BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M02

Length=606
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007135360.1|  hypothetical protein PHAVU_010G122800g             238   4e-75   Phaseolus vulgaris [French bean]
gb|AGV54302.1|  ubiquitin conjugating enzyme 2                          238   5e-75   Phaseolus vulgaris [French bean]
gb|AAY44872.1|  ubiquitinating enzyme                                   236   7e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CBI35791.3|  unnamed protein product                                239   8e-75   Vitis vinifera
ref|XP_003528740.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    236   2e-74   Glycine max [soybeans]
ref|NP_001241297.1|  uncharacterized protein LOC100789952               236   3e-74   Glycine max [soybeans]
ref|XP_007215904.1|  hypothetical protein PRUPE_ppa010775mg             235   3e-74   Prunus persica
ref|NP_199854.1|  ubiquitin-conjugating enzyme 33                       236   3e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281013.1|  hypothetical protein CARUB_v10027028mg             235   4e-74   Capsella rubella
gb|KHN15844.1|  Ubiquitin-conjugating enzyme E2 34                      235   4e-74   Glycine soja [wild soybean]
emb|CDX81813.1|  BnaC08g37880D                                          235   4e-74   
ref|XP_004303762.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    235   6e-74   Fragaria vesca subsp. vesca
ref|XP_006416722.1|  hypothetical protein EUTSA_v10009625mg             234   7e-74   Eutrema salsugineum [saltwater cress]
ref|XP_004510574.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    234   7e-74   Cicer arietinum [garbanzo]
ref|XP_006305567.1|  hypothetical protein CARUB_v10010163mg             234   8e-74   Capsella rubella
gb|AAY44873.1|  ubiquitinating enzyme                                   234   8e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442532.1|  PREDICTED: probable ubiquitin-conjugating en...    234   9e-74   Camelina sativa [gold-of-pleasure]
ref|XP_002892944.1|  ubiquitin-conjugating enzyme 32                    234   1e-73   
ref|XP_010482359.1|  PREDICTED: probable ubiquitin-conjugating en...    234   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009117711.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    234   1e-73   Brassica rapa
ref|XP_011079251.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    234   1e-73   Sesamum indicum [beniseed]
ref|XP_002264017.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    234   1e-73   Vitis vinifera
ref|XP_009606556.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    234   1e-73   Nicotiana tomentosiformis
ref|XP_011072703.1|  PREDICTED: probable ubiquitin-conjugating en...    234   2e-73   Sesamum indicum [beniseed]
ref|XP_010442125.1|  PREDICTED: probable ubiquitin-conjugating en...    234   2e-73   Camelina sativa [gold-of-pleasure]
gb|AFK39814.1|  unknown                                                 233   2e-73   Lotus japonicus
ref|XP_009796486.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    233   2e-73   Nicotiana sylvestris
ref|NP_173172.1|  ubiquitin-conjugating enzyme E2 34                    233   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498072.1|  PREDICTED: ubiquitin-conjugating enzyme E2 34      233   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010476872.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    233   3e-73   Camelina sativa [gold-of-pleasure]
ref|NP_001234557.1|  ubiquitin conjugating enzyme 2                     233   3e-73   
emb|CDO97785.1|  unnamed protein product                                233   4e-73   Coffea canephora [robusta coffee]
ref|XP_007024780.1|  Ubiquitin-conjugating enzyme 33 isoform 5          230   5e-73   
ref|XP_010540108.1|  PREDICTED: ubiquitin-conjugating enzyme E2 34      232   5e-73   Tarenaya hassleriana [spider flower]
ref|XP_006342888.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    233   5e-73   Solanum tuberosum [potatoes]
gb|KHG15672.1|  Ubiquitin-conjugating enzyme E2 34 -like protein        232   7e-73   Gossypium arboreum [tree cotton]
ref|XP_002865805.1|  hypothetical protein ARALYDRAFT_495109             232   7e-73   
gb|KHG17057.1|  Ubiquitin-conjugating enzyme E2 34 -like protein        232   7e-73   Gossypium arboreum [tree cotton]
ref|XP_007024776.1|  Ubiquitin-conjugating enzyme 34 isoform 1          232   8e-73   
gb|AFK36204.1|  unknown                                                 229   8e-73   Medicago truncatula
gb|KJB67068.1|  hypothetical protein B456_010G173000                    232   8e-73   Gossypium raimondii
ref|XP_009619784.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    232   8e-73   Nicotiana tomentosiformis
ref|XP_003627464.1|  Ubiquitin carrier protein E2                       232   8e-73   Medicago truncatula
ref|XP_010033652.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    232   9e-73   Eucalyptus grandis [rose gum]
gb|AFV96170.1|  ubiquitin conjugating enzyme J2                         232   1e-72   Camellia oleifera [abura-tsubaki]
gb|KDP40624.1|  hypothetical protein JCGZ_24623                         231   1e-72   Jatropha curcas
gb|EPS59194.1|  ubiquitin conjugating enzyme 2                          231   1e-72   Genlisea aurea
ref|XP_010459303.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    231   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006369076.1|  ubiquitin-conjugating enzyme family protein        231   2e-72   
ref|XP_009781008.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    230   2e-72   Nicotiana sylvestris
ref|XP_011048632.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    230   4e-72   Populus euphratica
ref|XP_008340154.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    230   4e-72   
ref|XP_009149175.1|  PREDICTED: ubiquitin-conjugating enzyme E2 34      230   4e-72   Brassica rapa
ref|XP_008380727.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    230   5e-72   Malus domestica [apple tree]
emb|CDY48483.1|  BnaC05g13430D                                          230   5e-72   Brassica napus [oilseed rape]
ref|XP_009110416.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    229   6e-72   Brassica rapa
ref|XP_002533817.1|  ubiquitin-conjugating enzyme E2 j2, putative       229   7e-72   Ricinus communis
ref|XP_004144451.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    229   1e-71   Cucumis sativus [cucumbers]
ref|XP_008460359.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    229   2e-71   Cucumis melo [Oriental melon]
ref|XP_006402094.1|  hypothetical protein EUTSA_v10014520mg             229   2e-71   
ref|XP_006426808.1|  hypothetical protein CICLE_v10026383mg             228   2e-71   Citrus clementina [clementine]
ref|XP_010537655.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    228   2e-71   Tarenaya hassleriana [spider flower]
gb|KJB70036.1|  hypothetical protein B456_011G054900                    233   3e-71   Gossypium raimondii
ref|XP_006357427.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    227   5e-71   Solanum tuberosum [potatoes]
ref|XP_007024777.1|  Ubiquitin-conjugating enzyme 34 isoform 2          227   6e-71   
emb|CDX83915.1|  BnaC08g17300D                                          227   6e-71   
ref|XP_006465798.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    227   8e-71   Citrus sinensis [apfelsine]
ref|XP_011031819.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    227   8e-71   Populus euphratica
ref|XP_004241904.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    226   1e-70   Solanum lycopersicum
gb|ABR17368.1|  unknown                                                 225   4e-70   Picea sitchensis
gb|AAC32141.1|  probable ubiquitin-conjugating enzyme E2                225   5e-70   Picea mariana [black spruce]
gb|ABK25198.1|  unknown                                                 225   5e-70   Picea sitchensis
ref|XP_010096535.1|  Ubiquitin-conjugating enzyme E2 34                 224   8e-70   Morus notabilis
gb|EYU21267.1|  hypothetical protein MIMGU_mgv1a012803mg                222   7e-69   Erythranthe guttata [common monkey flower]
ref|XP_010273799.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    222   9e-69   Nelumbo nucifera [Indian lotus]
ref|XP_004241903.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    220   3e-68   Solanum lycopersicum
ref|XP_001783467.1|  predicted protein                                  218   3e-67   
ref|XP_002966123.1|  ubiquitin-conjugating enzyme 33, E2                217   5e-67   
ref|XP_010932329.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    217   6e-67   Elaeis guineensis
ref|XP_010917360.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    216   1e-66   Elaeis guineensis
ref|XP_008803381.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    216   2e-66   Phoenix dactylifera
ref|XP_010685207.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    215   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009380708.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    213   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001132346.1|  uncharacterized protein LOC100193789               212   7e-65   Zea mays [maize]
gb|AFV13470.1|  ubiquitin conjugating enzyme 2                          211   9e-65   Coix lacryma-jobi
ref|XP_004964602.1|  PREDICTED: probable ubiquitin-conjugating en...    211   9e-65   Setaria italica
gb|AFV13460.1|  ubiquitin conjugating enzyme 2                          211   1e-64   Tripsacum dactyloides
ref|NP_001149627.1|  ubiquitin-conjugating enzyme E2 J2                 211   1e-64   Zea mays [maize]
ref|XP_002438001.1|  hypothetical protein SORBIDRAFT_10g006220          211   1e-64   Sorghum bicolor [broomcorn]
gb|AEJ07950.1|  ubiquitin conjugating enzyme 2                          211   1e-64   Sorghum propinquum
gb|ACA21862.1|  ubiquitin conjugating enzyme 2                          211   1e-64   Zea mays [maize]
gb|AEJ07935.1|  ubiquitin conjugating enzyme 2                          211   1e-64   Zea diploperennis [chapule]
gb|ABF67916.1|  ubiquitin conjugating enzyme 2                          211   1e-64   Zea mays [maize]
gb|AAV64221.1|  uce2                                                    213   3e-64   Zea mays [maize]
ref|XP_006828590.1|  hypothetical protein AMTR_s00129p00050230          209   5e-64   Amborella trichopoda
ref|XP_009399634.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    208   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003627465.1|  Ubiquitin carrier protein E2                       204   2e-63   
ref|NP_001057040.1|  Os06g0193000                                       207   3e-63   
ref|XP_006655872.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    207   3e-63   Oryza brachyantha
gb|EMS52702.1|  putative ubiquitin-conjugating enzyme E2 33             206   7e-63   Triticum urartu
ref|XP_003564160.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    204   4e-62   Brachypodium distachyon [annual false brome]
gb|KGN58478.1|  hypothetical protein Csa_3G646650                       205   1e-60   Cucumis sativus [cucumbers]
ref|XP_002303334.1|  ubiquitin-conjugating enzyme family protein        200   2e-60   
ref|NP_001032049.1|  ubiquitin-conjugating enzyme 33                    199   6e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KDO53756.1|  hypothetical protein CISIN_1g026499mg                   189   3e-56   Citrus sinensis [apfelsine]
dbj|BAJ94522.1|  predicted protein                                      179   8e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001701298.1|  hypothetical protein CHLREDRAFT_132639             177   2e-52   Chlamydomonas reinhardtii
ref|XP_002947154.1|  hypothetical protein VOLCADRAFT_103384             180   4e-52   Volvox carteri f. nagariensis
ref|XP_005646984.1|  UBC-like protein                                   176   5e-51   Coccomyxa subellipsoidea C-169
ref|XP_004340456.1|  Ubiquitinconjugating enzyme subfamily protein      174   3e-50   Acanthamoeba castellanii str. Neff
ref|XP_005763276.1|  hypothetical protein EMIHUDRAFT_357983             169   3e-49   Emiliania huxleyi CCMP1516
ref|XP_005849942.1|  hypothetical protein CHLNCDRAFT_12197              169   3e-49   Chlorella variabilis
ref|XP_008912815.1|  hypothetical protein PPTG_16981                    167   3e-48   Phytophthora parasitica INRA-310
ref|XP_008912814.1|  hypothetical protein PPTG_16980                    167   6e-48   Phytophthora parasitica INRA-310
gb|EWM21161.1|  ubiquitin-conjugating enzyme e2 j2 isoform 2            167   7e-48   Nannochloropsis gaditana
ref|XP_002903723.1|  ubiquitin-conjugating enzyme E2                    166   1e-47   Phytophthora infestans T30-4
ref|XP_009525163.1|  hypothetical protein PHYSODRAFT_491377             166   2e-47   Phytophthora sojae
emb|CBJ28210.1|  conserved unknown protein                              167   4e-47   Ectocarpus siliculosus
ref|XP_003060658.1|  predicted protein                                  163   6e-47   Micromonas pusilla CCMP1545
ref|XP_002903724.1|  ubiquitin-conjugating enzyme E2, putative          165   7e-47   Phytophthora infestans T30-4
ref|XP_002296203.1|  predicted protein                                  162   2e-46   Thalassiosira pseudonana CCMP1335
ref|XP_005841120.1|  hypothetical protein GUITHDRAFT_63988              160   1e-45   Guillardia theta CCMP2712
ref|XP_003489308.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    161   2e-45   Bombus impatiens
ref|XP_003403106.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    161   2e-45   Bombus terrestris [large earth bumblebee]
ref|XP_008560052.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    161   2e-45   
ref|XP_396699.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2-like    161   3e-45   Apis mellifera [bee]
ref|XP_005716871.1|  unnamed protein product                            160   3e-45   Chondrus crispus [carageen]
gb|EJK57366.1|  hypothetical protein THAOC_22597                        160   4e-45   Thalassiosira oceanica
emb|CEP13105.1|  hypothetical protein                                   161   4e-45   Parasitella parasitica
gb|EFX81890.1|  hypothetical protein DAPPUDRAFT_302785                  160   4e-45   Daphnia pulex
ref|XP_007417673.1|  hypothetical protein MELLADRAFT_40482              157   1e-44   Melampsora larici-populina 98AG31
ref|XP_007382733.1|  UBC-like protein                                   160   2e-44   Punctularia strigosozonata HHB-11173 SS5
ref|XP_002181137.1|  predicted protein                                  159   2e-44   Phaeodactylum tricornutum CCAP 1055/1
emb|CDR38464.1|  CYFA0S02e01970g1_1                                     159   2e-44   Cyberlindnera fabianii
ref|XP_009549427.1|  hypothetical protein HETIRDRAFT_324309             157   3e-44   Heterobasidion irregulare TC 32-1
gb|EPB88610.1|  ubiquitin-conjugating enzyme E2 J2                      159   3e-44   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_011275733.1|  Ubiquitin-conjugating enzyme E2                    160   3e-44   Wickerhamomyces ciferrii
ref|XP_003701122.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    158   4e-44   Megachile rotundata
ref|XP_002548161.1|  ubiquitin-conjugating enzyme E2 6                  157   4e-44   Candida tropicalis MYA-3404
ref|XP_004201939.1|  Piso0_001405                                       158   6e-44   
gb|EIE91493.1|  hypothetical protein RO3G_16204                         155   6e-44   Rhizopus delemar RA 99-880
gb|AEE62267.1|  unknown                                                 157   6e-44   Dendroctonus ponderosae
gb|EFN77898.1|  Ubiquitin-conjugating enzyme E2 J2                      157   6e-44   Harpegnathos saltator
ref|XP_011031822.1|  PREDICTED: ubiquitin-conjugating enzyme E2 3...    157   6e-44   Populus euphratica
emb|CCA17577.1|  ubiquitinconjugating enzyme E2 putative                157   6e-44   Albugo laibachii Nc14
gb|KDR18969.1|  Ubiquitin-conjugating enzyme E2 J2                      157   7e-44   Zootermopsis nevadensis
ref|XP_011149434.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      157   8e-44   Harpegnathos saltator
gb|EGA75167.1|  Ubc6p                                                   155   1e-43   Saccharomyces cerevisiae AWRI796
emb|CDK25885.1|  unnamed protein product                                157   1e-43   Kuraishia capsulata CBS 1993
ref|XP_007362840.1|  UBC-like protein                                   157   2e-43   Dichomitus squalens LYAD-421 SS1
ref|XP_011410307.1|  PREDICTED: structural maintenance of chromos...    167   2e-43   
emb|CEG67008.1|  Putative Ubiquitin-conjugating enzyme E2 J2            156   2e-43   Rhizopus microsporus
ref|XP_011257000.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    156   2e-43   Camponotus floridanus
dbj|GAN10580.1|  conserved hypothetical protein                         157   2e-43   Mucor ambiguus
ref|XP_011158987.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      156   2e-43   Solenopsis invicta [imported red fire ant]
ref|XP_008215286.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    156   3e-43   Nasonia vitripennis
ref|XP_007322517.1|  hypothetical protein SERLADRAFT_351869             154   3e-43   Serpula lacrymans var. lacrymans S7.9
ref|XP_973818.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2         155   3e-43   Tribolium castaneum [rust-red flour beetle]
ref|XP_004202564.1|  Piso0_001405                                       156   3e-43   
ref|XP_005647948.1|  UBC-like protein                                   155   3e-43   Coccomyxa subellipsoidea C-169
ref|NP_011026.3|  E2 ubiquitin-conjugating protein UBC6                 156   3e-43   Saccharomyces cerevisiae S288C
ref|XP_002405482.1|  ubiquitin protein ligase, putative                 154   4e-43   Ixodes scapularis [blacklegged tick]
emb|CDS09230.1|  Putative Ubiquitin-conjugating enzyme E2 6             156   4e-43   Lichtheimia ramosa
gb|EDN63076.1|  ubiquitin-conjugating enzyme                            156   4e-43   Saccharomyces cerevisiae YJM789
emb|CCI39487.1|  unnamed protein product                                155   4e-43   Albugo candida
emb|CDH59575.1|  ubc-like protein                                       156   4e-43   Lichtheimia corymbifera JMRC:FSU:9682
gb|EHN02769.1|  Ubc6p                                                   156   4e-43   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|EPT03069.1|  hypothetical protein FOMPIDRAFT_19405                   153   4e-43   Fomitopsis pinicola FP-58527 SS1
ref|XP_003959920.1|  hypothetical protein KAFR_0L01750                  156   5e-43   Kazachstania africana CBS 2517
ref|XP_007261327.1|  UBC-like protein                                   156   5e-43   Fomitiporia mediterranea MF3/22
gb|EGA59013.1|  Ubc6p                                                   155   5e-43   Saccharomyces cerevisiae FostersB
gb|EWG96518.1|  Ubc6p                                                   155   6e-43   Saccharomyces cerevisiae R103
ref|XP_011331927.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    155   6e-43   Ooceraea biroi
gb|KIP03433.1|  hypothetical protein PHLGIDRAFT_121586                  155   7e-43   Phlebiopsis gigantea 11061_1 CR5-6
gb|EHJ76300.1|  putative Ubiquitin-conjugating enzyme E2 J2             154   8e-43   
gb|EHN07620.1|  Ubc6p                                                   155   8e-43   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|EGA79225.1|  Ubc6p                                                   155   8e-43   Saccharomyces cerevisiae Vin13
ref|XP_002735278.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    155   8e-43   Saccoglossus kowalevskii
ref|XP_011499227.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    155   9e-43   Ceratosolen solmsi marchali
ref|XP_009162300.1|  hypothetical protein T265_00291                    156   9e-43   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_004180086.1|  hypothetical protein TBLA_0D00600                  155   1e-42   Tetrapisispora blattae CBS 6284
gb|KDQ19061.1|  hypothetical protein BOTBODRAFT_103425                  152   1e-42   Botryobasidium botryosum FD-172 SS1
ref|XP_007849131.1|  ubiquitin-conjugating enzyme e2 6                  155   1e-42   
gb|KDR70980.1|  hypothetical protein GALMADRAFT_144442                  155   1e-42   Galerina marginata CBS 339.88
ref|XP_011297863.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    154   1e-42   Fopius arisanus
ref|XP_007343684.1|  UBC-like protein                                   155   1e-42   
emb|CCK68678.1|  hypothetical protein KNAG_0B02360                      155   1e-42   Kazachstania naganishii CBS 8797
ref|XP_011256999.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-42   
gb|KEZ43409.1|  Ubiquitin-conjugating enzyme E2 J2                      155   1e-42   Scedosporium apiospermum
ref|XP_008613711.1|  ubiquitin-conjugating enzyme E2 J2                 152   1e-42   Saprolegnia diclina VS20
ref|XP_001512053.2|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      155   1e-42   
ref|XP_011103222.1|  ubc6p                                              154   1e-42   
ref|XP_005109064.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    154   2e-42   Aplysia californica
ref|XP_008038611.1|  UBC-like protein                                   152   2e-42   Trametes versicolor FP-101664 SS1
emb|CEP60262.1|  LALA0S01e06678g1_1                                     154   2e-42   Lachancea lanzarotensis
ref|XP_004363366.1|  ubiquitin conjugating enzyme protein 26            154   2e-42   Capsaspora owczarzaki ATCC 30864
gb|KFD53233.1|  hypothetical protein M513_05943                         158   2e-42   Trichuris suis
gb|KHJ40782.1|  ubiquitin--protein ligase                               158   2e-42   Trichuris suis
ref|XP_003326606.2|  ubiquitin-conjugating enzyme E2 J2                 154   2e-42   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_009033312.1|  hypothetical protein AURANDRAFT_20698              151   2e-42   Aureococcus anophagefferens
ref|XP_003337843.1|  ubiquitin-conjugating enzyme E2 J2                 151   2e-42   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|KIM88382.1|  hypothetical protein PILCRDRAFT_255471                  154   2e-42   Piloderma croceum F 1598
gb|AAX27905.2|  SJCHGC03539 protein                                     153   2e-42   Schistosoma japonicum
gb|EAW56264.1|  ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog...    151   2e-42   Homo sapiens [man]
emb|CAJ81624.1|  ubiquitin-conjugating enzyme E2, J2 (UBC6 homolo...    151   3e-42   Xenopus tropicalis [western clawed frog]
emb|CAF89614.1|  unnamed protein product                                152   3e-42   Tetraodon nigroviridis
gb|EMD38985.1|  hypothetical protein CERSUDRAFT_81780                   152   3e-42   Gelatoporia subvermispora B
ref|NP_001156134.1|  ubiquitin-conjugating enzyme E2 j2-like            153   3e-42   Acyrthosiphon pisum
ref|XP_010078958.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      151   3e-42   Pterocles gutturalis
emb|CAX70684.1|  hypotherical protein                                   153   3e-42   Schistosoma japonicum
pdb|2F4W|A  Chain A, Human Ubiquitin-Conjugating Enzyme E2 J2           152   4e-42   Homo sapiens [man]
ref|XP_007865380.1|  UBC-like protein                                   154   4e-42   Gloeophyllum trabeum ATCC 11539
emb|CCD60803.1|  ubiquitin-conjugating enzyme E2 j2, putative           153   4e-42   Schistosoma mansoni
gb|ESA22793.1|  hypothetical protein GLOINDRAFT_342500                  155   4e-42   
ref|XP_002602305.1|  hypothetical protein BRAFLDRAFT_115538             153   4e-42   Branchiostoma floridae
ref|XP_002811667.3|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    150   5e-42   
ref|XP_011054352.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   5e-42   Acromyrmex echinatior
gb|EGI65589.1|  Ubiquitin-conjugating enzyme E2 J2                      152   5e-42   Acromyrmex echinatior
emb|CCD60802.1|  ubiquitin-conjugating enzyme E2 j2, putative           152   5e-42   Schistosoma mansoni
gb|KIK49007.1|  hypothetical protein CY34DRAFT_797380                   154   5e-42   Suillus luteus UH-Slu-Lm8-n1
ref|XP_003973665.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    153   5e-42   
gb|EPQ10825.1|  Ubiquitin-conjugating enzyme E2 J2                      150   6e-42   Myotis brandtii
gb|KDO27448.1|  hypothetical protein SPRG_07036                         151   6e-42   Saprolegnia parasitica CBS 223.65
ref|XP_005986058.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      153   6e-42   Latimeria chalumnae
gb|EDL15057.1|  ubiquitin-conjugating enzyme E2, J2 homolog (yeas...    151   7e-42   Mus musculus [mouse]
ref|XP_009444627.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   7e-42   
emb|CAX70683.1|  hypotherical protein                                   152   7e-42   Schistosoma japonicum
ref|XP_001884237.1|  predicted protein                                  150   7e-42   Laccaria bicolor S238N-H82
ref|XP_006641956.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    153   7e-42   Lepisosteus oculatus
ref|XP_794726.3|  PREDICTED: ubiquitin-conjugating enzyme E2 J2-like    156   8e-42   
ref|XP_010625991.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   8e-42   Fukomys damarensis [Damara mole rat]
ref|NP_001088550.1|  ubiquitin-conjugating enzyme E2, J2                153   9e-42   Xenopus laevis [clawed frog]
ref|NP_001271243.1|  ubiquitin-conjugating enzyme E2 J2 isoform c       152   9e-42   Mus musculus [mouse]
ref|NP_001106369.1|  ubiquitin-conjugating enzyme E2 J2                 153   9e-42   Xenopus tropicalis [western clawed frog]
ref|XP_008639446.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      151   9e-42   
ref|XP_417582.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2 i...    152   9e-42   Gallus gallus [bantam]
ref|XP_003279745.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   9e-42   Nomascus leucogenys [White-cheeked Gibbon]
gb|KJA14603.1|  hypothetical protein HYPSUDRAFT_48986                   153   9e-42   Hypholoma sublateritium FD-334 SS-4
ref|XP_006732486.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Leptonychotes weddellii
ref|NP_001188113.1|  ubiquitin-conjugating enzyme e2 j2                 152   1e-41   Ictalurus punctatus
ref|XP_004545428.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    150   1e-41   
ref|XP_003891000.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Papio anubis [baboon]
gb|KIK55277.1|  hypothetical protein GYMLUDRAFT_48000                   153   1e-41   Gymnopus luxurians FD-317 M1
ref|XP_004407458.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Odobenus rosmarus divergens
ref|XP_011282698.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Felis catus [cat]
ref|XP_003939712.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Saimiri boliviensis boliviensis
ref|XP_008998466.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
gb|KII87129.1|  hypothetical protein PLICRDRAFT_42784                   152   1e-41   Plicaturopsis crispa FD-325 SS-3
dbj|GAA47842.1|  ubiquitin-conjugating enzyme E2 J2                     161   1e-41   Clonorchis sinensis [oriental liver fluke]
ref|NP_477515.2|  ubiquitin-conjugating enzyme E2 J2 isoform 2          152   1e-41   Homo sapiens [man]
ref|XP_010375488.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Rhinopithecus roxellana
ref|XP_848334.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2 i...    152   1e-41   Canis lupus familiaris [dogs]
ref|XP_004784051.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   
ref|XP_004024495.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_003809542.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   Pan paniscus [bonobo]
ref|XP_007648819.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   Cricetulus griseus [Chinese hamsters]
ref|XP_004639639.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Octodon degus
ref|XP_004599574.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Ochotona princeps [southern American pika]
ref|XP_009512935.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Phalacrocorax carbo [common cormorant]
ref|XP_007070260.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Chelonia mydas [green seaturtle]
ref|XP_003765232.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Sarcophilus harrisii
ref|XP_002929870.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Ailuropoda melanoleuca
ref|XP_010625989.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   Fukomys damarensis [Damara mole rat]
ref|XP_004880533.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|XP_007554214.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Poecilia formosa
ref|XP_003441582.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   Oreochromis niloticus
ref|XP_006784524.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   Neolamprologus brichardi [lyretail cichlid]
ref|XP_007310565.1|  UBC-like protein                                   153   1e-41   Stereum hirsutum FP-91666 SS1
ref|XP_006164155.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    151   1e-41   Tupaia chinensis
ref|XP_006127175.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Pelodiscus sinensis [Chinese softshell turtle]
gb|KJA13524.1|  hypothetical protein HYPSUDRAFT_119175                  149   1e-41   Hypholoma sublateritium FD-334 SS-4
ref|XP_005731418.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   Pundamilia nyererei
gb|EFN67994.1|  Ubiquitin-conjugating enzyme E2 J2                      152   1e-41   Camponotus floridanus
ref|XP_008276826.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Stegastes partitus
ref|XP_008529862.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   Equus przewalskii [Przewalski horse]
ref|XP_004483419.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   
ref|XP_005798029.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   
ref|XP_010753067.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   
ref|XP_010848531.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      151   1e-41   Bison bison bison
gb|KFB47151.1|  AGAP005954-PA-like protein                              152   1e-41   
ref|XP_006164154.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   
ref|XP_004425532.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|XP_007525778.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
gb|ELK23615.1|  Ubiquitin-conjugating enzyme E2 J2                      152   1e-41   
ref|XP_006018873.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   
ref|XP_005339324.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|XP_008850792.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|NP_001034247.1|  ubiquitin-conjugating enzyme E2 J2 isoform b       152   1e-41   
ref|XP_005079280.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   
ref|NP_001033132.1|  ubiquitin-conjugating enzyme E2 J2                 152   1e-41   
ref|XP_006277852.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|XP_003461569.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|XP_008576378.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   
ref|XP_005368757.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|XP_010784036.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|XP_003230047.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|XP_008149906.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|XP_007492115.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   
ref|XP_006992409.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   1e-41   
ref|XP_010862929.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|NP_001007656.1|  ubiquitin-conjugating enzyme E2 J2                 152   1e-41   
dbj|BAB23421.1|  unnamed protein product                                152   1e-41   
ref|XP_447487.1|  hypothetical protein                                  152   1e-41   
ref|XP_008165502.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|XP_006772590.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   1e-41   
ref|XP_008252011.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
gb|KGB40050.1|  Ubiquitin-conjugating enzyme E2 J2                      151   2e-41   
ref|XP_006239616.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|NP_001034246.1|  ubiquitin-conjugating enzyme E2 J2 isoform a       152   2e-41   
ref|XP_005427734.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    152   2e-41   
ref|XP_008046873.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_007166317.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_008864739.1|  hypothetical protein H310_02849                    150   2e-41   
gb|KFO31747.1|  Ubiquitin-conjugating enzyme E2 J2                      158   2e-41   
gb|AAK52607.1|AF296656_1  ubiquitin conjugating enzyme 6                152   2e-41   
ref|XP_001365337.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
gb|AAK52609.1|AF296658_1  ubiquitin conjugating enzyme 6                152   2e-41   
ref|XP_002419467.1|  ubiquitin-conjugating enzyme, putative             151   2e-41   
ref|XP_004069219.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_010214519.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_009669809.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_009060536.1|  hypothetical protein LOTGIDRAFT_125503             151   2e-41   
ref|XP_010160828.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_007426300.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
gb|ETE60509.1|  Ubiquitin-conjugating enzyme E2 J2                      152   2e-41   
ref|XP_315994.4|  AGAP005954-PA                                         151   2e-41   
ref|XP_010185678.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_005008872.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_004781376.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_009074744.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_010194866.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_008318477.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_007129174.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_006175464.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_004657823.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_004272316.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_004013836.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_003127539.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_005143694.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_003510010.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_010003468.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_006175463.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_009905091.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_010138026.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_006067022.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
gb|KFZ67776.1|  Ubiquitin-conjugating enzyme E2 J2                      152   2e-41   
ref|XP_010151004.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_009976781.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_004705283.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_003413559.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_008501849.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_006871765.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
emb|CDS31880.1|  actin protein 8                                        151   2e-41   
ref|XP_011271564.1|  Ubiquitin-conjugating enzyme E2                    151   2e-41   
ref|XP_008945726.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_003670477.1|  hypothetical protein NDAI_0E04170                  152   2e-41   
gb|ETN65134.1|  ubiquitin-conjugating enzyme E2 J2                      150   2e-41   
ref|XP_005496344.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
gb|AAF21504.1|  Ubc6p homolog                                           152   2e-41   
ref|XP_001645911.1|  hypothetical protein Kpol_1045p39                  152   2e-41   
ref|XP_009887883.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_005530497.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_007943591.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_004384403.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
gb|ELU12627.1|  hypothetical protein CAPTEDRAFT_17752                   151   2e-41   
ref|XP_006885913.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
gb|EJT96453.1|  UBC-like protein                                        151   2e-41   
ref|NP_001083004.1|  ubiquitin-conjugating enzyme E2 J2                 152   2e-41   
ref|XP_009845783.1|  hypothetical protein H257_18427                    150   2e-41   
ref|XP_008576377.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_005918606.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    153   2e-41   
gb|KIY70213.1|  UBC-like protein                                        152   2e-41   
ref|XP_008923853.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   2e-41   
ref|XP_006903955.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
gb|KDQ50163.1|  hypothetical protein JAAARDRAFT_142414                  149   2e-41   
ref|XP_005871359.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    152   2e-41   
gb|KIM38326.1|  hypothetical protein M413DRAFT_244583                   151   2e-41   
gb|KIL92115.1|  hypothetical protein FAVG1_04522                        152   2e-41   
ref|XP_007237905.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   2e-41   
ref|XP_005057884.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      151   2e-41   
ref|XP_002190461.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    151   3e-41   
gb|EDK37910.2|  hypothetical protein PGUG_02008                         152   3e-41   
ref|XP_002552516.1|  KLTH0C06688p                                       151   3e-41   
ref|XP_006686820.1|  hypothetical protein CANTEDRAFT_122708             150   3e-41   
ref|XP_001661087.1|  AAEL010844-PA                                      151   3e-41   
ref|XP_001486337.1|  hypothetical protein PGUG_02008                    152   3e-41   
ref|XP_009093927.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      151   3e-41   
dbj|BAC36280.1|  unnamed protein product                                151   3e-41   
gb|KIK92645.1|  hypothetical protein PAXRUDRAFT_13125                   151   3e-41   
ref|XP_007094660.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      151   4e-41   
gb|EPY50860.1|  ubiquitin conjugating enzyme Ubc6                       150   4e-41   
gb|EDL15058.1|  ubiquitin-conjugating enzyme E2, J2 homolog (yeas...    152   4e-41   
gb|EPE08593.1|  ubiquitin-conjugating enzyme                            151   4e-41   
gb|KFO64811.1|  Ubiquitin-conjugating enzyme E2 J2                      151   4e-41   
ref|XP_008709858.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      152   4e-41   
ref|XP_005690848.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   4e-41   
ref|XP_007376468.1|  ubiquitin-conjugating enzyme E2 6                  150   4e-41   
ref|XP_010753003.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    152   4e-41   
gb|EPX74741.1|  ubiquitin conjugating enzyme Ubc6                       150   4e-41   
emb|CDQ89932.1|  unnamed protein product                                151   5e-41   
ref|XP_003667566.1|  hypothetical protein NDAI_0A01650                  150   5e-41   
ref|NP_001139839.1|  Ubiquitin-conjugating enzyme E2 J2                 151   5e-41   
ref|XP_006965037.1|  ubiquitin-conjugating enzyme                       151   5e-41   
ref|XP_003674376.1|  hypothetical protein NCAS_0A14390                  150   5e-41   
ref|XP_005008871.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    151   5e-41   
ref|XP_003052938.1|  predicted protein                                  151   5e-41   
gb|KIY48124.1|  ubiquitin-conjugating enzyme E2 6                       150   5e-41   
emb|CDR38462.1|  CYFA0S02e01948g1_1                                     150   5e-41   
gb|EDL15059.1|  ubiquitin-conjugating enzyme E2, J2 homolog (yeas...    152   5e-41   
gb|ELK19564.1|  Ubiquitin-conjugating enzyme E2 J2                      152   6e-41   
ref|XP_007770573.1|  UBC-like protein                                   149   6e-41   
gb|KEF59806.1|  ubiquitin-conjugating enzyme E2 J2                      151   6e-41   
emb|CDW58757.1|  Ubiquitin-conjugating enzyme E2 J2                     155   6e-41   
ref|XP_008596433.1|  ubiquitin-conjugating enzyme                       150   6e-41   
gb|KIX02391.1|  hypothetical protein Z518_08332                         151   6e-41   
ref|XP_001400652.1|  ubiquitin-conjugating enzyme E2 6                  151   6e-41   
gb|KGQ07130.1|  Ubiquitin-conjugating enzyme E2 6                       150   6e-41   
dbj|GAA87252.1|  ubiquitin-conjugating enzyme Ubc6                      151   7e-41   
ref|XP_007327910.1|  hypothetical protein AGABI1DRAFT_112285            150   7e-41   
ref|XP_003793231.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    150   7e-41   
ref|XP_007905115.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J2      150   7e-41   
ref|XP_003233857.1|  ubiquitin-conjugating enzyme E2                    151   7e-41   
ref|XP_002176091.2|  ubiquitin conjugating enzyme Ubc6                  150   7e-41   
gb|KIJ65234.1|  hypothetical protein HYDPIDRAFT_89300                   151   7e-41   
ref|XP_006676817.1|  hypothetical protein BATDEDRAFT_34481              150   7e-41   
ref|XP_007979239.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    149   8e-41   
ref|XP_001274754.1|  ubiquitin-conjugating enzyme Ubc6, putative        150   8e-41   
gb|EXM34472.1|  ubiquitin-conjugating enzyme E2 J2                      150   8e-41   
gb|EXM08934.1|  ubiquitin-conjugating enzyme E2 J2                      150   8e-41   
emb|CCT70365.1|  probable ubiquitin-conjugating enzyme                  150   8e-41   
gb|ENH62071.1|  Ubiquitin-conjugating enzyme E2 6                       150   8e-41   
ref|XP_001826536.1|  ubiquitin-conjugating enzyme E2 6                  150   8e-41   
gb|EXK33868.1|  ubiquitin-conjugating enzyme E2 J2                      150   9e-41   
gb|EWG38674.1|  ubiquitin-conjugating enzyme E2 J2                      150   9e-41   
ref|XP_003680255.1|  hypothetical protein TDEL_0C01550                  150   9e-41   
ref|XP_008614119.1|  ubiquitin-conjugating enzyme E2 J2                 149   9e-41   
gb|EGU84641.1|  hypothetical protein FOXB_04829                         150   9e-41   
gb|AAL59236.1|AF448416_17  ubiqutin conjugating enzyme 2                148   9e-41   
ref|XP_006108890.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-co...    150   9e-41   
gb|EDP47239.1|  ubiquitin-conjugating enzyme Ubc6, putative             150   1e-40   
ref|XP_001831820.2|  ubiquitin-conjugating enzyme E2 6                  150   1e-40   
ref|XP_001262340.1|  ubiquitin-conjugating enzyme Ubc6, putative        150   1e-40   
ref|XP_001211932.1|  ubiquitin-conjugating enzyme E2 6                  150   1e-40   
emb|CDM26724.1|  Ubiquitin-conjugating enzyme E2 6                      150   1e-40   
gb|KIJ07731.1|  hypothetical protein PAXINDRAFT_89932                   150   1e-40   
gb|KIJ94438.1|  hypothetical protein K443DRAFT_683738                   150   1e-40   
dbj|GAM20197.1|  hypothetical protein SAMD00019534_033720               147   1e-40   
gb|EDL36221.1|  mCG8609                                                 150   1e-40   
gb|ERE84253.1|  ubiquitin-conjugating enzyme E2 J2-like isoform 1       152   1e-40   
gb|EGD99032.1|  ubiquitin-conjugating enzyme E2                         150   1e-40   
ref|XP_003170125.1|  hypothetical protein MGYG_07370                    150   1e-40   
ref|XP_001742091.1|  hypothetical protein                               149   1e-40   
gb|KGO36530.1|  Ubiquitin-conjugating enzyme, E2                        150   1e-40   
gb|KDB25935.1|  hypothetical protein H109_02227                         150   1e-40   
gb|KIM32924.1|  hypothetical protein M408DRAFT_326622                   150   1e-40   
gb|EZF31538.1|  hypothetical protein H101_04861                         150   1e-40   
emb|CCM02624.1|  predicted protein                                      154   1e-40   
gb|KGO70943.1|  Ubiquitin-conjugating enzyme, E2                        150   1e-40   
ref|XP_004353891.1|  hypothetical protein DFA_12256                     147   1e-40   
gb|EYB85972.1|  hypothetical protein Y032_0287g1440                     149   2e-40   
gb|KGO59942.1|  Ubiquitin-conjugating enzyme, E2                        150   2e-40   
ref|XP_002559015.1|  Pc13g05810                                         150   2e-40   
emb|CEJ91206.1|  Putative Ubiquitin-conjugating enzyme                  150   2e-40   
ref|XP_001383146.1|  hypothetical protein PICST_35186                   149   2e-40   
gb|KDE04538.1|  hypothetical protein, variant                           147   2e-40   
gb|KEY78206.1|  ubiquitin conjugating enzyme Ubc6                       150   2e-40   
ref|XP_002849443.1|  ubiquitin-conjugating enzyme E2 6                  150   2e-40   
gb|ERE84251.1|  ubiquitin-conjugating enzyme E2 J2-like isoform 1       155   2e-40   
gb|KIH69376.1|  ubiquitin--protein ligase                               148   2e-40   
ref|XP_001798374.1|  hypothetical protein SNOG_08047                    150   2e-40   
ref|XP_001850537.1|  ubiquitin-conjugating enzyme E2 J2                 149   2e-40   
dbj|BAC11355.1|  unnamed protein product                                149   2e-40   
gb|KIK20812.1|  hypothetical protein PISMIDRAFT_682013                  150   2e-40   
gb|KEQ79211.1|  ubiquitin-protein ligase                                150   2e-40   
gb|KID92721.1|  ubiquitin-conjugating enzyme                            149   2e-40   
ref|XP_456755.2|  DEHA2A09746p                                          149   2e-40   
ref|XP_011444985.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    149   2e-40   
ref|XP_011410708.1|  actin family protein                               149   2e-40   
tpe|CBF79306.1|  TPA: ubiquitin-conjugating enzyme Ubc6, putative...    150   2e-40   
ref|XP_004781374.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    150   2e-40   
gb|EYE92604.1|  ubiquitin-conjugating enzyme E2 6                       150   2e-40   
ref|NP_001289362.1|  ubiquitin-conjugating enzyme E2 J2                 149   2e-40   
gb|EYB85973.1|  hypothetical protein Y032_0287g1440                     148   2e-40   
gb|KEQ70417.1|  UBC-like protein                                        150   2e-40   
gb|KID78255.1|  ubiquitin-conjugating enzyme                            149   2e-40   
gb|KFG80109.1|  ubiquitin-conjugating enzyme                            149   2e-40   
emb|CDS35930.1|  ubiquitin conjugating enzyme E2 J2                     148   2e-40   
gb|KEQ64189.1|  ubiquitin-protein ligase                                149   2e-40   
ref|XP_009444622.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    150   2e-40   
gb|ACO12210.1|  Ubiquitin-conjugating enzyme E2 J2                      148   3e-40   
ref|XP_003664434.1|  hypothetical protein MYCTH_2315657                 149   3e-40   
gb|KDN46289.1|  UBC-like protein                                        147   3e-40   
ref|XP_003717534.1|  ubiquitin-conjugating enzyme                       149   3e-40   
gb|KEQ97570.1|  hypothetical protein AUEXF2481DRAFT_3370                149   3e-40   
ref|XP_001481553.1|  ubiquitin-conjugating enzyme Ubc6                  150   3e-40   
gb|KDE04537.1|  hypothetical protein MVLG_05009                         148   3e-40   
gb|EHK44041.1|  hypothetical protein TRIATDRAFT_300381                  149   3e-40   
ref|XP_007979233.1|  PREDICTED: ubiquitin-conjugating enzyme E2 J...    150   3e-40   
gb|KIM62498.1|  hypothetical protein SCLCIDRAFT_119442                  146   3e-40   
ref|XP_008714493.1|  hypothetical protein HMPREF1541_01915              149   3e-40   



>ref|XP_007135360.1| hypothetical protein PHAVU_010G122800g [Phaseolus vulgaris]
 gb|ESW07354.1| hypothetical protein PHAVU_010G122800g [Phaseolus vulgaris]
Length=238

 Score =   238 bits (607),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+CI RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCIKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>gb|AGV54302.1| ubiquitin conjugating enzyme 2 [Phaseolus vulgaris]
Length=237

 Score =   238 bits (606),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+CI RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCIKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>gb|AAY44872.1| ubiquitinating enzyme [Arabidopsis thaliana]
Length=219

 Score =   236 bits (603),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMTTPNGRFVTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>emb|CBI35791.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +1

Query  223  F*FTKL*S*GMAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFA  402
            F FT + S  MAEK+C+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFA
Sbjct  59   FVFTTIQSWEMAEKSCVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFA  118

Query  403  GGYYYGKIKFPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTG  582
            GGYYYGKIKFPPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTG
Sbjct  119  GGYYYGKIKFPPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTG  178

Query  583  LLSFMMDN  606
            LLSFMMDN
Sbjct  179  LLSFMMDN  186



>ref|XP_003528740.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Glycine max]
 gb|KHN01477.1| Ubiquitin-conjugating enzyme E2 34 [Glycine soja]
Length=238

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+CI RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCIKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|NP_001241297.1| uncharacterized protein LOC100789952 [Glycine max]
 gb|ACU24248.1| unknown [Glycine max]
Length=238

 Score =   236 bits (601),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+CI RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCIKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_007215904.1| hypothetical protein PRUPE_ppa010775mg [Prunus persica]
 ref|XP_008228102.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 [Prunus mume]
 gb|EMJ17103.1| hypothetical protein PRUPE_ppa010775mg [Prunus persica]
Length=237

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV ++VARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHIVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|NP_199854.1| ubiquitin-conjugating enzyme 33 [Arabidopsis thaliana]
 ref|NP_001032048.2| ubiquitin-conjugating enzyme 33 [Arabidopsis thaliana]
 sp|Q9FK29.1|UBC33_ARATH RecName: Full=Probable ubiquitin-conjugating enzyme E2 33; AltName: 
Full=Ubiquitin carrier protein 33 [Arabidopsis thaliana]
 gb|AAK55735.1|AF380654_1 AT5g50430/MXI22_15 [Arabidopsis thaliana]
 dbj|BAB09462.1| ubiquitin conjugating enzyme-like protein [Arabidopsis thaliana]
 gb|AAM98304.1| At5g50430/MXI22_15 [Arabidopsis thaliana]
 gb|AED95943.1| ubiquitin-conjugating enzyme 33 [Arabidopsis thaliana]
 gb|AED95944.1| ubiquitin-conjugating enzyme 33 [Arabidopsis thaliana]
Length=243

 Score =   236 bits (601),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMTTPNGRFVTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_006281013.1| hypothetical protein CARUB_v10027028mg [Capsella rubella]
 gb|EOA13911.1| hypothetical protein CARUB_v10027028mg [Capsella rubella]
Length=240

 Score =   235 bits (600),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMTTPNGRFVTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>gb|KHN15844.1| Ubiquitin-conjugating enzyme E2 34 [Glycine soja]
Length=238

 Score =   235 bits (600),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+CI RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCIKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>emb|CDX81813.1| BnaC08g37880D [Brassica napus]
Length=238

 Score =   235 bits (600),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_004303762.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467490.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Fragaria 
vesca subsp. vesca]
Length=240

 Score =   235 bits (599),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_006416722.1| hypothetical protein EUTSA_v10009625mg [Eutrema salsugineum]
 gb|ESQ35075.1| hypothetical protein EUTSA_v10009625mg [Eutrema salsugineum]
Length=236

 Score =   234 bits (598),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_004510574.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like isoform X1 
[Cicer arietinum]
 ref|XP_004510575.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like isoform X2 
[Cicer arietinum]
Length=237

 Score =   234 bits (598),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV ++VARPSPSDILEWHYVLEG EGTPF+GGYYYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHIVARPSPSDILEWHYVLEGSEGTPFSGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_006305567.1| hypothetical protein CARUB_v10010163mg [Capsella rubella]
 gb|EOA38465.1| hypothetical protein CARUB_v10010163mg [Capsella rubella]
Length=237

 Score =   234 bits (598),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>gb|AAY44873.1| ubiquitinating enzyme [Arabidopsis thaliana]
Length=213

 Score =   234 bits (596),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_010442532.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 33 [Camelina 
sativa]
Length=240

 Score =   234 bits (598),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMTTPNGRFVTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_002892944.1| ubiquitin-conjugating enzyme 32 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69203.1| ubiquitin-conjugating enzyme 32 [Arabidopsis lyrata subsp. lyrata]
Length=237

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_010482359.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 33 [Camelina 
sativa]
Length=240

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMTTPNGRFVTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_009117711.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Brassica 
rapa]
 ref|XP_009117712.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Brassica 
rapa]
 emb|CDY21754.1| BnaA09g45050D [Brassica napus]
Length=235

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG +GTPFAGGYYYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSDGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_011079251.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Sesamum indicum]
 ref|XP_011079261.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Sesamum indicum]
 ref|XP_011079271.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Sesamum indicum]
 ref|XP_011079280.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Sesamum indicum]
Length=236

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV NVVARP P+DILEWHYVLEG +GTPFAGGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSNVVARPLPNDILEWHYVLEGSQGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_002264017.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Vitis vinifera]
Length=237

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_009606556.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Nicotiana 
tomentosiformis]
Length=239

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_011072703.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 33 [Sesamum 
indicum]
Length=237

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV NVVARP P+DILEWHYVLEG +GTPFAGGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSNVVARPLPNDILEWHYVLEGSQGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_010442125.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 33 [Camelina 
sativa]
Length=240

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+CI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKSCIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMTTPNGRFVTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>gb|AFK39814.1| unknown [Lotus japonicus]
Length=238

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+CI RLQKEYRALCKEPV NVVARPSPSDILEWHYVLEG EGTPF+GGYYYGKIKF
Sbjct  1    MAEKSCIKRLQKEYRALCKEPVSNVVARPSPSDILEWHYVLEGSEGTPFSGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPE+WNPMWSVSSILTGLLSFMMD
Sbjct  61   PPEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPETWNPMWSVSSILTGLLSFMMD  117



>ref|XP_009796486.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Nicotiana 
sylvestris]
Length=239

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|NP_173172.1| ubiquitin-conjugating enzyme E2 34 [Arabidopsis thaliana]
 ref|NP_001077554.1| ubiquitin-conjugating enzyme E2 34 [Arabidopsis thaliana]
 sp|Q9SHI7.1|UBC34_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 34; AltName: Full=Ubiquitin 
carrier protein 34 [Arabidopsis thaliana]
 gb|AAD50006.1|AC007651_1 Similar to Ubiquitin Conjugating Enzyme [Arabidopsis thaliana]
 gb|AAM61238.1| putative ubiquitin-conjugating enzyme [Arabidopsis thaliana]
 gb|AAO23638.1| At1g17280 [Arabidopsis thaliana]
 dbj|BAE99355.1| putative ubiquitin-conjugating enzyme [Arabidopsis thaliana]
 gb|AEE29567.1| ubiquitin-conjugating enzyme E2 34 [Arabidopsis thaliana]
 gb|AEE29568.1| ubiquitin-conjugating enzyme E2 34 [Arabidopsis thaliana]
Length=237

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_010498072.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 [Camelina sativa]
Length=237

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_010476872.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Camelina 
sativa]
 ref|XP_010476873.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Camelina 
sativa]
Length=237

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|NP_001234557.1| ubiquitin conjugating enzyme 2 [Solanum lycopersicum]
 gb|AAK62819.1| ubiquitin conjugating enzyme 2 [Solanum lycopersicum]
Length=239

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>emb|CDO97785.1| unnamed protein product [Coffea canephora]
Length=237

 Score =   233 bits (594),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +VVARP+P+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVVARPAPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_007024780.1| Ubiquitin-conjugating enzyme 33 isoform 5, partial [Theobroma 
cacao]
 gb|EOY27402.1| Ubiquitin-conjugating enzyme 33 isoform 5, partial [Theobroma 
cacao]
Length=167

 Score =   230 bits (586),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_010540108.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 [Tarenaya hassleriana]
 ref|XP_010540110.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 [Tarenaya hassleriana]
 ref|XP_010540111.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 [Tarenaya hassleriana]
 ref|XP_010540112.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 [Tarenaya hassleriana]
Length=225

 Score =   232 bits (592),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_006342888.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like isoform X1 
[Solanum tuberosum]
 ref|XP_006342889.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like isoform X2 
[Solanum tuberosum]
 ref|XP_006342890.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like isoform X3 
[Solanum tuberosum]
Length=239

 Score =   233 bits (593),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>gb|KHG15672.1| Ubiquitin-conjugating enzyme E2 34 -like protein [Gossypium arboreum]
Length=236

 Score =   232 bits (592),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_002865805.1| hypothetical protein ARALYDRAFT_495109 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42064.1| hypothetical protein ARALYDRAFT_495109 [Arabidopsis lyrata subsp. 
lyrata]
Length=240

 Score =   232 bits (592),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCK PV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKVPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMTTPNGRFVTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>gb|KHG17057.1| Ubiquitin-conjugating enzyme E2 34 -like protein [Gossypium arboreum]
Length=230

 Score =   232 bits (591),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_007024776.1| Ubiquitin-conjugating enzyme 34 isoform 1 [Theobroma cacao]
 ref|XP_007024778.1| Ubiquitin-conjugating enzyme 34 isoform 1 [Theobroma cacao]
 ref|XP_007024779.1| Ubiquitin-conjugating enzyme 34 isoform 1 [Theobroma cacao]
 gb|EOY27398.1| Ubiquitin-conjugating enzyme 34 isoform 1 [Theobroma cacao]
 gb|EOY27400.1| Ubiquitin-conjugating enzyme 34 isoform 1 [Theobroma cacao]
 gb|EOY27401.1| Ubiquitin-conjugating enzyme 34 isoform 1 [Theobroma cacao]
Length=237

 Score =   232 bits (591),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>gb|AFK36204.1| unknown [Medicago truncatula]
Length=166

 Score =   229 bits (585),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV ++VARPSPSDILEWHYVLEG EGTPF+GGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHIVARPSPSDILEWHYVLEGSEGTPFSGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PQEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>gb|KJB67068.1| hypothetical protein B456_010G173000 [Gossypium raimondii]
Length=236

 Score =   232 bits (591),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_009619784.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Nicotiana 
tomentosiformis]
 ref|XP_009619785.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Nicotiana 
tomentosiformis]
Length=231

 Score =   232 bits (591),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMVTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_003627464.1| Ubiquitin carrier protein E2 [Medicago truncatula]
 gb|ACJ86000.1| unknown [Medicago truncatula]
 gb|AET01940.1| ubiquitin-conjugating enzyme [Medicago truncatula]
 gb|AFK33358.1| unknown [Medicago truncatula]
Length=241

 Score =   232 bits (591),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV ++VARPSPSDILEWHYVLEG EGTPF+GGYYYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHIVARPSPSDILEWHYVLEGSEGTPFSGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PQEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_010033652.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Eucalyptus 
grandis]
 gb|KCW53350.1| hypothetical protein EUGRSUZ_J02593 [Eucalyptus grandis]
Length=237

 Score =   232 bits (591),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV NV+ARPSP+DILEWHYVLEG  GTPF GGYYYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSNVIARPSPNDILEWHYVLEGSSGTPFVGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>gb|AFV96170.1| ubiquitin conjugating enzyme J2 [Camellia oleifera]
Length=239

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +V ARPSPSDILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVTARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPFKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>gb|KDP40624.1| hypothetical protein JCGZ_24623 [Jatropha curcas]
Length=239

 Score =   231 bits (590),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPVP+VVARPSPSDILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVPHVVARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TP+GRF+ ++KICLSMSDFHPESWNPMWS SSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMITPSGRFLTQKKICLSMSDFHPESWNPMWSASSILTGLLSFMMDN  118



>gb|EPS59194.1| ubiquitin conjugating enzyme 2 [Genlisea aurea]
Length=232

 Score =   231 bits (590),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV NVVARP P+DILEWHYVLEG +GTPF+GGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSNVVARPLPNDILEWHYVLEGSKGTPFSGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD+
Sbjct  61   PPEYPFKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDD  118



>ref|XP_010459303.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Camelina 
sativa]
Length=237

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
             PEYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   SPEYPYKPPGITMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_006369076.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 gb|ERP65645.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
Length=235

 Score =   231 bits (588),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFM DN
Sbjct  61   PPEYPYKPPGIIMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMTDN  118



>ref|XP_009781008.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Nicotiana 
sylvestris]
Length=231

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPF+GGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFSGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMVTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_011048632.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Populus euphratica]
Length=235

 Score =   230 bits (587),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFM DN
Sbjct  61   PPEYPYKPPGIIMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMTDN  118



>ref|XP_008340154.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Malus domestica]
Length=233

 Score =   230 bits (586),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+CI RLQKEYRALCKEPV ++VARP P+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCIKRLQKEYRALCKEPVSHIVARPHPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPFKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_009149175.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 [Brassica rapa]
 emb|CDY26258.1| BnaA06g11590D [Brassica napus]
Length=235

 Score =   230 bits (586),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG +GTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSDGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPNGRFITQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_008380727.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Malus domestica]
Length=237

 Score =   230 bits (586),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+CI RLQKEYRALCKEPV ++VARP P+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCIKRLQKEYRALCKEPVSHIVARPHPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPFKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>emb|CDY48483.1| BnaC05g13430D [Brassica napus]
Length=235

 Score =   230 bits (586),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG +GTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSDGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPNGRFITQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_009110416.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Brassica 
rapa]
 emb|CDX96777.1| BnaA08g23200D [Brassica napus]
Length=235

 Score =   229 bits (585),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG +GTPFAGGYYYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSDGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTP+GRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPSGRFITQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_002533817.1| ubiquitin-conjugating enzyme E2 j2, putative [Ricinus communis]
 gb|EEF28570.1| ubiquitin-conjugating enzyme E2 j2, putative [Ricinus communis]
Length=237

 Score =   229 bits (585),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPVP+VVARPS  DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVSRLQKEYRALCKEPVPHVVARPSSRDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YPY PPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPDYPYNPPGITMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_004144451.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Cucumis sativus]
 ref|XP_004169504.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Cucumis sativus]
Length=237

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA+KACI RLQKEYRALCKEPV ++VARP+PSDILEWHYVLEG EGTPFAGG+Y+GKIKF
Sbjct  1    MADKACIKRLQKEYRALCKEPVSHIVARPAPSDILEWHYVLEGSEGTPFAGGFYHGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_008460359.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Cucumis melo]
 ref|XP_008460360.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Cucumis melo]
 ref|XP_008460361.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Cucumis melo]
Length=237

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA+KACI RLQKEYRALCKEPV ++VARP+PSDILEWHYVLEG EGTPFAGG+Y+GKIKF
Sbjct  1    MADKACIKRLQKEYRALCKEPVSHIVARPAPSDILEWHYVLEGSEGTPFAGGFYHGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_006402094.1| hypothetical protein EUTSA_v10014520mg [Eutrema salsugineum]
 ref|XP_006402095.1| hypothetical protein EUTSA_v10014520mg [Eutrema salsugineum]
 gb|ESQ43547.1| hypothetical protein EUTSA_v10014520mg [Eutrema salsugineum]
 gb|ESQ43548.1| hypothetical protein EUTSA_v10014520mg [Eutrema salsugineum]
Length=243

 Score =   229 bits (583),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYR+LCKEPV +VVARPSP+DILEWHYVLEG +GTPFAGG+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRSLCKEPVSHVVARPSPNDILEWHYVLEGSDGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYPYKPPGI MTTPNGRF  ++K+CLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PAEYPYKPPGITMTTPNGRFATQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_006426808.1| hypothetical protein CICLE_v10026383mg [Citrus clementina]
 gb|ESR40048.1| hypothetical protein CICLE_v10026383mg [Citrus clementina]
Length=237

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG  GTPFAGGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSNGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++K+CLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_010537655.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Tarenaya 
hassleriana]
 ref|XP_010537656.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Tarenaya 
hassleriana]
Length=235

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK CI RLQKEYRALCKEPV +VVARPS +DILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKVCIKRLQKEYRALCKEPVSHVVARPSQNDILEWHYVLEGGEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>gb|KJB70036.1| hypothetical protein B456_011G054900 [Gossypium raimondii]
Length=384

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+CI RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCIKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGITMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_006357427.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Solanum tuberosum]
Length=231

 Score =   227 bits (579),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG YYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGLYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPFKPPGISMVTPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_007024777.1| Ubiquitin-conjugating enzyme 34 isoform 2 [Theobroma cacao]
 gb|EOY27399.1| Ubiquitin-conjugating enzyme 34 isoform 2 [Theobroma cacao]
Length=239

 Score =   227 bits (579),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 112/120 (93%), Gaps = 2/120 (2%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEW--HYVLEGCEGTPFAGGYYYGKI  426
            MAEK+C+ RLQKEYRALCKEPV +VVARPSP+DILEW  HYVLEG EGTPFAGGYYYGKI
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSPNDILEWRKHYVLEGSEGTPFAGGYYYGKI  60

Query  427  KFPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            KFPPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   KFPPEYPYKPPGITMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  120



>emb|CDX83915.1| BnaC08g17300D [Brassica napus]
Length=236

 Score =   227 bits (579),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA+KACI RLQKEYRALCKEPV +VVARPSP+DILEWHYVL+G +GTPFAGGYYYGKIKF
Sbjct  1    MAQKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLKGSDGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTP+GRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGITMTTPSGRFITQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_006465798.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Citrus sinensis]
 gb|KDO53755.1| hypothetical protein CISIN_1g026499mg [Citrus sinensis]
Length=237

 Score =   227 bits (578),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG  GTPFAGGYYYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++K+CLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>ref|XP_011031819.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like isoform X1 
[Populus euphratica]
 ref|XP_011031820.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like isoform X1 
[Populus euphratica]
Length=239

 Score =   227 bits (578),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVARPS SDILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSSSDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFM DN
Sbjct  61   PPEYPYKPPGIIMITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMTDN  118



>ref|XP_004241904.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 isoform X2 [Solanum 
lycopersicum]
 ref|XP_004241905.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010322817.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 isoform X2 [Solanum 
lycopersicum]
Length=231

 Score =   226 bits (576),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYRALCKEPV +VVARPSP+DILEWHYVLEG EGTPFAGG YYGKIKF
Sbjct  1    MAEKACVKRLQKEYRALCKEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGLYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI M TPNGRFM  +KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD 
Sbjct  61   PPEYPFKPPGISMVTPNGRFMTHKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDT  118



>gb|ABR17368.1| unknown [Picea sitchensis]
Length=242

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAE AC+ RLQKE+RALCKEPVPNVVARPSPSDILEWHYVLEG EGTPFAGG Y+GK+KF
Sbjct  1    MAETACVKRLQKEFRALCKEPVPNVVARPSPSDILEWHYVLEGSEGTPFAGGVYHGKVKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRF   ++IC+SMSD+HPE+WNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMITPNGRFATHKRICMSMSDYHPETWNPMWSVSSILTGLLSFMMDN  118



>gb|AAC32141.1| probable ubiquitin-conjugating enzyme E2 [Picea mariana]
Length=242

 Score =   225 bits (573),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAE AC+ RLQKE+RALCKEPVPNVVARPSPSDILEWHYVLEG EGTPFAGG Y+GK+KF
Sbjct  1    MAETACVKRLQKEFRALCKEPVPNVVARPSPSDILEWHYVLEGSEGTPFAGGVYHGKVKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRF   ++IC+SMSD+HPE+WNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMITPNGRFATHKRICMSMSDYHPETWNPMWSVSSILTGLLSFMMDN  118



>gb|ABK25198.1| unknown [Picea sitchensis]
Length=242

 Score =   225 bits (573),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAE AC+ RLQKE+RALCKEPVPNVVARPSPSDILEWHYVLEG EGTPFAGG Y+GK+KF
Sbjct  1    MAETACVKRLQKEFRALCKEPVPNVVARPSPSDILEWHYVLEGSEGTPFAGGVYHGKVKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRF   ++IC+SMSD+HPE+WNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMITPNGRFATHKRICMSMSDYHPETWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_010096535.1| Ubiquitin-conjugating enzyme E2 34 [Morus notabilis]
 gb|EXB64655.1| Ubiquitin-conjugating enzyme E2 34 [Morus notabilis]
Length=236

 Score =   224 bits (571),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVA PSP+DILEWHYVLEG EGTPFAGGYYYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVAHPSPNDILEWHYVLEGSEGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TP+GRFM +RK+CLSMSDFHPE+WNPMWSVSSIL GLLSFMMDN
Sbjct  61   PPEYPYKPPGITMVTPSGRFMTQRKLCLSMSDFHPETWNPMWSVSSILQGLLSFMMDN  118



>gb|EYU21267.1| hypothetical protein MIMGU_mgv1a012803mg [Erythranthe guttata]
Length=239

 Score =   222 bits (565),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKEYR+LCKEPV NVVARP P++ILEWHYVLEG +GT FAGGYYYG IKF
Sbjct  1    MAEKACVKRLQKEYRSLCKEPVSNVVARPHPNNILEWHYVLEGSQGTAFAGGYYYGHIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPPGI MTTPNGRF+ + KICLSMSDFHPESWNPMWS SSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPGISMTTPNGRFLTKTKICLSMSDFHPESWNPMWSSSSILTGLLSFMMDN  118



>ref|XP_010273799.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Nelumbo nucifera]
Length=241

 Score =   222 bits (565),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA+K+C+ RLQKEYRALCKEPV +V+ARPSP+DILEWHYVLEG +GTPFAGGYYYGKIKF
Sbjct  1    MADKSCVKRLQKEYRALCKEPVSHVMARPSPNDILEWHYVLEGSDGTPFAGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPP I M TPNGRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPFKPPSISMITPNGRFITQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_004241903.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322814.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322815.1| PREDICTED: ubiquitin-conjugating enzyme E2 34 isoform X1 [Solanum 
lycopersicum]
Length=236

 Score =   220 bits (561),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 109/123 (89%), Gaps = 5/123 (4%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCK-----EPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYY  417
            MAEKAC+ RLQKEYRALCK     EPV +VVARPSP+DILEWHYVLEG EGTPFAGG YY
Sbjct  1    MAEKACVKRLQKEYRALCKTVILQEPVSHVVARPSPNDILEWHYVLEGSEGTPFAGGLYY  60

Query  418  GKIKFPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFM  597
            GKIKFPPEYP+KPPGI M TPNGRFM  +KICLSMSDFHPESWNPMWSVSSILTGLLSFM
Sbjct  61   GKIKFPPEYPFKPPGISMVTPNGRFMTHKKICLSMSDFHPESWNPMWSVSSILTGLLSFM  120

Query  598  MDN  606
            MD 
Sbjct  121  MDT  123



>ref|XP_001783467.1| predicted protein [Physcomitrella patens]
 gb|EDQ51712.1| predicted protein [Physcomitrella patens]
Length=245

 Score =   218 bits (555),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA++AC+ RLQKE+RALCKEPVP+V+ARPSP+DILEWHYVLEG + TPF GG Y+GK+KF
Sbjct  1    MADRACVQRLQKEFRALCKEPVPHVLARPSPTDILEWHYVLEGSKNTPFEGGVYHGKVKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRF  +++IC+SMSDFHPE+WNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMITPNGRFATQKRICMSMSDFHPETWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_002966123.1| ubiquitin-conjugating enzyme 33, E2, partial [Selaginella moellendorffii]
 ref|XP_002982178.1| ubiquitin-conjugating enzyme 33, E2, partial [Selaginella moellendorffii]
 gb|EFJ16846.1| ubiquitin-conjugating enzyme 33, E2, partial [Selaginella moellendorffii]
 gb|EFJ32150.1| ubiquitin-conjugating enzyme 33, E2, partial [Selaginella moellendorffii]
Length=224

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAE+AC+ RLQ+E++ALCKEPVP+VVA+PSPSDILEWHYVLEG +GTPF GG+Y+GK+KF
Sbjct  1    MAERACVKRLQREFKALCKEPVPHVVAKPSPSDILEWHYVLEGSQGTPFEGGFYHGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI M TPNGRF  ++++C+SMSDFHPE+WNPMWSVSSILTGLLSFMMDN
Sbjct  61   PPEYPYKPPGISMITPNGRFATQKRLCMSMSDFHPETWNPMWSVSSILTGLLSFMMDN  118



>ref|XP_010932329.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Elaeis guineensis]
Length=236

 Score =   217 bits (552),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAE+AC+ RLQKEY A+CKEP P +VARPSPSDIL+WH+VLEG +GTPF GGYYYGK+KF
Sbjct  1    MAERACVKRLQKEYHAICKEPPPQIVARPSPSDILDWHFVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YPYKPP I M TPNGRF P RKICLSMSDFHPESWNPMWSVSS+LTGLLSFMMD+
Sbjct  61   PPDYPYKPPSISMITPNGRFAPHRKICLSMSDFHPESWNPMWSVSSVLTGLLSFMMDD  118



>ref|XP_010917360.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Elaeis guineensis]
 ref|XP_010917361.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Elaeis guineensis]
 ref|XP_010917362.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Elaeis guineensis]
Length=238

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAE+AC+ RLQKEY A+CKEP P +VARPSPSDIL+WH+VLEG +GTPF GGYYYGK+KF
Sbjct  1    MAERACVKRLQKEYHAICKEPPPQIVARPSPSDILDWHFVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YPYKPP I M TPNGRF P +KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD+
Sbjct  61   PPDYPYKPPSISMITPNGRFAPHKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDD  118



>ref|XP_008803381.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Phoenix dactylifera]
 ref|XP_008803382.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Phoenix dactylifera]
Length=238

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAE+AC+ RLQKEY A+CKEP P +VARPSPSDIL+WH+VLEG +GTPF GGYYYGK+KF
Sbjct  1    MAERACVKRLQKEYHAICKEPPPQIVARPSPSDILDWHFVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YPYKPP I M TPNGRF P +KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD+
Sbjct  61   PPDYPYKPPSISMITPNGRFAPHKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDD  118



>ref|XP_010685207.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Beta vulgaris 
subsp. vulgaris]
Length=235

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKE+RALCKEPVP++ ARPSP++ILEW+YVLEG EGTPF+GGYYYG+I F
Sbjct  1    MAEKACVKRLQKEFRALCKEPVPHIFARPSPNNILEWYYVLEGSEGTPFSGGYYYGRITF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P EYP+KPP I+MTTPNGRF  + KICLSMSDFHPESWNPMWSVSSILTGLLSFMMD
Sbjct  61   PSEYPFKPPSIRMTTPNGRFATDTKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  117



>ref|XP_009380708.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380709.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Musa acuminata 
subsp. malaccensis]
Length=236

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA++AC+ RLQKEYRA+CKEP P +VARPSPSDIL+WH+VLEG EGTPFAGG YYG++KF
Sbjct  1    MADRACVKRLQKEYRAICKEPPPQIVARPSPSDILDWHFVLEGSEGTPFAGGCYYGRLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             PEYP+KPP I+M TPNGRF+P  KICLSMSDFHPESWNPMWSVSSILTGLLSFM+D
Sbjct  61   SPEYPFKPPSIRMVTPNGRFVPNEKICLSMSDFHPESWNPMWSVSSILTGLLSFMLD  117



>ref|NP_001132346.1| uncharacterized protein LOC100193789 [Zea mays]
 gb|ACF80236.1| unknown [Zea mays]
 gb|AFW76605.1| hypothetical protein ZEAMMB73_872463 [Zea mays]
Length=239

 Score =   212 bits (539),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY ALCKEP P VVARP P+DILEWHYVLEG +GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHALCKEPPPQVVARPLPNDILEWHYVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>gb|AFV13470.1| ubiquitin conjugating enzyme 2 [Coix lacryma-jobi]
Length=239

 Score =   211 bits (538),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY ALCKEP P +VARP P+DILEWHYVLEG +GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHALCKEPPPQIVARPLPNDILEWHYVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>ref|XP_004964602.1| PREDICTED: probable ubiquitin-conjugating enzyme E2 33-like [Setaria 
italica]
Length=240

 Score =   211 bits (538),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY ALCKEP P +VARP P+DILEWHYVLEG +GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHALCKEPPPQIVARPLPNDILEWHYVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>gb|AFV13460.1| ubiquitin conjugating enzyme 2 [Tripsacum dactyloides]
Length=239

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY ALCKEP P +VARP P+DILEWHYVLEG +GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHALCKEPPPQIVARPLPNDILEWHYVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>ref|NP_001149627.1| ubiquitin-conjugating enzyme E2 J2 [Zea mays]
 gb|AAL35400.1| ubiquitin conjugating enzyme 2 [Zea mays]
 gb|ABF67919.1| ubiquitin conjugating enzyme 2 [Zea mays]
 gb|ACF82469.1| unknown [Zea mays]
 gb|ACG36151.1| ubiquitin-conjugating enzyme E2 J2 [Zea mays]
 gb|AEJ07896.1| ubiquitin conjugating enzyme 2 [Zea mays subsp. mexicana]
 gb|AEJ07920.1| ubiquitin conjugating enzyme 2 [Zea mays]
 gb|AEJ07928.1| ubiquitin conjugating enzyme 2 [Zea mays subsp. mexicana]
 gb|AFW85491.1| Ubiquitin conjugating enzyme 2Ubiquitin-conjugating enzyme E2 
J2 [Zea mays]
Length=239

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY ALCKEP P +VARP P+DILEWHYVLEG +GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHALCKEPPPQIVARPLPNDILEWHYVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>ref|XP_002438001.1| hypothetical protein SORBIDRAFT_10g006220 [Sorghum bicolor]
 gb|EER89368.1| hypothetical protein SORBIDRAFT_10g006220 [Sorghum bicolor]
Length=239

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY ALCKEP P +VARP P+DILEWHYVLEG +GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHALCKEPPPQIVARPLPNDILEWHYVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>gb|AEJ07950.1| ubiquitin conjugating enzyme 2 [Sorghum propinquum]
Length=239

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY ALCKEP P +VARP P+DILEWHYVLEG +GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHALCKEPPPQIVARPLPNDILEWHYVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>gb|ACA21862.1| ubiquitin conjugating enzyme 2 [Zea mays]
Length=239

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY ALCKEP P +VARP P+DILEWHYVLEG +GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHALCKEPPPQIVARPLPNDILEWHYVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>gb|AEJ07935.1| ubiquitin conjugating enzyme 2 [Zea diploperennis]
Length=239

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY ALCKEP P +VARP P+DILEWHYVLEG +GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHALCKEPPPQIVARPLPNDILEWHYVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>gb|ABF67916.1| ubiquitin conjugating enzyme 2 [Zea mays]
 gb|ABF67930.1| ubiquitin conjugating enzyme 2 [Zea mays]
 gb|ABF67941.1| ubiquitin conjugating enzyme 2 [Zea mays]
 gb|ABF67951.1| ubiquitin conjugating enzyme 2 [Zea mays]
Length=239

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY ALCKEP P +VARP P+DILEWHYVLEG +GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHALCKEPPPQIVARPLPNDILEWHYVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>gb|AAV64221.1| uce2 [Zea mays]
Length=311

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY ALCKEP P +VARP P+DILEWHYVLEG +GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHALCKEPPPQIVARPLPNDILEWHYVLEGSKGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>ref|XP_006828590.1| hypothetical protein AMTR_s00129p00050230 [Amborella trichopoda]
 gb|ERM96006.1| hypothetical protein AMTR_s00129p00050230 [Amborella trichopoda]
Length=241

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAE+AC+ RLQKEYRAL KEPV +VVA PS SDILEWHYV EG EGTPFAGG Y+GK+KF
Sbjct  1    MAERACVKRLQKEYRALRKEPVSHVVAHPSQSDILEWHYVFEGSEGTPFAGGVYHGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP+KPP I M TPNGRF  +++IC+SMSDFHPE+WNPMWSV+SILTGLLSFMMDN
Sbjct  61   PPEYPFKPPSISMITPNGRFATQKRICMSMSDFHPETWNPMWSVASILTGLLSFMMDN  118



>ref|XP_009399634.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Musa acuminata 
subsp. malaccensis]
Length=237

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKAC+ RLQKE++ LCKEP P +VA PSPSDIL+WH+VLEG EGTPFAGGYYYGK+KF
Sbjct  1    MAEKACVRRLQKEFQDLCKEPPPQIVAHPSPSDILDWHFVLEGSEGTPFAGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
             P+YPYKPP I + TPNGRF   +KICLSMSD+HPESWNP+WSVSSILTGLLSFMMD+
Sbjct  61   QPDYPYKPPSISLITPNGRFATNKKICLSMSDYHPESWNPIWSVSSILTGLLSFMMDD  118



>ref|XP_003627465.1| Ubiquitin carrier protein E2 [Medicago truncatula]
Length=122

 Score =   204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV ++VARPSPSDILEWHYVLEG EGTPF+GGYYYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHIVARPSPSDILEWHYVLEGSEGTPFSGGYYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSF  594
            P EYPYKPPGI MTTPNGRFM ++KICLSMSDFHPESWNPMWSVS     + SF
Sbjct  61   PQEYPYKPPGISMTTPNGRFMTQKKICLSMSDFHPESWNPMWSVSRSDVLIFSF  114



>ref|NP_001057040.1| Os06g0193000 [Oryza sativa Japonica Group]
 dbj|BAD35271.1| putative ubiquitin conjugating enzyme [Oryza sativa Japonica 
Group]
 dbj|BAF18954.1| Os06g0193000 [Oryza sativa Japonica Group]
 gb|EAY99991.1| hypothetical protein OsI_21994 [Oryza sativa Indica Group]
 gb|EAZ36116.1| hypothetical protein OsJ_20427 [Oryza sativa Japonica Group]
 dbj|BAG89352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=240

 Score =   207 bits (528),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK C+ RLQKEY +LCKEP P +VARP P+DILEWH+VLEG  GTPF GGYYYGK+KF
Sbjct  1    MAEKGCLKRLQKEYHSLCKEPPPQIVARPLPNDILEWHFVLEGSAGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>ref|XP_006655872.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Oryza brachyantha]
Length=240

 Score =   207 bits (528),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAE+ C+ RLQKEY +LCKEP P +VARP P+DILEWH+VLEG  GTPF GGYYYGK+KF
Sbjct  1    MAERGCLKRLQKEYHSLCKEPPPQIVARPLPNDILEWHFVLEGSAGTPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP+YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PPDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>gb|EMS52702.1| putative ubiquitin-conjugating enzyme E2 33 [Triticum urartu]
Length=234

 Score =   206 bits (525),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA+K C+ RLQKEY ALCKEPVP +VARP P+DILEWH+VLEG   TPF GGYYYGK+KF
Sbjct  1    MADKGCLKRLQKEYHALCKEPVPQIVARPLPNDILEWHFVLEGSIATPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PSDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>ref|XP_003564160.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like [Brachypodium 
distachyon]
Length=240

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA++ C+ RLQKEY ALCKEP P +VARP P+DILEWHYVLEG  GTPF GG+YYGK+KF
Sbjct  1    MADRGCLKRLQKEYHALCKEPPPQIVARPLPNDILEWHYVLEGSAGTPFEGGFYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+SILTGLLSFMMD+
Sbjct  61   PSDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDD  118



>gb|KGN58478.1| hypothetical protein Csa_3G646650 [Cucumis sativus]
Length=400

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 105/119 (88%), Gaps = 9/119 (8%)
 Frame = +1

Query  250  GMAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIK  429
            GMA+KACI RLQKEYRALCKEPV ++VARP+PSDILEWHYVLEG EGTPFAGG+Y+GKIK
Sbjct  172  GMADKACIKRLQKEYRALCKEPVSHIVARPAPSDILEWHYVLEGSEGTPFAGGFYHGKIK  231

Query  430  FPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            FPP+         M TPNGRFM ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  232  FPPD---------MITPNGRFMTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  281



>ref|XP_002303334.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
 gb|EEE78313.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa]
Length=230

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 101/118 (86%), Gaps = 9/118 (8%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEK+C+ RLQKEYRALCKEPV +VVARPSPSDILEWHYVLEG EGTPFAGG+YYGKIKF
Sbjct  1    MAEKSCVKRLQKEYRALCKEPVSHVVARPSPSDILEWHYVLEGSEGTPFAGGFYYGKIKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PP          M TPNGRFM ++KICLSM DFHPESWNPMWSVSSILTGLLSFM DN
Sbjct  61   PP---------YMITPNGRFMTQKKICLSMIDFHPESWNPMWSVSSILTGLLSFMTDN  109



>ref|NP_001032049.1| ubiquitin-conjugating enzyme 33 [Arabidopsis thaliana]
 gb|AED95945.1| ubiquitin-conjugating enzyme 33 [Arabidopsis thaliana]
Length=230

 Score =   199 bits (505),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 100/118 (85%), Gaps = 13/118 (11%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MAEKACI RLQKEYRALCKEPV +VVARPSP+DILEW              G+YYGKIKF
Sbjct  1    MAEKACIKRLQKEYRALCKEPVSHVVARPSPNDILEWR-------------GFYYGKIKF  47

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYPYKPPGI MTTPNGRF+ ++KICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN
Sbjct  48   PPEYPYKPPGITMTTPNGRFVTQKKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  105



>gb|KDO53756.1| hypothetical protein CISIN_1g026499mg [Citrus sinensis]
Length=228

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +1

Query  304  CKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKPPGIKMTTPN  483
             +EPV +VVARPSP+DILEWHYVLEG  GTPFAGGYYYGKIKFPPEYPYKPPGI M TPN
Sbjct  9    VQEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPN  68

Query  484  GRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            GRFM ++K+CLSMSDFHPESWNPMWSVSSILTGLLSFMMD
Sbjct  69   GRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMD  108



>dbj|BAJ94522.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=126

 Score =   179 bits (455),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA+K C+ RLQKEY ALCKEPVP +VARP P+DILEWH+VLEG   TPF GGYYYGK+KF
Sbjct  1    MADKGCLKRLQKEYHALCKEPVPQIVARPLPNDILEWHFVLEGSVATPFEGGYYYGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVS  567
            P +YP+KPP I MTTP+GRF P ++ICLSMSDFHPESWNPMWSV+
Sbjct  61   PSDYPFKPPSISMTTPSGRFAPHKRICLSMSDFHPESWNPMWSVA  105



>ref|XP_001701298.1| hypothetical protein CHLREDRAFT_132639 [Chlamydomonas reinhardtii]
 gb|EDO97593.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=166

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K C+ RLQKEY++L K+PVP++ A PSPS++LEWH+VLEG +GT + GG Y+GK+ F
Sbjct  1    MAGKQCMTRLQKEYKSLLKDPVPHITAHPSPSNLLEWHFVLEGAKGTEYDGGVYHGKLVF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YP+KPP I + TPNGRF    K+CLSM+D+HPESWNPMWSV +ILTGLLSFM D 
Sbjct  61   PADYPFKPPSISLFTPNGRFATNTKLCLSMTDYHPESWNPMWSVGTILTGLLSFMYDT  118



>ref|XP_002947154.1| hypothetical protein VOLCADRAFT_103384 [Volvox carteri f. nagariensis]
 gb|EFJ51744.1| hypothetical protein VOLCADRAFT_103384 [Volvox carteri f. nagariensis]
Length=275

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  262  KACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPE  441
            K C+ RLQKEY++L K+PVPN+ A PSPS++LEWH+VLEG +GT + GG Y+GK+ FPPE
Sbjct  6    KQCMTRLQKEYKSLLKDPVPNITAHPSPSNLLEWHFVLEGAKGTEYEGGVYHGKLVFPPE  65

Query  442  YPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            YP+KPP I + TPNGRF    K+CLSM+D+HPESWNPMWSV +ILTGLLSFM D 
Sbjct  66   YPFKPPSISLFTPNGRFATNTKLCLSMTDYHPESWNPMWSVGTILTGLLSFMYDT  120



>ref|XP_005646984.1| UBC-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE22440.1| UBC-like protein [Coccomyxa subellipsoidea C-169]
Length=229

 Score =   176 bits (445),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KAC+ RLQKEY++L K+PVPN+ A PSPS++LEWHYVLEG   + +  G Y+GK+ F
Sbjct  1    MASKACVNRLQKEYKSLLKDPVPNIKAHPSPSNLLEWHYVLEGSANSDYESGVYHGKVIF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
              +YPYKPP I M TP+GRF  ++K+CLSMSDFHPESWNPMWSV +IL GLLSFM +
Sbjct  61   SQQYPYKPPSIIMLTPSGRFAVQQKLCLSMSDFHPESWNPMWSVGTILNGLLSFMNE  117



>ref|XP_004340456.1| Ubiquitinconjugating enzyme subfamily protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR18428.1| Ubiquitinconjugating enzyme subfamily protein [Acanthamoeba castellanii 
str. Neff]
Length=239

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            M++K  ++RLQKE + L KEPVP+V A P+P++ILEWHYV+ G + TP+ GG Y+GK++F
Sbjct  1    MSKKQYVVRLQKELQQLLKEPVPHVKAFPNPANILEWHYVITGPDDTPYRGGVYHGKLRF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP KPP I M TPNGRF P  ++CLSMSDFHPE+WNP+WSV SILTGLLSFM+++
Sbjct  61   PPEYPMKPPSIMMLTPNGRFKPNTRLCLSMSDFHPETWNPLWSVGSILTGLLSFMLED  118



>ref|XP_005763276.1| hypothetical protein EMIHUDRAFT_357983, partial [Emiliania huxleyi 
CCMP1516]
 ref|XP_005781433.1| hypothetical protein EMIHUDRAFT_365968, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD10847.1| hypothetical protein EMIHUDRAFT_357983, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD29004.1| hypothetical protein EMIHUDRAFT_365968, partial [Emiliania huxleyi 
CCMP1516]
Length=152

 Score =   169 bits (427),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K C++RLQKEY+ L KEPVPN+ A P P++ILEWH+V+ G   TP+AGG Y+GK+ F
Sbjct  1    MASKPCLLRLQKEYQRLNKEPVPNISAEPRPNNILEWHFVINGPASTPYAGGQYHGKLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YPYKPP I M TPNGRF    ++CLSMSDFHPESW P WSV +IL G+LSFM+++
Sbjct  61   PSDYPYKPPAIMMLTPNGRFNTNTRLCLSMSDFHPESWVPAWSVGTILNGVLSFMLES  118



>ref|XP_005849942.1| hypothetical protein CHLNCDRAFT_12197, partial [Chlorella variabilis]
 gb|EFN57840.1| hypothetical protein CHLNCDRAFT_12197, partial [Chlorella variabilis]
Length=170

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 97/124 (78%), Gaps = 6/124 (5%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGK---  423
            M  KACI RLQKEY+A+ K+P P + A P+P+++L+WHY+LEG +G+ F GG Y+GK   
Sbjct  1    MGTKACINRLQKEYKAILKDPAPQITAHPAPNNLLDWHYLLEGPKGSDFEGGCYHGKSDR  60

Query  424  ---IKFPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSF  594
               + FPPEYP+KPP I M TPNGRF    K+CLSMS FHPESWNP+WSVS+ILTGLLSF
Sbjct  61   GEGVTFPPEYPFKPPSIVMLTPNGRFATNTKLCLSMSSFHPESWNPLWSVSTILTGLLSF  120

Query  595  MMDN  606
            M+++
Sbjct  121  MLES  124



>ref|XP_008912815.1| hypothetical protein PPTG_16981 [Phytophthora parasitica INRA-310]
 gb|ETI35490.1| hypothetical protein F443_18177 [Phytophthora parasitica P1569]
 gb|ETK75739.1| hypothetical protein L915_17696 [Phytophthora parasitica]
 gb|ETL29181.1| hypothetical protein L916_17584 [Phytophthora parasitica]
 gb|ETL82398.1| hypothetical protein L917_17429 [Phytophthora parasitica]
 gb|ETM35636.1| hypothetical protein L914_17489 [Phytophthora parasitica]
 gb|ETN01914.1| hypothetical protein PPTG_16981 [Phytophthora parasitica INRA-310]
 gb|ETO64228.1| hypothetical protein F444_18200 [Phytophthora parasitica P1976]
 gb|ETP05323.1| hypothetical protein F441_18042 [Phytophthora parasitica CJ01A1]
 gb|ETP33451.1| hypothetical protein F442_18017 [Phytophthora parasitica P10297]
Length=176

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA      RL+KEY AL + PV N+ A P   +ILEWHYV+ G EGTP+ GG+Y+GK+KF
Sbjct  1    MASAMATKRLRKEYLALQRNPVENIRAAPLEKNILEWHYVITGTEGTPYEGGFYHGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP KPP + M TPNGRF   R+ICLSMSDFHPE+WNP+W+V SILTGL SFM+++
Sbjct  61   PPEYPMKPPSVIMCTPNGRFEINRRICLSMSDFHPETWNPLWAVGSILTGLYSFMLED  118



>ref|XP_008912814.1| hypothetical protein PPTG_16980 [Phytophthora parasitica INRA-310]
 gb|ETI35489.1| hypothetical protein F443_18176 [Phytophthora parasitica P1569]
 gb|ETK75738.1| hypothetical protein L915_17695 [Phytophthora parasitica]
 gb|ETL29180.1| hypothetical protein L916_17583 [Phytophthora parasitica]
 gb|ETL82397.1| hypothetical protein L917_17428 [Phytophthora parasitica]
 gb|ETM35635.1| hypothetical protein L914_17488 [Phytophthora parasitica]
 gb|ETN01913.1| hypothetical protein PPTG_16980 [Phytophthora parasitica INRA-310]
 gb|ETO64227.1| hypothetical protein F444_18199 [Phytophthora parasitica P1976]
 gb|ETP05322.1| hypothetical protein F441_18041 [Phytophthora parasitica CJ01A1]
 gb|ETP33450.1| hypothetical protein F442_18016 [Phytophthora parasitica P10297]
Length=222

 Score =   167 bits (424),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA      RL+KEY A+ ++PV  + A P  ++ILEWHYV+ G +GTP+ GG+Y+GK+KF
Sbjct  1    MASVMATKRLRKEYLAMQRKPVDYIQAVPLETNILEWHYVITGTKGTPYEGGFYHGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP KPP + M TPNGRF   +++CLSMSDFHPE+WNPMWSVSSILTGL SFM++N
Sbjct  61   PPEYPMKPPSVMMITPNGRFKTNQRLCLSMSDFHPETWNPMWSVSSILTGLYSFMLEN  118



>gb|EWM21161.1| ubiquitin-conjugating enzyme e2 j2 isoform 2 [Nannochloropsis 
gaditana]
Length=199

 Score =   167 bits (422),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA      RL+KE  AL ++PV N+ ARP  S+IL WHYVL+G +G+P+ GGYY+GK+KF
Sbjct  8    MATTLSAKRLRKELIALQRDPVENITARPLESNILVWHYVLKGAKGSPYEGGYYHGKLKF  67

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP KPP I M TP+GRF P  ++CLSMSDFHPE+WNPMWSVS+IL GL +FM+D+
Sbjct  68   PPEYPLKPPSIMMLTPSGRFKPNTRLCLSMSDFHPETWNPMWSVSTILMGLQAFMLDS  125



>ref|XP_002903723.1| ubiquitin-conjugating enzyme E2 [Phytophthora infestans T30-4]
 gb|EEY54778.1| ubiquitin-conjugating enzyme E2 [Phytophthora infestans T30-4]
Length=175

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL+KEY AL + PV N+ A P  ++ILEWHYV+ G EGTP+ GG+Y+GK+KFPPEYP KP
Sbjct  5    RLRKEYVALQRNPVENIRAAPLENNILEWHYVITGTEGTPYEGGFYHGKLKFPPEYPMKP  64

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P + M TPNGRF   R+ICLSMSDFHPE+WNP+W+V SILTGL SFM++N
Sbjct  65   PSVIMCTPNGRFDINRRICLSMSDFHPETWNPLWAVGSILTGLYSFMLEN  114



>ref|XP_009525163.1| hypothetical protein PHYSODRAFT_491377 [Phytophthora sojae]
 gb|EGZ22446.1| hypothetical protein PHYSODRAFT_491377 [Phytophthora sojae]
Length=216

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL+KEY A+ ++PV  + A P  S+ILEWHYV+ G +GTP+ GG+Y+GK+KFPPEYP KP
Sbjct  5    RLRKEYLAMQRKPVDYIQAVPVESNILEWHYVITGTKGTPYEGGFYHGKLKFPPEYPMKP  64

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P + M TPNGRF   +++CLSMSDFHPE+WNPMWSVSSILTGL SFM++N
Sbjct  65   PSVMMITPNGRFKTNQRLCLSMSDFHPETWNPMWSVSSILTGLYSFMLEN  114



>emb|CBJ28210.1| conserved unknown protein [Ectocarpus siliculosus]
Length=285

 Score =   167 bits (424),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA      RL+KE  A+ + P+ N+VA P  ++ILEWHYV+ G +G+P+ GG+Y+GK+KF
Sbjct  21   MASDMATRRLRKELMAIKRNPIDNIVATPMDNNILEWHYVITGTKGSPYEGGHYHGKLKF  80

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP KPP + M TPNGRF   R++CLSMSDFHPESWNPMWSVS+IL GL SFM+DN
Sbjct  81   PPEYPMKPPSVMMMTPNGRFACSRRLCLSMSDFHPESWNPMWSVSTILMGLYSFMLDN  138



>ref|XP_003060658.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55427.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=155

 Score =   163 bits (412),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = +1

Query  271  IMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPY  450
            + RLQKE + L K+P+P+++ARP P+++LEWHY LEG   T +AGG Y+GKI FP EYP+
Sbjct  1    VARLQKELKLLAKDPLPSMLARPHPNNLLEWHYCLEGASDTAYAGGTYHGKIIFPKEYPF  60

Query  451  KPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            KPP I M TP+GRF P  ++CLSMSDFHPESWNPMWS+SSI++GL SFM+++
Sbjct  61   KPPSIMMCTPSGRFQPNTRLCLSMSDFHPESWNPMWSLSSIMSGLQSFMVES  112



>ref|XP_002903724.1| ubiquitin-conjugating enzyme E2, putative [Phytophthora infestans 
T30-4]
 gb|EEY54779.1| ubiquitin-conjugating enzyme E2, putative [Phytophthora infestans 
T30-4]
Length=218

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL+KEY A+ ++PV  + A P  ++ILEWHYV+ G +GTP+ GG+Y+GK+KFPPEYP KP
Sbjct  5    RLRKEYLAMQRKPVDYIQAVPLETNILEWHYVITGTKGTPYEGGFYHGKLKFPPEYPMKP  64

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P + M TPNGRF   +++CLSMSDFHPE+WNPMWSVSSILTGL SFM++N
Sbjct  65   PSVMMITPNGRFKTNQRLCLSMSDFHPETWNPMWSVSSILTGLYSFMLEN  114



>ref|XP_002296203.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|ACI64920.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=169

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 95/122 (78%), Gaps = 4/122 (3%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPV--PNVVARPSPSDILEWHYVLEGCE--GTPFAGGYYYG  420
            MA      RLQ+E +AL K P+  P ++A+P+ ++ILEWHYVLEG     +P+ GG Y+G
Sbjct  1    MASPLATKRLQRELKALMKNPLTSPKIIAQPNEANILEWHYVLEGDADPNSPYNGGIYHG  60

Query  421  KIKFPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMM  600
            K+ FP EYPYKPPG+ M TPNGRF P R++CLSMSDFHPESWNPMWS+S+ILTGL SFM+
Sbjct  61   KLIFPKEYPYKPPGVLMLTPNGRFKPNRRLCLSMSDFHPESWNPMWSISTILTGLYSFMV  120

Query  601  DN  606
            +N
Sbjct  121  EN  122



>ref|XP_005841120.1| hypothetical protein GUITHDRAFT_63988, partial [Guillardia theta 
CCMP2712]
 gb|EKX54140.1| hypothetical protein GUITHDRAFT_63988, partial [Guillardia theta 
CCMP2712]
Length=167

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RLQ+E + L +EPV  V A P PS++LEWH+V+EG  G+P+ GGYY+G I+FP EYPYKP
Sbjct  1    RLQRELKKLKEEPVAGVHATPLPSNMLEWHFVIEGPAGSPYQGGYYHGIIRFPQEYPYKP  60

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P I+M TP+GRF P ++ICLSMSDFHPE+WN MWSVSSIL G++SFM+D+
Sbjct  61   PSIRMLTPSGRFEPNQRICLSMSDFHPETWNCMWSVSSILQGVVSFMLDS  110



>ref|XP_003489308.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Bombus impatiens]
Length=230

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
            +   RL+++Y  L K+PVP VVA P PS+ILEWHYV++G E TP+ GG+Y+GK+ FP E+
Sbjct  7    SATARLKQDYLRLKKDPVPYVVAEPVPSNILEWHYVVKGPEKTPYEGGFYHGKLIFPVEF  66

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P++PP I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++N
Sbjct  67   PFQPPSIYMTTPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIEN  120



>ref|XP_003403106.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Bombus terrestris]
Length=230

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
            +   RL+++Y  L K+PVP VVA P PS+ILEWHYV++G E TP+ GG+Y+GK+ FP E+
Sbjct  7    SATARLKQDYLRLKKDPVPYVVAEPVPSNILEWHYVVKGPEKTPYEGGFYHGKLIFPVEF  66

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P++PP I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++N
Sbjct  67   PFQPPSIYMTTPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIEN  120



>ref|XP_008560052.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Microplitis 
demolitor]
Length=230

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = +1

Query  253  MAEK--ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKI  426
            MA K  +   RL+++Y  L K+PVP VVA P PS+ILEWHYV++G E TP+ GGYY+GK+
Sbjct  1    MARKTNSATARLKQDYLRLKKDPVPYVVAEPVPSNILEWHYVVKGPENTPYEGGYYHGKL  60

Query  427  KFPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             FP E+P++PP I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  61   VFPGEFPFQPPSIYMTTPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIE  119



>ref|XP_396699.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Apis mellifera]
 ref|XP_003692553.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Apis florea]
 ref|XP_006607346.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Apis dorsata]
Length=230

 Score =   161 bits (407),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
            +   RL+++Y  L K+P+P VVA P PS+ILEWHYV++G E TP+ GG+Y+GK+ FP E+
Sbjct  7    SATARLKQDYLRLKKDPIPYVVAEPVPSNILEWHYVVKGPEKTPYEGGFYHGKLIFPVEF  66

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P++PP I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++N
Sbjct  67   PFQPPSIYMTTPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIEN  120



>ref|XP_005716871.1| unnamed protein product [Chondrus crispus]
 emb|CDF37052.1| unnamed protein product [Chondrus crispus]
Length=220

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K C  RL+KE R + +EP P++ ARP PS+IL W++VLEG   +P+ GG + G+++F
Sbjct  1    MASKTCTHRLRKEMRNISREPSPHITARPLPSNILRWYFVLEGPSDSPYEGGIFMGRLQF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMM  600
            P EYP+KPP + M TP GRF   +K+CLSMSDFHPE+WNP+WSVS++LTGLLSFMM
Sbjct  61   PEEYPFKPPAVYMCTPQGRFKCNQKLCLSMSDFHPETWNPLWSVSAVLTGLLSFMM  116



>gb|EJK57366.1| hypothetical protein THAOC_22597 [Thalassiosira oceanica]
Length=225

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 93/123 (76%), Gaps = 5/123 (4%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPV--PNVVARPSPSDILEWHYVLEGCEG---TPFAGGYYY  417
            MA      RLQ+E +AL K P+  P +VA P+ ++ILEWHYVLEG      +P+ GG Y+
Sbjct  1    MASPLATKRLQRELKALHKTPLNNPKIVAAPNEANILEWHYVLEGPTDDPRSPYYGGIYH  60

Query  418  GKIKFPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFM  597
            GK+ FP EYPYKPPG+ M TPNGRF P R++CLSMSDFHPESWNPMWS+S+IL GL SFM
Sbjct  61   GKLIFPKEYPYKPPGVIMLTPNGRFHPNRRLCLSMSDFHPESWNPMWSISTILMGLYSFM  120

Query  598  MDN  606
            +DN
Sbjct  121  LDN  123



>emb|CEP13105.1| hypothetical protein [Parasitella parasitica]
Length=244

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY A+ K P P + A+P  S+IL+WHYV+ G   TP+ GG YYGKI F
Sbjct  1    MATKGAYKRLTKEYMAIQKNPPPYITAKPLESNILDWHYVITGPPDTPYDGGEYYGKITF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPP I+MTTP+GRF P+ ++CLSMSDFHP SWNP WS+S+IL GLLSFM+ +
Sbjct  61   PAEYPFKPPSIRMTTPSGRFQPDTRLCLSMSDFHPSSWNPSWSISTILNGLLSFMVGD  118



>gb|EFX81890.1| hypothetical protein DAPPUDRAFT_302785 [Daphnia pulex]
Length=237

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  259  EKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPP  438
              +   RL+++Y  L K+P+P VVA P PS+ILEWHYV+ G E +P+ GGYY+GK+ FP 
Sbjct  5    NNSATSRLKQDYLRLKKDPIPYVVAEPLPSNILEWHYVVSGPENSPYEGGYYHGKLLFPA  64

Query  439  EYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            E+P+KPP I M TPNGRF P  ++CLS+SDFHP+SWNP WSVS+ILTGLLSFM++
Sbjct  65   EFPFKPPSIYMITPNGRFKPNTRLCLSISDFHPDSWNPAWSVSTILTGLLSFMLE  119



>ref|XP_007417673.1| hypothetical protein MELLADRAFT_40482 [Melampsora larici-populina 
98AG31]
 gb|EGF99003.1| hypothetical protein MELLADRAFT_40482 [Melampsora larici-populina 
98AG31]
Length=158

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KE+  L K P P ++ARP  SDILEWHY++ G   TP+ GG ++G + F
Sbjct  1    MASKQAHKRLMKEHADLNKAPPPFIIARPKESDILEWHYIIRGPPDTPYEGGEFWGTVIF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YP+KPPGIKM TP+GRF P+RKIC SMSD+HP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PADYPFKPPGIKMLTPSGRFQPDRKICTSMSDYHPGSWNPAWSVATILTGLLSFMVGD  118



>ref|XP_007382733.1| UBC-like protein [Punctularia strigosozonata HHB-11173 SS5]
 gb|EIN09465.1| UBC-like protein [Punctularia strigosozonata HHB-11173 SS5]
Length=278

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY A+ KEP P V A P   +IL WHY++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAHKRLSKEYVAMQKEPPPFVWAAPEEKNILNWHYIIRGPPDSPFAGGEYHGMLMF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP +WNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMLTPSGRFQPDKKICFSMSDFHPGTWNPAWSVATILTGLLSFMLSD  118



>ref|XP_002181137.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47060.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=222

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPV--PNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKI  426
            MA   C  RL KE RAL K+P+  P +   P+ S++LE HYV+EG + T + GG Y+GK+
Sbjct  1    MATDICTRRLTKELRALQKDPIRDPKITVAPNESNLLEMHYVIEGSKDTEYEGGVYHGKL  60

Query  427  KFPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
             FP EYP KPPG+ M TP+GRF P R++CLSMSDFHPESWNPMWSVS+ILTGL SFM++ 
Sbjct  61   IFPREYPLKPPGVMMITPSGRFQPGRRLCLSMSDFHPESWNPMWSVSTILTGLYSFMIET  120



>emb|CDR38464.1| CYFA0S02e01970g1_1 [Cyberlindnera fabianii]
Length=258

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA  A   RL KEY ++ KEPVP +VARP   +ILEWHY++ G   TP+ GG Y+G + F
Sbjct  1    MASPAATKRLNKEYLSITKEPVPYIVARPRDDNILEWHYIITGPPETPYQGGQYHGTLIF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
              +YPYKPP I+M TP+GRF+P +++CLS+SD+HPESWNP W+V +ILTGLLSFM  N
Sbjct  61   TSDYPYKPPAIRMVTPSGRFVPNQRLCLSISDYHPESWNPSWTVETILTGLLSFMTSN  118



>ref|XP_009549427.1| hypothetical protein HETIRDRAFT_324309 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW79170.1| hypothetical protein HETIRDRAFT_324309 [Heterobasidion irregulare 
TC 32-1]
Length=174

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY  + KEP P V A P   DIL W+YVL G   +PFAGG Y+G + F
Sbjct  1    MASKAAYKRLSKEYVTMQKEPPPFVWAAPDEKDILTWNYVLRGPPDSPFAGGEYHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP SWNP WSV++ILTGL+SFM+ +
Sbjct  61   PSEYPFKPPGIKMYTPSGRFQPDKKICFSMSDFHPGSWNPAWSVATILTGLVSFMLSD  118



>gb|EPB88610.1| ubiquitin-conjugating enzyme E2 J2 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=252

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY A+ K P P + A+P  S+IL+WHYV+ G   TP+ GG YYG+I F
Sbjct  1    MATKGAYKRLTKEYMAIQKNPPPYITAKPLESNILDWHYVITGPPDTPYEGGEYYGRITF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPP I+MTTP+GRF P+ ++CLSMSDFHP SWNP WS+S+IL GLLSFM+ +
Sbjct  61   PAEYPFKPPSIRMTTPSGRFQPDTRLCLSMSDFHPSSWNPSWSISTILNGLLSFMVGD  118



>ref|XP_011275733.1| Ubiquitin-conjugating enzyme E2 [Wickerhamomyces ciferrii]
 emb|CCH42380.1| Ubiquitin-conjugating enzyme E2 [Wickerhamomyces ciferrii]
Length=298

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA  A   RL KEY+ L  EP+  V A+PS S+IL+WHY++ G   TPF GG YYG + F
Sbjct  1    MATVAAQKRLTKEYKNLKAEPIDLVFAKPSESNILQWHYIITGPPDTPFQGGEYYGLLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMM  600
            PP+YP+KPP IKM TPNGRF P  ++CLS+SD+HPE+WNP WSV +ILTGL SFM 
Sbjct  61   PPQYPFKPPAIKMITPNGRFQPNTRLCLSISDYHPETWNPAWSVGTILTGLTSFMT  116



>ref|XP_003701122.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Megachile 
rotundata]
Length=230

 Score =   158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
            +   RL+++Y  L K+PVP V+A P PS+ILEWHYV++G E TP+ GG+Y+GK+ FP E+
Sbjct  7    SATARLKQDYLRLKKDPVPYVLAEPVPSNILEWHYVVKGPEKTPYEGGFYHGKLIFPGEF  66

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P++PP I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  67   PFQPPSIYMTTPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIE  119



>ref|XP_002548161.1| ubiquitin-conjugating enzyme E2 6 [Candida tropicalis MYA-3404]
 gb|EER33640.1| ubiquitin-conjugating enzyme E2 6 [Candida tropicalis MYA-3404]
Length=219

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA +    RLQKE++++   P P ++A+P+  +ILEWHYV+ G EGTP+ GG Y+G ++F
Sbjct  1    MASRQATKRLQKEFKSIQNSPPPYIIAKPNDENILEWHYVITGPEGTPYEGGQYHGILRF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFM  597
            P +YP+KPP I + TPNGRF    ++CLSMSD+HP++WNP WSV++ILTGLLSFM
Sbjct  61   PTDYPFKPPAISIITPNGRFSTNTRLCLSMSDYHPDTWNPAWSVATILTGLLSFM  115



>ref|XP_004201939.1| Piso0_001405 [Millerozyma farinosa CBS 7064]
 emb|CCE88633.1| Piso0_001405 [Millerozyma farinosa CBS 7064]
Length=244

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA +    RL KEY+A+   P P + ARP+  +ILEWHYV+ G   TPF GG Y+G ++F
Sbjct  1    MASRQAQRRLTKEYKAISTNPPPYITARPNEENILEWHYVITGPADTPFEGGQYHGLLRF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFM  597
            P EYP+KPP I MTTPNGRF    ++CLSMSDFHP++WNP WSV++ILTGLLSFM
Sbjct  61   PAEYPFKPPSITMTTPNGRFSCNTRLCLSMSDFHPDTWNPAWSVATILTGLLSFM  115



>gb|EIE91493.1| hypothetical protein RO3G_16204 [Rhizopus delemar RA 99-880]
Length=153

 Score =   155 bits (392),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY A+   P P + A+P  S+ILEWHYV++G   +P+AGG YYG++ F
Sbjct  1    MATKTAYKRLTKEYLAIQANPPPFITAKPLESNILEWHYVIQGPPDSPYAGGEYYGRLNF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P EYPYKPP I+M TP+GRF P+ ++CL+MSDFHP  WNP WSVS+IL GLLSFM+ 
Sbjct  61   PAEYPYKPPSIRMITPSGRFQPDTRLCLTMSDFHPSLWNPSWSVSTILNGLLSFMVS  117



>gb|AEE62267.1| unknown [Dendroctonus ponderosae]
 gb|ENN80907.1| hypothetical protein YQE_02695, partial [Dendroctonus ponderosae]
 gb|ERL85714.1| hypothetical protein D910_03129 [Dendroctonus ponderosae]
Length=228

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL+++Y  L ++P+P V+A P  SDILEWHYV+ G E TP+ GG+Y+GK+ FP ++P+KP
Sbjct  15   RLRQDYLRLKRDPIPYVIAEPLGSDILEWHYVVTGPENTPYEGGFYHGKLVFPSDFPFKP  74

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P I M TPNGRF   RK+CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  75   PAIYMITPNGRFKTNRKLCLSISDFHPDTWNPAWSVSTILTGLLSFMLE  123



>gb|EFN77898.1| Ubiquitin-conjugating enzyme E2 J2 [Harpegnathos saltator]
Length=230

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL+++Y  L K+PVP V+A P PS+ILEWHYV++G E TP+ GG+Y+GK+ FP E+P++P
Sbjct  11   RLKQDYLRLKKDPVPYVLAEPVPSNILEWHYVVKGPEKTPYEGGFYHGKLIFPGEFPFQP  70

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  71   PSIYMTTPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIE  119



>ref|XP_011031822.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like isoform X2 
[Populus euphratica]
 ref|XP_011031823.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like isoform X2 
[Populus euphratica]
 ref|XP_011031824.1| PREDICTED: ubiquitin-conjugating enzyme E2 34-like isoform X2 
[Populus euphratica]
Length=209

 Score =   157 bits (396),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +1

Query  367  YVLEGCEGTPFAGGYYYGKIKFPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESW  546
            YVLEG EGTPFAGG+YYGKIKFPPEYPYKPPGI M TPNGRFM ++KICLSMSDFHPESW
Sbjct  9    YVLEGSEGTPFAGGFYYGKIKFPPEYPYKPPGIIMITPNGRFMTQKKICLSMSDFHPESW  68

Query  547  NPMWSVSSILTGLLSFMMDN  606
            NPMWSVSSILTGLLSFM DN
Sbjct  69   NPMWSVSSILTGLLSFMTDN  88



>emb|CCA17577.1| ubiquitinconjugating enzyme E2 putative [Albugo laibachii Nc14]
Length=232

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA      RL+KEY A+ ++ + N+VA P  S+ILEWHYV+ G   + + GGYY+G ++F
Sbjct  1    MASFLATKRLRKEYIAIQRKSIENIVAAPLHSNILEWHYVIVGTSESCYEGGYYHGILRF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP KPP + M TPNGRF   +++CLSMSDFHPE+WNPMWSVSSILTGL SFM++N
Sbjct  61   PPEYPMKPPSVLMLTPNGRFKTNQRLCLSMSDFHPETWNPMWSVSSILTGLYSFMLEN  118



>gb|KDR18969.1| Ubiquitin-conjugating enzyme E2 J2 [Zootermopsis nevadensis]
Length=235

 Score =   157 bits (398),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +1

Query  262  KACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPE  441
             +   RL+++Y  L K+PVP VVA P P++ILEWHYV+ G E TP+ GG Y+GK+ FP E
Sbjct  7    NSATARLKQDYLRLKKDPVPYVVAEPLPANILEWHYVVTGPENTPYDGGLYHGKLVFPRE  66

Query  442  YPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            +P+KPPGI M TPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  67   FPFKPPGIYMITPNGRFKTNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIE  120



>ref|XP_011149434.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Harpegnathos saltator]
Length=233

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL+++Y  L K+PVP V+A P PS+ILEWHYV++G E TP+ GG+Y+GK+ FP E+P++P
Sbjct  14   RLKQDYLRLKKDPVPYVLAEPVPSNILEWHYVVKGPEKTPYEGGFYHGKLIFPGEFPFQP  73

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  74   PSIYMTTPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIE  122



>gb|EGA75167.1| Ubc6p [Saccharomyces cerevisiae AWRI796]
Length=203

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY+ + + P P ++ARP+  +ILEWHY++ G   TP+ GG Y+G + F
Sbjct  1    MATKQAHKRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YPYKPP I+M TPNGRF P  ++CLSMSD+HP++WNP WSVS+IL GLLSFM  +
Sbjct  61   PSDYPYKPPAIRMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSD  118



>emb|CDK25885.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=239

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K+   RL KEYRA+   P P +VA+ S  +ILEWHYV+ G   TP+ GG Y+G + F
Sbjct  1    MASKSAHKRLTKEYRAIQANPPPFIVAKASEQNILEWHYVITGPPETPYEGGQYHGTLSF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPP I+MTTPNGRF    ++CLSMSD+HP++WNP WSVS+ILTGLLSFM  +
Sbjct  61   PTEYPFKPPAIRMTTPNGRFQVNTRLCLSMSDYHPDTWNPGWSVSTILTGLLSFMTGD  118



>ref|XP_007362840.1| UBC-like protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF64029.1| UBC-like protein [Dichomitus squalens LYAD-421 SS1]
Length=260

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY A+ KEP P V A P   +IL W+Y++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAYKRLSKEYVAMQKEPPPFVWAAPDEKNILTWNYIIRGPPDSPFAGGEYHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMITPSGRFQPDKKICFSMSDFHPGSWNPAWSVATILTGLLSFMLSD  118



>ref|XP_011410307.1| PREDICTED: structural maintenance of chromosomes protein 4-like 
[Amphimedon queenslandica]
Length=1334

 Score =   167 bits (422),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 68/118 (58%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +1

Query  250   GMAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIK  429
             G +  + I RL ++Y+ L K+PVP + A P  S+ILEW Y ++G EGTP+ GGYY+GK+ 
Sbjct  1104  GSSSSSSIKRLTQDYKRLKKDPVPYIEAAPIESNILEWRYCVKGPEGTPYHGGYYHGKLV  1163

Query  430   FPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             FPP+YP+KPP I M TPNGRF   +++CLS+SDFHP++WNP WSV++ILTGLLSFM++
Sbjct  1164  FPPDYPFKPPRILMITPNGRFATNKRLCLSISDFHPDTWNPAWSVATILTGLLSFMVE  1221



>emb|CEG67008.1| Putative Ubiquitin-conjugating enzyme E2 J2 [Rhizopus microsporus]
Length=231

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K+   RL KEY A+ K P P + A+P  ++ILEWHYV+ G   +P+AGG YYG++ F
Sbjct  1    MATKSAYKRLTKEYLAIQKNPPPFITAKPLENNILEWHYVIRGPPDSPYAGGEYYGRLNF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPP I+MTTP+GRF P+ ++CL+MSDFHP  WNP WSV++IL GLLSFM+ +
Sbjct  61   PAEYPFKPPSIRMTTPSGRFQPDTRLCLTMSDFHPSLWNPSWSVATILNGLLSFMVGD  118



>ref|XP_011257000.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Camponotus 
floridanus]
Length=233

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
            +   RL+++Y  L K+PVP V+A P PS+ILEWHYV+ G E TP+ GG+Y+GK+ FP E+
Sbjct  10   SATARLKQDYLRLKKDPVPYVLAEPVPSNILEWHYVVVGPEKTPYEGGFYHGKLIFPGEF  69

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P++PP I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  70   PFQPPSIYMTTPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIE  122



>dbj|GAN10580.1| conserved hypothetical protein [Mucor ambiguus]
Length=252

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY A+ K P P + A+P  S+IL+WHYV+ G   TP+ GG YYG+I F
Sbjct  1    MATKGAYKRLTKEYMAIQKNPPPYITAKPLESNILDWHYVITGPPDTPYEGGEYYGRITF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPP I+M TP+GRF P+ ++CLSMSDFHP SWNP WS+S+IL GLLSFM+ +
Sbjct  61   PAEYPFKPPSIRMITPSGRFQPDTRLCLSMSDFHPSSWNPSWSISTILNGLLSFMVGD  118



>ref|XP_011158987.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Solenopsis invicta]
Length=231

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
            +   RL+++Y  L ++PVP V+A P PS+ILEWHYV+ G E TP+ GG+Y+GK+ FP E+
Sbjct  10   SATQRLKQDYLRLKRDPVPYVLAEPVPSNILEWHYVVRGPEKTPYEGGFYHGKLIFPGEF  69

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P++PP I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  70   PFQPPSIYMTTPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIE  122



>ref|XP_008215286.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215287.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215288.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215289.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215290.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215291.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215292.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215293.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215294.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215295.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215296.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215297.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215298.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215299.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215300.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
 ref|XP_008215301.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Nasonia vitripennis]
Length=236

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
                RL+++Y  L K+PVP V A P PS+ILEWHYV++G E TP+ GG+Y+GK+ FP E+
Sbjct  7    TATARLKQDYLRLKKDPVPYVQAEPVPSNILEWHYVIKGPENTPYEGGFYHGKLVFPGEF  66

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P++PP I MTTPNGRF    K+CLS+SDFHP++WNP WSVS+IL GLLSFM+++
Sbjct  67   PFQPPSIYMTTPNGRFKVNTKLCLSISDFHPDTWNPAWSVSTILIGLLSFMIES  120



>ref|XP_007322517.1| hypothetical protein SERLADRAFT_351869 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO20551.1| hypothetical protein SERLADRAFT_351869 [Serpula lacrymans var. 
lacrymans S7.9]
Length=171

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY ++ KEP P V A P   +IL W+Y++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAQKRLTKEYVSMQKEPPPFVWAVPDEKNILTWNYLIRGPPDSPFAGGEYHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMMTPSGRFQPDKKICFSMSDFHPGSWNPAWSVATILTGLLSFMLSD  118



>ref|XP_973818.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Tribolium castaneum]
 gb|EFA03490.1| hypothetical protein TcasGA2_TC013489 [Tribolium castaneum]
Length=225

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +1

Query  262  KACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPE  441
             +   RL+++Y  L ++PVP + A P PS+ILEWHYV+ G E TP+ GG+Y+GK+ FP E
Sbjct  7    NSATSRLKQDYLRLKRDPVPYITAEPLPSNILEWHYVVCGPENTPYEGGFYHGKLVFPRE  66

Query  442  YPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            +P+KPP I M TPNGRF   +K+CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  67   FPFKPPSIYMITPNGRFRTNKKLCLSISDFHPDTWNPAWSVSTILTGLLSFMLE  120



>ref|XP_004202564.1| Piso0_001405 [Millerozyma farinosa CBS 7064]
 emb|CCE79348.1| Piso0_001405 [Millerozyma farinosa CBS 7064]
Length=244

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA +    RL KEY+A+   P P + ARP+  +ILEWHYV+ G   TPF GG Y+G ++F
Sbjct  1    MASRQAQRRLTKEYKAISTNPPPFITARPNEENILEWHYVITGPADTPFEGGQYHGLLRF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPP I M TPNGRF    ++CLSMSDFHP++WNP WSV++ILTGLLSFM  +
Sbjct  61   PAEYPFKPPSITMATPNGRFSCNTRLCLSMSDFHPDTWNPAWSVATILTGLLSFMTSD  118



>ref|XP_005647948.1| UBC-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE23404.1| UBC-like protein [Coccomyxa subellipsoidea C-169]
Length=223

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVA-RPSPSDILEWHYVLEGCEGTPFAGGYYYGKIK  429
            MA K C+ +L+KE RA   +P P+V A   +  ++LEWHY++EG   TP+AGG Y GK++
Sbjct  1    MAPKVCVNKLKKEMRAFLADPPPHVPAVHVNEKNMLEWHYLIEGPPDTPYAGGMYIGKLR  60

Query  430  FPPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            FPPEYP+KPP I M TPNGRF    +IC+SMSD+HPE+WNP+WSV+SILTGLLSFM+++
Sbjct  61   FPPEYPFKPPAIMMLTPNGRFETNTRICMSMSDYHPETWNPLWSVASILTGLLSFMLED  119



>ref|NP_011026.3| E2 ubiquitin-conjugating protein UBC6 [Saccharomyces cerevisiae 
S288c]
 sp|P33296.1|UBC6_YEAST RecName: Full=Ubiquitin-conjugating enzyme E2 6; AltName: Full=Ubiquitin 
carrier protein UBC6; AltName: Full=Ubiquitin-protein 
ligase UBC6 [Saccharomyces cerevisiae S288c]
 emb|CAA51706.1| ubiquitin conjugating enzyme [Saccharomyces cerevisiae]
 gb|AAB64655.1| Ubc6p: ubiquitin-conjugating enzyme [Saccharomyces cerevisiae]
 tpg|DAA07761.1| TPA: E2 ubiquitin-conjugating protein UBC6 [Saccharomyces cerevisiae 
S288c]
 prf||1920365A ubiquitin conjugating enzyme
Length=250

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY+ + + P P ++ARP+  +ILEWHY++ G   TP+ GG Y+G + F
Sbjct  1    MATKQAHKRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YPYKPP I+M TPNGRF P  ++CLSMSD+HP++WNP WSVS+IL GLLSFM  +
Sbjct  61   PSDYPYKPPAIRMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSD  118



>ref|XP_002405482.1| ubiquitin protein ligase, putative [Ixodes scapularis]
 gb|EEC15301.1| ubiquitin protein ligase, putative [Ixodes scapularis]
Length=177

 Score =   154 bits (388),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A K    RL  EY  L  EPVP V A P PSDILEWH+ + G E TP  GG Y+GK++FP
Sbjct  5    ASKTAARRLHLEYTKLLCEPVPYVTAHPLPSDILEWHFAVRGPEKTPLEGGVYHGKLRFP  64

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             ++P+ PP I + TPNGRF    ++CLS+SDFHPESWNP WS+SSILTGLLSFM+D
Sbjct  65   ADFPFSPPSIFLITPNGRFQCNTRLCLSISDFHPESWNPSWSLSSILTGLLSFMVD  120



>emb|CDS09230.1| Putative Ubiquitin-conjugating enzyme E2 6 [Absidia idahoensis 
var. thermophila]
Length=253

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K+   RL KEY  + K P P +VA+P  S+ILEWHYV+ G   TP+ GG YYG++ F
Sbjct  1    MATKSAFKRLTKEYMEIEKNPPPFIVAKPLESNILEWHYVIRGPPDTPYEGGEYYGRLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPP I+MTTP+GRF P+ ++CL+MSDFHP  WNP WSV++IL GLLSFM  +
Sbjct  61   PSEYPFKPPAIRMTTPSGRFQPDTRLCLTMSDFHPSLWNPSWSVATILNGLLSFMTTD  118



>gb|EDN63076.1| ubiquitin-conjugating enzyme [Saccharomyces cerevisiae YJM789]
 gb|EDV08931.1| ubiquitin-conjugating enzyme E2 6 [Saccharomyces cerevisiae RM11-1a]
 gb|EDZ72568.1| YER100Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|EEU05199.1| Ubc6p [Saccharomyces cerevisiae JAY291]
 emb|CAY79284.1| Ubc6p [Saccharomyces cerevisiae EC1118]
 gb|EGA62636.1| Ubc6p [Saccharomyces cerevisiae FostersO]
 gb|EGA83147.1| Ubc6p [Saccharomyces cerevisiae Lalvin QA23]
 gb|EGA87119.1| Ubc6p [Saccharomyces cerevisiae VL3]
 dbj|GAA22966.1| K7_Ubc6p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EIW10895.1| Ubc6p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG86599.1| Ubc6p [Saccharomyces cerevisiae R008]
 gb|EWG91493.1| Ubc6p [Saccharomyces cerevisiae P301]
 gb|EWH18848.1| Ubc6p [Saccharomyces cerevisiae P283]
 gb|AHY75661.1| Ubc6p [Saccharomyces cerevisiae YJM993]
 gb|AJP38371.1| Ubc6p [Saccharomyces cerevisiae YJM1078]
Length=250

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY+ + + P P ++ARP+  +ILEWHY++ G   TP+ GG Y+G + F
Sbjct  1    MATKQAHKRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YPYKPP I+M TPNGRF P  ++CLSMSD+HP++WNP WSVS+IL GLLSFM  +
Sbjct  61   PSDYPYKPPAIRMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSD  118



>emb|CCI39487.1| unnamed protein product [Albugo candida]
Length=233

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA      RL+KEY A+ ++ + N+VA P  S+ILEWHYV+ G   + + GG+Y+G ++F
Sbjct  1    MASFLATKRLRKEYMAIQRKSIENIVAAPLHSNILEWHYVIIGTNDSCYEGGFYHGILRF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP KPP + M TPNGRF   +++CLSMSDFHPE+WNPMWSVSSILTGL SFM+++
Sbjct  61   PPEYPMKPPSVLMLTPNGRFKTNQRLCLSMSDFHPETWNPMWSVSSILTGLYSFMLES  118



>emb|CDH59575.1| ubc-like protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=253

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K+   RL KEY  + K P P +VA+P  S+ILEWHYV+ G   TP+ GG YYG++ F
Sbjct  1    MATKSAFKRLTKEYMEIEKNPPPFIVAKPLESNILEWHYVIRGPPDTPYEGGEYYGRLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPP I+MTTP+GRF P+ ++CL+MSDFHP  WNP WSV++IL GLLSFM  +
Sbjct  61   PSEYPFKPPAIRMTTPSGRFQPDTRLCLTMSDFHPSLWNPSWSVATILNGLLSFMTTD  118



>gb|EHN02769.1| Ubc6p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EJT44189.1| UBC6-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=250

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY+ + + P P ++ARP+  +ILEWHY++ G   TP+ GG Y+G + F
Sbjct  1    MATKQAHKRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPAETPYKGGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YPYKPP I+M TPNGRF P  ++CLSMSD+HP++WNP WSVS+IL GLLSFM  +
Sbjct  61   PSDYPYKPPAIRMVTPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSD  118



>gb|EPT03069.1| hypothetical protein FOMPIDRAFT_19405, partial [Fomitopsis pinicola 
FP-58527 SS1]
Length=155

 Score =   153 bits (386),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY  + ++P P + A P  ++IL W+Y++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAHKRLTKEYMTMQRDPPPFIWAVPEENNILTWNYIIRGPPDSPFAGGEYHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P+RKIC SMSDFHP +WNP WSVS+ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMLTPSGRFQPDRKICFSMSDFHPGTWNPAWSVSTILTGLLSFMLSD  118



>ref|XP_003959920.1| hypothetical protein KAFR_0L01750 [Kazachstania africana CBS 
2517]
 emb|CCF60785.1| hypothetical protein KAFR_0L01750 [Kazachstania africana CBS 
2517]
Length=251

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K  + RL KEY+ + + P P +VARP+  +ILEWHYV+ G   TP++ G Y+G + F
Sbjct  1    MATKQALKRLTKEYKLIVENPPPYIVARPNEDNILEWHYVITGPSDTPYSSGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFM  597
            P +YPYKPP I+M TPNGRF    ++CLSMSD+HP+ WNP WSVS+ILTGLLSFM
Sbjct  61   PSDYPYKPPAIRMITPNGRFKENTRLCLSMSDYHPDLWNPGWSVSTILTGLLSFM  115



>ref|XP_007261327.1| UBC-like protein [Fomitiporia mediterranea MF3/22]
 gb|EJD07375.1| UBC-like protein [Fomitiporia mediterranea MF3/22]
Length=270

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY A+ +EP P V A P   +IL W+Y++ G   +P+AGG +YG + F
Sbjct  1    MASKAAFKRLTKEYVAMQREPPPFVWAAPDEKNILHWNYIIRGPPDSPYAGGEFYGVVLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMLTPSGRFQPDKKICFSMSDFHPGSWNPAWSVATILTGLLSFMLAD  118



>gb|EGA59013.1| Ubc6p [Saccharomyces cerevisiae FostersB]
Length=249

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY+ + + P P ++ARP+  +ILEWHY++ G   TP+ GG Y+G + F
Sbjct  1    MATKQAHKRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YPYKPP I+M TPNGRF P  ++CLSMSD+HP++WNP WSVS+IL GLLSFM  +
Sbjct  61   PSDYPYKPPAIRMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSD  118



>gb|EWG96518.1| Ubc6p [Saccharomyces cerevisiae R103]
Length=248

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY+ + + P P ++ARP+  +ILEWHY++ G   TP+ GG Y+G + F
Sbjct  1    MATKQAHKRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YPYKPP I+M TPNGRF P  ++CLSMSD+HP++WNP WSVS+IL GLLSFM  +
Sbjct  61   PSDYPYKPPAIRMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSD  118



>ref|XP_011331927.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Cerapachys 
biroi]
 gb|EZA58743.1| Ubiquitin-conjugating enzyme E2 J2 [Cerapachys biroi]
Length=233

 Score =   155 bits (392),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL+++Y  L K+PVP V+A P PS+ILEWHYV+ G E TP+ GG+Y+GK+ FP E+P++P
Sbjct  14   RLKQDYLRLKKDPVPYVLAEPVPSNILEWHYVVIGPEKTPYEGGFYHGKLIFPGEFPFQP  73

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  74   PSIYMTTPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIE  122



>gb|KIP03433.1| hypothetical protein PHLGIDRAFT_121586 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=265

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY A+ +EP P V A P   +IL W+Y++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAHKRLNKEYVAMQREPPPFVWAAPDEKNILTWNYIIRGPPDSPFAGGEYHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P+RKIC SMSDFHP +WNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMLTPSGRFQPDRKICFSMSDFHPGTWNPAWSVATILTGLLSFMLSD  118



>gb|EHJ76300.1| putative Ubiquitin-conjugating enzyme E2 J2 [Danaus plexippus]
Length=226

 Score =   154 bits (390),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL+++Y  L  +PVP V A P PS+ILEWHYV++G E +P+ GGYY+GKI FP E+P+KP
Sbjct  12   RLKQDYLRLKNDPVPYVTAEPVPSNILEWHYVVKGPEKSPYEGGYYHGKIIFPREFPFKP  71

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P I M TPNGRF    K+CLS++DFHP++WNP WS+S+ILTGLLSFM++
Sbjct  72   PSIYMITPNGRFKTNTKLCLSITDFHPDTWNPAWSISTILTGLLSFMLE  120



>gb|EHN07620.1| Ubc6p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=260

 Score =   155 bits (393),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY+ + + P P ++ARP+  +ILEWHY++ G   TP+ GG Y+G + F
Sbjct  1    MATKQAHKRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YPYKPP I+M TPNGRF P  ++CLSMSD+HP++WNP WSVS+IL GLLSFM  +
Sbjct  61   PSDYPYKPPAIRMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSD  118



>gb|EGA79225.1| Ubc6p [Saccharomyces cerevisiae Vin13]
Length=260

 Score =   155 bits (393),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY+ + + P P ++ARP+  +ILEWHY++ G   TP+ GG Y+G + F
Sbjct  1    MATKQAHKRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YPYKPP I+M TPNGRF P  ++CLSMSD+HP++WNP WSVS+IL GLLSFM  +
Sbjct  61   PSDYPYKPPAIRMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSD  118



>ref|XP_002735278.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Saccoglossus 
kowalevskii]
Length=237

 Score =   155 bits (391),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
                RL+++Y  + K+PVP V A P  S+ILEWHYV+ G EGTP+ GGYY+GK+ FP E+
Sbjct  8    TATARLKQDYIRIMKDPVPYVTAAPLHSNILEWHYVVRGPEGTPYEGGYYHGKLVFPREF  67

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P+KPP I M TPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  68   PFKPPSIYMITPNGRFKCNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMVE  120



>ref|XP_011499227.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Ceratosolen 
solmsi marchali]
 ref|XP_011499228.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Ceratosolen 
solmsi marchali]
Length=235

 Score =   155 bits (391),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL+++Y  L K+PVP V A P PS+ILEWHYV++G E TP+ GG+Y+GK+ FP E+P++P
Sbjct  11   RLKQDYLRLKKDPVPYVQAEPIPSNILEWHYVIKGPENTPYEGGFYHGKLVFPVEFPFQP  70

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P I MTTPNGRF    K+CLS+SD+HP++WNP WSVS+IL GLLSFM+++
Sbjct  71   PSIYMTTPNGRFKVNTKLCLSISDYHPDTWNPAWSVSTILIGLLSFMIES  120



>ref|XP_009162300.1| hypothetical protein T265_00291 [Opisthorchis viverrini]
 gb|KER33837.1| hypothetical protein T265_00291 [Opisthorchis viverrini]
Length=304

 Score =   156 bits (395),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  259  EKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPP  438
            +   I RL+++Y  L K+PVP V A P PS++ EWHYV+ G   +P+ GGYY+GK+ FP 
Sbjct  88   KSTAIQRLKQDYIRLIKDPVPYVTAEPLPSNMFEWHYVIRGPSDSPYKGGYYHGKLVFPR  147

Query  439  EYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            E+P++PP I M TPNGRF    ++CLS+SDFHP++WNP WSVSSILTGLLSFM++N
Sbjct  148  EFPFRPPSIYMITPNGRFACNTRLCLSISDFHPDTWNPAWSVSSILTGLLSFMLEN  203



>ref|XP_004180086.1| hypothetical protein TBLA_0D00600 [Tetrapisispora blattae CBS 
6284]
 emb|CCH60567.1| hypothetical protein TBLA_0D00600 [Tetrapisispora blattae CBS 
6284]
Length=256

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY+ + + P P + ARP+ S+ILEWHY++ G + TP+ GG Y+G + F
Sbjct  1    MATKQAHKRLTKEYKMMVETPPPYITARPNESNILEWHYIIIGPQDTPYDGGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YPYKPP I+M TPNGRF    ++CLSMSD+HP++WNP WSV++IL GLLSFM  N
Sbjct  61   PSDYPYKPPAIRMITPNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMTGN  118



>gb|KDQ19061.1| hypothetical protein BOTBODRAFT_103425 [Botryobasidium botryosum 
FD-172 SS1]
Length=171

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY A+ + P P V A+P   +IL W+Y++ G    P+AGG Y+G I F
Sbjct  1    MASKAAHKRLSKEYVAMQRSPPPYVFAQPDEHNILNWNYIIRGPPDCPYAGGEYHGIILF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP +WNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMYTPSGRFQPDKKICFSMSDFHPGTWNPAWSVATILTGLLSFMLSD  118



>ref|XP_007849131.1| ubiquitin-conjugating enzyme e2 6 [Moniliophthora roreri MCA 
2997]
 gb|ESK91569.1| ubiquitin-conjugating enzyme e2 6 [Moniliophthora roreri MCA 
2997]
Length=267

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY A+ KEP P + A P   +IL W+Y++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAQKRLTKEYVAMVKEPPPFIWAVPDEKNILTWNYIIRGPPDSPFAGGEYHGVLMF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP +WNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMLTPSGRFHPDKKICFSMSDFHPGTWNPAWSVATILTGLLSFMLSD  118



>gb|KDR70980.1| hypothetical protein GALMADRAFT_144442 [Galerina marginata CBS 
339.88]
Length=278

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY A+ KEP P V A P   +IL W++++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAQKRLSKEYVAMQKEPPPFVWAAPDEKNILTWNFLIRGPADSPFAGGEYHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P+RKIC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMFTPSGRFQPDRKICFSMSDFHPGSWNPAWSVATILTGLLSFMLSD  118



>ref|XP_011297863.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Fopius arisanus]
 ref|XP_011297864.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Fopius arisanus]
Length=230

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL+++Y  L K+PVP ++A P+PS+ILEWHYV++G E TP+ GG+Y+GK+ FP E+P+ P
Sbjct  11   RLRQDYMRLKKDPVPYIIAEPNPSNILEWHYVVKGPESTPYNGGFYHGKLIFPGEFPFLP  70

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+IL GLLSFM++
Sbjct  71   PSIYMTTPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILAGLLSFMIE  119



>ref|XP_007343684.1| UBC-like protein [Auricularia delicata TFB-10046 SS5]
 gb|EJD48248.1| UBC-like protein [Auricularia delicata TFB-10046 SS5]
Length=257

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KE+ A+ KEP P V A P   DIL W++++ G   +P+ GG Y G+I F
Sbjct  1    MASKAAQKRLSKEFVAMQKEPPPFVWAAPDEKDILSWYFIVRGPPDSPYHGGEYLGQIMF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P+RKIC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMITPSGRFQPDRKICFSMSDFHPGSWNPAWSVATILTGLLSFMLSD  118



>emb|CCK68678.1| hypothetical protein KNAG_0B02360 [Kazachstania naganishii CBS 
8797]
Length=251

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K  + RL KEY+ + + P P V ARP+  +ILEWHYV+ G   TP+ GG Y+G + F
Sbjct  1    MATKQALKRLTKEYKLIVENPPPYVTARPNEDNILEWHYVITGPPETPYEGGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFM  597
            P +YPYKPP I+M TPNGRF    ++CLSMSD+HP+ WNP WSVS+ILTGLLSFM
Sbjct  61   PSDYPYKPPAIRMVTPNGRFKENTRLCLSMSDYHPDLWNPGWSVSTILTGLLSFM  115



>ref|XP_011256999.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Camponotus 
floridanus]
 gb|EFN67993.1| Ubiquitin-conjugating enzyme E2 J2 [Camponotus floridanus]
Length=178

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
            + ++RL+++Y  L  +PVP V+A P P++ LEWHYV++G E TP+ GGYY+GKI FP E+
Sbjct  7    SAMLRLKQDYLHLKMDPVPYVLAEPVPANFLEWHYVVKGPESTPYEGGYYHGKIIFPEEF  66

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P+KPP I M+TPNGRF    ++CLS+SD+HPE+WNP W+VS+ILTGLLSFM++
Sbjct  67   PFKPPSIYMSTPNGRFCINARLCLSISDYHPETWNPAWNVSTILTGLLSFMIE  119



>gb|KEZ43409.1| Ubiquitin-conjugating enzyme E2 J2 [Scedosporium apiospermum]
Length=265

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL +EY+A+ + P P + A PS S+ILEWHY++ G E TP+ GG Y+G + F
Sbjct  1    MASKAARTRLTREYKAISENPPPYITAHPSESNILEWHYIITGPEDTPYHGGQYWGTLMF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFM  597
            PPEYP+KPP I+M TP+GRF P  ++CLS+SDFHP+S+NP W VS+IL GLLSFM
Sbjct  61   PPEYPFKPPAIRMHTPSGRFQPSTRLCLSISDFHPKSFNPAWEVSTILIGLLSFM  115



>ref|XP_008613711.1| ubiquitin-conjugating enzyme E2 J2 [Saprolegnia diclina VS20]
 gb|EQC33025.1| ubiquitin-conjugating enzyme E2 J2 [Saprolegnia diclina VS20]
Length=186

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 2/118 (2%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA      RL+KEY AL K+PV N+ A P  S+ILEWHYV+ G     + GG Y+GK+KF
Sbjct  1    MAPSMATTRLRKEYVALKKKPVDNIEAVPLESNILEWHYVIRGV--GVYEGGLYHGKLKF  58

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP KPP + M TP+GRF P  ++CLSMSDFHPE+WNPMWSV SILTGL SFM ++
Sbjct  59   PPEYPMKPPSVYMATPSGRFEPNTRLCLSMSDFHPETWNPMWSVGSILTGLFSFMNED  116



>ref|XP_001512053.2| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Ornithorhynchus 
anatinus]
Length=259

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPETTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I MTTPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMTTPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|XP_011103222.1| ubc6p [Saccharomyces arboricola H-6]
 gb|EJS43993.1| ubc6p [Saccharomyces arboricola H-6]
Length=250

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KEY+ + + P P ++ARP+  ++LEWHY++ G   TP+  G Y+G + F
Sbjct  1    MATKQAHRRLTKEYKLMVENPPPYIIARPNEDNVLEWHYIITGPADTPYKDGQYHGTLTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YPYKPP I+M TPNGRF P  ++CLSMSD+HP++WNP WSVS+IL GLLSFM  +
Sbjct  61   PSDYPYKPPAIRMVTPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTSD  118



>ref|XP_005109064.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Aplysia californica]
Length=244

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL++++  + K+PVP + A P PS+ILEWHY++EG E +P+ GG Y+GK+ FP E+P+KP
Sbjct  13   RLKQDFMRIMKDPVPYIQAAPVPSNILEWHYIVEGPENSPYEGGIYHGKLVFPREFPFKP  72

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P I M TPNGRFM   ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  73   PSIYMLTPNGRFMCNSRLCLSISDFHPDTWNPAWSVSTILTGLLSFMLE  121



>ref|XP_008038611.1| UBC-like protein [Trametes versicolor FP-101664 SS1]
 gb|EIW58291.1| UBC-like protein [Trametes versicolor FP-101664 SS1]
Length=162

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY A+ KEP P V A P   +IL W++++ G   +P+AGG ++G + F
Sbjct  1    MASKAAYRRLSKEYIAMQKEPPPFVWAAPDEKNILTWNFIIRGPPDSPYAGGEFHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMFTPSGRFQPDKKICFSMSDFHPGSWNPAWSVATILTGLLSFMLAD  118



>emb|CEP60262.1| LALA0S01e06678g1_1 [Lachancea lanzarotensis]
Length=245

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA +    RL KEY+++ + P P ++A+P+  +ILEWHYV+ G   TP++GG Y+G + F
Sbjct  1    MATRQAQKRLTKEYKSMVENPPPFIIAQPNEDNILEWHYVISGPPDTPYSGGQYHGTLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P +YP+KPP I+M TP+GRF  + ++CLSMSD+HP++WNP WSVS+ILTGLLSFM  N
Sbjct  61   PSDYPFKPPAIRMVTPSGRFKEDTRLCLSMSDYHPDTWNPSWSVSTILTGLLSFMTSN  118



>ref|XP_004363366.1| ubiquitin conjugating enzyme protein 26 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE92723.1| ubiquitin conjugating enzyme protein 26 [Capsaspora owczarzaki 
ATCC 30864]
Length=247

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  268  CIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYP  447
            C  RLQKEYR + K+PVP + A P  S+ILEWHYV+ G E +P+  G Y+GK+ FP +YP
Sbjct  5    CTQRLQKEYRMILKDPVPYIRAVPRTSNILEWHYVITGPENSPYHNGLYHGKLVFPKDYP  64

Query  448  YKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            +KPP I M TP+GRF    ++CLSMSDFHPE +NP WSV+SILTGLLSFM+++
Sbjct  65   FKPPAISMFTPSGRFQTNTRLCLSMSDFHPELFNPAWSVASILTGLLSFMLES  117



>gb|KFD53233.1| hypothetical protein M513_05943 [Trichuris suis]
 gb|KFD65555.1| hypothetical protein M514_05943 [Trichuris suis]
Length=430

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
              ++RL+K+   L ++PVP V A P PS+ILEWHY++EG + TPF GG+Y+GK+ FPP+Y
Sbjct  210  VALLRLRKDAVRLMRDPVPYVTAVPLPSNILEWHYIVEGPKDTPFEGGFYHGKLVFPPDY  269

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P+KPP I M TPNGRFM   ++CLS+SDFHP++WNP WSV +ILTGLLSFM+++
Sbjct  270  PFKPPSIYMFTPNGRFMTNCRLCLSISDFHPDTWNPTWSVGTILTGLLSFMLES  323



>gb|KHJ40782.1| ubiquitin--protein ligase [Trichuris suis]
Length=432

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
              ++RL+K+   L ++PVP V A P PS+ILEWHY++EG + TPF GG+Y+GK+ FPP+Y
Sbjct  212  VALLRLRKDAVRLMRDPVPYVTAVPLPSNILEWHYIVEGPKDTPFEGGFYHGKLVFPPDY  271

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P+KPP I M TPNGRFM   ++CLS+SDFHP++WNP WSV +ILTGLLSFM+++
Sbjct  272  PFKPPSIYMFTPNGRFMTNCRLCLSISDFHPDTWNPTWSVGTILTGLLSFMLES  325



>ref|XP_003326606.2| ubiquitin-conjugating enzyme E2 J2 [Puccinia graminis f. sp. 
tritici CRL 75-36-700-3]
 gb|EFP82187.2| ubiquitin-conjugating enzyme E2 J2 [Puccinia graminis f. sp. 
tritici CRL 75-36-700-3]
Length=244

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KE   L K P P ++ARP  +DILEWHY+L G   TP+ GG ++G + F
Sbjct  1    MASKQANKRLMKELVDLNKSPPPFIIARPRETDILEWHYILRGPPDTPYEGGEFWGTVIF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMM  600
            P EYP+KPP IKM TP+GRF P+RKIC SMSD+HP SWNP WSV++IL GLLSFM+
Sbjct  61   PAEYPFKPPAIKMLTPSGRFQPDRKICTSMSDYHPASWNPAWSVATILNGLLSFMV  116



>ref|XP_009033312.1| hypothetical protein AURANDRAFT_20698, partial [Aureococcus anophagefferens]
 gb|EGB12242.1| hypothetical protein AURANDRAFT_20698, partial [Aureococcus anophagefferens]
Length=158

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA      RL +E+ A+ K P  N+VARP  S++LEWHYV+ G + + + GG+Y+GK+KF
Sbjct  1    MASDLATRRLLREFAAMRKAPPDNIVARPLESNVLEWHYVITGTKDSVYEGGHYHGKLKF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP +PP + M TP+GRF    ++CLSMSDFHPESWNPMWSVS+ILTGL SFM+++
Sbjct  61   PTEYPLRPPSVLMCTPSGRFKTNCRLCLSMSDFHPESWNPMWSVSTILTGLYSFMLES  118



>ref|XP_003337843.1| ubiquitin-conjugating enzyme E2 J2 [Puccinia graminis f. sp. 
tritici CRL 75-36-700-3]
 gb|EFP93424.1| ubiquitin-conjugating enzyme E2 J2 [Puccinia graminis f. sp. 
tritici CRL 75-36-700-3]
Length=169

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA K    RL KE+  + K P P +VARP  ++ILEWHY++ G   TP+ GG ++G + F
Sbjct  1    MASKQAQKRLMKEHSEITKSPPPFIVARPKDTNILEWHYIIRGPPDTPYTGGEFWGTVTF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMM  600
            PPEYP++PP I M TP+GRF P  KIC SMSD+HP+SWNP W VS+ILTGLLSFM+
Sbjct  61   PPEYPFRPPAIVMMTPSGRFNPGSKICTSMSDYHPDSWNPAWGVSTILTGLLSFMV  116



>gb|KIM88382.1| hypothetical protein PILCRDRAFT_255471 [Piloderma croceum F 1598]
Length=254

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY A+ KEP P V A P   +IL W+Y++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAHKRLTKEYVAMQKEPPPFVWACPDEKNILTWNYLIRGPPDSPFAGGEYHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P+R+IC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMLTPSGRFQPDRRICFSMSDFHPGSWNPAWSVATILTGLLSFMLSD  118



>gb|AAX27905.2| SJCHGC03539 protein [Schistosoma japonicum]
Length=212

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
              + RL+++Y  L K+PVP V A P P+++ EWHYV++G   +P+ GGYY+GK+ FP ++
Sbjct  26   TALQRLKQDYLRLAKDPVPYVTAEPLPTNLFEWHYVIKGPSDSPYKGGYYHGKLIFPRDF  85

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P++PP I M TPNGRF    ++CLS+SDFHP++WNP WSVSSILTGLLSFM++N
Sbjct  86   PFRPPSIYMITPNGRFACNTRLCLSISDFHPDTWNPAWSVSSILTGLLSFMLEN  139



>gb|EAW56264.1| ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast), isoform 
CRA_g, partial [Homo sapiens]
Length=155

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>emb|CAJ81624.1| ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) [Xenopus 
(Silurana) tropicalis]
Length=168

 Score =   151 bits (382),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLVFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>emb|CAF89614.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=185

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEKTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>gb|EMD38985.1| hypothetical protein CERSUDRAFT_81780 [Ceriporiopsis subvermispora 
B]
Length=204

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY A+ KEP P V A P   +IL W+Y++ G   +P+AGG Y+G + F
Sbjct  1    MASKAAHKRLHKEYLAMQKEPPPFVWAVPDEKNILTWNYIIRGPPDSPYAGGEYHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP +WNP WSV++ILTGLLSF++ +
Sbjct  61   PSEYPFKPPGIKMLTPSGRFQPDKKICFSMSDFHPGTWNPAWSVATILTGLLSFLLSD  118



>ref|NP_001156134.1| ubiquitin-conjugating enzyme E2 j2-like [Acyrthosiphon pisum]
 ref|XP_008184932.1| PREDICTED: ubiquitin-conjugating enzyme E2 j2-like isoform X1 
[Acyrthosiphon pisum]
 ref|XP_008184934.1| PREDICTED: ubiquitin-conjugating enzyme E2 j2-like isoform X1 
[Acyrthosiphon pisum]
 dbj|BAH70882.1| ACYPI003183 [Acyrthosiphon pisum]
Length=222

 Score =   153 bits (386),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +1

Query  262  KACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPE  441
             +  +RL+++Y  L  +PVP V+A P+PS+ILEW+YV+ G + +P+AGGYY G++ FP +
Sbjct  6    SSATLRLKQDYIRLKNDPVPYVIAEPNPSNILEWYYVVSGPDDSPYAGGYYLGRLVFPRD  65

Query  442  YPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            +P+KPP I M TPNGRF    ++CLS+SD+HP++WNP WSVS+ILTGLLSFM++N
Sbjct  66   FPFKPPSIYMITPNGRFKTNTRLCLSISDYHPDTWNPAWSVSTILTGLLSFMLEN  120



>ref|XP_010078958.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2, partial [Pterocles 
gutturalis]
 gb|KFV00365.1| Ubiquitin-conjugating enzyme E2 J2, partial [Pterocles gutturalis]
Length=165

 Score =   151 bits (381),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>emb|CAX70684.1| hypotherical protein [Schistosoma japonicum]
 emb|CAX70685.1| hypotherical protein [Schistosoma japonicum]
 emb|CAX75670.1| hypotherical protein [Schistosoma japonicum]
Length=236

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
              + RL+++Y  L K+PVP V A P P+++ EWHYV++G   +P+ GGYY+GK+ FP ++
Sbjct  12   TALQRLKQDYLRLAKDPVPYVTAEPLPTNLFEWHYVIKGPSDSPYKGGYYHGKLIFPRDF  71

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P++PP I M TPNGRF    ++CLS+SDFHP++WNP WSVSSILTGLLSFM++N
Sbjct  72   PFRPPSIYMITPNGRFACNTRLCLSISDFHPDTWNPAWSVSSILTGLLSFMLEN  125



>pdb|2F4W|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 J2
 pdb|2F4W|B Chain B, Human Ubiquitin-Conjugating Enzyme E2 J2
Length=187

 Score =   152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  11   APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  70

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++ 
Sbjct  71   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEK  127



>ref|XP_007865380.1| UBC-like protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ56697.1| UBC-like protein [Gloeophyllum trabeum ATCC 11539]
Length=268

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY  + KEP P V A P   +IL W+Y++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAYKRLTKEYVNMQKEPPPFVWAIPDEKNILTWNYIIRGPPDSPFAGGEYHGVLMF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMYTPSGRFQPDKKICFSMSDFHPGSWNPAWSVATILTGLLSFMLSD  118



>emb|CCD60803.1| ubiquitin-conjugating enzyme E2 j2, putative [Schistosoma mansoni]
Length=236

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
              + RL+++Y  L K+PVP V A P P+++ EWHYV++G   +P+ GGYY+GK+ FP ++
Sbjct  12   TALQRLKQDYLRLSKDPVPYVTAEPLPTNLFEWHYVIKGPADSPYKGGYYHGKLVFPRDF  71

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P++PP I M TPNGRF    ++CLS+SDFHP++WNP WSVSSILTGLLSFM++N
Sbjct  72   PFRPPSIYMITPNGRFACNTRLCLSISDFHPDTWNPAWSVSSILTGLLSFMLEN  125



>gb|ESA22793.1| hypothetical protein GLOINDRAFT_342500 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX53996.1| E2 ubiquitin-conjugating protein UBC6 [Rhizophagus irregularis 
DAOM 197198w]
 gb|EXX53997.1| E2 ubiquitin-conjugating protein UBC6 [Rhizophagus irregularis 
DAOM 197198w]
Length=307

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY  L K P P ++A+P  S+ILEWHYV+ G   TP+  G Y+G + F
Sbjct  1    MATKAAYKRLNKEYITLQKNPPPYLMAKPLESNILEWHYVIRGPPDTPYHNGEYHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPP I+MTTP+GRF P+ ++CLSMSDFHP +WNP WSV++ILTGLLSFM  N
Sbjct  61   PAEYPFKPPSIRMTTPSGRFQPDTRLCLSMSDFHPSTWNPSWSVATILTGLLSFMTSN  118



>ref|XP_002602305.1| hypothetical protein BRAFLDRAFT_115538 [Branchiostoma floridae]
 gb|EEN58317.1| hypothetical protein BRAFLDRAFT_115538 [Branchiostoma floridae]
Length=239

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  L K+PVP + A P PS+ILEWHYV++G E +P+ GG Y+GK+ FP
Sbjct  6    APTTATQRLKQDYLRLMKDPVPYITAAPLPSNILEWHYVVKGPENSPYEGGQYHGKLVFP  65

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  66   REFPFKPPSIYMMTPNGRFKCNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMLE  121



>ref|XP_002811667.3| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like, partial [Pongo 
abelii]
Length=166

 Score =   150 bits (380),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++ 
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEK  125



>ref|XP_011054352.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Acromyrmex echinatior]
Length=233

 Score =   152 bits (385),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
            +   RL+++Y  L ++PVP V+A P PS+ILEWHYV+ G E TP+ GG+Y+GK+ FP E+
Sbjct  10   SATARLRQDYLRLKRDPVPYVLAEPVPSNILEWHYVVIGPEKTPYEGGFYHGKLIFPGEF  69

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P++PP I M TPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  70   PFQPPSIYMITPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIE  122



>gb|EGI65589.1| Ubiquitin-conjugating enzyme E2 J2 [Acromyrmex echinatior]
Length=230

 Score =   152 bits (385),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
            +   RL+++Y  L ++PVP V+A P PS+ILEWHYV+ G E TP+ GG+Y+GK+ FP E+
Sbjct  7    SATARLRQDYLRLKRDPVPYVLAEPVPSNILEWHYVVIGPEKTPYEGGFYHGKLIFPGEF  66

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P++PP I M TPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  67   PFQPPSIYMITPNGRFKVNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMIE  119



>emb|CCD60802.1| ubiquitin-conjugating enzyme E2 j2, putative [Schistosoma mansoni]
Length=223

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
              + RL+++Y  L K+PVP V A P P+++ EWHYV++G   +P+ GGYY+GK+ FP ++
Sbjct  12   TALQRLKQDYLRLSKDPVPYVTAEPLPTNLFEWHYVIKGPADSPYKGGYYHGKLVFPRDF  71

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P++PP I M TPNGRF    ++CLS+SDFHP++WNP WSVSSILTGLLSFM++N
Sbjct  72   PFRPPSIYMITPNGRFACNTRLCLSISDFHPDTWNPAWSVSSILTGLLSFMLEN  125



>gb|KIK49007.1| hypothetical protein CY34DRAFT_797380 [Suillus luteus UH-Slu-Lm8-n1]
Length=277

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY ++ KEP P V A P   +IL W+Y++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAHKRLAKEYVSMQKEPPPFVWATPDEKNILTWNYLIRGPPDSPFAGGEYHGVLIF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP +WNP WSV++ILTGLLSFM+ +
Sbjct  61   PAEYPFKPPGIKMFTPSGRFQPDKKICFSMSDFHPGTWNPAWSVATILTGLLSFMLSD  118



>ref|XP_003973665.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Takifugu 
rubripes]
Length=261

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    ATTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEKTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>gb|EPQ10825.1| Ubiquitin-conjugating enzyme E2 J2 [Myotis brandtii]
Length=153

 Score =   150 bits (378),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  22   APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  81

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  82   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  137



>gb|KDO27448.1| hypothetical protein SPRG_07036 [Saprolegnia parasitica CBS 223.65]
Length=183

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 86/118 (73%), Gaps = 2/118 (2%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA      RL+KEY  L K+PV N+ A P  S+ILEWHYV+ G     + GG Y+GK+KF
Sbjct  1    MAPSMATTRLRKEYVGLKKKPVDNIEAVPLESNILEWHYVIRGV--GVYEGGLYHGKLKF  58

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            PPEYP KPP + M TP+GRF P  ++CLSMSDFHPE+WNPMWSV SILTGL SFM ++
Sbjct  59   PPEYPMKPPSVYMATPSGRFEPNTRLCLSMSDFHPETWNPMWSVGSILTGLFSFMNED  116



>ref|XP_005986058.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Latimeria chalumnae]
Length=259

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEKTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>gb|EDL15057.1| ubiquitin-conjugating enzyme E2, J2 homolog (yeast), isoform 
CRA_a [Mus musculus]
Length=196

 Score =   151 bits (381),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  16   APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  75

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  76   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  131



>ref|XP_009444627.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform X2 [Pan 
troglodytes]
Length=232

 Score =   152 bits (384),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>emb|CAX70683.1| hypotherical protein [Schistosoma japonicum]
Length=236

 Score =   152 bits (384),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +1

Query  265  ACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEY  444
              + RL+++Y  L K+PVP V A P P+++ EWHYV++G   +P+ GGYY+GK+ FP ++
Sbjct  12   TALQRLKQDYLRLAKDPVPYVTAEPLPTNLFEWHYVIKGPSDSPYKGGYYHGKLIFPRDF  71

Query  445  PYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P++PP I M TPNGRF    + CLS+SDFHP++WNP WSVSSILTGLLSFM++N
Sbjct  72   PFRPPSIYMITPNGRFACNTRFCLSISDFHPDTWNPAWSVSSILTGLLSFMLEN  125



>ref|XP_001884237.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR05272.1| predicted protein [Laccaria bicolor S238N-H82]
Length=174

 Score =   150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A K    RL KE+ A+ +EP P V A P   +IL W+Y+L G   TPFAGG Y+G + FP
Sbjct  3    ASKPAQKRLTKEFVAMQREPPPFVWAVPDEKNILTWNYLLRGPPDTPFAGGEYHGVLLFP  62

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
             EYP+KPPGIKM TP+GRF P++KIC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  63   SEYPFKPPGIKMFTPSGRFQPDKKICFSMSDFHPGSWNPAWSVATILTGLLSFMLSD  119



>ref|XP_006641956.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Lepisosteus 
oculatus]
Length=262

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  12   APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEKTPYEGGYYHGKLIFP  71

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  72   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  127



>ref|XP_794726.3| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Strongylocentrotus 
purpuratus]
Length=390

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +1

Query  277  RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
            RL+++Y  L K+PVP V A P PS+ILEWHYV+ G + TP+ GG Y+GK+ FP E+P+KP
Sbjct  12   RLKQDYMRLKKDPVPYVTAEPLPSNILEWHYVVRGPKETPYEGGLYHGKLVFPREFPFKP  71

Query  457  PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
            P I MTTPNGRF    ++CLS+SDFHP++WNP WSVS+ILTGLLSFM++
Sbjct  72   PSIYMTTPNGRFKTNTRLCLSISDFHPDTWNPAWSVSTILTGLLSFMVE  120



>ref|XP_010625991.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform X2 [Fukomys 
damarensis]
Length=232

 Score =   152 bits (384),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|NP_001088550.1| ubiquitin-conjugating enzyme E2, J2 [Xenopus laevis]
 gb|AAH84937.1| LOC495424 protein [Xenopus laevis]
Length=259

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLVFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|NP_001271243.1| ubiquitin-conjugating enzyme E2 J2 isoform c [Mus musculus]
Length=232

 Score =   152 bits (384),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|NP_001106369.1| ubiquitin-conjugating enzyme E2 J2 [Xenopus (Silurana) tropicalis]
 gb|AAI55440.1| ube2j2 protein [Xenopus (Silurana) tropicalis]
Length=259

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLVFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|XP_008639446.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Corvus brachyrhynchos]
Length=218

 Score =   151 bits (382),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPELTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|XP_417582.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform 2 [Gallus 
gallus]
 ref|XP_001233677.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform 1 [Gallus 
gallus]
 ref|XP_003212293.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Meleagris gallopavo]
Length=259

 Score =   152 bits (385),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPETTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|XP_003279745.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform 1 [Nomascus 
leucogenys]
Length=259

 Score =   152 bits (385),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>gb|KJA14603.1| hypothetical protein HYPSUDRAFT_48986 [Hypholoma sublateritium 
FD-334 SS-4]
Length=269

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY A+ KEP P V A P   +IL W++++ G   +PF GG Y+G + F
Sbjct  1    MASKAAQKRLSKEYAAMQKEPPPFVWAAPDEKNILNWNFLIRGPPDSPFTGGEYHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PAEYPFKPPGIKMFTPSGRFSPDKKICFSMSDFHPGSWNPAWSVATILTGLLSFMLSD  118



>ref|XP_006732486.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Leptonychotes 
weddellii]
Length=259

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLVFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|NP_001188113.1| ubiquitin-conjugating enzyme e2 j2 [Ictalurus punctatus]
 gb|ADO28547.1| ubiquitin-conjugating enzyme e2 j2 [Ictalurus punctatus]
Length=260

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEKTPYEGGYYHGKLVFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|XP_004545428.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2-like [Maylandia 
zebra]
Length=182

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  25   APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEKTPYEGGYYHGKLIFP  84

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  85   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  140



>ref|XP_003891000.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Papio anubis]
 ref|XP_005545173.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform X1 [Macaca 
fascicularis]
 ref|XP_005545174.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform X2 [Macaca 
fascicularis]
 ref|XP_007979234.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform X2 [Chlorocebus 
sabaeus]
 ref|XP_007979235.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform X2 [Chlorocebus 
sabaeus]
 ref|XP_007979236.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform X2 [Chlorocebus 
sabaeus]
 ref|XP_007979238.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform X2 [Chlorocebus 
sabaeus]
 ref|XP_009206404.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Papio anubis]
 ref|XP_009206434.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Papio anubis]
 ref|XP_009206460.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Papio anubis]
Length=259

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>gb|KIK55277.1| hypothetical protein GYMLUDRAFT_48000 [Gymnopus luxurians FD-317 
M1]
Length=268

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KE+ A+ ++P P + A P   +IL W+Y++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAQKRLNKEFVAMQRDPPPFIWAVPDEKNILTWNYIIRGPPDSPFAGGEYHGVLLF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PSEYPFKPPGIKMLTPSGRFHPDKKICFSMSDFHPGSWNPAWSVATILTGLLSFMLSD  118



>ref|XP_004407458.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Odobenus rosmarus 
divergens]
Length=259

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLVFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|XP_011282698.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Felis catus]
Length=259

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLVFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|XP_003939712.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Saimiri boliviensis 
boliviensis]
Length=259

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>ref|XP_008998466.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 [Callithrix jacchus]
Length=259

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



>gb|KII87129.1| hypothetical protein PLICRDRAFT_42784 [Plicaturopsis crispa FD-325 
SS-3]
Length=264

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  MAEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKF  432
            MA KA   RL KEY  + KEP P V A P   +IL W++++ G   +PFAGG Y+G + F
Sbjct  1    MASKAAHKRLSKEYVVMQKEPPPFVWAVPDEKNILTWNFLIRGPPDSPFAGGEYHGMLMF  60

Query  433  PPEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
            P EYP+KPPGIKM TP+GRF P++KIC SMSDFHP SWNP WSV++ILTGLLSFM+ +
Sbjct  61   PTEYPFKPPGIKMLTPSGRFQPDKKICFSMSDFHPGSWNPAWSVATILTGLLSFMLSD  118



>dbj|GAA47842.1| ubiquitin-conjugating enzyme E2 J2 [Clonorchis sinensis]
Length=1232

 Score =   161 bits (408),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 66/110 (60%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +1

Query  277   RLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFPPEYPYKP  456
             RL+++Y  L K+PVP V A P PS++ EWHYV+ G   +P+ GGYY+GK+ FP E+P++P
Sbjct  1022  RLKQDYIRLIKDPVPYVTAEPLPSNMFEWHYVIRGPSDSPYKGGYYHGKLVFPREFPFRP  1081

Query  457   PGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMDN  606
             P I M TPNGRF    ++CLS+SDFHP++WNP WSVSSILTGLLSFM++N
Sbjct  1082  PSIYMITPNGRFACNTRLCLSISDFHPDTWNPAWSVSSILTGLLSFMLEN  1131



>ref|NP_477515.2| ubiquitin-conjugating enzyme E2 J2 isoform 2 [Homo sapiens]
 ref|XP_005244775.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform X1 [Homo 
sapiens]
 ref|XP_005244776.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform X2 [Homo 
sapiens]
 ref|XP_006710396.1| PREDICTED: ubiquitin-conjugating enzyme E2 J2 isoform X3 [Homo 
sapiens]
 sp|Q8N2K1.3|UB2J2_HUMAN RecName: Full=Ubiquitin-conjugating enzyme E2 J2; AltName: Full=Non-canonical 
ubiquitin-conjugating enzyme 2; Short=NCUBE-2 
[Homo sapiens]
 gb|AAH94777.1| Ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) [Homo 
sapiens]
 gb|AAI04891.1| Ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) [Homo 
sapiens]
 gb|AAI13431.1| Ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) [Homo 
sapiens]
 gb|EAW56256.1| ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast), isoform 
CRA_b [Homo sapiens]
 gb|EAW56258.1| ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast), isoform 
CRA_b [Homo sapiens]
 gb|EAW56260.1| ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast), isoform 
CRA_b [Homo sapiens]
 gb|EAW56261.1| ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast), isoform 
CRA_b [Homo sapiens]
 gb|EAW56265.1| ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast), isoform 
CRA_b [Homo sapiens]
 dbj|BAF84624.1| unnamed protein product [Homo sapiens]
 gb|AAI43658.1| Ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) [Homo 
sapiens]
 gb|ADR83504.1| ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast) (UBE2J2), 
transcript variant 2 [synthetic construct]
 gb|AIC52916.1| UBE2J2, partial [synthetic construct]
 gb|AIC57596.1| UBE2J2, partial [synthetic construct]
Length=259

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  256  AEKACIMRLQKEYRALCKEPVPNVVARPSPSDILEWHYVLEGCEGTPFAGGYYYGKIKFP  435
            A      RL+++Y  + K+PVP + A P PS+ILEWHYV+ G E TP+ GGYY+GK+ FP
Sbjct  9    APTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFP  68

Query  436  PEYPYKPPGIKMTTPNGRFMPERKICLSMSDFHPESWNPMWSVSSILTGLLSFMMD  603
             E+P+KPP I M TPNGRF    ++CLS++DFHP++WNP WSVS+ILTGLLSFM++
Sbjct  69   REFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVE  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800