +  D
Sbjct  123  HGAEAFAREQGVEAADPSYFITPENIERLKQAQDANRVQID  163



>ref|XP_010031115.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Eucalyptus 
grandis]
Length=318

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 116/160 (73%), Gaps = 1/160 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WAIA+HGGAGV   LP E +   +A L  CL LG+ AL+S    +DVVELVVRELE +P 
Sbjct  3    WAIALHGGAGVPLTLPPEGRLPREACLRHCLQLGVDALKSKKSPLDVVELVVRELENNPH  62

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FN+G+GS LT  GTVEMEA IMDG+  +CGAVSG+T V N +SLARLVM+R+PH YLAF 
Sbjct  63   FNAGKGSVLTSSGTVEMEACIMDGN-MKCGAVSGLTTVVNAISLARLVMERTPHIYLAFD  121

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE FA++ GVE  +  +FIT +N+  LK AKEA  +  D
Sbjct  122  GAEAFAREHGVETLDASHFITPENIQRLKQAKEANRVQID  161



>ref|XP_008240025.1| PREDICTED: LOW QUALITY PROTEIN: isoaspartyl peptidase/L-asparaginase 
1-like [Prunus mume]
Length=321

 Score =   185 bits (470),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 123/161 (76%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P +LP +R+   +A L  CL++G+ AL+++ PA+DVVEL+VRELE  P
Sbjct  3    WAVALHGGAGDIPLSLPPKRRLPLEAGLRHCLHIGVEALKANTPALDVVELMVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG  +RCGAVS +T V NP+SLARL+M+++PH YLAF
Sbjct  63   YFNAGKGSVLTTLGTVEMEACIMDGT-KRCGAVSWLTTVVNPISLARLIMEKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT +NV  L+ AKEA  +  D
Sbjct  122  DGAEAFAREQGVETVDSSHFITPENVERLQQAKEANRVQID  162



>ref|XP_009596886.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Nicotiana 
tomentosiformis]
Length=315

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E +E  +  L  CL +G+ AL++    +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPKDLPPELREPREVCLRYCLQMGVDALKAHKSPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG+ + CGAVSG+T V N +SLARLVM+++PH YLAF
Sbjct  63   YFNAGKGSVLTSNGTVEMEACIMDGNTKNCGAVSGLTTVVNAISLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  +  +FIT  N+  LK AKEA  +  D
Sbjct  123  EGAEAFAREQGVETMDPSHFITPRNIERLKQAKEANRVQVD  163



>sp|P50288.1|ASPG_LUPAL RecName: Full=Isoaspartyl peptidase/L-asparaginase; AltName: 
Full=L-asparagine amidohydrolase; Contains: RecName: Full=Isoaspartyl 
peptidase/L-asparaginase subunit alpha; Contains: 
RecName: Full=Isoaspartyl peptidase/L-asparaginase subunit beta; 
Flags: Precursor [Lupinus albus]
 gb|AAA33409.1| L-asparaginase [Lupinus albus]
Length=325

 Score =   185 bits (469),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            W+IA+HGGAG  P +LP ER++  +  L  CL +GI AL++  P +DVVELVVRELE   
Sbjct  4    WSIALHGGAGDIPFSLPPERRKPREEGLRHCLQIGIEALKAQNPPLDVVELVVRELENIQ  63

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G GS LT+ GTVEMEASIMDG+  +CGAVSG+  V NP+SLAR VMD++PH +LAF
Sbjct  64   HFNAGIGSVLTNSGTVEMEASIMDGNTMKCGAVSGLNTVMNPISLARQVMDKTPHIFLAF  123

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GA++  KQQGVE  ++ +FITE+NV  LKLA EA  +  D
Sbjct  124  QGAQDLGKQQGVETVDSSHFITEENVERLKLAIEANRVQVD  164



>ref|XP_010031103.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Eucalyptus 
grandis]
Length=319

 Score =   184 bits (468),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 117/161 (73%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P  LP ER+   +A L  CL LG+ AL+S    +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPLTLPPERRLPREACLRHCLQLGVDALKSKKSPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG+  +CGAVSG+T V N +SLARLVM+R+PH YLAF
Sbjct  63   HFNAGKGSVLTSSGTVEMEACIMDGN-MKCGAVSGLTTVVNAISLARLVMERTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++ GVE  +  +FIT +N+  LK AKEA  +  D
Sbjct  122  DGAEAFAREHGVETLDASHFITPENIQRLKQAKEANRVQID  162



>gb|KDP31384.1| hypothetical protein JCGZ_11760 [Jatropha curcas]
Length=321

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 118/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P ++P ER+   +A L  CL +G++AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPFSMPPERRLPREATLRHCLQIGVAALQAQKHPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG  ++CGAVSG+T V N VSLARLVM+++PH YLAF
Sbjct  63   NFNAGKGSVLTTAGTVEMEACIMDGKTKKCGAVSGLTTVVNAVSLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++  FIT +N+  L  AKEA  +  D
Sbjct  123  DGAETFAREQGVETVDSSQFITPENIERLNQAKEANRVQID  163



>ref|NP_001050607.1| Os03g0597600 [Oryza sativa Japonica Group]
 gb|ABF97457.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12521.1| Os03g0597600 [Oryza sativa Japonica Group]
 dbj|BAG91444.1| unnamed protein product [Oryza sativa Japonica Group]
Length=317

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P +LP +R+E   A L RCL+L  +ALRS   A+DVVELVVRELE  P
Sbjct  3    WAVALHGGAGDIPRSLPPDRREPRLATLRRCLDLATAALRSGRAALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             +N+G GS LT  GTVEMEA++MDG+  RCGAVSG++ V N VSLARLVM+++PH YLAF
Sbjct  63   HYNAGVGSVLTADGTVEMEAAVMDGNTLRCGAVSGLSTVVNAVSLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  +  +FITE N   L+ AKEA  +  D
Sbjct  123  DGAEAFAREQGVETKDPSHFITEANKERLRQAKEANRVQVD  163



>ref|XP_008374665.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Malus 
domestica]
Length=326

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+ GGAG  P +LP ER+   +A +  CL++G+ AL+++ P +DVVELVVRELE  P
Sbjct  3    WAIALQGGAGDIPLSLPPERRLPREAGIRHCLHIGVEALKANTPPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMD   +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   HFNAGKGSVLTTDGTVEMEACIMDDK-KRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGV   ++ +FIT DNV  L  AKEAK +  D
Sbjct  122  GGAEAFAREQGVXTLDSSHFITPDNVXRLNQAKEAKRVQID  162



>gb|EEC75690.1| hypothetical protein OsI_12500 [Oryza sativa Indica Group]
Length=310

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P +LP +R+E   A L RCL+L  +ALRS   A+DVVELVVRELE  P
Sbjct  3    WAVALHGGAGDIPRSLPPDRREPRLATLRRCLDLATAALRSGRAALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             +N+G GS LT  GTVEMEA++MDG+  RCGAVSG++ V N VSLARLVM+++PH YLAF
Sbjct  63   HYNAGVGSVLTADGTVEMEAAVMDGNTLRCGAVSGLSTVVNAVSLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  +  +FITE N   L+ AKEA  +  D
Sbjct  123  DGAEAFAREQGVETKDPSHFITEANKERLRQAKEANRVQVD  163



>gb|KHF98766.1| hypothetical protein F383_16974 [Gossypium arboreum]
Length=321

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPN-LPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P+ LP +R+   +  L  CL++GI+AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPHSLPPDRRLPREVGLRHCLDVGIAALKAHKHPLDVVELVVRELENYP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEASIMDG  ++CGAVSG++ V N VSLARLVM+++PH YL F
Sbjct  63   HFNAGKGSVLTSSGTVEMEASIMDGKSKKCGAVSGLSTVVNAVSLARLVMEKTPHIYLGF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE A+  YFIT +N+  LK A++A  +  D
Sbjct  123  HGAEAFAREQGVETADPSYFITPENIERLKQAQDANRVQID  163



>ref|XP_009346253.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Pyrus 
x bretschneideri]
Length=326

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +L  ER+   +A +  CL++G+ AL+++   +DVVELVVRELE +P
Sbjct  3    WAIALHGGAGGIPLSLSPERRLPCEAGIRHCLHIGVEALKANTSPLDVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMD   +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   HFNAGKGSVLTTDGTVEMEACIMDDK-KRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT DNV  L  AKEAK +  D
Sbjct  122  DGAEAFAREQGVETLDSSHFITPDNVERLHKAKEAKRVQID  162



>ref|NP_001149875.1| transposon protein [Zea mays]
 gb|ACG37065.1| transposon protein [Zea mays]
 tpg|DAA50236.1| TPA: L-asparaginase-like family protein [Zea mays]
Length=335

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P  LP E +E   A L RCL++G +ALR    A+DVVELVVRELE  P
Sbjct  3    WALALHGGAGDVPRTLPPESREPRLATLRRCLDIGTAALREGRTALDVVELVVRELEDCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEA +M+G    CGAVSG++ V N VSLARLVM+++PH YLAF
Sbjct  63   HFNAGRGSVLTSAGTVEMEACVMEGATLHCGAVSGLSTVANAVSLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  +  +FIT++N+  L+ AKEA  +  D
Sbjct  123  DGAEAFAREQGVETKDPSHFITDNNIERLRQAKEANRVQID  163



>gb|AAO59983.1| putative L-asparaginase [Oryza sativa Japonica Group]
Length=308

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P +LP +R+E   A L RCL+L  +ALRS   A+DVVELVVRELE  P
Sbjct  3    WAVALHGGAGDIPRSLPPDRREPRLATLRRCLDLATAALRSGRAALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             +N+G GS LT  GTVEMEA++MDG+  RCGAVSG++ V N VSLARLVM+++PH YLAF
Sbjct  63   HYNAGVGSVLTADGTVEMEAAVMDGNTLRCGAVSGLSTVVNAVSLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAI  523
             GAE FA++QGVE  +  +FITE N   L+ AKEA  +
Sbjct  123  DGAEAFAREQGVETKDPSHFITEANKERLRQAKEANRV  160



>ref|XP_001753813.1| predicted protein [Physcomitrella patens]
 gb|EDQ81565.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 122/159 (77%), Gaps = 2/159 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            WA+A+HGGAG+     +  + Q+  +  L   LN+GI+AL++ L A++ VELVV+ LE +
Sbjct  4    WALALHGGAGMIAQEKMSADWQKCTEEALNEILNIGITALQNKLTALETVELVVKALEDN  63

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
             LFN+G+GS LT+KGTVEMEASIMDG  + CGAVSG++ V +PVSLARLVM  SPH YLA
Sbjct  64   TLFNAGKGSVLTNKGTVEMEASIMDGRTKNCGAVSGLSTVVHPVSLARLVMSNSPHVYLA  123

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAI  523
            F+GAEEFA+QQGVEM + + FIT++N   L++AK+ K++
Sbjct  124  FNGAEEFARQQGVEMVDTETFITDENREKLEMAKKTKSV  162



>ref|XP_009346265.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Pyrus 
x bretschneideri]
Length=321

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP ER+   +A L   L++G+ AL+++ P +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPERRLPREAGLRHSLHIGVVALKANTPPLDVVELVVRELENIP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMD   +RCGAVSG+T V NP+SLARLVM+++PH YLAF
Sbjct  63   HFNAGKGSVLTTDGTVEMEACIMDDK-KRCGAVSGLTTVVNPISLARLVMEKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE   + +FIT +NV  L  AKEAK +  D
Sbjct  122  DGAEAFAREQGVETLHSSHFITPENVERLSQAKEAKRVQID  162



>ref|XP_007037644.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
 gb|EOY22145.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
Length=320

 Score =   182 bits (463),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP +R+   +A L  CL++GI+AL++    +DVVELVVRELE  P
Sbjct  3    WAIALHGGAGDIPLSLPPDRRLPREAGLRHCLDVGIAALKAHKHPLDVVELVVRELENHP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG  ++CGAVSG++ V N +SLAR VMD++PH YLAF
Sbjct  63   HFNAGKGSVLTTSGTVEMEACIMDGKTKKCGAVSGLSTVVNAISLARKVMDKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QG+E  +  YFIT +N+  LK A+EA  +  D
Sbjct  123  DGAEAFAREQGLETVDPSYFITPENIERLKQAQEANRVQID  163



>ref|XP_009785994.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Nicotiana 
sylvestris]
Length=315

 Score =   182 bits (462),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 116/161 (72%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P +LP E +E  +  L  CL +G+ AL++    + VVELVVRELE +P
Sbjct  3    WAIALHGGAGDIPKDLPPELREPRETCLRYCLQMGVDALKAHKSPLGVVELVVRELENNP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG+ + CGAVSG+T V N +SLARLVM+++PH YLAF
Sbjct  63   YFNAGKGSVLTSNGTVEMEACIMDGNTKNCGAVSGLTTVVNAISLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  +  +FIT  N+  LK AKEA  +  D
Sbjct  123  EGAEAFAREQGVETMDPSHFITPRNIERLKQAKEANRVQVD  163



>ref|XP_010232895.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like [Brachypodium 
distachyon]
Length=321

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 116/161 (72%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+ GG G  P +LP ER E   A L RCL+LG+SAL+    A+DVVELVVRELE  P
Sbjct  3    WAIALQGGGGDIPRSLPPERAEPRLATLRRCLDLGVSALQDGRAALDVVELVVRELENCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEASIMDG    CG+V G++ V NP+SLAR+VM+++PH YLAF
Sbjct  63   HFNAGKGSVLTSDGTVEMEASIMDGTTMGCGSVCGLSTVVNPISLARIVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            + AE FA+ QGVE  +  +FITE+N+  L  AKEA  +  D
Sbjct  123  NAAEAFARDQGVETMDPSHFITEENLERLGQAKEANRVQLD  163



>ref|XP_002992515.1| hypothetical protein SELMODRAFT_236523 [Selaginella moellendorffii]
 gb|EFJ06453.1| hypothetical protein SELMODRAFT_236523 [Selaginella moellendorffii]
Length=298

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            WA+A+HGGAG D     ER E  +++L  CL+LG++ L S   A+DVVELVVR LE + +
Sbjct  3    WALALHGGAG-DIKRS-ERTEAVESVLLECLSLGVAELESGRCALDVVELVVRALENNEM  60

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FN+G+GS LT +GTVEMEASIMDG    CGAVSG+T V NP+SLARLVM+++PH  LAF 
Sbjct  61   FNAGKGSVLTAEGTVEMEASIMDGATGDCGAVSGLTTVVNPISLARLVMEKTPHILLAFD  120

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE FA+QQGVE A+  YF+TE N+  L+  KE + +  D
Sbjct  121  GAEAFARQQGVETADPGYFVTERNIQRLRQTKETQTVQID  160



>gb|KJB51090.1| hypothetical protein B456_008G200400 [Gossypium raimondii]
Length=319

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIAVHGGAG  P +LP E++   +A L RCL++GI+AL++    +DVVELV RELE +P
Sbjct  3    WAIAVHGGAGDIPLSLPPEKRLPREAGLRRCLDVGIAALKAHNHPLDVVELV-RELENNP  61

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG   +CGAVSG++ V N +SLARLVMD++PH YLAF
Sbjct  62   HFNAGKGSVLTTSGTVEMEACIMDGKTMKCGAVSGVSTVVNAISLARLVMDKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QG+E  E  +FIT +N+  LK A+EA  +  D
Sbjct  122  DGAEAFAREQGLETVEMSHFITPENIERLKQAQEADRVQLD  162



>gb|KJB51083.1| hypothetical protein B456_008G200400 [Gossypium raimondii]
Length=319

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 120/161 (75%), Gaps = 2/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIAVHGGAG  P +LP E++   +A L RCL++GI+AL++    +DVVELV RELE +P
Sbjct  3    WAIAVHGGAGDIPLSLPPEKRLPREAGLRRCLDVGIAALKAHNHPLDVVELV-RELENNP  61

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+G+GS LT  GTVEMEA IMDG   +CGAVSG++ V N +SLARLVMD++PH YLAF
Sbjct  62   HFNAGKGSVLTTSGTVEMEACIMDGKTMKCGAVSGVSTVVNAISLARLVMDKTPHIYLAF  121

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QG+E  E  +FIT +N+  LK A+EA  +  D
Sbjct  122  DGAEAFAREQGLETVEMSHFITPENIERLKQAQEADRVQLD  162



>ref|XP_004236074.1| PREDICTED: isoaspartyl peptidase/L-asparaginase [Solanum lycopersicum]
Length=315

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 116/161 (72%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P ++P E +E  +A L  CL   + AL++    +DVVE+VVRELE + 
Sbjct  3    WAIALHGGAGDIPKDMPPELREPREASLRYCLQTAVDALKAQKSPLDVVEIVVRELENNL  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEA IMDG+ + CGAVSG+T V N +SLARLVM+++PH YLAF
Sbjct  63   YFNAGRGSVLTSNGTVEMEACIMDGNTKNCGAVSGLTTVVNAISLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FA++QGVE  ++ +FIT  N+  LK AKEA  +  D
Sbjct  123  EGAEAFAREQGVETTDSSHFITPRNIERLKQAKEANKVQVD  163



>gb|EMS66458.1| putative isoaspartyl peptidase/L-asparaginase 2 [Triticum urartu]
Length=155

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 5/114 (4%)
 Frame = +2

Query  149  LGISALRSSLPAIDVVEL--VVRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRCG  322
            +GIS     LPA   V L  VVRELETDP FNSGRGSALT  GTVEMEASIMDGHGRRCG
Sbjct  1    MGISV---HLPAFAFVSLKAVVRELETDPCFNSGRGSALTRAGTVEMEASIMDGHGRRCG  57

Query  323  AVSGITKVKNPVSLARLVMDRSPHSYLAFSGAEEFAKQQGVEMAENDYFITEDN  484
            AVSG++ V+NPVSLAR VMD+SPHSYLAF GAE+FA++QG+E+ +N YFITE+N
Sbjct  58   AVSGVSTVRNPVSLARRVMDKSPHSYLAFDGAEDFAREQGLEVVDNSYFITEEN  111



>sp|P30362.1|ASPG_LUPAR RecName: Full=Isoaspartyl peptidase/L-asparaginase; AltName: 
Full=L-asparagine amidohydrolase; Contains: RecName: Full=Isoaspartyl 
peptidase/L-asparaginase subunit alpha; Contains: 
RecName: Full=Isoaspartyl peptidase/L-asparaginase subunit beta; 
Flags: Precursor, partial [Lupinus arboreus]
 emb|CAA36824.1| asparaginase [Lupinus arboreus]
Length=306

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = +2

Query  98   PLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPLFNSGRGSALTHKGTV  277
            P ER++  +  L  CL +G+ AL++    +DVVELVVRELE +  FN+G GS LT+ GTV
Sbjct  1    PPERRKPREEGLRHCLQIGVEALKARKSPLDVVELVVRELENNEHFNAGIGSVLTNSGTV  60

Query  278  EMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFSGAEEFAKQQGVEMAE  457
            EMEASIMDG   +CGAVSG++ V NP+SLARLVM+++PH YLAF GA++FAKQQGVE  +
Sbjct  61   EMEASIMDGKSMKCGAVSGLSTVLNPISLARLVMEKTPHMYLAFQGAQDFAKQQGVETVD  120

Query  458  NDYFITEDNVGMLKLAKEAKAILFD  532
            + +FIT +NV  LKLA EA  +  D
Sbjct  121  SSHFITAENVERLKLAIEANRVQID  145



>ref|XP_004982478.1| PREDICTED: isoaspartyl peptidase/L-asparaginase 1-like isoform 
X2 [Setaria italica]
Length=303

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 98/130 (75%), Gaps = 1/130 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG  P  LP E +E   A L RCL+LG +ALR    A+DVVELVVRELE  P
Sbjct  3    WALALHGGAGDVPRTLPPETREPRLAALRRCLDLGAAALRDGRAALDVVELVVRELEDCP  62

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
             FN+GRGS LT  GTVEMEA +M+G   RCGAV+G++ V N VSLARLVM+++PH YLAF
Sbjct  63   HFNAGRGSVLTADGTVEMEACVMEGATLRCGAVAGLSTVANAVSLARLVMEKTPHIYLAF  122

Query  410  SGAEEFAKQQ  439
             GAE FA++Q
Sbjct  123  DGAEAFAREQ  132



>ref|XP_011074409.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Sesamum 
indicum]
Length=248

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/84 (86%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  281  MEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFSGAEEFAKQQGVEMAEN  460
            MEASIMDG GRRCGAVSG+T VKNP+SLARLVM++SPHSYLAFSGAEEFAK  GVEM +N
Sbjct  1    MEASIMDGSGRRCGAVSGVTTVKNPISLARLVMEKSPHSYLAFSGAEEFAKHHGVEMVDN  60

Query  461  DYFITEDNVGMLKLAKEAKAILFD  532
            DYFITEDNVGMLKLAKEA +ILFD
Sbjct  61   DYFITEDNVGMLKLAKEADSILFD  84



>ref|XP_004352518.1| asparaginase [Acanthamoeba castellanii str. Neff]
 gb|ELR23041.1| asparaginase [Acanthamoeba castellanii str. Neff]
Length=350

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 106/161 (66%), Gaps = 1/161 (1%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WA+A+HGGAG +  ++PL+R+EE    L   L+ G+S L     A+D VE VVR LE DP
Sbjct  13   WALALHGGAGTISRSVPLDRREEYLKGLRTALDTGVSILAQGGTALDAVEAVVRTLEDDP  72

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            LFN+GRG+  TH  TVE++ASIMDG    CGAV G+  VKNP+SLARLVM+++ H  L+ 
Sbjct  73   LFNAGRGAVFTHDETVELDASIMDGRTLACGAVCGVKTVKNPISLARLVMEKTSHVLLSG  132

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            +GAE+FA   GVE  EN YF TE     L+ AK    +  D
Sbjct  133  AGAEQFAAVVGVERCENSYFYTEHRHRALQQAKATDQVQLD  173



>ref|XP_007210207.1| hypothetical protein PRUPE_ppa016260mg, partial [Prunus persica]
 gb|EMJ11406.1| hypothetical protein PRUPE_ppa016260mg, partial [Prunus persica]
Length=277

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +2

Query  179  PAIDVVELVVRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPV  358
            PA+DVVELVVRELE  P FN+G+GS LT +GTVEMEA I+DG  +RCGAVSG+T V NP+
Sbjct  3    PALDVVELVVRELENIPHFNAGKGSVLTTQGTVEMEACIIDGT-KRCGAVSGLTTVVNPI  61

Query  359  SLARLVMDRSPHSYLAFSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            SLARLVM+++PH YLAF GAE FA++QGVE  ++ +FIT +NV  LK AKEA  +  D
Sbjct  62   SLARLVMEKTPHIYLAFDGAEAFAREQGVETVDSSHFITPENVERLKQAKEANRVQID  119



>gb|KJB29446.1| hypothetical protein B456_005G101000 [Gossypium raimondii]
Length=247

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  281  MEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFSGAEEFAKQQGVEMAEN  460
            MEASIMDG  RRCGAVSG++ VKNPVSLARLVMD+SPHSYLAFSGAE+FAK+QGVE+ +N
Sbjct  1    MEASIMDGPKRRCGAVSGLSTVKNPVSLARLVMDKSPHSYLAFSGAEDFAKKQGVELVDN  60

Query  461  DYFITEDNVGMLKLAKEAKAILFD  532
            +YFITEDNVGMLKLAKEA +ILFD
Sbjct  61   EYFITEDNVGMLKLAKEANSILFD  84



>gb|KJB63905.1| hypothetical protein B456_010G023000 [Gossypium raimondii]
Length=246

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = +2

Query  281  MEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFSGAEEFAKQQGVEMAEN  460
            MEASIMDG  RRCGAVSG+T VKNP+SLARLVMD++PHSYL F+GAEEFA++QGVE+ +N
Sbjct  1    MEASIMDGPKRRCGAVSGLTTVKNPISLARLVMDKTPHSYLGFAGAEEFARKQGVELVDN  60

Query  461  DYFITEDNVGMLKLAKEAKAILFD  532
            +YFITEDNVGMLKLAKEA +ILFD
Sbjct  61   EYFITEDNVGMLKLAKEANSILFD  84



>gb|ABF91922.1| asparaginase family protein [Myxococcus xanthus DK 1622]
Length=351

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAGV    NL  ER+EE +A LT+ L  G + L S   A+D V   VR LE  
Sbjct  29   WGLVIHGGAGVISRENLSPEREEEVRAALTQSLQAGHAVLASGGSALDAVSAAVRILEDS  88

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+G+G+  TH G  E++A+IMDG  R+ GAV+G+  VKNP+SLARLVM++SPH  + 
Sbjct  89   PYFNAGKGAVFTHDGVNELDAAIMDGTTRKAGAVAGLRHVKNPISLARLVMEQSPHVMMV  148

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAE FAK QGVE+ +  YF TED    L+ A E
Sbjct  149  GEGAEAFAKSQGVELVDPKYFYTEDRWQGLQRALE  183



>ref|XP_009406526.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 2 [Musa 
acuminata subsp. malaccensis]
Length=251

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  281  MEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFSGAEEFAKQQGVEMAEN  460
            MEASIMDGHGRRCGAVSG+T VKNPVSLARLVMDRSPHSYLAF GAEEFA++QGVE+ +N
Sbjct  1    MEASIMDGHGRRCGAVSGLTTVKNPVSLARLVMDRSPHSYLAFDGAEEFAREQGVEVVDN  60

Query  461  DYFITEDNVGMLKLAKEAKAILFD  532
             YFITE+N+ MLK AKEA +I++D
Sbjct  61   SYFITEENMSMLKRAKEANSIMYD  84



>ref|WP_020478257.1| asparaginase [Myxococcus xanthus]
Length=373

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAGV    NL  ER+EE +A LT+ L  G + L S   A+D V   VR LE  
Sbjct  51   WGLVIHGGAGVISRENLSPEREEEVRAALTQSLQAGHAVLASGGSALDAVSAAVRILEDS  110

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+G+G+  TH G  E++A+IMDG  R+ GAV+G+  VKNP+SLARLVM++SPH  + 
Sbjct  111  PYFNAGKGAVFTHDGVNELDAAIMDGTTRKAGAVAGLRHVKNPISLARLVMEQSPHVMMV  170

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAE FAK QGVE+ +  YF TED    L+ A E
Sbjct  171  GEGAEAFAKSQGVELVDPKYFYTEDRWQGLQRALE  205



>gb|EMT27934.1| Putative isoaspartyl peptidase/L-asparaginase 2 [Aegilops tauschii]
Length=254

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  281  MEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFSGAEEFAKQQGVEMAEN  460
            MEASIMDG GRRCGAVSG++ VKNPVSLAR VMD+SPHSYLAF GAE+FA++QG+E+ +N
Sbjct  1    MEASIMDGRGRRCGAVSGVSTVKNPVSLARRVMDKSPHSYLAFDGAEDFAREQGLEVVDN  60

Query  461  DYFITEDNVGMLKLAKEAKAILFD  532
             YFITE+N+GMLKLAKEA +ILFD
Sbjct  61   SYFITEENIGMLKLAKEANSILFD  84



>ref|WP_013935658.1| asparaginase [Myxococcus fulvus]
 gb|AEI62486.1| asparaginase family protein [Myxococcus fulvus HW-1]
Length=375

 Score =   147 bits (371),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 99/155 (64%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAGV    NL  ER+ E +A LT+ L  G + L S   A+D V   VR LE  
Sbjct  54   WGLVIHGGAGVISRENLSPEREAEVRAALTQSLQAGHAVLASGGSALDAVSAAVRILEDS  113

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+G+G+  TH G  E++A+IMDG  R+ GAV+G+  VKNP SLARLVM++SPH  + 
Sbjct  114  PYFNAGKGAVFTHDGVNELDAAIMDGKTRQAGAVAGVRHVKNPSSLARLVMEQSPHVMMV  173

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAE FAK QGVE+ +  YF TED    L+ A E
Sbjct  174  GEGAEAFAKSQGVELVDPKYFYTEDRWQGLQRALE  208



>gb|EMS61236.1| Isoaspartyl peptidase/L-asparaginase [Triticum urartu]
Length=343

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  203  VVRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMD  382
            +VRELE  P FN+G+GS LT  GTVEMEAS+MDG   RCGAVSG++ V NP+SLAR VMD
Sbjct  81   MVRELEDCPHFNAGKGSVLTSDGTVEMEASVMDGTDMRCGAVSGLSTVVNPISLARRVMD  140

Query  383  RSPHSYLAFSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            ++PH YLAF GAE FA+ QGVE  +  +FITE+N+  LK AKEA  +  D
Sbjct  141  KTPHIYLAFDGAEAFARDQGVETRDQSHFITEENIERLKNAKEANRVQID  190



>ref|WP_002635219.1| asparaginase [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK91572.1| Isoaspartyl aminopeptidase protein [Myxococcus sp. (contaminant 
ex DSM 436)]
Length=371

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 97/155 (63%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAGV    NL  ER+ E +A LT+ L  G + L     A+D V   VR LE  
Sbjct  50   WGLVIHGGAGVISRENLSPEREAEVRAALTQSLEAGHAVLARGGSALDAVSAAVRVLEDS  109

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+G+G+  TH G  E++A+IMDG  R+ GAV+G+  V+NP+ LARLVM++SPH  + 
Sbjct  110  PYFNAGKGAVFTHDGVNELDAAIMDGTTRKAGAVAGLRHVRNPIELARLVMEKSPHVMMV  169

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAE FAK QGV + +  YF TED    L+ A E
Sbjct  170  GEGAEAFAKTQGVALVDPKYFYTEDRWQGLQRALE  204



>ref|XP_006856300.1| hypothetical protein AMTR_s00047p00122380 [Amborella trichopoda]
 gb|ERN17767.1| hypothetical protein AMTR_s00047p00122380 [Amborella trichopoda]
Length=276

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +2

Query  206  VRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDR  385
            VRELE DP FN+GRGS LT +GTVEMEA IMDG   +CGAVSG++ V N +SLARLVM++
Sbjct  13   VRELENDPNFNAGRGSVLTSQGTVEMEACIMDGTTMKCGAVSGLSTVVNAISLARLVMEK  72

Query  386  SPHSYLAFSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            +PH YLAF GAE FA++QGVE  + ++F+T +N+  L+ AKEA  +  D
Sbjct  73   TPHIYLAFDGAEAFAREQGVETVDPNHFVTPENIERLEQAKEANRVQID  121



>ref|WP_019515461.1| hypothetical protein [Sphingomonas sp. Mn802worker]
Length=307

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 101/162 (62%), Gaps = 3/162 (2%)
 Frame = +2

Query  53   WAIAVHGGAGVDPN--LPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAG+     L  E+ E A+A LTR L  G + L +   +ID VE  VR LE D
Sbjct  5    WTLVIHGGAGIINRGVLTPEQDEGARAALTRALEAGAAVLANDGASIDAVEAAVRVLEDD  64

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FNS RG+ LT +G VE++A+IMDG  R  GAV+G++  +NPV+LAR V D SPH  L 
Sbjct  65   PHFNSARGAVLTFEGKVELDAAIMDGRDRSAGAVAGVSTARNPVTLARAVKDHSPHVLLT  124

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             +GA+ FA++Q +E A  D+F+  +    L   KE+ A  FD
Sbjct  125  GAGADTFAREQSIEQAGEDWFVVPERRAQLAAMKES-ADWFD  165



>ref|WP_002629379.1| Isoaspartyl aminopeptidase [Cystobacter fuscus]
 gb|EPX59829.1| Isoaspartyl aminopeptidase [Cystobacter fuscus DSM 2262]
Length=371

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP--NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W IA+HGGAG+ P  +L  ER+   +A LT  L  G + L     +++ V   +R LE  
Sbjct  50   WGIALHGGAGIIPRESLSPEREAAVRAALTEALQAGHAVLARGGTSVEAVTSAIRVLEDS  109

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+G+G+  TH+G  E++ASIM+G  R  GAV+G+  VKNP+SLAR VM++SPH  L 
Sbjct  110  PYFNAGKGAVFTHEGKNELDASIMNGRTREAGAVAGLRHVKNPISLARTVMEKSPHVMLI  169

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAK  517
              GAE FA++QG+E+   DYF TE+    L+ A EA+
Sbjct  170  GEGAEAFAREQGLELVSEDYFHTEERWQSLQRALEAE  206



>ref|WP_008597184.1| isoaspartyl peptidase [Nitratireductor pacificus]
 gb|EKF18628.1| asparaginase [Nitratireductor pacificus pht-3B]
Length=309

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 103/162 (64%), Gaps = 2/162 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKAL--LTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            WA+A+HGGAG      L +QEEA+    L   L  G + L     AID VE  V  LE +
Sbjct  6    WALALHGGAGTILRSKLTKQEEARFREGLADALRAGTAVLEKGGAAIDAVERTVIALEEN  65

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P+FN+GRGS LT +G +EM+A+IMDG     GAV G+  V+NP+SLARLVM+++ H  LA
Sbjct  66   PMFNAGRGSVLTSEGGIEMDAAIMDGRNLDAGAVIGLNTVRNPISLARLVMEKNDHVVLA  125

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              GAE FA+++G++    D+F+TE     L+ A++ +A+  D
Sbjct  126  GKGAEAFARERGLQSMPTDWFVTERRRNQLEEARKTQAVSLD  167



>ref|WP_012285180.1| asparaginase [Caulobacter sp. K31]
 gb|ABZ70252.1| peptidase T2 asparaginase 2 [Caulobacter sp. K31]
Length=338

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 101/150 (67%), Gaps = 2/150 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W++A+HGGAGV    +L  E+++  +A L   L  G   L+S   ++D VE  VR LE +
Sbjct  31   WSLAIHGGAGVLERGDLTPEKEKAYRAGLDAALEAGAKVLKSGGSSLDAVEATVRVLEDN  90

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            PLFNSG+G+  T +G  E++ASIMDG   + GAV+G+T+ +NP+SLAR VM++SPH  LA
Sbjct  91   PLFNSGKGAVFTAEGKNELDASIMDGATLKAGAVAGVTRTRNPISLARAVMEKSPHVLLA  150

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGML  496
              GA++F+K++G+E  +  YF T++    L
Sbjct  151  RDGADQFSKEKGLEQVDPKYFFTQERWDQL  180



>ref|WP_015346819.1| asparaginase family protein [Myxococcus stipitatus]
 ref|YP_007358240.1| asparaginase family protein [Myxococcus stipitatus DSM 14675]
 gb|AGC42556.1| asparaginase family protein [Myxococcus stipitatus DSM 14675]
Length=374

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAGV    NL  ER+ E +A L + L  G + L     ++D V   VR LE  
Sbjct  51   WGLVIHGGAGVISRENLSAEREAEVRAALQQALQAGHAVLAQGGSSLDAVTAAVRILEDS  110

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+G+G+   H G  E++A+IMDG  R  GAV+G+ +VKNP+ LAR VM++SPH  + 
Sbjct  111  PHFNAGKGAVFNHDGINELDAAIMDGATRSAGAVAGLRRVKNPIELARRVMEKSPHVMMM  170

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAE+FAK QGVE+ +  YF TED    L+ A E
Sbjct  171  GEGAEQFAKAQGVELVDPKYFFTEDRWQSLQRALE  205



>ref|WP_022824798.1| asparaginase [Hymenobacter norwichensis]
Length=327

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 100/153 (65%), Gaps = 2/153 (1%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEA-KALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +++A+HGGAG + P L    +E A +A L   L +G + LR   PA+D VEL VR LE +
Sbjct  5    FSLAIHGGAGTISPALMTPEKELAYQAALRESLEVGYAVLREGGPALDAVELAVRSLEDN  64

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            PLFN+GRG+  TH+G  EM+A+IMDG  R  GAV+G+  V+NP+  ARLVM+++ H  LA
Sbjct  65   PLFNAGRGAVFTHEGHQEMDAAIMDGRDRAAGAVTGVRTVQNPIRAARLVMEKTEHVLLA  124

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLA  505
            + GA+E A++ G+     +YF TE     L+ A
Sbjct  125  YPGADELAQEHGLPTQPAEYFFTEHRFEQLQEA  157



>gb|KCW83769.1| hypothetical protein EUGRSUZ_B00638 [Eucalyptus grandis]
Length=272

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 82/109 (75%), Gaps = 1/109 (1%)
 Frame = +2

Query  206  VRELETDPLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDR  385
            VRELE +P FN+G+GS LT  GTVEMEA IMDG+  +CGAVSG+T V N +SLARLVM+R
Sbjct  8    VRELENNPHFNAGKGSVLTSSGTVEMEACIMDGN-MKCGAVSGLTTVVNAISLARLVMER  66

Query  386  SPHSYLAFSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            +PH YLAF GAE FA++ GVE  +  +FIT +N+  LK AKEA  +  D
Sbjct  67   TPHIYLAFDGAEAFAREHGVETLDASHFITPENIQRLKQAKEANRVQID  115



>gb|KCW83768.1| hypothetical protein EUGRSUZ_B00637 [Eucalyptus grandis]
Length=532

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 96/156 (62%), Gaps = 29/156 (19%)
 Frame = +2

Query  149  LGISALRSSLPAIDVVELVV----------------------------RELETDPLFNSG  244
            LG+ AL+S    +DVVELVV                            RELE +P FN+G
Sbjct  221  LGVDALKSKKSPLDVVELVVIDLRYKHRSYYVFREFGRILAVFGDNQVRELENNPHFNAG  280

Query  245  RGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFSGAEE  424
            +GS LT  GTVEMEA IMDG+  +CGAVSG+T V N +SLARLVM+R+PH YLAF GAE 
Sbjct  281  KGSVLTSSGTVEMEACIMDGN-MKCGAVSGLTTVVNAISLARLVMERTPHIYLAFDGAEA  339

Query  425  FAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            FA++ GVE  +  +FIT +N+  LK AKEA  +  D
Sbjct  340  FAREHGVETLDASHFITPENIQRLKQAKEANRVQID  375



>ref|WP_014681491.1| asparaginase [Solitalea canadensis]
 gb|AFD08267.1| asparaginase [Solitalea canadensis DSM 3403]
Length=329

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 101/161 (63%), Gaps = 2/161 (1%)
 Frame = +2

Query  56   AIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            A+ +HGGAG  +  N+  E++E  +A LT+ L  G + L     +ID VE  V  +E  P
Sbjct  12   ALVIHGGAGTILKKNMTPEKEEAYRAALTQALKAGYAVLEKGGKSIDAVEAAVNIMEDSP  71

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            LFN+G+G+  T++G  EM+ASIMDG     G+V+ +T +KNP++ A+ VM +SPH  +  
Sbjct  72   LFNAGKGAVFTNEGKNEMDASIMDGKNLMAGSVASVTTIKNPITAAKTVMLKSPHVMMIG  131

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            +GAE+FAK+QG+ + +  YF TED    L+ AKE   I  D
Sbjct  132  AGAEKFAKEQGLTIVDPSYFYTEDRWKQLQKAKEEDKIQLD  172



>ref|WP_035017313.1| asparaginase [Caulobacter vibrioides]
Length=343

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 104/162 (64%), Gaps = 2/162 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W++AVHGGAGV     L  E+ +  +A L   L  G   L++   ++D VE  VR LE +
Sbjct  36   WSLAVHGGAGVLERGELTPEKDKAYRAGLNAALEAGAKILKAGGSSLDAVEAAVRVLEDN  95

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            PLFN+G+G+  T +G  E++A+IMDG   + GAV+G+T+ +NP+SLAR VM++SPH  LA
Sbjct  96   PLFNAGKGAVFTAEGRNELDAAIMDGATLKAGAVAGVTRTRNPISLARAVMEKSPHVMLA  155

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              GA++F+K+ G+E A  +YF TED    L   ++ +  + D
Sbjct  156  REGADQFSKEMGLEQAPPEYFYTEDRWKQLLAWRKDQHAMLD  197



>gb|ENZ81746.1| asparaginase [Caulobacter crescentus OR37]
Length=356

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 104/162 (64%), Gaps = 2/162 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W++AVHGGAGV     L  E+ +  +A L   L  G   L++   ++D VE  VR LE +
Sbjct  49   WSLAVHGGAGVLERGELTPEKDKAYRAGLNAALEAGAKILKAGGSSLDAVEAAVRVLEDN  108

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            PLFN+G+G+  T +G  E++A+IMDG   + GAV+G+T+ +NP+SLAR VM++SPH  LA
Sbjct  109  PLFNAGKGAVFTAEGRNELDAAIMDGATLKAGAVAGVTRTRNPISLARAVMEKSPHVMLA  168

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              GA++F+K+ G+E A  +YF TED    L   ++ +  + D
Sbjct  169  REGADQFSKEMGLEQAPPEYFYTEDRWKQLLAWRKDQHAMLD  210



>ref|WP_036514883.1| asparaginase [Oceanicaulis sp. HL-87]
Length=357

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEA--KALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W+I +HGGAGV     ++ Q EA  +A L   L  G + LR     IDVVE +++  E D
Sbjct  30   WSIIIHGGAGVIERGDMDAQTEAAYRAALQSALEQGGAMLRDGADGIDVVEALIQAFEDD  89

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P+FN+GRG   T  G VEM+AS+M G  R  GAV+G+T V++P+SLAR VM+ SPH  LA
Sbjct  90   PMFNAGRGGVFTADGRVEMDASVMIGSTRAAGAVAGVTSVRHPISLARAVMEHSPHVMLA  149

Query  407  FSGAEEFAKQQGVEMAENDYFITE  478
              GAE FA ++G+E+A+  +F TE
Sbjct  150  GDGAEGFAAERGLELADQAFFFTE  173



>ref|WP_036969594.1| isoaspartyl peptidase [Pseudoalteromonas lipolytica]
 gb|EWH05911.1| isoaspartyl peptidase [Pseudoalteromonas lipolytica SCSIO 04301]
Length=344

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 97/155 (63%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +AIA+HGGAG         E+++  +A L   +  G S L     ++D +   +  LE  
Sbjct  28   FAIAIHGGAGTIEKSRFTPEQEKAYRAKLKEAVETGYSVLEKGGESLDAITAAINVLENS  87

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+GRG+  T+ GT E++ASIMDG  R+ GAVSG+  ++NP++LARLVM++S H  L+
Sbjct  88   PYFNAGRGAVYTYDGTHELDASIMDGRSRQAGAVSGVKHIENPINLARLVMEKSVHVMLS  147

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAEEFAK QG+ + EN+ F TED    L  AKE
Sbjct  148  GQGAEEFAKTQGMPLVENNLFDTEDRYEALLKAKE  182



>ref|WP_038129740.1| isoaspartyl peptidase [Verrucomicrobia bacterium SCGC AAA168-F10]
Length=315

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 97/159 (61%), Gaps = 1/159 (1%)
 Frame = +2

Query  53   WAIAVHGGAG-VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG V P++P ER+    A L   L +G+  L     ++D VE  VR LE +P
Sbjct  15   WAIALHGGAGYVSPDMPEERKARYMAALDSALAIGVDILEQGGSSLDAVEQTVRFLEDNP  74

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            LFN+GRG+  T++G  E++A+IMDG     GA +G+T VK+P+SLAR++M+ S H   A 
Sbjct  75   LFNAGRGAVFTNEGKNELDAAIMDGSQMNAGAATGLTTVKHPISLARIIMEESRHILFAG  134

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAIL  526
             GAE+FA Q  VE  + +YF         K A E +  L
Sbjct  135  DGAEQFADQTTVERVDPEYFKVPARYEAWKRANEHQGYL  173



>ref|WP_007139073.1| asparaginase [Flavobacterium frigoris]
 gb|EIA07737.1| isoaspartyl aminopeptidase @ Asp-X dipeptidase [Flavobacterium 
frigoris PS1]
Length=343

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 103/162 (64%), Gaps = 2/162 (1%)
 Frame = +2

Query  53   WAIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +AI +HGGAG  +  N+  E + E KA L   + +G + L++   +I+ VE  +  +E  
Sbjct  28   FAIVIHGGAGTILKKNMSPELEAEYKAKLEEAVKVGYAVLKNGGSSIEAVEKTINVMENS  87

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            PLFN+G+G+  T++G  E++ASIMDG   + GA++G+T VKNP+SLAR VM++S H  LA
Sbjct  88   PLFNAGKGAVFTNQGKNELDASIMDGKTLKAGAIAGVTTVKNPISLARAVMEKSEHVLLA  147

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
              GAE FAK+ G+E+    YF TE+    L  A+E + I  D
Sbjct  148  REGAEYFAKENGLEIVNPAYFYTENRYQSLLKAQEKEKIELD  189



>ref|WP_026947825.1| isoaspartyl peptidase [Algoriphagus marincola]
Length=355

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 102/162 (63%), Gaps = 2/162 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +A+A+HGGAG     N+  E++ E +A L   L+ G + L S   A+D V   V+ +E  
Sbjct  37   FALAIHGGAGTIKRENMSEEQEAEYRAKLKEALDAGYTVLESGGEALDAVIAAVKVMEDS  96

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            PLFN+G+G+  T++G  EM+A+IMDG  R  GAV+G+T VKNP++ AR VM+ SPH ++ 
Sbjct  97   PLFNAGKGAVFTNEGKNEMDAAIMDGRDRNAGAVAGLTTVKNPITAARAVMENSPHVFMT  156

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             +GAE+FA +Q +E+   DYF T+     L+  +E +    D
Sbjct  157  GAGAEQFAVEQDLELVSPDYFFTDFRFQQLEKIRETEKTQLD  198



>ref|WP_007674727.1| asparaginase [Caulobacter sp. AP07]
 gb|EJL24057.1| asparaginase [Caulobacter sp. AP07]
Length=338

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 103/155 (66%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W++A+HGGAGV    +L  E++   +A L   +  G   L++   ++D VE  VR LE +
Sbjct  31   WSLAIHGGAGVIKRGDLTPEKEAAYRAGLDAAMAAGAKVLKAGGSSLDAVEATVRVLEDN  90

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            PLFN+G+G+  T +G  E++ASIMDG   + GAV+G+T+ KNP+SLAR VM++SPH  LA
Sbjct  91   PLFNAGKGAVFTAEGKNELDASIMDGKTLKAGAVAGVTRTKNPISLARAVMEQSPHVLLA  150

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GA++F+K++G+E  +  YF TE+    L+  ++
Sbjct  151  RDGADQFSKEKGLEQVDPSYFRTEERWKQLETWRK  185



>ref|WP_014855981.1| asparaginase [Melioribacter roseus]
 gb|AFN74546.1| peptidase T2 asparaginase 2 [Melioribacter roseus P3M-2]
Length=322

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 90/142 (63%), Gaps = 0/142 (0%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            + I +HGGAGV  +LP + + + KA L+  L  G   L S   ++D V   +  +E  PL
Sbjct  26   FGIVIHGGAGVIKDLPADLENQYKAKLSEALEAGYKILESGGSSLDAVTKAINIMEDSPL  85

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FN+G+G+ L   G  E++ASIMDG     GAV+GI  +KNP++LARLVM++SPH  L   
Sbjct  86   FNAGKGAVLNDLGFAELDASIMDGGNLNAGAVAGIRHIKNPINLARLVMEKSPHVMLIGR  145

Query  413  GAEEFAKQQGVEMAENDYFITE  478
            GAEEFA Q G +  ++ YFITE
Sbjct  146  GAEEFAFQNGFQFVDSTYFITE  167



>gb|KIX22183.1| isoaspartyl peptidase [Flavobacterium sp. 316]
Length=345

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 100/161 (62%), Gaps = 2/161 (1%)
 Frame = +2

Query  56   AIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            AI +HGGAG  +  N+  E + E K +L   +  G S L++   +ID VE  +  LE  P
Sbjct  32   AIVIHGGAGTILKKNMSPELELEYKKVLEIAVKEGYSILKNGGTSIDAVEKTINILENSP  91

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            LFN+G+G+  T+ G  E++ASIMDG   + GAV+G+T VKNP++LAR VM++S H  LA 
Sbjct  92   LFNAGKGAVFTNDGKNELDASIMDGKTLKAGAVAGVTTVKNPINLARAVMEKSEHVMLAR  151

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GAE FAKQ G+E+ +  YF  E+    L  AKE + I  D
Sbjct  152  EGAEYFAKQNGLEIVDPSYFYVENRYQSLLKAKEKEKIELD  192



>ref|WP_028786727.1| hypothetical protein [Terrimonas ferruginea]
Length=346

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 94/143 (66%), Gaps = 2/143 (1%)
 Frame = +2

Query  59   IAVHGGAGVDPNLPLE--RQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            + +HGGAGV     L+  R+ EA   L R L+ G S L S   A+D VE VVR LE DP 
Sbjct  30   LVIHGGAGVLERGKLDPLREREALDALNRALDKGYSILDSGGSALDAVEQVVRVLEDDPS  89

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FN+GRG+  T +G  E++ASIM+G     GAV+G+T ++NP+S AR VM++SPH  LA  
Sbjct  90   FNAGRGAVFTAEGRHELDASIMNGKTLAAGAVAGVTTIRNPISAARAVMEKSPHVMLAGR  149

Query  413  GAEEFAKQQGVEMAENDYFITED  481
            GAEEFA+ QG++  +N YF  ED
Sbjct  150  GAEEFARLQGLQQVDNAYFSVED  172



>ref|WP_008666718.1| isoaspartyl aminopeptidase [Rhodopirellula europaea]
 gb|EMI26698.1| isoaspartyl aminopeptidase [Rhodopirellula europaea SH398]
Length=473

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++  A L   L  G   L     A+D VE V+R LE DP
Sbjct  33   WAIVIHGGAGSSPAQLGEASSQKRTAGLQHALQTGRDMLADGATAMDTVEAVIRTLEDDP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            +FN+GRGS +T++G VEM++S+MDG    CGAV+G+T+VKNP+SLAR VM  + H  L  
Sbjct  93   IFNAGRGSVVTNEGRVEMDSSVMDGKTLACGAVAGVTRVKNPISLARRVMTETKHVLLIG  152

Query  410  SGAEEFAKQQGVEMAENDYFITE  478
             GA+EFA+ Q V + + +YF+++
Sbjct  153  PGADEFAETQQVPLVDPEYFLSQ  175



>ref|WP_009099500.1| peptidase T2 asparaginase 2 [Rhodopirellula sp. SWK7]
 gb|EMI43600.1| peptidase T2 asparaginase 2 [Rhodopirellula sp. SWK7]
Length=468

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 92/146 (63%), Gaps = 1/146 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEAKAL-LTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAIA+HGGAG  P    E   E ++  L   L  G   L     A+D VE V+R +E DP
Sbjct  33   WAIAIHGGAGSSPAQLDEASSEKRSQGLQNALQKGRDLLAGGGTAVDTVEAVIRLMEDDP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            +FN+GRG+ LT  G  E++ASIMDG    CGAV+G+TKVKNP+SLAR VM  + H  LA 
Sbjct  93   IFNAGRGAVLTEDGRAELDASIMDGKTLGCGAVAGVTKVKNPISLARRVMTNTKHVLLAG  152

Query  410  SGAEEFAKQQGVEMAENDYFITEDNV  487
             GA+ FA  Q V + + DYFIT+ +V
Sbjct  153  PGADLFAAGQQVPLVDPDYFITKRDV  178



>ref|WP_034813444.1| asparaginase [Hyphomonas sp. L-53-1-40]
 gb|KCZ63842.1| hypothetical protein L53_04930 [Hyphomonas sp. L-53-1-40]
Length=329

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 92/144 (64%), Gaps = 2/144 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEA--KALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAGV     +  ++EA   A L   L  G + LR+   A+D VE  V  +E D
Sbjct  30   WRLVIHGGAGVITREGMSPEKEAAYTAALETALEAGAAVLRNGGSALDAVEAAVIPMEDD  89

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            PLFNSG G+  T  GT E++ASIMDG  R  GAV+G+T+V+NP+  AR VMD+S H   A
Sbjct  90   PLFNSGHGAVFTAAGTHELDASIMDGRARNAGAVAGVTRVRNPIKAARAVMDKSEHVMFA  149

Query  407  FSGAEEFAKQQGVEMAENDYFITE  478
             SGA+ FA+ QG+++ +N YF T+
Sbjct  150  GSGADAFAEAQGLDIVDNSYFDTD  173



>ref|WP_033023212.1| isoaspartyl peptidase [Pseudoalteromonas sp. Bsw20308]
Length=343

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +AIA+HGGAG          ++EE +A LT+ +  G   L     ++D V   +  LE  
Sbjct  27   FAIAIHGGAGTIEKARFTPAQEEEYRAKLTQAVETGYKVLHQGGESLDAVTAAIAVLEQS  86

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+GRG+  T+ G  E++ASIMDG  R  GAV+G+  +++P++LARLVMD S H  L+
Sbjct  87   PYFNAGRGAVYTYDGGHELDASIMDGRNREAGAVAGVKHIESPINLARLVMDNSVHVMLS  146

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAEEFAK+QGVE+ EN+ F TE     L  AK+
Sbjct  147  GQGAEEFAKEQGVELIENNLFDTESRYKALLKAKQ  181



>ref|WP_043406432.1| asparaginase [Cystobacter violaceus]
 gb|KFA89100.1| asparaginase [Cystobacter violaceus Cb vi76]
Length=371

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W I +HGGAGV    +L  ER+   +A+L   L  G + L     ++D V   VR +E  
Sbjct  50   WGIVIHGGAGVIKRESLTPEREAAVRAVLAESLQAGHAILAKGGSSLDAVTAAVRVMEDS  109

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            PLFN+G+G+  TH G  E++A+IM+G  R  G+V+G+  VKNP+ LAR VM++SPH  + 
Sbjct  110  PLFNAGKGAVFTHDGKNELDAAIMNGRTREAGSVAGLHHVKNPIVLARAVMEKSPHVMMI  169

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAK  517
             +GAE FA+QQGVE+ +  YF TE+    L+ A EA+
Sbjct  170  GAGAEAFARQQGVELVDPGYFHTEERWQSLQRALEAE  206



>ref|WP_012566613.1| asparaginase [Rhodospirillum centenum]
 gb|ACI98826.1| L-asparaginase, putative [Rhodospirillum centenum SW]
Length=351

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDPNLPLERQEEA--KALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W +AVHGGAG      +  + EA  +A L+  L  G + L +   A+D VE V+R LE D
Sbjct  27   WTLAVHGGAGTMDRERMGPETEASYRAALSAALERGSAVLEAGGSALDAVEAVIRGLEDD  86

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+GRG+  T  G +E++A++MDG   + GAV+G+T V++PVSLAR VMDRSPH  L 
Sbjct  87   PQFNAGRGAVFTADGRIELDAAVMDGATLKAGAVAGVTGVRHPVSLARAVMDRSPHVMLI  146

Query  407  FSGAEEFAKQQGVEMAENDYFITE  478
             +GAE+F ++ GVE A   +F TE
Sbjct  147  GAGAEQFGREAGVEQAPPSWFFTE  170



>ref|WP_008172390.1| asparaginase [Pseudoalteromonas sp. BSi20652]
 dbj|GAA61884.1| beta-aspartyl-peptidase [Pseudoalteromonas sp. BSi20652]
Length=343

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +AIA+HGGAG          +++E +A LT  +  G   LR    ++D V   +  LE  
Sbjct  27   FAIAIHGGAGTIEKARFTPAQEKEYRAKLTEAVETGYKVLRQGGESLDAVTAAITVLEQS  86

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+GRG+  T+ G  E++ASIMDG  R+ GAV+G+  +++P+ LARLVMD S H  L+
Sbjct  87   PYFNAGRGAVYTYDGGHELDASIMDGRNRQAGAVAGVKHIESPIKLARLVMDNSVHVMLS  146

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAEEFAK+QGVE+ EN+ F TE     L  AK+
Sbjct  147  GQGAEEFAKEQGVELIENNLFDTEPRYKALLKAKQ  181



>ref|WP_008222778.1| asparaginase [Rheinheimera nanhaiensis]
 dbj|GAB59821.1| beta-aspartyl-peptidase [Rheinheimera nanhaiensis E407-8]
Length=332

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 97/159 (61%), Gaps = 4/159 (3%)
 Frame = +2

Query  59   IAVHGGAGV---DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            I +HGGAG    D   P + Q    A+LT  +N G S L     ++D V   V  LE  P
Sbjct  25   IVIHGGAGTISRDSMTPAQEQAY-HAMLTHAVNQGYSVLERGGSSLDAVTAAVTILEDSP  83

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            LFN+G+G+  T   T E++ASIMDG  R  GAV+G+T VKNP+ LAR VM++S H  LA 
Sbjct  84   LFNAGKGAVYTFDETHELDASIMDGKSRNAGAVAGVTNVKNPILLARAVMEKSVHVMLAG  143

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAIL  526
             GAE+FAK+Q +E+ +N YF TE     LK AK+A A L
Sbjct  144  KGAEQFAKEQQLELVDNSYFNTEFRYEALKRAKQAIAPL  182



>ref|WP_008991605.1| asparaginase [Galbibacter marinus]
 gb|EKF55112.1| L-asparaginase [Galbibacter marinus]
Length=349

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = +2

Query  53   WAIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +AI +HGGAG  +  N+    +   K +L + + +G   L     ++D VE  +R LE  
Sbjct  39   FAIVIHGGAGTILKENISDSMELAYKTVLEQSVRMGYKILNDGGSSLDAVEACIRILEDS  98

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            PLFN+G+G+  T+  T E++ASIM+G  +  GAV+G+T +KNP++LAR VM++S H  LA
Sbjct  99   PLFNAGKGAVFTNNATNELDASIMEGRTKNAGAVAGVTTIKNPITLARAVMEQSEHVMLA  158

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAI  523
              GAEEFAKQ GV + + +YF TE  +  LK+A+   +I
Sbjct  159  REGAEEFAKQVGVTLVDPEYFYTESRMKALKVAQNKNSI  197



>ref|WP_040006961.1| isoaspartyl peptidase [Fibrisoma limi]
Length=343

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 97/160 (61%), Gaps = 3/160 (2%)
 Frame = +2

Query  56   AIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            A+ +HGGAG     N+   +++  +  L R L  G + LR    ++D VE  +  LE  P
Sbjct  26   ALVIHGGAGTISRKNMTPAKEKAYRETLNRSLQAGYAVLRKGGTSLDAVEAAIHVLEDSP  85

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            LFN+G+G+  TH G  E++ASIMDG   + GA++G+T +KNP+S AR VMD+S H  L  
Sbjct  86   LFNAGKGAVFTHDGKHELDASIMDGKTLKAGAIAGVTNIKNPISTARRVMDKSEHVMLMG  145

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLA-KEAKAIL  526
             GAE FAKQQ +E+ E  YF TE     L+ A KE K +L
Sbjct  146  QGAELFAKQQNMELVEPTYFYTEARWRALQEAIKEEKTVL  185



>emb|CCH56729.1| beta-aspartyl-peptidase (threonine type) [Fibrisoma limi BUZ 
3]
Length=344

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 97/160 (61%), Gaps = 3/160 (2%)
 Frame = +2

Query  56   AIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            A+ +HGGAG     N+   +++  +  L R L  G + LR    ++D VE  +  LE  P
Sbjct  27   ALVIHGGAGTISRKNMTPAKEKAYRETLNRSLQAGYAVLRKGGTSLDAVEAAIHVLEDSP  86

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            LFN+G+G+  TH G  E++ASIMDG   + GA++G+T +KNP+S AR VMD+S H  L  
Sbjct  87   LFNAGKGAVFTHDGKHELDASIMDGKTLKAGAIAGVTNIKNPISTARRVMDKSEHVMLMG  146

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLA-KEAKAIL  526
             GAE FAKQQ +E+ E  YF TE     L+ A KE K +L
Sbjct  147  QGAELFAKQQNMELVEPTYFYTEARWRALQEAIKEEKTVL  186



>ref|WP_024283520.1| isoaspartyl peptidase [Algoriphagus marincola]
Length=355

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 101/162 (62%), Gaps = 2/162 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +A+A+HGGAG      +  E++ E +A L   L+ G + L S   A+D V   V+ +E  
Sbjct  37   FALAIHGGAGTIKRETMSEEQEAEYRAKLKEALDAGYTVLESGGEALDAVIAAVKVMEDS  96

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            PLFN+G+G+  T++G  EM+A+IMDG  R  GAV+G+T VKNP++ AR VM+ SPH ++ 
Sbjct  97   PLFNAGKGAVFTNEGKNEMDAAIMDGRDRNAGAVAGLTTVKNPITAARAVMENSPHVFMT  156

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             +GAE FAK+Q +E+   DYF T+     L+  +E +    D
Sbjct  157  GAGAEVFAKEQELELVSPDYFYTDFRFQQLEKIRETEKTQLD  198



>ref|WP_007339179.1| asparaginase family protein [Rhodopirellula baltica]
 gb|ELP31653.1| asparaginase family protein [Rhodopirellula baltica SWK14]
Length=471

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 92/143 (64%), Gaps = 1/143 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++    L   L  G   L     A+D VE V+R LE DP
Sbjct  33   WAIVIHGGAGSSPAQLGDASSKQRTKGLQHALQTGRDMLADGATAMDTVEAVIRTLEDDP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            +FN+GRGS +T++G VEM++S+MDG    CGAV+G+T+VKNP+SLAR VM ++ H  L  
Sbjct  93   IFNAGRGSVVTNEGRVEMDSSVMDGKTLACGAVAGVTRVKNPISLARRVMTKTKHVLLVG  152

Query  410  SGAEEFAKQQGVEMAENDYFITE  478
             GA+EFA+ Q V + +  YF+++
Sbjct  153  PGADEFAETQQVPLVDPKYFLSQ  175



>gb|EKS14063.1| beta-aspartyl-peptidase [Pseudoalteromonas sp. Bsw20308]
Length=370

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +AIA+HGGAG          ++EE +A LT+ +  G   L     ++D V   +  LE  
Sbjct  54   FAIAIHGGAGTIEKARFTPAQEEEYRAKLTQAVETGYKVLHQGGESLDAVTAAIAVLEQS  113

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+GRG+  T+ G  E++ASIMDG  R  GAV+G+  +++P++LARLVMD S H  L+
Sbjct  114  PYFNAGRGAVYTYDGGHELDASIMDGRNREAGAVAGVKHIESPINLARLVMDNSVHVMLS  173

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAEEFAK+QGVE+ EN+ F TE     L  AK+
Sbjct  174  GQGAEEFAKEQGVELIENNLFDTESRYKALLKAKQ  208



>ref|WP_010161672.1| asparaginase [Sphingomonas sp. PAMC 26617]
Length=308

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 89/142 (63%), Gaps = 2/142 (1%)
 Frame = +2

Query  53   WAIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAG      L   + E A   L R L+ G + L     A+D VE  VR LE D
Sbjct  3    WTLMLHGGAGQMTPATLTPAQVEGATEALGRALDAGAAVLAGDGSALDAVEAAVRVLEDD  62

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FNSGRG+ALTH G  E++A+IMDG  R  G+V+G+T  ++PVSLAR VM  SPH  L+
Sbjct  63   PHFNSGRGAALTHDGIAELDAAIMDGRDRNAGSVAGVTATRHPVSLARAVMAHSPHVLLS  122

Query  407  FSGAEEFAKQQGVEMAENDYFI  472
             +GA+ FA++QG E A  D+ +
Sbjct  123  GAGADTFAREQGCEAATQDWLV  144



>ref|WP_039963566.1| asparaginase [Rhodopirellula europaea]
Length=473

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++  A L   L  G   L     A+D VE V+R LE +P
Sbjct  33   WAIVIHGGAGSSPAQLGEASSQKRTAGLQHALQTGRDMLADGATAMDTVEAVIRTLEDNP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            +FN+GRGS +T++G VEM++S+MDG    CGAV+G+T+VKNP+SLAR VM  + H  L  
Sbjct  93   IFNAGRGSVVTNEGRVEMDSSVMDGKTLACGAVAGVTRVKNPISLARRVMTETKHVLLVG  152

Query  410  SGAEEFAKQQGVEMAENDYFITE  478
             GA+EFA+ Q V + + +YF+++
Sbjct  153  PGADEFAEAQQVPLVDPEYFLSQ  175



>gb|EMB13625.1| Asparaginase family protein [Rhodopirellula europaea 6C]
Length=445

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++  A L   L  G   L     A+D VE V+R LE +P
Sbjct  5    WAIVIHGGAGSSPAQLGEASSQKRTAGLQHALQTGRDMLADGATAMDTVEAVIRTLEDNP  64

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            +FN+GRGS +T++G VEM++S+MDG    CGAV+G+T+VKNP+SLAR VM  + H  L  
Sbjct  65   IFNAGRGSVVTNEGRVEMDSSVMDGKTLACGAVAGVTRVKNPISLARRVMTETKHVLLVG  124

Query  410  SGAEEFAKQQGVEMAENDYFITE  478
             GA+EFA+ Q V + + +YF+++
Sbjct  125  PGADEFAEAQQVPLVDPEYFLSQ  147



>ref|WP_036968277.1| isoaspartyl peptidase [Providencia alcalifaciens]
 gb|EUD06013.1| asparaginase [Providencia alcalifaciens R90-1475]
Length=342

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 100/160 (63%), Gaps = 2/160 (1%)
 Frame = +2

Query  59   IAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            + +HGGAG      +  E+++E +  LT+ L  G + L     ++D V+  +  +E  PL
Sbjct  28   LVIHGGAGTITKNTITPEQEKEYQEKLTQALEAGYAVLNKGGSSLDAVQASINVMEDSPL  87

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FN+G+G+  TH+G  EM+ASIMDG  R+ GAV+G+T +KNP++ A  VM +SPH  +   
Sbjct  88   FNAGKGAVFTHEGKNEMDASIMDGSNRKAGAVAGVTNIKNPINAAYAVMTKSPHVMMVSK  147

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA +QG+E+ +  YF T+     L+ AKE + ++ D
Sbjct  148  GAEQFAAEQGLEIVDPSYFRTDFRWEQLQKAKEKEKVVLD  187



>ref|WP_006658094.1| asparaginase [Providencia alcalifaciens]
 gb|EEB46814.1| asparaginase [Providencia alcalifaciens DSM 30120]
 gb|EKT67070.1| exported L-asparaginase [Providencia alcalifaciens Dmel2]
 gb|ETT07313.1| asparaginase [Providencia alcalifaciens F90-2004]
 gb|EUC96638.1| asparaginase [Providencia alcalifaciens PAL-2]
 gb|EUD03198.1| asparaginase [Providencia alcalifaciens RIMD 1656011]
 gb|EUD09136.1| asparaginase [Providencia alcalifaciens 205/92]
Length=342

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 100/160 (63%), Gaps = 2/160 (1%)
 Frame = +2

Query  59   IAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDPL  232
            + +HGGAG      +  E+++E +  LT+ L  G + L     ++D V+  +  +E  PL
Sbjct  28   LVIHGGAGTITKNTITPEQEKEYQEKLTQALEAGYAVLNKGGSSLDAVQASINVMEDSPL  87

Query  233  FNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAFS  412
            FN+G+G+  TH+G  EM+ASIMDG  R+ GAV+G+T +KNP++ A  VM +SPH  +   
Sbjct  88   FNAGKGAVFTHEGKNEMDASIMDGSNRKAGAVAGVTNIKNPINAAYAVMTKSPHVMMVSK  147

Query  413  GAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
            GAE+FA +QG+E+ +  YF T+     L+ AKE + ++ D
Sbjct  148  GAEQFAAEQGLEIVDPSYFRTDFRWEQLQKAKEKEKVVLD  187



>ref|WP_010214369.1| asparaginase [Sphingomonas sp. PAMC 26621]
Length=308

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 89/142 (63%), Gaps = 2/142 (1%)
 Frame = +2

Query  53   WAIAVHGGAG--VDPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            W + +HGGAG      L   + E A   L R L+ G + L     A+D VE  VR LE D
Sbjct  3    WTLMLHGGAGQMTPATLTPAQVEGATEALGRALDAGAAVLAGDGSALDAVEAAVRVLEDD  62

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FNSGRG+ALTH G  E++A+IMDG  R  G+V+G+T  ++PVSLAR VM  SPH  L+
Sbjct  63   PHFNSGRGAALTHDGVAELDAAIMDGRDRNAGSVAGVTATRHPVSLARAVMAHSPHVLLS  122

Query  407  FSGAEEFAKQQGVEMAENDYFI  472
             +GA+ FA++QG E A  D+ +
Sbjct  123  GAGADMFAREQGCEAATQDWLV  144



>ref|WP_033038482.1| isoaspartyl peptidase [Pseudoalteromonas sp. S3431]
Length=343

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +AIA+HGGAG          +++E +A LT+ +  G   L     ++D V   +  LE  
Sbjct  27   FAIAIHGGAGTIEKARFTPAQEKEYRAKLTQAVETGYKVLHQGGESLDAVTAAIAVLEQS  86

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+GRG+  T+ G  E++ASIMDG  R  GAV+G+  +++P++LARLVMD S H  L+
Sbjct  87   PYFNAGRGAVYTYDGGHELDASIMDGRNREAGAVAGVKHIESPINLARLVMDNSVHVMLS  146

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAEEFAK+QGVE+ EN+ F TE     L  AK+
Sbjct  147  GQGAEEFAKEQGVELIENNLFDTESRYKALLKAKQ  181



>gb|KDC55075.1| isoaspartyl peptidase [Pseudoalteromonas sp. S3431]
Length=344

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +AIA+HGGAG          +++E +A LT+ +  G   L     ++D V   +  LE  
Sbjct  28   FAIAIHGGAGTIEKARFTPAQEKEYRAKLTQAVETGYKVLHQGGESLDAVTAAIAVLEQS  87

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+GRG+  T+ G  E++ASIMDG  R  GAV+G+  +++P++LARLVMD S H  L+
Sbjct  88   PYFNAGRGAVYTYDGGHELDASIMDGRNREAGAVAGVKHIESPINLARLVMDNSVHVMLS  147

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAEEFAK+QGVE+ EN+ F TE     L  AK+
Sbjct  148  GQGAEEFAKEQGVELIENNLFDTESRYKALLKAKQ  182



>ref|WP_004242876.1| asparaginase [Proteus mirabilis]
 emb|CAR42608.1| putative exported L-asparaginase [Proteus mirabilis HI4320]
 gb|EEI49182.1| asparaginase [Proteus mirabilis ATCC 29906]
 gb|EKA97756.1| hypothetical protein HMPREF1310_02018 [Proteus mirabilis WGLW4]
 gb|EKB00840.1| hypothetical protein HMPREF1311_01179 [Proteus mirabilis WGLW6]
 gb|AGS59723.1| exported L-asparaginase [Proteus mirabilis BB2000]
 gb|KGY38247.1| isoaspartyl peptidase [Proteus mirabilis]
 gb|KGY41989.1| isoaspartyl peptidase [Proteus mirabilis]
 gb|KGZ02347.1| isoaspartyl peptidase [Proteus mirabilis]
Length=345

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 101/161 (63%), Gaps = 4/161 (2%)
 Frame = +2

Query  59   IAVHGGAGV---DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            + +HGGAG    D   P E+++E KA LT  LN G + L S   +I+ V+  +  +E  P
Sbjct  32   LVIHGGAGTITKDTITP-EQEKEYKAKLTEALNAGYAVLNSGGTSIEAVQKSINVMEDSP  90

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            LFN+G+G+  TH G  E++ASIMDG  R+ GAV+G+T VKNP++ A  VM++SPH  +  
Sbjct  91   LFNAGKGAVFTHDGRNELDASIMDGKTRKAGAVAGVTTVKNPINAAIAVMEKSPHVMMVS  150

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKEAKAILFD  532
             GA+ FAK+QG+ + +  YF TE     L+ A E + ++ D
Sbjct  151  QGADLFAKEQGLTIVDPSYFRTEYRWQQLQKALEKEQVVLD  191



>ref|WP_008487330.1| asparaginase [Idiomarina xiamenensis]
 gb|EKE86919.1| asparaginase [Idiomarina xiamenensis 10-D-4]
Length=342

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 2/154 (1%)
 Frame = +2

Query  56   AIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            AIA+HGGAG     NL  E+++  K  L + L+ G + L     + D V   ++ +E  P
Sbjct  31   AIAIHGGAGTITRANLSAEQEQAYKDKLKQALDAGYAVLEKGGNSTDAVIAAIQIMEDSP  90

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            LFN+GRG+  T  G  E++ASIM G     GAV+G+  VK+P+ LAR VMD+S H  L+ 
Sbjct  91   LFNAGRGAVYTWDGEHELDASIMSGANGNAGAVAGVKTVKSPIQLARTVMDKSVHVMLSG  150

Query  410  SGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
            SGAE+FAKQQG+   +NDYF TE  +  L  AK+
Sbjct  151  SGAEQFAKQQGLTQVDNDYFDTEQRLQQLNRAKQ  184



>ref|WP_033015518.1| isoaspartyl peptidase [Pseudoalteromonas sp. BSi20495]
Length=343

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +AIA+HGGAG          +++E +A LT+ +  G   L     ++D V   +  LE  
Sbjct  27   FAIAIHGGAGTIEKARFTPAQEKEYRAKLTQAVETGYKVLHQGGESLDAVTAAIAVLEQS  86

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+GRG+  T+ G  E++ASIMDG  R  GAV+G+  +++P++LARLVMD S H  L+
Sbjct  87   PYFNAGRGAVYTYDGGHELDASIMDGRNREAGAVAGVKHIESPINLARLVMDNSVHVMLS  146

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAEEFAK+QGVE+ EN+ F TE     L  AK+
Sbjct  147  GQGAEEFAKEQGVELIENNLFDTESRYKALLKAKQ  181



>ref|WP_039487338.1| MULTISPECIES: isoaspartyl peptidase [Pseudoalteromonas]
 gb|KHM49483.1| isoaspartyl peptidase [Pseudoalteromonas flavipulchra NCIMB 2033 
= ATCC BAA-314]
 gb|KID39569.1| isoaspartyl peptidase [Pseudoalteromonas distincta]
Length=343

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 96/155 (62%), Gaps = 2/155 (1%)
 Frame = +2

Query  53   WAIAVHGGAGV--DPNLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETD  226
            +AIA+HGGAG          +++E +A LT+ +  G   L     ++D V   +  LE  
Sbjct  27   FAIAIHGGAGTIEKARFTPAQEKEYRAKLTQAVETGYKVLHQGGESLDAVIAAIAVLEQS  86

Query  227  PLFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLA  406
            P FN+GRG+  T+ G  E++ASIMDG  R  GAVSG+  +++P++LARLVMD S H  L+
Sbjct  87   PYFNAGRGAVYTYDGGHELDASIMDGRNREAGAVSGVKHIESPINLARLVMDNSVHVMLS  146

Query  407  FSGAEEFAKQQGVEMAENDYFITEDNVGMLKLAKE  511
              GAEEFAK+QGVE+ EN+ F TE     L  AK+
Sbjct  147  GQGAEEFAKEQGVELVENNLFDTEPRYKALLKAKQ  181



>ref|WP_011121656.1| asparaginase [Rhodopirellula baltica]
 ref|NP_868129.1| L-asparaginase [Rhodopirellula baltica SH 1]
 emb|CAD78407.1| L-asparaginase [Rhodopirellula baltica SH 1]
Length=471

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 91/143 (64%), Gaps = 1/143 (1%)
 Frame = +2

Query  53   WAIAVHGGAGVDP-NLPLERQEEAKALLTRCLNLGISALRSSLPAIDVVELVVRELETDP  229
            WAI +HGGAG  P  L     ++    L   L  G   L     A+D VE V+R LE DP
Sbjct  33   WAIVIHGGAGSSPAQLGDASSKQRTKGLQHALQTGRDMLADGATAMDTVEAVIRTLEDDP  92

Query  230  LFNSGRGSALTHKGTVEMEASIMDGHGRRCGAVSGITKVKNPVSLARLVMDRSPHSYLAF  409
            +FN+GRGS +T++G VEM++S+MDG    CGAV+G+T+VKNP+SLAR VM  + H  L  
Sbjct  93   IFNAGRGSVVTNEGRVEMDSSVMDGKTLACGAVAGVTRVKNPISLARRVMTETKHVLLVG  152

Query  410  SGAEEFAKQQGVEMAENDYFITE  478
             GA+EFA+ Q V + +  YF+++
Sbjct  153  PGADEFAETQQVPLVDPKYFLSQ  175



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200