BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001M01

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771431.1|  PREDICTED: carbonyl reductase family member ...    241   7e-76   Nicotiana sylvestris
ref|XP_009618446.1|  PREDICTED: carbonyl reductase family member ...    241   7e-76   Nicotiana tomentosiformis
ref|XP_007023099.1|  NAD(P)-binding Rossmann-fold superfamily pro...    236   2e-74   Theobroma cacao [chocolate]
gb|KDP42495.1|  hypothetical protein JCGZ_00292                         235   5e-74   Jatropha curcas
ref|XP_006349286.1|  PREDICTED: dehydrogenase/reductase SDR famil...    236   6e-74   Solanum tuberosum [potatoes]
ref|XP_011087630.1|  PREDICTED: NADPH-dependent pterin aldehyde r...    235   1e-73   Sesamum indicum [beniseed]
ref|XP_004230419.1|  PREDICTED: carbonyl reductase family member ...    236   2e-73   Solanum lycopersicum
ref|XP_010314315.1|  PREDICTED: carbonyl reductase family member ...    236   2e-73   Solanum lycopersicum
ref|XP_002268804.1|  PREDICTED: NADPH-dependent pterin aldehyde r...    234   2e-73   Vitis vinifera
ref|XP_011087629.1|  PREDICTED: NADPH-dependent pterin aldehyde r...    234   3e-73   Sesamum indicum [beniseed]
emb|CBI29642.3|  unnamed protein product                                234   7e-73   Vitis vinifera
gb|EPS57319.1|  hypothetical protein M569_17499                         230   4e-72   Genlisea aurea
ref|XP_010274977.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    230   8e-72   Nelumbo nucifera [Indian lotus]
ref|XP_008786449.1|  PREDICTED: uncharacterized oxidoreductase YM...    231   1e-71   Phoenix dactylifera
ref|XP_010274976.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    229   1e-71   Nelumbo nucifera [Indian lotus]
gb|EYU35030.1|  hypothetical protein MIMGU_mgv1a010194mg                228   3e-70   Erythranthe guttata [common monkey flower]
ref|XP_010490908.1|  PREDICTED: uncharacterized oxidoreductase YM...    226   3e-70   Camelina sativa [gold-of-pleasure]
ref|NP_563866.1|  NADPH-dependent pterin aldehyde reductase             225   4e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65520.1|  unknown                                                 225   5e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892558.1|  hypothetical protein ARALYDRAFT_471142             224   8e-70   
ref|XP_006417480.1|  hypothetical protein EUTSA_v10008625mg             224   9e-70   Eutrema salsugineum [saltwater cress]
ref|XP_010676803.1|  PREDICTED: NADPH-dependent pterin aldehyde r...    224   1e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010475892.1|  PREDICTED: uncharacterized oxidoreductase YM...    224   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_007023100.1|  NAD(P)-binding Rossmann-fold superfamily pro...    223   2e-69   
ref|XP_010458373.1|  PREDICTED: carbonyl reductase family member ...    223   2e-69   Camelina sativa [gold-of-pleasure]
gb|EYU35029.1|  hypothetical protein MIMGU_mgv1a012162mg                224   3e-69   Erythranthe guttata [common monkey flower]
gb|KHG10740.1|  Oxidoreductase                                          223   6e-69   Gossypium arboreum [tree cotton]
ref|XP_010030227.1|  PREDICTED: dehydrogenase/reductase SDR famil...    222   1e-68   Eucalyptus grandis [rose gum]
ref|XP_002527853.1|  short-chain dehydrogenase, putative                222   1e-68   Ricinus communis
gb|KCW57161.1|  hypothetical protein EUGRSUZ_I02792                     221   2e-68   Eucalyptus grandis [rose gum]
ref|XP_010030228.1|  PREDICTED: dehydrogenase/reductase SDR famil...    221   3e-68   Eucalyptus grandis [rose gum]
ref|XP_010534693.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    220   5e-68   Tarenaya hassleriana [spider flower]
gb|KJB69051.1|  hypothetical protein B456_011G003700                    220   5e-68   Gossypium raimondii
gb|KJB69053.1|  hypothetical protein B456_011G003700                    219   5e-68   Gossypium raimondii
emb|CDY20941.1|  BnaA08g25840D                                          219   7e-68   Brassica napus [oilseed rape]
gb|KJB69052.1|  hypothetical protein B456_011G003700                    219   8e-68   Gossypium raimondii
gb|KCW57164.1|  hypothetical protein EUGRSUZ_I02794                     220   9e-68   Eucalyptus grandis [rose gum]
ref|XP_010930522.1|  PREDICTED: NADPH-dependent pterin aldehyde r...    220   1e-67   
ref|XP_009144454.1|  PREDICTED: carbonyl reductase family member 4      218   4e-67   Brassica rapa
ref|XP_006470178.1|  PREDICTED: carbonyl reductase family member ...    217   8e-67   Citrus sinensis [apfelsine]
ref|XP_006431477.1|  hypothetical protein CICLE_v10002114mg             217   3e-66   
ref|XP_010086727.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG    219   4e-66   
ref|XP_004300012.1|  PREDICTED: NADPH-dependent pterin aldehyde r...    213   3e-65   Fragaria vesca subsp. vesca
ref|XP_006836855.1|  hypothetical protein AMTR_s00099p00083600          213   3e-65   Amborella trichopoda
ref|NP_001047141.1|  Os02g0557700                                       211   8e-65   
ref|XP_002453989.1|  hypothetical protein SORBIDRAFT_04g022790          211   1e-64   Sorghum bicolor [broomcorn]
ref|XP_006385080.1|  hypothetical protein POPTR_0004s23710g             211   2e-64   
ref|XP_011028396.1|  PREDICTED: NADPH-dependent pterin aldehyde r...    211   2e-64   Populus euphratica
ref|XP_003575150.1|  PREDICTED: uncharacterized oxidoreductase YM...    211   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_009415002.1|  PREDICTED: uncharacterized oxidoreductase YM...    211   2e-64   
dbj|BAJ89206.1|  predicted protein                                      211   2e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006303587.1|  hypothetical protein CARUB_v10011121mg             211   2e-64   
gb|EEC73408.1|  hypothetical protein OsI_07663                          212   3e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_009415001.1|  PREDICTED: uncharacterized oxidoreductase YM...    211   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004952782.1|  PREDICTED: uncharacterized oxidoreductase YM...    210   5e-64   Setaria italica
ref|NP_001144211.1|  hypothetical protein                               209   9e-64   Zea mays [maize]
ref|XP_009355378.1|  PREDICTED: carbonyl reductase family member 4      209   1e-63   Pyrus x bretschneideri [bai li]
gb|EAZ23452.1|  hypothetical protein OsJ_07145                          209   1e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008464738.1|  PREDICTED: carbonyl reductase family member ...    208   2e-63   Cucumis melo [Oriental melon]
ref|XP_004149129.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    207   6e-63   Cucumis sativus [cucumbers]
ref|XP_003520921.1|  PREDICTED: carbonyl reductase family member ...    206   1e-62   Glycine max [soybeans]
ref|XP_007223751.1|  hypothetical protein PRUPE_ppa010537mg             206   2e-62   
ref|XP_008218650.1|  PREDICTED: carbonyl reductase family member 4      205   4e-62   Prunus mume [ume]
ref|XP_008347943.1|  PREDICTED: carbonyl reductase family member ...    206   7e-62   
ref|XP_008378946.1|  PREDICTED: carbonyl reductase family member 4      202   3e-61   
emb|CDY20642.1|  BnaC08g14160D                                          218   4e-61   Brassica napus [oilseed rape]
emb|CAN82350.1|  hypothetical protein VITISV_019435                     204   5e-61   Vitis vinifera
gb|KEH32750.1|  enoyl-(acyl carrier) reductase                          200   2e-60   Medicago truncatula
ref|XP_010030947.1|  PREDICTED: dehydrogenase/reductase SDR famil...    200   4e-60   Eucalyptus grandis [rose gum]
emb|CDO97648.1|  unnamed protein product                                196   2e-59   Coffea canephora [robusta coffee]
gb|KEH30263.1|  enoyl-(acyl carrier) reductase                          197   4e-59   Medicago truncatula
ref|XP_002981195.1|  hypothetical protein SELMODRAFT_113925             197   5e-59   
ref|XP_006648744.1|  PREDICTED: alcohol dehydrogenase 1-like            195   5e-59   
ref|XP_004499366.1|  PREDICTED: uncharacterized oxidoreductase Yo...    196   1e-58   Cicer arietinum [garbanzo]
ref|XP_008464739.1|  PREDICTED: carbonyl reductase family member ...    195   3e-58   Cucumis melo [Oriental melon]
ref|XP_006576299.1|  PREDICTED: carbonyl reductase family member ...    193   1e-57   Glycine max [soybeans]
gb|KCW57162.1|  hypothetical protein EUGRSUZ_I02793                     191   2e-56   Eucalyptus grandis [rose gum]
gb|AFW86137.1|  hypothetical protein ZEAMMB73_815528                    186   4e-56   
ref|XP_007153913.1|  hypothetical protein PHAVU_003G075700g             188   2e-55   Phaseolus vulgaris [French bean]
ref|XP_008464744.1|  PREDICTED: uncharacterized oxidoreductase YM...    187   3e-55   Cucumis melo [Oriental melon]
ref|XP_004149138.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    185   3e-54   Cucumis sativus [cucumbers]
gb|EMT28916.1|  3-oxoacyl-(acyl-carrier-protein) reductase              181   2e-53   
ref|XP_004169581.1|  PREDICTED: uncharacterized oxidoreductase YM...    181   3e-52   
ref|XP_004169582.1|  PREDICTED: uncharacterized oxidoreductase YM...    180   3e-52   
gb|KGN66094.1|  hypothetical protein Csa_1G570190                       178   9e-52   Cucumis sativus [cucumbers]
ref|XP_006431476.1|  hypothetical protein CICLE_v10002114mg             176   1e-51   
ref|XP_004149130.1|  PREDICTED: uncharacterized oxidoreductase Yx...    177   3e-51   Cucumis sativus [cucumbers]
ref|XP_008464742.1|  PREDICTED: uncharacterized oxidoreductase YM...    176   6e-51   Cucumis melo [Oriental melon]
ref|XP_008464740.1|  PREDICTED: uncharacterized oxidoreductase YM...    177   8e-51   Cucumis melo [Oriental melon]
ref|XP_004159599.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    176   1e-50   
gb|KGN49563.1|  hypothetical protein Csa_5G002580                       173   2e-50   Cucumis sativus [cucumbers]
ref|XP_003606948.1|  Dehydrogenase/reductase SDR family member          174   6e-50   
ref|XP_008450668.1|  PREDICTED: uncharacterized oxidoreductase YM...    173   1e-49   Cucumis melo [Oriental melon]
ref|XP_008460601.1|  PREDICTED: dehydrogenase/reductase SDR famil...    172   2e-49   Cucumis melo [Oriental melon]
gb|KGN66095.1|  hypothetical protein Csa_1G570200                       172   2e-49   Cucumis sativus [cucumbers]
ref|XP_004169584.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    171   4e-49   
ref|XP_008464746.1|  PREDICTED: uncharacterized oxidoreductase YM...    169   4e-48   Cucumis melo [Oriental melon]
ref|XP_004156156.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    169   4e-47   
gb|KGN49700.1|  hypothetical protein Csa_5G077190                       166   4e-47   Cucumis sativus [cucumbers]
gb|KGN49575.1|  hypothetical protein Csa_5G011650                       164   2e-46   Cucumis sativus [cucumbers]
ref|XP_004142297.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    164   3e-46   Cucumis sativus [cucumbers]
ref|XP_004149629.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    164   4e-46   
ref|XP_008464743.1|  PREDICTED: uncharacterized oxidoreductase YM...    163   5e-46   
ref|XP_008464741.1|  PREDICTED: uncharacterized oxidoreductase YM...    164   8e-46   Cucumis melo [Oriental melon]
ref|WP_015155074.1|  short-chain dehydrogenase/reductase SDR            162   1e-45   Chroococcidiopsis thermalis
ref|WP_009631629.1|  dehydrogenase of unknown specificity               160   7e-45   Synechocystis sp. PCC 7509
ref|WP_009785739.1|  oxidoreductase                                     160   9e-45   Lyngbya sp. PCC 8106
ref|XP_004142335.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    160   1e-44   
gb|KGN49666.1|  hypothetical protein Csa_5G054570                       159   2e-44   Cucumis sativus [cucumbers]
ref|WP_010996048.1|  oxidoreductase                                     157   1e-43   Nostocaceae
ref|WP_011321438.1|  oxidoreductase                                     157   1e-43   Trichormus variabilis
ref|WP_015222120.1|  short-chain dehydrogenase/reductase SDR            156   2e-43   
ref|WP_015227788.1|  short-chain dehydrogenase/reductase SDR            156   2e-43   Halothece sp. PCC 7418
ref|WP_023068200.1|  short chain dehydrogenase family protein           155   5e-43   Lyngbya aestuarii
ref|XP_008465557.1|  PREDICTED: zerumbone synthase-like                 155   5e-43   Cucumis melo [Oriental melon]
gb|EDL58891.1|  Short-chain dehydrogenase/reductase SDR                 155   5e-43   Gimesia maris DSM 8797
ref|XP_001639338.1|  predicted protein                                  155   7e-43   Nematostella vectensis
ref|WP_041398487.1|  oxidoreductase                                     154   8e-43   
ref|WP_044238407.1|  oxidoreductase                                     154   1e-42   Gimesia maris
gb|ADY61252.1|  short-chain dehydrogenase/reductase SDR                 155   2e-42   Rubinisphaera brasiliensis DSM 5305
ref|WP_015183053.1|  dehydrogenase                                      154   2e-42   Microcoleus sp. PCC 7113
ref|WP_017662369.1|  hypothetical protein                               154   2e-42   Geitlerinema sp. PCC 7105
ref|WP_006198503.1|  oxidoreductase                                     153   2e-42   Nodularia spumigena
ref|XP_001639339.1|  predicted protein                                  155   2e-42   Nematostella vectensis
ref|WP_015170533.1|  short-chain dehydrogenase/reductase SDR            153   3e-42   Geitlerinema sp. PCC 7407
ref|WP_015189582.1|  short-chain dehydrogenase/reductase SDR            153   3e-42   Gloeocapsa sp. PCC 7428
ref|WP_015243794.1|  oxidoreductase                                     153   3e-42   Singulisphaera acidiphila
ref|WP_006622451.1|  MULTISPECIES: oxidoreductase                       153   4e-42   Arthrospira
ref|WP_012376707.1|  oxidoreductase                                     152   5e-42   Opitutus terrae
ref|WP_044205558.1|  oxidoreductase                                     152   6e-42   Coleofasciculus chthonoplastes
ref|WP_006670039.1|  oxidoreductase                                     152   8e-42   Arthrospira
dbj|BAI88001.1|  short-chain dehydrogenase/reductase SDR                152   9e-42   Arthrospira platensis NIES-39
ref|WP_006617575.1|  oxidoreductase                                     152   1e-41   Arthrospira platensis
gb|EDX77088.1|  oxidoreductase, short chain dehydrogenase/reducta...    152   1e-41   Coleofasciculus chthonoplastes PCC 7420
ref|XP_004169583.1|  PREDICTED: uncharacterized oxidoreductase YM...    150   1e-41   
ref|WP_039716170.1|  oxidoreductase                                     151   1e-41   
ref|WP_011613345.1|  oxidoreductase                                     150   3e-41   Trichodesmium erythraeum
ref|WP_006633506.1|  oxidoreductase                                     150   5e-41   Microcoleus vaginatus
ref|XP_004154036.1|  PREDICTED: uncharacterized oxidoreductase YM...    147   1e-40   
gb|KGN49694.1|  hypothetical protein Csa_5G072680                       149   1e-40   Cucumis sativus [cucumbers]
ref|WP_020470937.1|  hypothetical protein                               149   2e-40   Zavarzinella formosa
ref|XP_004142298.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    149   2e-40   Cucumis sativus [cucumbers]
ref|WP_015177499.1|  3-oxoacyl-(acyl-carrier-protein) reductase         149   2e-40   Oscillatoria nigro-viridis
ref|XP_004170843.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...    149   2e-40   
ref|WP_009783326.1|  oxidoreductase                                     147   6e-40   Lyngbya sp. PCC 8106
ref|WP_041237617.1|  oxidoreductase                                     146   2e-39   
ref|WP_007357715.1|  MULTISPECIES: oxidoreductase                       145   2e-39   Kamptonema
gb|ACK68785.1|  short-chain dehydrogenase/reductase SDR                 146   2e-39   Cyanothece sp. PCC 7424
ref|WP_007360508.1|  oxidoreductase                                     145   3e-39   Opitutaceae bacterium TAV1
ref|XP_001639337.1|  predicted protein                                  145   3e-39   Nematostella vectensis
ref|WP_009511827.1|  oxidoreductase                                     145   4e-39   Opitutaceae bacterium TAV5
ref|WP_012912122.1|  oxidoreductase                                     145   4e-39   Pirellula staleyi
ref|WP_013320495.1|  oxidoreductase                                     144   1e-38   Cyanothece sp. PCC 7822
ref|WP_010583909.1|  oxidoreductase                                     143   2e-38   Schlesneria paludicola
ref|WP_035992728.1|  oxidoreductase                                     142   4e-38   Leptolyngbya sp. KIOST-1
ref|WP_022771528.1|  short-chain alcohol dehydrogenase-like protein     142   5e-38   Candidatus Symbiobacter mobilis
ref|XP_004151593.1|  PREDICTED: oxidoreductase UcpA-like                139   1e-37   
ref|WP_010477928.1|  oxidoreductase                                     140   3e-37   Acaryochloris sp. CCMEE 5410
ref|WP_039723460.1|  MULTISPECIES: oxidoreductase                       139   5e-37   Lyngbya confervoides
ref|WP_010038018.1|  oxidoreductase                                     138   2e-36   Gemmata obscuriglobus
ref|WP_034641141.1|  short-chain dehydrogenase                          138   2e-36   Bacillus manliponensis
ref|WP_035614822.1|  oxidoreductase                                     137   4e-36   Haloferula sp. BvORR071
ref|WP_020035664.1|  hypothetical protein                               136   1e-35   
ref|WP_033674877.1|  short-chain dehydrogenase                          136   1e-35   Bacillus gaemokensis
ref|WP_043589787.1|  oxidoreductase                                     135   2e-35   Geminisphaera colitermitum
ref|WP_029631720.1|  oxidoreductase [                                   135   3e-35   [Scytonema hofmanni] UTEX B 1581
ref|WP_020149797.1|  hypothetical protein                               135   3e-35   
ref|WP_017301486.1|  hypothetical protein                               135   4e-35   Nodosilinea nodulosa
ref|WP_027360907.1|  oxidoreductase                                     134   1e-34   Desulforegula conservatrix
ref|WP_012160753.1|  oxidoreductase                                     133   1e-34   Acaryochloris marina
dbj|BAL52423.1|  short-chain dehydrogenase/reductase                    131   7e-34   uncultured gamma proteobacterium
ref|WP_013011272.1|  oxidoreductase                                     130   2e-33   Denitrovibrio acetiphilus
ref|WP_008273974.1|  oxidoreductase                                     130   2e-33   Cyanothece sp. CCY0110
ref|WP_009966067.1|  oxidoreductase                                     130   3e-33   Verrucomicrobium spinosum
ref|WP_018756498.1|  hypothetical protein                               129   5e-33   Paenibacillus terrigena
ref|WP_038161913.1|  oxidoreductase                                     129   7e-33   Verrucomicrobium sp. BvORR106
ref|WP_021830966.1|  Short chain dehydrogenase                          129   8e-33   Crocosphaera watsonii
ref|XP_009618450.1|  PREDICTED: uncharacterized protein LOC104110628    130   1e-32   
ref|WP_009543694.1|  MULTISPECIES: oxidoreductase                       127   3e-32   Cyanothece
ref|WP_040351871.1|  oxidoreductase                                     126   7e-32   Blastopirellula marina
ref|WP_022947702.1|  oxidoreductase                                     125   2e-31   Methylohalobius crimeensis
gb|EAQ76885.1|  Short-chain dehydrogenase/reductase SDR                 123   6e-31   Blastopirellula marina DSM 3645
ref|WP_007311547.1|  short-chain dehydrogenase/reductase SDR            121   1e-30   
ref|WP_041096310.1|  short-chain dehydrogenase                          123   1e-30   Bacillus badius
ref|WP_000810932.1|  short-chain dehydrogenase                          123   1e-30   Bacillus thuringiensis
ref|XP_008649107.1|  PREDICTED: uncharacterized oxidoreductase YM...    120   1e-30   Zea mays [maize]
gb|EEL87964.1|  Short-chain dehydrogenase/reductase SDR                 123   1e-30   Bacillus cereus AH1272
ref|WP_000440729.1|  short chain dehydrogenase                          123   2e-30   Bacillus
ref|WP_000440728.1|  short-chain dehydrogenase                          123   2e-30   Bacillus cereus
ref|WP_000440730.1|  short-chain dehydrogenase                          122   2e-30   Bacillus cereus
ref|XP_003606949.1|  short-chain dehydrogenase/reductase (SDR) fa...    122   2e-30   
ref|WP_035430161.1|  short-chain dehydrogenase                          121   6e-30   Bacillus sp. UNC322MFChir4.1
ref|WP_000810931.1|  MULTISPECIES: short-chain dehydrogenase            121   7e-30   Bacillus
ref|WP_000810933.1|  short-chain dehydrogenase                          120   9e-30   Bacillus cereus
ref|WP_025151198.1|  short-chain dehydrogenase                          120   1e-29   
ref|WP_001189039.1|  short-chain dehydrogenase                          120   1e-29   Bacillus
gb|EEM29033.1|  Short-chain dehydrogenase/reductase SDR                 120   1e-29   Bacillus thuringiensis Bt407
ref|WP_000812262.1|  short chain dehydrogenase                          120   2e-29   
gb|EEK67628.1|  Short-chain dehydrogenase/reductase SDR                 120   2e-29   Bacillus wiedmannii
ref|WP_001189038.1|  MULTISPECIES: short-chain dehydrogenase            120   2e-29   Bacillus
ref|WP_016087986.1|  short chain dehydrogenase                          120   2e-29   Bacillus
gb|EEK89651.1|  Short-chain dehydrogenase/reductase SDR                 120   2e-29   Bacillus cereus m1550
ref|WP_016134418.1|  short chain dehydrogenase                          120   2e-29   Bacillus cereus
gb|EEL11646.1|  Short-chain dehydrogenase/reductase SDR                 120   2e-29   Bacillus cereus BDRD-Cer4
ref|WP_016081735.1|  MULTISPECIES: short chain dehydrogenase            120   2e-29   Bacillus
ref|WP_043322963.1|  short-chain dehydrogenase                          120   2e-29   Bacillus cereus group
ref|WP_000823063.1|  short chain dehydrogenase                          119   2e-29   Bacillus cereus
ref|WP_000823061.1|  short-chain dehydrogenase                          119   2e-29   Bacillus
ref|WP_023521865.1|  3-oxoacyl-[acyl-carrier protein] reductase         119   3e-29   Bacillus thuringiensis
gb|EEL29063.1|  Short-chain dehydrogenase/reductase SDR                 120   3e-29   Bacillus cereus Rock1-15
ref|WP_025709714.1|  short-chain dehydrogenase                          119   3e-29   Bacillus cereus
ref|WP_000823062.1|  MULTISPECIES: short-chain dehydrogenase            119   3e-29   Bacillus
gb|EEK78948.1|  Short-chain dehydrogenase/reductase SDR                 120   3e-29   Bacillus cereus R309803
gb|AFU12973.1|  Short-chain dehydrogenase/reductase SDR                 119   3e-29   Bacillus thuringiensis MC28
ref|WP_000823058.1|  MULTISPECIES: short-chain dehydrogenase            119   3e-29   Bacillus
ref|WP_029438176.1|  short-chain dehydrogenase                          119   3e-29   Bacillus cereus group
ref|WP_001189477.1|  short-chain dehydrogenase                          119   4e-29   Bacillus cereus
gb|EEL56307.1|  Short-chain dehydrogenase/reductase SDR                 119   4e-29   Bacillus cereus Rock4-2
ref|WP_002119222.1|  short-chain dehydrogenase                          119   5e-29   Bacillus cereus
gb|EEL70927.1|  Short-chain dehydrogenase/reductase SDR                 119   6e-29   Bacillus mycoides
ref|WP_033666829.1|  short-chain dehydrogenase                          119   6e-29   Bacillus cereus
ref|WP_016117759.1|  short chain dehydrogenase                          119   6e-29   Bacillus cereus group
ref|WP_001189475.1|  short-chain dehydrogenase                          119   6e-29   Bacillus cereus group
gb|EJR61835.1|  hypothetical protein IIO_02743                          119   6e-29   Bacillus cereus VD115
gb|EEK51007.1|  Short-chain dehydrogenase/reductase SDR                 119   6e-29   Bacillus cereus ATCC 10876
ref|WP_000823059.1|  short chain dehydrogenase                          119   6e-29   Bacillus
gb|EEK73393.1|  Short-chain dehydrogenase/reductase SDR                 119   6e-29   Bacillus mycoides
ref|WP_001189476.1|  short chain dehydrogenase                          119   7e-29   Bacillus wiedmannii
ref|WP_000823060.1|  short-chain dehydrogenase                          119   7e-29   Bacillus cereus
ref|XP_008460623.1|  PREDICTED: uncharacterized oxidoreductase YM...    117   7e-29   
ref|WP_033663273.1|  short-chain dehydrogenase                          119   7e-29   Bacillus cereus group
ref|WP_017674104.1|  short-chain dehydrogenase                          118   7e-29   Bacillus
ref|WP_001189474.1|  short-chain dehydrogenase                          118   7e-29   Bacillus
ref|WP_002200587.1|  short-chain dehydrogenase                          118   7e-29   Bacillus cereus
ref|WP_033668583.1|  short-chain dehydrogenase                          118   8e-29   Bacillus cereus group
gb|KGT44065.1|  short-chain dehydrogenase                               118   8e-29   Bacillus cereus
ref|WP_033661284.1|  short-chain dehydrogenase                          118   9e-29   
ref|WP_016092666.1|  short chain dehydrogenase                          118   9e-29   Bacillus cereus
gb|EEL34695.1|  Short-chain dehydrogenase/reductase SDR                 118   1e-28   Bacillus cereus Rock3-28
ref|WP_033657367.1|  MULTISPECIES: short-chain dehydrogenase            118   1e-28   Bacillus
gb|EEM47916.1|  Short-chain dehydrogenase/reductase SDR                 118   1e-28   Bacillus thuringiensis serovar pakistani str. T13001
gb|EOP25422.1|  short chain dehydrogenase                               118   1e-28   Bacillus cereus VD131
ref|WP_006926006.1|  3-oxoacyl-[acyl-carrier protein] reductase         118   1e-28   Bacillus sp. GeD10
ref|WP_002136176.1|  short-chain dehydrogenase                          118   1e-28   Bacillus cereus
gb|EEM83894.1|  Short-chain dehydrogenase/reductase SDR                 118   1e-28   Bacillus thuringiensis serovar huazhongensis BGSC 4BD1
ref|WP_000238413.1|  short-chain dehydrogenase                          118   1e-28   Bacillus cereus group
ref|WP_000823069.1|  MULTISPECIES: short chain dehydrogenase            117   1e-28   Bacillus
ref|WP_000823067.1|  MULTISPECIES: short-chain dehydrogenase            117   1e-28   Bacillus
ref|WP_000823064.1|  MULTISPECIES: short-chain dehydrogenase            117   1e-28   Bacillus cereus group
gb|EEK95073.1|  Short-chain dehydrogenase/reductase SDR                 117   1e-28   Bacillus cereus BDRD-ST24
ref|WP_000823065.1|  short chain dehydrogenase                          117   2e-28   Bacillus
gb|EEL99511.1|  Short-chain dehydrogenase/reductase SDR                 118   2e-28   Bacillus mycoides DSM 2048
gb|EEK62303.1|  Short-chain dehydrogenase/reductase SDR                 117   2e-28   Bacillus cereus 172560W
ref|WP_003259997.1|  short-chain dehydrogenase                          116   2e-28   
ref|WP_033706745.1|  short-chain dehydrogenase                          117   2e-28   Bacillus mycoides
ref|WP_000823068.1|  MULTISPECIES: short-chain dehydrogenase            117   2e-28   Bacillus
ref|WP_016094098.1|  short chain dehydrogenase                          117   2e-28   Bacillus cereus
ref|WP_002165872.1|  short-chain dehydrogenase                          117   2e-28   Bacillus cereus group
gb|EEL65148.1|  Short-chain dehydrogenase/reductase SDR                 117   2e-28   Bacillus cereus F65185
ref|WP_000823070.1|  short chain dehydrogenase                          117   2e-28   Bacillus cereus
ref|WP_000439931.1|  short-chain dehydrogenase                          117   3e-28   Bacillus cereus group
ref|WP_002148137.1|  short-chain dehydrogenase                          117   3e-28   Bacillus cereus
ref|WP_002202101.1|  short-chain dehydrogenase                          117   3e-28   Bacillus cereus
ref|WP_000823066.1|  MULTISPECIES: short-chain dehydrogenase            117   3e-28   Bacillus cereus group
gb|EEM53560.1|  Short-chain dehydrogenase/reductase SDR                 117   4e-28   Bacillus thuringiensis serovar kurstaki str. T03a001
ref|WP_002085764.1|  MULTISPECIES: short-chain dehydrogenase            116   4e-28   Bacillus
ref|WP_000439932.1|  short-chain dehydrogenase                          116   4e-28   Bacillus cereus
gb|EEL02901.1|  Short-chain dehydrogenase/reductase SDR                 116   5e-28   Bacillus cereus BDRD-ST196
ref|WP_016102072.1|  short chain dehydrogenase                          116   5e-28   Bacillus cereus
ref|WP_033692313.1|  short-chain dehydrogenase                          116   5e-28   Bacillus
ref|WP_016098475.1|  short chain dehydrogenase                          116   6e-28   Bacillus cereus
ref|WP_000823054.1|  short-chain dehydrogenase                          116   6e-28   Bacillus cereus group
ref|WP_000823053.1|  MULTISPECIES: short-chain dehydrogenase            116   7e-28   Bacillus
ref|WP_003278162.1|  short-chain dehydrogenase                          116   7e-28   
ref|WP_016120162.1|  short chain dehydrogenase                          115   9e-28   Bacillus cereus
ref|WP_002185921.1|  short-chain dehydrogenase                          115   1e-27   Bacillus mycoides
ref|WP_016740822.1|  3-ketoacyl-ACP reductase                           115   1e-27   Bacillales
ref|WP_012684202.1|  short-chain dehydrogenase                          115   1e-27   Brevibacillus brevis
ref|WP_016104773.1|  short chain dehydrogenase                          115   1e-27   Bacillus cereus
ref|WP_007721163.1|  short-chain dehydrogenase                          114   2e-27   
ref|WP_017247253.1|  3-ketoacyl-ACP reductase                           114   4e-27   
ref|WP_002157946.1|  short-chain dehydrogenase                          113   7e-27   
gb|EAL15660.1|  oxidoreductase, short chain dehydrogenase/reducta...    112   2e-26   
ref|WP_041922837.1|  oxidoreductase                                     105   3e-25   
gb|AFK38678.1|  unknown                                                 101   2e-23   
gb|KJB63351.1|  hypothetical protein B456_010G117600                  99.4    5e-23   
ref|WP_011532307.1|  SDR family dehydrogenase                           101   2e-22   
ref|XP_002294694.1|  predicted protein                                99.0    2e-21   
ref|WP_041573786.1|  dehydrogenase                                    97.1    8e-21   
emb|CBJ88330.1|  putative Short-chain dehydrogenase/reductase SDR     97.1    9e-21   
gb|KGN49560.1|  hypothetical protein Csa_5G002550                     92.8    1e-20   
ref|XP_004151557.1|  PREDICTED: 3-oxoacyl-[acyl-carrier-protein] ...  95.9    1e-20   
ref|WP_037745883.1|  hypothetical protein                             95.5    2e-20   
ref|WP_009168986.1|  3-ketoacyl-ACP reductase                         93.2    2e-19   
ref|WP_012941761.1|  dehydrogenase                                    93.2    2e-19   
emb|CDZ80783.1|  NADP-dependent 3-hydroxy acid dehydrogenase YdfG     92.8    4e-19   
ref|WP_008908883.1|  3-ketoacyl-ACP reductase                         92.4    5e-19   
ref|WP_032121863.1|  3-ketoacyl-ACP reductase                         92.0    5e-19   
ref|WP_008425005.1|  3-oxoacyl-(acyl-carrier-protein) reductase       92.0    5e-19   
ref|WP_015391266.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG  92.0    6e-19   
ref|WP_027634092.1|  3-ketoacyl-ACP reductase                         90.5    2e-18   
ref|WP_022360998.1|  hypothetical protein                             90.5    2e-18   
ref|WP_026486138.1|  hypothetical protein                             90.5    2e-18   
ref|WP_008119703.1|  3-ketoacyl-ACP reductase [                       90.1    3e-18   
ref|WP_022483921.1|  3-oxoacyl-(Acyl-carrier-protein) reductase       90.1    3e-18   
ref|WP_024614536.1|  3-ketoacyl-ACP reductase                         89.7    4e-18   
ref|WP_039634530.1|  3-ketoacyl-ACP reductase                         89.4    5e-18   
ref|WP_031131891.1|  hypothetical protein                             89.0    6e-18   
ref|WP_021869665.1|  3-oxoacyl-[acyl-carrier-protein] reductase       89.0    7e-18   
ref|WP_033308018.1|  hypothetical protein                             88.6    7e-18   
ref|WP_015559407.1|  MULTISPECIES: 3-oxoacyl-(acyl-carrier-protei...  89.0    8e-18   
ref|WP_015522449.1|  3-oxoacyl-(acyl-carrier-protein) reductase       89.0    8e-18   
ref|WP_018592438.1|  3-ketoacyl-ACP reductase                         88.6    9e-18   
ref|WP_039315591.1|  3-ketoacyl-ACP reductase                         88.6    1e-17   
ref|WP_040211546.1|  3-ketoacyl-ACP reductase                         88.2    1e-17   
ref|WP_017210853.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           88.2    1e-17   
ref|WP_011968414.1|  3-ketoacyl-ACP reductase                         87.8    2e-17   
ref|WP_020492399.1|  3-ketoacyl-ACP reductase                         87.8    2e-17   
ref|WP_040986212.1|  hypothetical protein                             87.8    2e-17   
ref|WP_022344463.1|  3-oxoacyl-(Acyl-carrier-protein) reductase       87.4    2e-17   
ref|WP_022476767.1|  3-oxoacyl-(Acyl-carrier-protein) reductase       87.4    3e-17   
ref|WP_006855300.1|  3-ketoacyl-ACP reductase                         87.4    3e-17   
ref|WP_021315831.1|  3-oxoacyl-[acyl-carrier protein] reductase       87.0    3e-17   
ref|WP_027638221.1|  3-ketoacyl-ACP reductase                         87.0    3e-17   
ref|WP_006772553.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           87.0    3e-17   
ref|WP_019224679.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           86.7    4e-17   
ref|WP_035141544.1|  short-chain dehydrogenase                        86.7    4e-17   
ref|WP_026889059.1|  3-ketoacyl-ACP reductase                         86.7    4e-17   
ref|WP_022744597.1|  3-oxoacyl-[acyl-carrier-protein] reductase FabG  86.7    4e-17   
ref|WP_027635031.1|  3-ketoacyl-ACP reductase                         86.7    4e-17   
ref|WP_002579519.1|  3-ketoacyl-ACP reductase                         86.7    4e-17   
ref|WP_011099060.1|  3-ketoacyl-ACP reductase                         86.7    4e-17   
ref|WP_039679563.1|  3-ketoacyl-ACP reductase                         86.7    4e-17   
ref|WP_024292600.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           86.7    5e-17   
ref|WP_027435644.1|  3-ketoacyl-ACP reductase                         86.7    5e-17   
ref|WP_024039014.1|  3-oxoacyl-(Acyl-carrier-protein) reductase       86.7    5e-17   
ref|WP_027084523.1|  3-ketoacyl-ACP reductase                         86.3    5e-17   
ref|WP_041856581.1|  short-chain dehydrogenase                        86.3    5e-17   
ref|WP_025230685.1|  3-ketoacyl-ACP reductase                         86.3    6e-17   
ref|WP_035299266.1|  short-chain dehydrogenase                        84.0    6e-17   
gb|ABF41263.1|  short-chain dehydrogenase/reductase SDR               86.3    6e-17   
ref|WP_007050864.1|  3-ketoacyl-ACP reductase                         85.9    8e-17   
emb|CEK31452.1|  3-oxoacyl-ACP reductase [ [                          85.9    9e-17   
ref|WP_021129188.1|  3-oxoacyl-[acyl-carrier-protein] reductase [     85.9    9e-17   
ref|WP_041001817.1|  hypothetical protein                             85.9    9e-17   
ref|WP_022412959.1|  3-oxoacyl-[acyl-carrier protein] reductase       85.5    1e-16   
ref|WP_004635063.1|  3-ketoacyl-ACP reductase                         85.5    1e-16   
ref|WP_013537152.1|  3-oxoacyl-ACP synthase                           85.5    1e-16   
ref|WP_015044752.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           85.5    1e-16   
ref|WP_003374850.1|  3-ketoacyl-ACP reductase                         85.5    1e-16   
ref|WP_035773366.1|  hypothetical protein                             85.1    1e-16   
ref|WP_019542817.1|  3-ketoacyl-ACP reductase                         85.1    1e-16   
ref|WP_039219373.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           85.1    1e-16   
ref|WP_006088801.1|  short-chain dehydrogenase/reductase SDR          85.1    2e-16   
ref|WP_022077780.1|  3-oxoacyl-(Acyl-carrier-protein) reductase       85.1    2e-16   
ref|WP_021875457.1|  3-oxoacyl-[acyl-carrier-protein] reductase       85.1    2e-16   
ref|WP_029320399.1|  hypothetical protein                             85.1    2e-16   
ref|WP_013297970.1|  3-ketoacyl-ACP reductase                         85.1    2e-16   
ref|WP_044045562.1|  short-chain dehydrogenase                        85.1    2e-16   
ref|WP_039383992.1|  short-chain dehydrogenase                        85.1    2e-16   
emb|CAF24302.1|  putative blue fluorescent protein                    85.1    2e-16   
ref|WP_024505161.1|  hypothetical protein                             85.1    2e-16   
ref|WP_039358457.1|  MULTISPECIES: short-chain dehydrogenase          84.7    2e-16   
ref|WP_004444747.1|  3-ketoacyl-ACP reductase                         84.7    2e-16   
ref|WP_031585743.1|  3-oxoacyl-ACP reductase                          84.7    2e-16   
ref|WP_002605460.1|  3-oxoacyl-[acyl-carrier-protein] reductase [     84.7    2e-16   
ref|WP_015305876.1|  dehydrogenase of unknown specificity, short-...  84.7    2e-16   
ref|WP_027423646.1|  3-ketoacyl-ACP reductase                         84.7    2e-16   
ref|WP_021025666.1|  short-chain dehydrogenase                        85.1    2e-16   
ref|WP_023437637.1|  3-ketoacyl-ACP reductase                         84.7    2e-16   
ref|WP_039236552.1|  3-ketoacyl-ACP reductase                         84.7    2e-16   
gb|KIC71843.1|  NADP-dependent L-serine/L-allo-threonine dehydrog...  84.7    2e-16   
ref|WP_022587648.1|  3-ketoacyl-ACP reductase                         84.3    3e-16   
ref|WP_025529603.1|  3-ketoacyl-ACP reductase [                       84.3    3e-16   
ref|WP_040999668.1|  hypothetical protein                             84.3    3e-16   
ref|WP_039741954.1|  3-oxoacyl-ACP synthase                           84.3    3e-16   
ref|WP_029467575.1|  3-ketoacyl-ACP reductase, partial [              84.0    3e-16   
emb|CDC16019.1|  3-oxoacyl-(Acyl-carrier-protein) reductase           83.6    4e-16   
emb|CEJ74785.1|  3-oxoacyl-[acyl-carrier protein] reductase (3-ke...  84.0    4e-16   
ref|WP_009272378.1|  3-ketoacyl-ACP reductase                         84.0    4e-16   
ref|WP_006440057.1|  3-ketoacyl-ACP reductase [                       84.0    4e-16   
ref|WP_021430005.1|  MULTISPECIES: 3-oxoacyl-[acyl-carrier-protei...  84.0    4e-16   
gb|KIC72982.1|  putative oxidoreductase                               84.3    4e-16   
ref|WP_027035689.1|  hypothetical protein                             84.0    4e-16   
ref|WP_027097401.1|  3-ketoacyl-ACP reductase                         84.0    4e-16   
ref|WP_015528348.1|  3-oxoacyl-(acyl-carrier-protein) reductase [     84.0    4e-16   
ref|WP_038282206.1|  3-ketoacyl-ACP reductase [                       83.6    5e-16   
ref|WP_019125587.1|  3-ketoacyl-ACP reductase                         83.6    5e-16   
ref|WP_024037426.1|  hypothetical protein                             83.6    5e-16   
ref|WP_036223680.1|  short-chain dehydrogenase                        83.6    5e-16   
ref|WP_008014152.1|  dehydrogenase                                    83.6    5e-16   
ref|WP_021984442.1|  3-oxoacyl-(Acyl-carrier-protein) reductase       83.6    5e-16   
gb|EDQ97194.1|  3-oxoacyl-[acyl-carrier-protein] reductase            83.6    6e-16   
ref|WP_039905541.1|  3-ketoacyl-ACP reductase                         83.6    6e-16   
ref|WP_015255004.1|  3-ketoacyl-ACP reductase                         83.6    6e-16   
ref|WP_020508873.1|  hypothetical protein                             83.2    6e-16   
ref|WP_021433828.1|  3-oxoacyl-[acyl-carrier-protein] reductase [     83.2    6e-16   
ref|WP_022071618.1|  3-oxoacyl-[acyl-carrier-protein] reductase       83.2    7e-16   
ref|WP_011035120.1|  oxidoreductase                                   83.2    7e-16   
ref|WP_028118589.1|  3-ketoacyl-ACP reductase                         83.2    7e-16   
ref|WP_042351348.1|  oxidoreductase                                   83.2    7e-16   
ref|WP_013172642.1|  3-ketoacyl-ACP reductase [                       83.2    7e-16   
ref|WP_006702535.1|  3-ketoacyl-ACP reductase                         83.2    7e-16   
ref|WP_004043212.1|  short-chain family oxidoreductase                83.2    8e-16   
ref|WP_017314218.1|  hypothetical protein                             83.2    8e-16   
ref|WP_007870502.1|  3-ketoacyl-ACP reductase [                       82.8    9e-16   
ref|WP_013788133.1|  3-ketoacyl-ACP reductase                         82.8    9e-16   
ref|WP_003374496.1|  3-ketoacyl-ACP reductase                         82.8    1e-15   
ref|WP_012425010.1|  3-ketoacyl-ACP reductase                         82.8    1e-15   
ref|WP_025716353.1|  oxidoreductase                                   83.2    1e-15   
ref|WP_012451614.1|  3-ketoacyl-ACP reductase                         82.8    1e-15   
ref|WP_022371161.1|  dehydrogenases with different specificities ...  82.8    1e-15   
ref|WP_027095534.1|  hypothetical protein [                           82.8    1e-15   
ref|WP_007708110.1|  3-ketoacyl-ACP reductase [                       82.8    1e-15   
ref|WP_012689839.1|  short-chain dehydrogenase                        82.8    1e-15   
ref|WP_022090393.1|  3-oxoacyl-(Acyl-carrier-protein) reductase       82.4    1e-15   
ref|WP_022182594.1|  3-oxoacyl-[acyl-carrier-protein] reductase       82.4    1e-15   
ref|WP_022378378.1|  3-oxoacyl-[acyl-carrier-protein] reductase       82.4    1e-15   
ref|WP_022408545.1|  3-oxoacyl-[acyl-carrier protein] reductase       82.4    1e-15   
ref|WP_011025739.1|  3-ketoacyl-ACP reductase                         82.4    1e-15   
ref|WP_027414562.1|  3-oxoacyl-ACP reductase                          82.4    1e-15   
ref|WP_002597351.1|  3-oxoacyl-[acyl-carrier-protein] reductase       82.4    1e-15   
ref|WP_008726615.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           82.4    1e-15   
ref|WP_006637183.1|  3-ketoacyl-(acyl-carrier-protein) reductase      82.4    1e-15   
ref|WP_008422885.1|  dehydrogenase                                    82.4    1e-15   
ref|WP_011682525.1|  short-chain dehydrogenase                        82.8    1e-15   
ref|WP_025642054.1|  3-ketoacyl-ACP reductase [                       82.4    1e-15   
ref|WP_010966837.1|  3-ketoacyl-ACP reductase                         82.4    1e-15   
ref|WP_022263720.1|  3-oxoacyl-[acyl-carrier-protein] reductase       82.4    1e-15   
ref|WP_021977157.1|  3-oxoacyl-(Acyl-carrier-protein) reductase       82.4    1e-15   
ref|WP_013919424.1|  3-ketoacyl-ACP reductase                         82.4    2e-15   
ref|WP_028658709.1|  3-oxoacyl-ACP reductase                          82.4    2e-15   
ref|WP_042243443.1|  short-chain dehydrogenase                        82.4    2e-15   
ref|WP_026653096.1|  3-oxoacyl-ACP reductase                          82.0    2e-15   
ref|WP_002565799.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           82.0    2e-15   
ref|WP_022035368.1|  3-oxoacyl-(Acyl-carrier-protein) reductase       82.0    2e-15   
ref|WP_034582835.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
ref|WP_014652141.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
ref|WP_043927958.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
ref|WP_029112551.1|  hypothetical protein                             82.0    2e-15   
ref|WP_028087524.1|  3-oxoacyl-ACP reductase                          82.0    2e-15   
ref|WP_019003700.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
ref|WP_003182496.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           82.0    2e-15   
ref|WP_011938770.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
ref|WP_036676290.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
ref|WP_021938129.1|  3-oxoacyl-[acyl-carrier-protein] reductase       82.0    2e-15   
ref|WP_002577077.1|  MULTISPECIES: 3-oxoacyl-[acyl-carrier-protei...  82.0    2e-15   
ref|WP_002584547.1|  3-ketoacyl-ACP reductase [                       82.0    2e-15   
ref|WP_009076544.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
ref|WP_040619364.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
ref|WP_017751435.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
ref|WP_027936848.1|  hypothetical protein                             82.0    2e-15   
ref|WP_002594175.1|  MULTISPECIES: 3-oxoacyl-[acyl-carrier-protei...  82.0    2e-15   
ref|WP_040948745.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
gb|EEZ60662.1|  3-oxoacyl-[acyl-carrier-protein] reductase            82.0    2e-15   
ref|WP_042361348.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
ref|WP_026337265.1|  3-oxoacyl-ACP reductase                          82.0    2e-15   
ref|WP_010491210.1|  3-ketoacyl-ACP reductase                         82.0    2e-15   
ref|WP_008687363.1|  3-ketoacyl-ACP reductase                         81.6    2e-15   
ref|WP_027642069.1|  3-ketoacyl-ACP reductase [                       81.6    2e-15   
ref|WP_013638607.1|  3-oxoacyl-ACP synthase                           81.6    2e-15   
ref|WP_029452923.1|  3-ketoacyl-ACP reductase                         81.6    2e-15   
ref|WP_025850690.1|  3-ketoacyl-ACP reductase                         81.6    2e-15   
ref|WP_011595591.1|  MULTISPECIES: short-chain dehydrogenase          81.6    2e-15   
ref|WP_021639286.1|  3-oxoacyl-[acyl-carrier-protein] reductase       81.6    2e-15   
ref|WP_036583882.1|  3-oxoacyl-ACP reductase                          81.6    2e-15   
ref|WP_008397739.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           81.6    3e-15   
ref|WP_021740193.1|  3-oxoacyl-[acyl-carrier-protein] reductase       81.6    3e-15   
ref|WP_013270777.1|  3-ketoacyl-ACP reductase [                       81.3    3e-15   
ref|WP_021859714.1|  3-oxoacyl-[acyl-carrier-protein] reductase       80.9    3e-15   
ref|WP_009475668.1|  short-chain dehydrogenase                        81.3    3e-15   
ref|WP_022345223.1|  3-oxoacyl-(Acyl-carrier-protein) reductase       81.3    3e-15   
ref|WP_029731475.1|  3-ketoacyl-ACP reductase                         81.3    3e-15   
ref|WP_035141211.1|  3-ketoacyl-ACP reductase                         81.3    3e-15   
ref|WP_028221279.1|  oxidoreductase                                   81.3    3e-15   
ref|WP_005339510.1|  3-ketoacyl-ACP reductase                         81.3    4e-15   
ref|WP_022278878.1|  3-oxoacyl-[acyl-carrier-protein] reductase       81.3    4e-15   
ref|WP_011022644.1|  oxidoreductase                                   80.9    4e-15   
ref|WP_003880717.1|  MULTISPECIES: NAD-dependent oxidoreductase       81.3    4e-15   
ref|WP_026319527.1|  hypothetical protein                             80.9    4e-15   
ref|WP_010269679.1|  3-ketoacyl-ACP reductase                         80.9    4e-15   
ref|WP_003498431.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           80.9    4e-15   
ref|WP_015052215.1|  oxidoreductase                                   80.9    4e-15   
ref|WP_027638269.1|  short-chain dehydrogenase                        80.9    4e-15   
ref|WP_014758620.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           80.9    4e-15   
ref|WP_005333188.1|  3-ketoacyl-ACP reductase                         80.9    4e-15   
ref|WP_016998969.1|  hypothetical protein                             80.9    4e-15   
ref|WP_003495675.1|  MULTISPECIES: 3-ketoacyl-ACP reductase           80.9    4e-15   
ref|WP_008160695.1|  short-chain dehydrogenase/reductase SDR          80.9    4e-15   
ref|WP_037088501.1|  3-ketoacyl-ACP reductase                         80.9    4e-15   
ref|WP_021899119.1|  3-oxoacyl-[acyl-carrier-protein] reductase       80.9    4e-15   
ref|WP_026699204.1|  3-ketoacyl-ACP reductase                         80.9    5e-15   
ref|WP_033305255.1|  oxidoreductase                                   80.9    5e-15   
ref|WP_035808083.1|  3-ketoacyl-ACP reductase                         80.9    5e-15   
ref|WP_022847699.1|  3-oxoacyl-ACP synthase                           80.9    5e-15   
ref|WP_015525540.1|  MULTISPECIES: 3-oxoacyl-(acyl-carrier-protei...  80.9    5e-15   
ref|WP_023436945.1|  3-ketoacyl-ACP reductase                         80.9    5e-15   
ref|WP_006650856.1|  short-chain dehydrogenase/reductase SDR          80.9    5e-15   
ref|WP_040948619.1|  3-oxoacyl-ACP reductase                          80.5    5e-15   
ref|WP_011022643.1|  oxidoreductase                                   80.5    5e-15   



>ref|XP_009771431.1| PREDICTED: carbonyl reductase family member 4-like [Nicotiana 
sylvestris]
Length=253

 Score =   241 bits (614),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 167/197 (85%), Gaps = 3/197 (2%)
 Frame = +3

Query  33   MTTLSTPTTVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKl  212
            MT    PTT  +  + ++  G  +TVLITGVSRGLGKALALE+AKRGH +IGC+RSQDKL
Sbjct  1    MTLPPMPTTAGISSMRLAG-GEIRTVLITGVSRGLGKALALEMAKRGHCVIGCARSQDKL  59

Query  213  nslhaelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINR  392
            N+L  ELAS ++  S  +NKHL+M VDV  NSSVEELA AVME K +PDI+VN+AGTINR
Sbjct  60   NALQPELASVTNPPS--ENKHLLMNVDVSLNSSVEELARAVMEKKGVPDIIVNSAGTINR  117

Query  393  NNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPY  572
            NN+LWEVPAE+FD+VIDTN+KG ANVLRHFIPLM++KKQG+I+N+SS WGRSAAAQVAPY
Sbjct  118  NNKLWEVPAEEFDSVIDTNIKGTANVLRHFIPLMLEKKQGVIINMSSSWGRSAAAQVAPY  177

Query  573  CASKWAIEGLTKSIAKE  623
            C SKWAIEGLT+S+AKE
Sbjct  178  CTSKWAIEGLTRSVAKE  194



>ref|XP_009618446.1| PREDICTED: carbonyl reductase family member 4-like [Nicotiana 
tomentosiformis]
Length=253

 Score =   241 bits (614),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 167/197 (85%), Gaps = 3/197 (2%)
 Frame = +3

Query  33   MTTLSTPTTVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKl  212
            MT    PTT  +  + ++  G  +TVLITGVSRGLGKALALE+AKRGH +IGC+RSQDKL
Sbjct  1    MTLPPMPTTAGISSMRLAG-GEIRTVLITGVSRGLGKALALEMAKRGHCVIGCARSQDKL  59

Query  213  nslhaelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINR  392
            N+L  ELAS ++  S  +NKHL+M VDV  NSSVEELA AVME K +PDI+VN+AGTINR
Sbjct  60   NALQPELASVTNPPS--ENKHLLMNVDVSLNSSVEELARAVMEKKGVPDIIVNSAGTINR  117

Query  393  NNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPY  572
            NN+LWEVPAE+FD+VIDTN+KG ANVLRHFIPLM++KKQG+I+N+SS WGRSAAAQVAPY
Sbjct  118  NNKLWEVPAEEFDSVIDTNIKGTANVLRHFIPLMLEKKQGVIINMSSSWGRSAAAQVAPY  177

Query  573  CASKWAIEGLTKSIAKE  623
            C SKWAIEGLT+S+AKE
Sbjct  178  CTSKWAIEGLTRSVAKE  194



>ref|XP_007023099.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY25721.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=238

 Score =   236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 157/177 (89%), Gaps = 8/177 (5%)
 Frame = +3

Query  93   GAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNK  272
            GA KTVL+TGVS+GLG+ALALEL+KRGHT+IGCSR+Q+KLNSL +ELA+         ++
Sbjct  11   GAAKTVLVTGVSKGLGRALALELSKRGHTVIGCSRAQEKLNSLQSELAA--------PDR  62

Query  273  HLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNV  452
            HL++ VDVRSNSSVEELA  VME K +PDI+VNNAGTIN+NNR+WEVPAE+FD VIDTNV
Sbjct  63   HLLLNVDVRSNSSVEELARLVMEKKVVPDIIVNNAGTINKNNRIWEVPAEEFDTVIDTNV  122

Query  453  KGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            KGVANV+RHFIPLMI K+QGIIVN+SSGWGRS AA VAPYCASKWAIEGL+K++AKE
Sbjct  123  KGVANVMRHFIPLMIPKRQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSKAVAKE  179



>gb|KDP42495.1| hypothetical protein JCGZ_00292 [Jatropha curcas]
Length=239

 Score =   235 bits (600),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 155/182 (85%), Gaps = 6/182 (3%)
 Frame = +3

Query  78   SMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasasssts  257
            S  A  A KTV++TGVS+GLG+ALALELAKRGHT+IGCSR+QDKLNSL +EL S      
Sbjct  5    SFGASSAGKTVMVTGVSKGLGRALALELAKRGHTVIGCSRAQDKLNSLQSELTSDR----  60

Query  258  ssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNV  437
               + HL++ VDVRSNSSVEELA AVME K +PDI+VNNAGTINRNN+LWEVP E+FD V
Sbjct  61   --NDHHLLLNVDVRSNSSVEELAKAVMEKKGVPDIIVNNAGTINRNNKLWEVPVEEFDTV  118

Query  438  IDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIA  617
            IDTNVKGVANVLRHFIPLM+  K+GIIVN+SSGWGRS AA VAPYCASKWAIEGLT+S+A
Sbjct  119  IDTNVKGVANVLRHFIPLMLPNKRGIIVNMSSGWGRSGAALVAPYCASKWAIEGLTRSVA  178

Query  618  KE  623
            KE
Sbjct  179  KE  180



>ref|XP_006349286.1| PREDICTED: dehydrogenase/reductase SDR family member 7-like [Solanum 
tuberosum]
Length=253

 Score =   236 bits (601),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 163/197 (83%), Gaps = 3/197 (2%)
 Frame = +3

Query  33   MTTLSTPTTVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKl  212
            MT    PT      +  SA GA +T+LITGVSRGLGKALALELAKRGH IIGC+RSQDKL
Sbjct  1    MTLPPMPTPAGNPSMR-SAGGAIRTLLITGVSRGLGKALALELAKRGHYIIGCARSQDKL  59

Query  213  nslhaelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINR  392
            N+   ELAS+++  S  +N HL+M VDV  NSSVEE A AVME K +PDI+VN AGTINR
Sbjct  60   NAFQTELASSTNPPS--ENNHLLMSVDVSLNSSVEEFARAVMEKKGVPDIIVNCAGTINR  117

Query  393  NNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPY  572
            NN+LWEVPAE+FD+VIDTN+KG ANVLRHFIPLM++KKQG+IVN+SSGWGRS AAQVAPY
Sbjct  118  NNKLWEVPAEEFDSVIDTNLKGTANVLRHFIPLMLEKKQGVIVNMSSGWGRSGAAQVAPY  177

Query  573  CASKWAIEGLTKSIAKE  623
            CASKWAIEGLT S+AKE
Sbjct  178  CASKWAIEGLTASVAKE  194



>ref|XP_011087630.1| PREDICTED: NADPH-dependent pterin aldehyde reductase isoform 
X2 [Sesamum indicum]
Length=250

 Score =   235 bits (599),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 172/198 (87%), Gaps = 8/198 (4%)
 Frame = +3

Query  33   MTTLSTPTTVNLEELSMSAPGAH-KTVLITGVSrglgkalalelakrgHTIIGCSRSQDK  209
            MT  +TPT  N    +M+AP  H KTVLITG+SRGLGKALALELAKRGHT+IGCSRS DK
Sbjct  1    MTAPATPTATN----TMAAP--HLKTVLITGISRGLGKALALELAKRGHTVIGCSRSSDK  54

Query  210  lnslhaelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTIN  389
            ++SL +ELASAS S S++ NKHL M VDVRS+SSV ELA AV+E K++PD++VNNAGTIN
Sbjct  55   ISSLQSELASASESKSNA-NKHLCMTVDVRSDSSVAELARAVVEKKAVPDVIVNNAGTIN  113

Query  390  RNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAP  569
            RNN +WEVP ++FD VIDTN+KG+ANVLRHFIP+MI+ K GIIVN+SSGWGRSAAAQVAP
Sbjct  114  RNNNIWEVPVDEFDAVIDTNIKGIANVLRHFIPIMIENKHGIIVNMSSGWGRSAAAQVAP  173

Query  570  YCASKWAIEGLTKSIAKE  623
            YCASKWA+EG+T+++AKE
Sbjct  174  YCASKWAVEGMTRAVAKE  191



>ref|XP_004230419.1| PREDICTED: carbonyl reductase family member 4 isoform X2 [Solanum 
lycopersicum]
Length=313

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 159/180 (88%), Gaps = 2/180 (1%)
 Frame = +3

Query  84   SAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsss  263
            SA GA +T+LITGVSRGLGKALALELAKRGH IIGC+RSQDKLN+   ELAS+++  S  
Sbjct  77   SAGGAIRTLLITGVSRGLGKALALELAKRGHYIIGCARSQDKLNAFQTELASSTNPPS--  134

Query  264  QNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVID  443
            +NKHL+M VDV  NSSVEE A AVME K +PDI+VN AGTINRNN+LWEVPAE+FD+VID
Sbjct  135  ENKHLLMSVDVSLNSSVEEFARAVMEKKGVPDIIVNCAGTINRNNKLWEVPAEEFDSVID  194

Query  444  TNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            TN+KG ANVLR+FIPLM++KKQG+IVN+SSGWGRS AAQVAPYCASKWAIEGLT S+AKE
Sbjct  195  TNLKGTANVLRYFIPLMLEKKQGVIVNMSSGWGRSGAAQVAPYCASKWAIEGLTASVAKE  254



>ref|XP_010314315.1| PREDICTED: carbonyl reductase family member 4 isoform X1 [Solanum 
lycopersicum]
Length=315

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 159/180 (88%), Gaps = 2/180 (1%)
 Frame = +3

Query  84   SAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsss  263
            SA GA +T+LITGVSRGLGKALALELAKRGH IIGC+RSQDKLN+   ELAS+++  S  
Sbjct  79   SAGGAIRTLLITGVSRGLGKALALELAKRGHYIIGCARSQDKLNAFQTELASSTNPPS--  136

Query  264  QNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVID  443
            +NKHL+M VDV  NSSVEE A AVME K +PDI+VN AGTINRNN+LWEVPAE+FD+VID
Sbjct  137  ENKHLLMSVDVSLNSSVEEFARAVMEKKGVPDIIVNCAGTINRNNKLWEVPAEEFDSVID  196

Query  444  TNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            TN+KG ANVLR+FIPLM++KKQG+IVN+SSGWGRS AAQVAPYCASKWAIEGLT S+AKE
Sbjct  197  TNLKGTANVLRYFIPLMLEKKQGVIVNMSSGWGRSGAAQVAPYCASKWAIEGLTASVAKE  256



>ref|XP_002268804.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Vitis vinifera]
Length=264

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 157/180 (87%), Gaps = 5/180 (3%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasasss-----tsss  263
            ++TVLITGV +GLG+ALALE+AKRGHT++GCSRSQD+L SL +EL+S +SS       SS
Sbjct  26   NRTVLITGVGKGLGRALALEIAKRGHTVVGCSRSQDRLTSLQSELSSVASSPQSDSAVSS  85

Query  264  QNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVID  443
             ++H  M VDVRSNSSVEELA AVME K +PDI+VNNAGTINRNNR+WEVP E+FD VID
Sbjct  86   SDRHFFMTVDVRSNSSVEELARAVMEKKGVPDIIVNNAGTINRNNRIWEVPEEEFDTVID  145

Query  444  TNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            TNVKG ANV+R FIPLMI+ KQGIIVN+SSGWGRSAAAQVAPYCASKWA+EGL++S+AKE
Sbjct  146  TNVKGTANVMRQFIPLMIENKQGIIVNMSSGWGRSAAAQVAPYCASKWAVEGLSRSVAKE  205



>ref|XP_011087629.1| PREDICTED: NADPH-dependent pterin aldehyde reductase isoform 
X1 [Sesamum indicum]
Length=268

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 171/197 (87%), Gaps = 6/197 (3%)
 Frame = +3

Query  33   MTTLSTPTTVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKl  212
            MT  +TPT  N    +M+AP   KTVLITG+SRGLGKALALELAKRGHT+IGCSRS DK+
Sbjct  1    MTAPATPTATN----TMAAPHL-KTVLITGISRGLGKALALELAKRGHTVIGCSRSSDKI  55

Query  213  nslhaelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINR  392
            +SL +ELASAS S S++ NKHL M VDVRS+SSV ELA AV+E K++PD++VNNAGTINR
Sbjct  56   SSLQSELASASESKSNA-NKHLCMTVDVRSDSSVAELARAVVEKKAVPDVIVNNAGTINR  114

Query  393  NNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPY  572
            NN +WEVP ++FD VIDTN+KG+ANVLRHFIP+MI+ K GIIVN+SSGWGRSAAAQVAPY
Sbjct  115  NNNIWEVPVDEFDAVIDTNIKGIANVLRHFIPIMIENKHGIIVNMSSGWGRSAAAQVAPY  174

Query  573  CASKWAIEGLTKSIAKE  623
            CASKWA+EG+T+++AKE
Sbjct  175  CASKWAVEGMTRAVAKE  191



>emb|CBI29642.3| unnamed protein product [Vitis vinifera]
Length=307

 Score =   234 bits (598),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 157/180 (87%), Gaps = 5/180 (3%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasasss-----tsss  263
            ++TVLITGV +GLG+ALALE+AKRGHT++GCSRSQD+L SL +EL+S +SS       SS
Sbjct  69   NRTVLITGVGKGLGRALALEIAKRGHTVVGCSRSQDRLTSLQSELSSVASSPQSDSAVSS  128

Query  264  QNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVID  443
             ++H  M VDVRSNSSVEELA AVME K +PDI+VNNAGTINRNNR+WEVP E+FD VID
Sbjct  129  SDRHFFMTVDVRSNSSVEELARAVMEKKGVPDIIVNNAGTINRNNRIWEVPEEEFDTVID  188

Query  444  TNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            TNVKG ANV+R FIPLMI+ KQGIIVN+SSGWGRSAAAQVAPYCASKWA+EGL++S+AKE
Sbjct  189  TNVKGTANVMRQFIPLMIENKQGIIVNMSSGWGRSAAAQVAPYCASKWAVEGLSRSVAKE  248



>gb|EPS57319.1| hypothetical protein M569_17499, partial [Genlisea aurea]
Length=232

 Score =   230 bits (587),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 156/174 (90%), Gaps = 1/174 (1%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            KTVLITGVSRGLG+ALALELAK+GHTIIGCSRS DKL SL +EL SAS +T+    KHLI
Sbjct  1    KTVLITGVSRGLGRALALELAKQGHTIIGCSRSADKLPSLQSELDSASENTAG-SGKHLI  59

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            M  DV+SNSSVEELA A++E K +PD++VNNAGTINRNN++WEVP E+FD+VIDTN+KG 
Sbjct  60   MNADVKSNSSVEELARALVEKKVVPDMIVNNAGTINRNNKIWEVPEEEFDSVIDTNLKGT  119

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLMI+ K GIIVN+SSGWGRSAAAQVAPYCASKWAIEGLT+++AKE
Sbjct  120  ANVLRHFIPLMIENKHGIIVNMSSGWGRSAAAQVAPYCASKWAIEGLTRAVAKE  173



>ref|XP_010274977.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
isoform X2 [Nelumbo nucifera]
Length=244

 Score =   230 bits (586),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            + +LITGVSRGLG+ALALE+AKRGH IIGC+R+QDKLNSL AEL+S+ +S+SSS  +HL+
Sbjct  12   RKILITGVSRGLGRALALEMAKRGHIIIGCARTQDKLNSLQAELSSSDNSSSSSSFEHLL  71

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            MKVDV+S++SVEELA  VME K +PDI+VNNAGTIN+NN++WEVP E+FD V+DTN+KG 
Sbjct  72   MKVDVKSDNSVEELARIVMERKGVPDIIVNNAGTINKNNKIWEVPEEEFDTVVDTNIKGT  131

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+LRHF+PLM+++KQGIIVNLSSGWGRSAAAQVAPYCASKWA+EGLTKS+AKE
Sbjct  132  ANMLRHFLPLMLERKQGIIVNLSSGWGRSAAAQVAPYCASKWAVEGLTKSVAKE  185



>ref|XP_008786449.1| PREDICTED: uncharacterized oxidoreductase YMR226C [Phoenix dactylifera]
Length=295

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +3

Query  93   GAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNK  272
            GA KTVLITGVSRGLG+ALALELAKRGH IIG +RSQ+K+  L AEL S   + SSS +K
Sbjct  60   GAPKTVLITGVSRGLGRALALELAKRGHAIIGFARSQEKIQGLLAELPSDDPAPSSSPSK  119

Query  273  HLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNV  452
            HLI++ D+RS++S++ELA  V+E + +PDI+VNNAGTIN+NN++WEVPAE+FD VIDTN+
Sbjct  120  HLIIQADIRSDTSIKELARLVVETRRVPDIIVNNAGTINKNNKIWEVPAEEFDTVIDTNI  179

Query  453  KGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            KGVAN+LRHF+PLMI+KKQGIIVN+SSGWGRSAAA+VAPYCASKWAIEGLT+S+AKE
Sbjct  180  KGVANILRHFLPLMIEKKQGIIVNMSSGWGRSAAAEVAPYCASKWAIEGLTRSVAKE  236



>ref|XP_010274976.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=245

 Score =   229 bits (585),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            + +LITGVSRGLG+ALALE+AKRGH IIGC+R+QDKLNSL AEL+S+ +S+SSS  +HL+
Sbjct  12   RKILITGVSRGLGRALALEMAKRGHIIIGCARTQDKLNSLQAELSSSDNSSSSSSFEHLL  71

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            MKVDV+S++SVEELA  VME K +PDI+VNNAGTIN+NN++WEVP E+FD V+DTN+KG 
Sbjct  72   MKVDVKSDNSVEELARIVMERKGVPDIIVNNAGTINKNNKIWEVPEEEFDTVVDTNIKGT  131

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+LRHF+PLM+++KQGIIVNLSSGWGRSAAAQVAPYCASKWA+EGLTKS+AKE
Sbjct  132  ANMLRHFLPLMLERKQGIIVNLSSGWGRSAAAQVAPYCASKWAVEGLTKSVAKE  185



>gb|EYU35030.1| hypothetical protein MIMGU_mgv1a010194mg [Erythranthe guttata]
Length=319

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 164/192 (85%), Gaps = 1/192 (1%)
 Frame = +3

Query  48   TPTTVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslha  227
            TPT V+     ++A    +TVLITGVSRGLG+ALALELAK GHT+IGCSRS DKL+SL +
Sbjct  70   TPTRVSNAVAGVAAAAELRTVLITGVSRGLGRALALELAKLGHTVIGCSRSADKLSSLQS  129

Query  228  elasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLW  407
            ELASAS + S+   KHLI+ VDVRS+SSVEELA AV+E K IP+I+VNNAGTINRNN+LW
Sbjct  130  ELASASENKSN-SGKHLILNVDVRSDSSVEELARAVVEKKVIPNIIVNNAGTINRNNKLW  188

Query  408  EVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKW  587
            EV AE FD+V+DTNVKG ANVLRHFIPLMI KK GIIVN+SSGWGRS AAQVAPYCASKW
Sbjct  189  EVSAEQFDSVMDTNVKGTANVLRHFIPLMIQKKHGIIVNMSSGWGRSVAAQVAPYCASKW  248

Query  588  AIEGLTKSIAKE  623
            A+EGLT+++AKE
Sbjct  249  AVEGLTRAVAKE  260



>ref|XP_010490908.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like [Camelina 
sativa]
Length=242

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 154/176 (88%), Gaps = 8/176 (5%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A +TVLITGVS+GLG+ALALELAKRGHT+IGC+R+Q+KL +L +EL+S++         H
Sbjct  16   AARTVLITGVSKGLGRALALELAKRGHTVIGCARTQEKLTALQSELSSSA--------NH  67

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L++  DV+ NSSVEELAH +ME K +PDI+VNNAGTIN+N+++WEV AEDFDNV+DTNVK
Sbjct  68   LLLTADVKLNSSVEELAHTIMEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVK  127

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            GVANVLRHFIPLM+ +KQGIIVNLSSGWGRS AA VAPYCASKWAIEGL++++AKE
Sbjct  128  GVANVLRHFIPLMLPRKQGIIVNLSSGWGRSGAALVAPYCASKWAIEGLSRAVAKE  183



>ref|NP_563866.1| NADPH-dependent pterin aldehyde reductase  [Arabidopsis thaliana]
 sp|Q9SY73.1|PTALR_ARATH RecName: Full=NADPH-dependent pterin aldehyde reductase [Arabidopsis 
thaliana]
 gb|AAD32881.1|AC005489_19 F14N23.19 [Arabidopsis thaliana]
 dbj|BAD44433.1| unknown protein [Arabidopsis thaliana]
 gb|ABF83679.1| At1g10310 [Arabidopsis thaliana]
 gb|AEE28564.1| NADPH-dependent pterin aldehyde reductase [Arabidopsis thaliana]
Length=242

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 153/176 (87%), Gaps = 8/176 (5%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A +TVLITGVS+GLG+ALALELAKRGHT+IGC+RSQ+KL +L +EL+S           H
Sbjct  16   AARTVLITGVSKGLGRALALELAKRGHTVIGCARSQEKLTALQSELSS--------STNH  67

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L++  DV+SNSSVEE+AH ++E K +PDI+VNNAGTIN+N+++WEV AEDFDNV+DTNVK
Sbjct  68   LLLTADVKSNSSVEEMAHTIVEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVK  127

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            GVANVLRHFIPLM+ +KQGIIVN+SSGWGRS AA VAPYCASKWAIEGL++++AKE
Sbjct  128  GVANVLRHFIPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRAVAKE  183



>gb|AAM65520.1| unknown [Arabidopsis thaliana]
Length=240

 Score =   225 bits (573),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 153/176 (87%), Gaps = 8/176 (5%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A +TVLITGVS+GLG+ALALELAKRGHT+IGC+RSQ+KL +L +EL+S           H
Sbjct  14   AARTVLITGVSKGLGRALALELAKRGHTVIGCARSQEKLTALQSELSS--------STNH  65

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L++  DV+SNSSVEE+AH ++E K +PDI+VNNAGTIN+N+++WEV AEDFDNV+DTNVK
Sbjct  66   LLLTADVKSNSSVEEMAHTIVEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVK  125

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            GVANVLRHFIPLM+ +KQGIIVN+SSGWGRS AA VAPYCASKWAIEGL++++AKE
Sbjct  126  GVANVLRHFIPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRAVAKE  181



>ref|XP_002892558.1| hypothetical protein ARALYDRAFT_471142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68817.1| hypothetical protein ARALYDRAFT_471142 [Arabidopsis lyrata subsp. 
lyrata]
Length=240

 Score =   224 bits (572),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 153/176 (87%), Gaps = 8/176 (5%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A +TVLITGVS+GLG+ALALELAKRGHT+IGC+R+Q+KL +L +EL+S           H
Sbjct  14   AARTVLITGVSKGLGRALALELAKRGHTVIGCARTQEKLTALQSELSS--------PTNH  65

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L++  DV+SNSSVEELAH ++E K +PDI+VNNAGTIN+N+++WEV AEDFDNV+DTNVK
Sbjct  66   LLLTADVKSNSSVEELAHTIVEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVK  125

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            GVANVLRHFIPLM+ +KQGIIVN+SSGWGRS AA VAPYCASKWAIEGL++++AKE
Sbjct  126  GVANVLRHFIPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRAVAKE  181



>ref|XP_006417480.1| hypothetical protein EUTSA_v10008625mg [Eutrema salsugineum]
 gb|ESQ35833.1| hypothetical protein EUTSA_v10008625mg [Eutrema salsugineum]
Length=242

 Score =   224 bits (572),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 154/176 (88%), Gaps = 8/176 (5%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A +TVLITGVS+GLG+ALALELAKRGHT+IGC+RSQ+KL +L +EL+S         + H
Sbjct  16   AARTVLITGVSKGLGRALALELAKRGHTVIGCARSQEKLTALRSELSS--------PDNH  67

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L++  DV+SNSSVEE+AH ++E K +PDI+VNNAGTIN+N+++WEV AEDFDNV+DTNVK
Sbjct  68   LLLPADVKSNSSVEEMAHTIVEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVK  127

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            GVANVLRHFIPLM+ +KQGIIVN+SSGWGRS AA VAPYCASKWAIEGL++++AKE
Sbjct  128  GVANVLRHFIPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRAVAKE  183



>ref|XP_010676803.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Beta vulgaris 
subsp. vulgaris]
Length=248

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 147/177 (83%), Gaps = 2/177 (1%)
 Frame = +3

Query  93   GAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNK  272
            GA KT+LITGVSRGLG+ALALELA RGH IIGC RSQD       +    +S +S   + 
Sbjct  15   GAKKTILITGVSRGLGRALALELALRGHCIIGCGRSQD--LINSLQQQLHNSPSSCDNSS  72

Query  273  HLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNV  452
            HL++ VDVRSNSSVEELA  V E K IPDI+VNNAGTIN+NN +WEVPAE+FD VIDTNV
Sbjct  73   HLLLNVDVRSNSSVEELAKLVAEKKRIPDIIVNNAGTINKNNNIWEVPAEEFDTVIDTNV  132

Query  453  KGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            KGVAN+LRHFIPLM +KK GIIVNLSSGWGRSAAAQV+PYCASKWAIEGL++++AKE
Sbjct  133  KGVANMLRHFIPLMNEKKHGIIVNLSSGWGRSAAAQVSPYCASKWAIEGLSRAVAKE  189



>ref|XP_010475892.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like [Camelina 
sativa]
Length=242

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 153/176 (87%), Gaps = 8/176 (5%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A +TVLITGVS+GLG+ALALELAKRGHT+IGC+R+Q+KL +L +EL+S +         H
Sbjct  16   AARTVLITGVSKGLGRALALELAKRGHTVIGCARTQEKLTALQSELSSPA--------NH  67

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L++  DV+ N+SVEELAH +ME K +PDI+VNNAGTIN+N+++WEV AEDFDNV+DTNVK
Sbjct  68   LLLTADVKLNTSVEELAHTIMEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVK  127

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            GVANVLRHFIPLM+ +KQGIIVNLSSGWGRS AA VAPYCASKWAIEGL++++AKE
Sbjct  128  GVANVLRHFIPLMLPRKQGIIVNLSSGWGRSGAALVAPYCASKWAIEGLSRAVAKE  183



>ref|XP_007023100.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY25722.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=234

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 153/177 (86%), Gaps = 12/177 (7%)
 Frame = +3

Query  93   GAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNK  272
            GA KTVL+TGVS+GLG+ALALEL+KRGHT+IGCSR+Q+KLNSL +ELA+         ++
Sbjct  11   GAAKTVLVTGVSKGLGRALALELSKRGHTVIGCSRAQEKLNSLQSELAA--------PDR  62

Query  273  HLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNV  452
            HL++ VDVRSNSSVEELA  VME K +PDI+    GTIN+NNR+WEVPAE+FD VIDTNV
Sbjct  63   HLLLNVDVRSNSSVEELARLVMEKKVVPDII----GTINKNNRIWEVPAEEFDTVIDTNV  118

Query  453  KGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            KGVANV+RHFIPLMI K+QGIIVN+SSGWGRS AA VAPYCASKWAIEGL+K++AKE
Sbjct  119  KGVANVMRHFIPLMIPKRQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSKAVAKE  175



>ref|XP_010458373.1| PREDICTED: carbonyl reductase family member 4-like [Camelina 
sativa]
Length=242

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 152/176 (86%), Gaps = 8/176 (5%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A +TVLITGVS+GLG+ALALELAKRGHT+IGC+R+Q+KL +L +EL S +         H
Sbjct  16   AARTVLITGVSKGLGRALALELAKRGHTVIGCARTQEKLTALQSELPSPA--------NH  67

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L++  DV+ NSSVEELAH +ME K +PDI+VNNAGTIN+N+++WEV AEDFDNV+DTNVK
Sbjct  68   LLLTADVKLNSSVEELAHTIMEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDNVMDTNVK  127

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            GVANVLRHFIPLM+ +KQGIIVN+SSGWGRS AA VAPYCASKWAIEGL++++AKE
Sbjct  128  GVANVLRHFIPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRAVAKE  183



>gb|EYU35029.1| hypothetical protein MIMGU_mgv1a012162mg [Erythranthe guttata]
Length=259

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 153/173 (88%), Gaps = 1/173 (1%)
 Frame = +3

Query  105  TVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIM  284
            TVLITGVSRGLG+ALALELAK GHT+IGCSRS DKL+SL +ELA+AS + S+   KHLI+
Sbjct  28   TVLITGVSRGLGRALALELAKLGHTVIGCSRSADKLSSLQSELAAASENKSN-SGKHLIL  86

Query  285  KVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVA  464
             VDVRS+SS+EELA  V+E K IP+I+VNNAGTINRNN LWEV AE FD+VIDTN+KG A
Sbjct  87   NVDVRSDSSIEELARTVVEKKVIPNIIVNNAGTINRNNNLWEVSAEQFDSVIDTNLKGTA  146

Query  465  NVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            NVLRHFIPLMI KKQGII N+SSGWGRS AA+VAPYCASKWA+EGLTK++AKE
Sbjct  147  NVLRHFIPLMIQKKQGIIFNMSSGWGRSVAAEVAPYCASKWAVEGLTKAVAKE  199



>gb|KHG10740.1| Oxidoreductase [Gossypium arboreum]
Length=245

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 154/174 (89%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            KTVLITGVS+GLG+ALA+EL+KRGHT+IGCSR+Q+KLNSL +EL+S         ++HL+
Sbjct  21   KTVLITGVSKGLGRALAVELSKRGHTVIGCSRAQEKLNSLQSELSS--------PDRHLL  72

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            +KVDVRS++SV+ELA  +ME K +PDI+VNNAGTIN+NNR+WEVP E+FD VIDTNVKG+
Sbjct  73   LKVDVRSDNSVKELARVMMEKKFVPDIIVNNAGTINKNNRIWEVPVEEFDTVIDTNVKGI  132

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLM+ K +GIIVN+SSGWGRS AA VAPYCASKWA+EGL++++AKE
Sbjct  133  ANVLRHFIPLMLPKSRGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRAVAKE  186



>ref|XP_010030227.1| PREDICTED: dehydrogenase/reductase SDR family member 7-like [Eucalyptus 
grandis]
Length=243

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 159/182 (87%), Gaps = 1/182 (1%)
 Frame = +3

Query  78   SMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasasssts  257
            S+      +TVLITGVS+GLGKALALELAKRGH++IGCSRSQDKL+SL + L+S++SS +
Sbjct  4    SLGGGSGRRTVLITGVSKGLGKALALELAKRGHSVIGCSRSQDKLDSLRSLLSSSASSDA  63

Query  258  ssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNV  437
            +  + HL+  VDVRSNSSVEELA  VME K +PDI+VNNAGTIN+NNR+W+VPA++FD V
Sbjct  64   A-DSPHLLFSVDVRSNSSVEELARVVMEKKGVPDIIVNNAGTINKNNRIWKVPADEFDAV  122

Query  438  IDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIA  617
            IDTNVKG+A +LRHF+P MI++K+GIIVNLSSGWGRS AA VAPYCASKWA+EGLTKS+A
Sbjct  123  IDTNVKGIAKMLRHFLPPMIERKRGIIVNLSSGWGRSTAALVAPYCASKWAVEGLTKSVA  182

Query  618  KE  623
            +E
Sbjct  183  EE  184



>ref|XP_002527853.1| short-chain dehydrogenase, putative [Ricinus communis]
 gb|EEF34556.1| short-chain dehydrogenase, putative [Ricinus communis]
Length=252

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 149/174 (86%), Gaps = 6/174 (3%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGVS+GLG+ALALELAKRGHT+IGCSR+QDKLNSL +EL S         N HL+
Sbjct  26   KKVMITGVSKGLGRALALELAKRGHTVIGCSRAQDKLNSLQSELPSDH------NNHHLL  79

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            +  DV SNSSVEELA A+ME K +PDI+VNNAGTIN+NN++WEVP E+FD VIDTNVKG+
Sbjct  80   LNADVSSNSSVEELAKAIMEKKGVPDIIVNNAGTINKNNKIWEVPVEEFDTVIDTNVKGI  139

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLM+  KQGIIVN+SSGWGRS AA VAPYCASKWA+EG+++S+AKE
Sbjct  140  ANVLRHFIPLMLPNKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGMSRSVAKE  193



>gb|KCW57161.1| hypothetical protein EUGRSUZ_I02792, partial [Eucalyptus grandis]
Length=240

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 159/182 (87%), Gaps = 1/182 (1%)
 Frame = +3

Query  78   SMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasasssts  257
            S+      +TVLITGVS+GLGKALALELAKRGH++IGCSRSQDKL+SL + L+S++SS +
Sbjct  1    SLGGGSGRRTVLITGVSKGLGKALALELAKRGHSVIGCSRSQDKLDSLRSLLSSSASSDA  60

Query  258  ssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNV  437
            +  + HL+  VDVRSNSSVEELA  VME K +PDI+VNNAGTIN+NNR+W+VPA++FD V
Sbjct  61   A-DSPHLLFSVDVRSNSSVEELARVVMEKKGVPDIIVNNAGTINKNNRIWKVPADEFDAV  119

Query  438  IDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIA  617
            IDTNVKG+A +LRHF+P MI++K+GIIVNLSSGWGRS AA VAPYCASKWA+EGLTKS+A
Sbjct  120  IDTNVKGIAKMLRHFLPPMIERKRGIIVNLSSGWGRSTAALVAPYCASKWAVEGLTKSVA  179

Query  618  KE  623
            +E
Sbjct  180  EE  181



>ref|XP_010030228.1| PREDICTED: dehydrogenase/reductase SDR family member 7-like [Eucalyptus 
grandis]
 gb|KCW57163.1| hypothetical protein EUGRSUZ_I02794 [Eucalyptus grandis]
Length=259

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITGVS+GLG+ALALELAKRGH++IGCSRSQDKL+SL + L+S+SS  ++    HL+
Sbjct  28   RTVLITGVSKGLGQALALELAKRGHSVIGCSRSQDKLDSLRSLLSSSSSDAAADS-PHLL  86

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + VDVRSNSSVEELA AVM+   +PDI+VNNAGTIN+NN++WEVPAE+FD VIDTNVKG+
Sbjct  87   LNVDVRSNSSVEELARAVMDKTGVPDIIVNNAGTINKNNKIWEVPAEEFDAVIDTNVKGI  146

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+LRHF+P MI +K G+IVN+SSGWGRS AA VAPYCASKWA+EGLTKS+AKE
Sbjct  147  ANMLRHFLPPMIQRKHGVIVNMSSGWGRSGAALVAPYCASKWAVEGLTKSVAKE  200



>ref|XP_010534693.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic 
[Tarenaya hassleriana]
 ref|XP_010550802.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic-like 
[Tarenaya hassleriana]
Length=242

 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 152/176 (86%), Gaps = 8/176 (5%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A +TVLITGVS+GLG+ALALEL KRGHT+IGCSRSQ+KL++L +EL+S +        KH
Sbjct  16   AARTVLITGVSKGLGRALALELDKRGHTVIGCSRSQEKLSALESELSSPA--------KH  67

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L +  D++SNSSVEELA AV+E K +PDI+VNNAGTIN+NN++W+VP E+FD VIDTNVK
Sbjct  68   LFLTADLKSNSSVEELARAVVEKKCVPDIIVNNAGTINKNNKIWDVPVEEFDAVIDTNVK  127

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            G+A+VLRHFIPLMI  KQGIIVN+SSGWGRS AA VAPYCASKWA+EGL++++AKE
Sbjct  128  GIASVLRHFIPLMIPHKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRAVAKE  183



>gb|KJB69051.1| hypothetical protein B456_011G003700 [Gossypium raimondii]
Length=245

 Score =   220 bits (561),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 153/174 (88%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            KTVLITGVS+GLG+ALA+EL+KRGHT+IGCSR+Q+KLNSL +EL+S         ++HL+
Sbjct  21   KTVLITGVSKGLGRALAVELSKRGHTVIGCSRAQEKLNSLQSELSS--------PDRHLL  72

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + VDVRS++SV+ELA  +ME K +PDI+VNNAGTIN+NNR+WEVP E+FD VIDTNVKG+
Sbjct  73   LNVDVRSDNSVKELARVMMEKKFVPDIIVNNAGTINKNNRIWEVPVEEFDTVIDTNVKGI  132

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLM+ K +GIIVN+SSGWGRS AA VAPYCASKWA+EGL++++AKE
Sbjct  133  ANVLRHFIPLMLPKSRGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRAVAKE  186



>gb|KJB69053.1| hypothetical protein B456_011G003700 [Gossypium raimondii]
Length=227

 Score =   219 bits (559),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 153/174 (88%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            KTVLITGVS+GLG+ALA+EL+KRGHT+IGCSR+Q+KLNSL +EL+S         ++HL+
Sbjct  21   KTVLITGVSKGLGRALAVELSKRGHTVIGCSRAQEKLNSLQSELSS--------PDRHLL  72

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + VDVRS++SV+ELA  +ME K +PDI+VNNAGTIN+NNR+WEVP E+FD VIDTNVKG+
Sbjct  73   LNVDVRSDNSVKELARVMMEKKFVPDIIVNNAGTINKNNRIWEVPVEEFDTVIDTNVKGI  132

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLM+ K +GIIVN+SSGWGRS AA VAPYCASKWA+EGL++++AKE
Sbjct  133  ANVLRHFIPLMLPKSRGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRAVAKE  186



>emb|CDY20941.1| BnaA08g25840D [Brassica napus]
Length=242

 Score =   219 bits (559),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 150/174 (86%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K VLITGVS+GLG+AL+LE+AKRGHT+IGC+R+Q+KL +L +EL+S           HL+
Sbjct  18   KVVLITGVSKGLGRALSLEMAKRGHTVIGCARTQEKLTALQSELSS--------PENHLL  69

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            +  DV+S+SSV+E+AH +ME K +PDI+VNNAGTIN+NN++WEV AEDFD+V+DTNVKGV
Sbjct  70   LTADVKSDSSVKEMAHTIMEKKGVPDIIVNNAGTINKNNKIWEVSAEDFDSVMDTNVKGV  129

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NVLRHFIPLM+ +KQGIIVN+SSGWGRS AA VAPYCASKWAIEGL++S+AKE
Sbjct  130  VNVLRHFIPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRSVAKE  183



>gb|KJB69052.1| hypothetical protein B456_011G003700 [Gossypium raimondii]
Length=243

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 153/174 (88%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            KTVLITGVS+GLG+ALA+EL+KRGHT+IGCSR+Q+KLNSL +EL+S         ++HL+
Sbjct  21   KTVLITGVSKGLGRALAVELSKRGHTVIGCSRAQEKLNSLQSELSS--------PDRHLL  72

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + VDVRS++SV+ELA  +ME K +PDI+VNNAGTIN+NNR+WEVP E+FD VIDTNVKG+
Sbjct  73   LNVDVRSDNSVKELARVMMEKKFVPDIIVNNAGTINKNNRIWEVPVEEFDTVIDTNVKGI  132

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLM+ K +GIIVN+SSGWGRS AA VAPYCASKWA+EGL++++AKE
Sbjct  133  ANVLRHFIPLMLPKSRGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRAVAKE  186



>gb|KCW57164.1| hypothetical protein EUGRSUZ_I02794 [Eucalyptus grandis]
Length=262

 Score =   220 bits (560),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITGVS+GLG+ALALELAKRGH++IGCSRSQDKL+SL + L+S+SS  ++    HL+
Sbjct  28   RTVLITGVSKGLGQALALELAKRGHSVIGCSRSQDKLDSLRSLLSSSSSDAAADS-PHLL  86

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + VDVRSNSSVEELA AVM+   +PDI+VNNAGTIN+NN++WEVPAE+FD VIDTNVKG+
Sbjct  87   LNVDVRSNSSVEELARAVMDKTGVPDIIVNNAGTINKNNKIWEVPAEEFDAVIDTNVKGI  146

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+LRHF+P MI +K G+IVN+SSGWGRS AA VAPYCASKWA+EGLTKS+AKE
Sbjct  147  ANMLRHFLPPMIQRKHGVIVNMSSGWGRSGAALVAPYCASKWAVEGLTKSVAKE  200



>ref|XP_010930522.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Elaeis 
guineensis]
Length=266

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            +   GA +TVLITGVSRGLG+ALALELAKRGHTIIG +RSQ+K+++L AEL S   + SS
Sbjct  27   LKGAGAPRTVLITGVSRGLGRALALELAKRGHTIIGFARSQEKIDALLAELPSDDPAPSS  86

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
            S +KHLI++ DVRS+SS++ELA  V+E + +PDI+VNNAGTIN+NN++W+V AE+FD VI
Sbjct  87   SPSKHLIIQADVRSDSSIKELARLVVETRRVPDIIVNNAGTINKNNKIWDVSAEEFDMVI  146

Query  441  DTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            DTN+KGVAN+LR+F+P+MI+KK+GIIVN SSGWGRSAAA+VAPYCASKWAIEGLT+S+AK
Sbjct  147  DTNIKGVANILRNFLPVMIEKKRGIIVNTSSGWGRSAAAEVAPYCASKWAIEGLTRSVAK  206

Query  621  E  623
            E
Sbjct  207  E  207



>ref|XP_009144454.1| PREDICTED: carbonyl reductase family member 4 [Brassica rapa]
Length=242

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 150/174 (86%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K VLITGVS+GLG+AL+LE+AKRGHT+IGC+R+Q+KL +L +EL+S           HL+
Sbjct  18   KVVLITGVSKGLGRALSLEMAKRGHTVIGCARTQEKLTALQSELSS--------PENHLL  69

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            +  DV+S+SSV+E+AH +ME K +PDI+VNNAGTIN+N+++WEV AEDFD+V+DTNVKGV
Sbjct  70   LTADVKSDSSVKEMAHTIMEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDSVMDTNVKGV  129

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NVLRHFIPLM+ +KQGIIVN+SSGWGRS AA VAPYCASKWAIEGL++S+AKE
Sbjct  130  VNVLRHFIPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRSVAKE  183



>ref|XP_006470178.1| PREDICTED: carbonyl reductase family member 4-like [Citrus sinensis]
 gb|KDO52045.1| hypothetical protein CISIN_1g026364mg [Citrus sinensis]
 gb|KDO52046.1| hypothetical protein CISIN_1g026364mg [Citrus sinensis]
Length=240

 Score =   217 bits (552),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITGVSRGLG+ALA ELAKRGHT+IGCSR+QDKL SL +EL +         + HL 
Sbjct  16   RTVLITGVSRGLGRALAQELAKRGHTVIGCSRTQDKLTSLQSELPN--------PDHHLF  67

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + VD+RSNSSVEELA  V+E K +PDI+VNNAGTIN+NN++W+V  E+FD VIDTNVKG+
Sbjct  68   LNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGI  127

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+LRHFIPLMI  KQGIIVN+SSGWGRS AA VAPYCASKWA+EGL++S+AKE
Sbjct  128  ANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKE  181



>ref|XP_006431477.1| hypothetical protein CICLE_v10002114mg [Citrus clementina]
 gb|ESR44717.1| hypothetical protein CICLE_v10002114mg [Citrus clementina]
Length=278

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITGVSRGLG+ALA ELAKRGHT+IGCSR+QDKL SL +EL +         + HL 
Sbjct  54   RTVLITGVSRGLGRALAQELAKRGHTVIGCSRTQDKLTSLQSELPN--------PDHHLF  105

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + VD+RSNSSVEELA  V+E K +PDI+VNNAGTIN+NN++W+V  E+FD VIDTNVKG+
Sbjct  106  LNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGI  165

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+LRHFIPLMI  KQGIIVN+SSGWGRS AA VAPYCASKWA+EGL++S+AKE
Sbjct  166  ANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKE  219



>ref|XP_010086727.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
 gb|EXB23143.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Morus notabilis]
Length=357

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 153/181 (85%), Gaps = 7/181 (4%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassst-------ss  260
            +T+LITGV RGLG+ALALELAK+GHT++GCSR+QDKL+SL  ELA+A+ ++       S 
Sbjct  118  RTILITGVGRGLGRALALELAKQGHTVVGCSRTQDKLDSLKLELAAATPASPSSTEPNSL  177

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
            S NKHL++  D+ SN+S+EELAH VME   IPDIVVNNAG IN+NNR+WEV  E+FD VI
Sbjct  178  SSNKHLLINADITSNNSIEELAHVVMEKNGIPDIVVNNAGAINKNNRIWEVTEEEFDTVI  237

Query  441  DTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
             TNVKG+ANVLRHFIPLM+ KKQGIIVN+SSGWGRS AA VAPYCASKWA+EGLT+S+AK
Sbjct  238  STNVKGIANVLRHFIPLMLPKKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLTRSVAK  297

Query  621  E  623
            E
Sbjct  298  E  298



>ref|XP_004300012.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Fragaria 
vesca subsp. vesca]
 ref|XP_011464933.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Fragaria 
vesca subsp. vesca]
Length=241

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 145/178 (81%), Gaps = 13/178 (7%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITGVS+GLG+ALA+ELAKRGHT+IGCSRSQDKL SL +EL+          + HL 
Sbjct  13   RTVLITGVSKGLGRALAVELAKRGHTVIGCSRSQDKLTSLQSELS---------SDNHLF  63

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            +  DV SNSS++ELA  VME K +PDI+VNNAG IN NN+LWEVPA++FD VIDTNVKGV
Sbjct  64   LAADVSSNSSIQELARIVMEKKGVPDIIVNNAGVINSNNKLWEVPADEFDGVIDTNVKGV  123

Query  462  ANVLRHFIPLMIDKK----QGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLM+ +      GIIVN+SSGWGRS AA VAPYCASKWA+EGLT+S+AKE
Sbjct  124  ANVLRHFIPLMLKRDPAPATGIIVNMSSGWGRSGAAHVAPYCASKWAVEGLTRSVAKE  181



>ref|XP_006836855.1| hypothetical protein AMTR_s00099p00083600 [Amborella trichopoda]
 gb|ERM99708.1| hypothetical protein AMTR_s00099p00083600 [Amborella trichopoda]
Length=238

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 152/182 (84%), Gaps = 6/182 (3%)
 Frame = +3

Query  78   SMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasasssts  257
            ++S+ G+ K VLITGVSRGLG+ALALE+AKRGHTI+GCSRSQ+KL+SL  +L+       
Sbjct  4    ALSSGGSAKLVLITGVSRGLGRALALEMAKRGHTIVGCSRSQEKLHSLSTQLSPDD----  59

Query  258  ssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNV  437
               +KHL +  DVRS+SSV ELA  +++ K IPDI+VNNAGTIN+NN++WE+ +E+FD V
Sbjct  60   --PSKHLFVLADVRSDSSVAELAKVMVDTKGIPDIIVNNAGTINKNNKIWEISSEEFDAV  117

Query  438  IDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIA  617
            +DTNVKG AN+LRHF+P MI  K+G+IVNLSSGWGRS+AA+VAPYCASKWAIEGLT S+A
Sbjct  118  LDTNVKGTANILRHFLPFMIQNKKGLIVNLSSGWGRSSAAEVAPYCASKWAIEGLTGSVA  177

Query  618  KE  623
            KE
Sbjct  178  KE  179



>ref|NP_001047141.1| Os02g0557700 [Oryza sativa Japonica Group]
 dbj|BAF09055.1| Os02g0557700 [Oryza sativa Japonica Group]
 dbj|BAG89452.1| unnamed protein product [Oryza sativa Japonica Group]
Length=225

 Score =   211 bits (537),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 146/174 (84%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITGVSRGLG+ALALELA+RGH ++GC RS D + SL AE+A+ +        +H +
Sbjct  23   RTVLITGVSRGLGRALALELARRGHAVVGCGRSADHVRSLEAEIATPA--------RHFL  74

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
               DVRS+S++ ELA AV+E K +PDI+VNNAGTIN+NN+ W VPAE+FD V+DTN+KG 
Sbjct  75   TVADVRSDSNMAELAKAVVEKKQVPDIIVNNAGTINKNNKTWSVPAEEFDTVVDTNIKGT  134

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLMI+KK GIIVNLSSGWGRSAAA+VAPYCASKWAIEGLT+S+AKE
Sbjct  135  ANVLRHFIPLMIEKKHGIIVNLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE  188



>ref|XP_002453989.1| hypothetical protein SORBIDRAFT_04g022790 [Sorghum bicolor]
 gb|EES06965.1| hypothetical protein SORBIDRAFT_04g022790 [Sorghum bicolor]
Length=246

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 144/173 (83%), Gaps = 8/173 (5%)
 Frame = +3

Query  105  TVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIM  284
            TVLITGVSRGLG+ALALELA+RGH ++GC RS + L SL AE+ S         ++H + 
Sbjct  23   TVLITGVSRGLGRALALELARRGHAVVGCGRSAEHLRSLEAEITS--------PSRHFLT  74

Query  285  KVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVA  464
              DVRS+SSV ELA AV+E K +PDI+VNNAGTIN+NN+ W VPAEDFD V+DTN+KG A
Sbjct  75   VADVRSDSSVAELAKAVVERKQVPDIIVNNAGTINKNNKTWNVPAEDFDMVVDTNIKGTA  134

Query  465  NVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            NVLRHF+PLMI+K+ GII+NLSSGWGRSAAA+VAPYCASKWAIEGLT+S+AKE
Sbjct  135  NVLRHFVPLMIEKRHGIIINLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE  187



>ref|XP_006385080.1| hypothetical protein POPTR_0004s23710g [Populus trichocarpa]
 gb|ERP62877.1| hypothetical protein POPTR_0004s23710g [Populus trichocarpa]
Length=251

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 144/174 (83%), Gaps = 9/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV +GLG+ALALEL KRGH +IGCSRSQD LNSL ++ +          +KHL+
Sbjct  28   KKVMITGVGKGLGRALALELDKRGHIVIGCSRSQDNLNSLQSQFS---------SDKHLL  78

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            +  DV+SNSSVEELA  V+E K +PDI+VNNAGTIN+N ++WEV  E+FD+VIDTNVKG+
Sbjct  79   LDADVKSNSSVEELARVVVEKKGVPDIIVNNAGTINQNKKIWEVSEEEFDSVIDTNVKGI  138

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+LRHFIPLMI  KQGIIVN+SSGWGRS AA VAPYCASKWA+EGL++S+AKE
Sbjct  139  ANMLRHFIPLMIPNKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKE  192



>ref|XP_011028396.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Populus 
euphratica]
 ref|XP_011028397.1| PREDICTED: NADPH-dependent pterin aldehyde reductase [Populus 
euphratica]
Length=251

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 143/174 (82%), Gaps = 9/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV +GLG+ALALEL KRGH +IGCSRSQD LNSL ++            +KHL+
Sbjct  28   KKVMITGVGKGLGRALALELDKRGHIVIGCSRSQDNLNSLQSQFT---------SDKHLL  78

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            +  DV+SNSSVEELA  V+E K +PDI+VNNAGTIN+N ++WEV  E+FD+VIDTNVKG+
Sbjct  79   LDADVKSNSSVEELARVVVEKKGVPDIIVNNAGTINQNKKIWEVSEEEFDSVIDTNVKGI  138

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+LRHFIPLMI  KQGIIVN+SSGWGRS AA VAPYCASKWA+EGL++S+AKE
Sbjct  139  ANMLRHFIPLMIPNKQGIIVNMSSGWGRSGAALVAPYCASKWAVEGLSRSVAKE  192



>ref|XP_003575150.1| PREDICTED: uncharacterized oxidoreductase YMR226C [Brachypodium 
distachyon]
Length=247

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 142/174 (82%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITGVSRGLG+ALA+ELA+RGH I+GCSRS D + SL AE+A          ++H +
Sbjct  23   RTVLITGVSRGLGRALAMELARRGHFIVGCSRSADPIRSLEAEIAF--------PSRHFL  74

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
               DVRS+S + ELA AV+E K IPDI+VN AGTIN+NN+ W VPAEDFD V+DTN+KG 
Sbjct  75   TVADVRSDSGMAELAKAVVEKKQIPDIIVNGAGTINKNNKTWNVPAEDFDAVVDTNIKGT  134

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHF+PLMI KK GII+N SSGWGRSAAA+VAPYCASKWAIEGLT+S+AKE
Sbjct  135  ANVLRHFVPLMIQKKHGIIINFSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE  188



>ref|XP_009415002.1| PREDICTED: uncharacterized oxidoreductase YMR226C isoform X2 
[Musa acuminata subsp. malaccensis]
Length=255

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 162/198 (82%), Gaps = 11/198 (6%)
 Frame = +3

Query  51   PTTVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslh--  224
            PT   ++  + +AP   KTVL+TGVSRGLG+AL+LELA+RGH +IGC+RS DK+ +L   
Sbjct  25   PTAAGMK--AEAAP--RKTVLVTGVSRGLGRALSLELARRGHAVIGCARSPDKVQALQHE  80

Query  225  -----aelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTIN  389
                  + +S+SSS++S  +KHLI+ +DVRS+S V+ LA  +ME K  PDI+VNNAGTIN
Sbjct  81   LMGVSPDASSSSSSSASPPSKHLIIDLDVRSDSGVQALAKLLMETKRFPDIIVNNAGTIN  140

Query  390  RNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAP  569
            +NN++WEVPAE+FD V+DTNVKG++N++RHF+PLMI +K G IVN+SSGWGRSAAA+VAP
Sbjct  141  KNNKIWEVPAEEFDMVMDTNVKGISNIIRHFLPLMIQRKHGTIVNMSSGWGRSAAAEVAP  200

Query  570  YCASKWAIEGLTKSIAKE  623
            YCASKWA+EGLTKS+AKE
Sbjct  201  YCASKWAVEGLTKSVAKE  218



>dbj|BAJ89206.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=247

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 144/174 (83%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITG+SRGLG+ALALELA+RGH ++GC RS D + SL AE+ S         ++H +
Sbjct  23   RTVLITGISRGLGRALALELARRGHAVVGCGRSADPIRSLEAEMGS--------PSRHFL  74

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
               DVRS+SS+ ELA AV+E K IPDI+VNNAGTIN+NN+ W VPAE+FD V+DTN+KG 
Sbjct  75   TVADVRSDSSMGELAKAVVERKQIPDIIVNNAGTINKNNKTWNVPAEEFDTVVDTNIKGT  134

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHF+PLMI KK G+I+NLSSGWGRSAAA+VAPYCASKWAIEGLT+S+AKE
Sbjct  135  ANVLRHFVPLMIQKKHGMIINLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE  188



>ref|XP_006303587.1| hypothetical protein CARUB_v10011121mg [Capsella rubella]
 gb|EOA36485.1| hypothetical protein CARUB_v10011121mg [Capsella rubella]
Length=264

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 153/198 (77%), Gaps = 30/198 (15%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A +TVLITGVS+GLG+ALALELAKRGHT+IGC+R+Q+KL +L ++L+S +         H
Sbjct  16   AARTVLITGVSKGLGRALALELAKRGHTVIGCARTQEKLTALQSDLSSPA--------NH  67

Query  276  LIMKVDV----------------------RSNSSVEELAHAVMENKSIPDIVVNNAGTIN  389
            L++  DV                      + NSSVEELAH +ME K +PDI+VNNAGTIN
Sbjct  68   LLLTADVVISAALPNLMSFLCCAIQSAFLKVNSSVEELAHTIMEKKGVPDIIVNNAGTIN  127

Query  390  RNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAP  569
            +N+++WEV AEDFDNV+DTNVKGVANVLRHFIPLM+ +KQGIIVN+SSGWGRS AA VAP
Sbjct  128  KNSKIWEVSAEDFDNVMDTNVKGVANVLRHFIPLMLPRKQGIIVNMSSGWGRSGAALVAP  187

Query  570  YCASKWAIEGLTKSIAKE  623
            YCASKWAIEGL++++AKE
Sbjct  188  YCASKWAIEGLSRAVAKE  205



>gb|EEC73408.1| hypothetical protein OsI_07663 [Oryza sativa Indica Group]
Length=293

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 146/174 (84%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITGVSRGLG+ALALELA+RGH ++GC RS D + SL AE+A+ +        +H +
Sbjct  23   RTVLITGVSRGLGRALALELARRGHAVVGCGRSADHVRSLEAEIATPA--------RHFL  74

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
               DVRS+S++ ELA AV+E K +PDI+VNNAGTIN+NN+ W VPAE+FD V+DTN+KG 
Sbjct  75   TVADVRSDSNMAELAKAVVEKKQVPDIIVNNAGTINKNNKTWSVPAEEFDTVVDTNIKGT  134

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLMI+KK GIIVNLSSGWGRSAAA+VAPYCASKWAIEGLT+S+AKE
Sbjct  135  ANVLRHFIPLMIEKKHGIIVNLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE  188



>ref|XP_009415001.1| PREDICTED: uncharacterized oxidoreductase YMR226C isoform X1 
[Musa acuminata subsp. malaccensis]
Length=277

 Score =   211 bits (538),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 162/198 (82%), Gaps = 11/198 (6%)
 Frame = +3

Query  51   PTTVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslh--  224
            PT   ++  + +AP   KTVL+TGVSRGLG+AL+LELA+RGH +IGC+RS DK+ +L   
Sbjct  25   PTAAGMK--AEAAP--RKTVLVTGVSRGLGRALSLELARRGHAVIGCARSPDKVQALQHE  80

Query  225  -----aelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTIN  389
                  + +S+SSS++S  +KHLI+ +DVRS+S V+ LA  +ME K  PDI+VNNAGTIN
Sbjct  81   LMGVSPDASSSSSSSASPPSKHLIIDLDVRSDSGVQALAKLLMETKRFPDIIVNNAGTIN  140

Query  390  RNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAP  569
            +NN++WEVPAE+FD V+DTNVKG++N++RHF+PLMI +K G IVN+SSGWGRSAAA+VAP
Sbjct  141  KNNKIWEVPAEEFDMVMDTNVKGISNIIRHFLPLMIQRKHGTIVNMSSGWGRSAAAEVAP  200

Query  570  YCASKWAIEGLTKSIAKE  623
            YCASKWA+EGLTKS+AKE
Sbjct  201  YCASKWAVEGLTKSVAKE  218



>ref|XP_004952782.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like [Setaria 
italica]
Length=246

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 143/173 (83%), Gaps = 8/173 (5%)
 Frame = +3

Query  105  TVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIM  284
            TVLITGVSRGLG+ALALELA+RGH ++GC RS + L SL AE+ S         ++H + 
Sbjct  23   TVLITGVSRGLGRALALELARRGHAVVGCGRSAEHLRSLEAEITS--------PSRHFLT  74

Query  285  KVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVA  464
              DVRS+SSV ELA A +E K +PD++VNNAGTIN+NN+ W VPAEDFD V+DTN+KG A
Sbjct  75   VADVRSDSSVAELAKAAVERKQVPDVIVNNAGTINKNNKTWNVPAEDFDMVVDTNIKGTA  134

Query  465  NVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            NVLRHF+PLMI+K+ GIIVNLSSGWGRSAAA+VAPYCASKWAIEGLT+S+AKE
Sbjct  135  NVLRHFVPLMIEKRHGIIVNLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE  187



>ref|NP_001144211.1| hypothetical protein [Zea mays]
 gb|ACG38701.1| hypothetical protein [Zea mays]
 gb|AFW71828.1| hypothetical protein ZEAMMB73_205528 [Zea mays]
Length=246

 Score =   209 bits (532),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 142/173 (82%), Gaps = 8/173 (5%)
 Frame = +3

Query  105  TVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIM  284
            TVLITGVSRGLG+ALALELA+RGH+++GC RS + L SL  E+ S         ++H   
Sbjct  23   TVLITGVSRGLGRALALELARRGHSVVGCGRSAEHLRSLEEEITS--------PSRHFFT  74

Query  285  KVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVA  464
              DVRS+SSV ELA  V+E K +PDI+VNNAGTIN+NN+ W VPAEDFD V+DTN+KG A
Sbjct  75   VADVRSDSSVAELAKTVVEKKQVPDIIVNNAGTINKNNKTWNVPAEDFDMVVDTNIKGTA  134

Query  465  NVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            NVLRHF+PLMI+K+ GII+NLSSGWGRSAAA+VAPYCASKWAIEGLT+S+AKE
Sbjct  135  NVLRHFVPLMIEKRHGIIINLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE  187



>ref|XP_009355378.1| PREDICTED: carbonyl reductase family member 4 [Pyrus x bretschneideri]
Length=245

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 147/181 (81%), Gaps = 14/181 (8%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A + V+ITGVS+GLG+ALA+E+AKRGHT+IGCSRSQDKLN+L +EL+          +KH
Sbjct  14   ASRIVVITGVSKGLGRALAVEMAKRGHTVIGCSRSQDKLNALQSELS---------SDKH  64

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L +  DVRSN+S+ +LA  VME + IPDIVVNNAG IN N +LWEVP E+FD+VIDTNVK
Sbjct  65   LFLNADVRSNNSIADLARVVMEKRGIPDIVVNNAGMINDNKKLWEVPVEEFDSVIDTNVK  124

Query  456  GVANVLRHFIPLMIDKKQ-----GIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            GVANVLRHFIPLM+ + +     GIIVN+SSGWGRS AA VAPYCASKWA+EGLT+S+A+
Sbjct  125  GVANVLRHFIPLMLSRNEGKNPSGIIVNISSGWGRSGAAHVAPYCASKWAVEGLTRSVAR  184

Query  621  E  623
            E
Sbjct  185  E  185



>gb|EAZ23452.1| hypothetical protein OsJ_07145 [Oryza sativa Japonica Group]
Length=247

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 145/174 (83%), Gaps = 8/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITGVSRGLG+ALALELA+RGH ++GC RS D + SL AE+A+ +        +  +
Sbjct  23   RTVLITGVSRGLGRALALELARRGHAVVGCGRSADHVRSLEAEIATPA--------RQFL  74

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
               DVRS+S++ ELA AV+E K +PDI+VNNAGTIN+NN+ W VPAE+FD V+DTN+KG 
Sbjct  75   TVADVRSDSNMAELAKAVVEKKQVPDIIVNNAGTINKNNKTWSVPAEEFDTVVDTNIKGT  134

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLMI+KK GIIVNLSSGWGRSAAA+VAPYCASKWAIEGLT+S+AKE
Sbjct  135  ANVLRHFIPLMIEKKHGIIVNLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE  188



>ref|XP_008464738.1| PREDICTED: carbonyl reductase family member 4-like isoform X1 
[Cucumis melo]
Length=247

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 150/176 (85%), Gaps = 3/176 (2%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            + +TVLITGVS+GLG+ALALELAKRGH+++GCSRSQDKLNSL+++  S   S+S+    H
Sbjct  16   SQRTVLITGVSKGLGRALALELAKRGHSVVGCSRSQDKLNSLNSDFTSLDLSSSA---NH  72

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L++ VDV S+S+V+E A  V+E K +PDI+VNNAGTIN+N+++WEVP E+FD V +TNVK
Sbjct  73   LLLPVDVSSDSNVQEFARVVVERKGVPDIIVNNAGTINKNSKIWEVPPEEFDAVYETNVK  132

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            G  N+LRHFIPLMI  K+GIIVN+SSGWGRS AA VAPYCASKWAIEGLT+S+AKE
Sbjct  133  GTVNILRHFIPLMIPSKKGIIVNMSSGWGRSGAALVAPYCASKWAIEGLTRSVAKE  188



>ref|XP_004149129.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
 ref|XP_004159598.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=247

 Score =   207 bits (527),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 149/176 (85%), Gaps = 3/176 (2%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            + KTVLITGVS+GLG+ALALELAKRGH++IGCSRSQDKLNSL+++  S   S+S+    H
Sbjct  16   SQKTVLITGVSKGLGRALALELAKRGHSVIGCSRSQDKLNSLNSDFISLDLSSSA---NH  72

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L++  DV S+S+V+E A  V+E K +PDI+VNNAGTIN+N+++WEVP E+FD V +TNVK
Sbjct  73   LLLPADVSSDSNVQEFARVVVERKGVPDIIVNNAGTINKNSKVWEVPPEEFDAVYETNVK  132

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            G  N+LRHFIPLMI  K+GIIVN+SSGWGRS AA VAPYCASKWAIEGLT+S+AKE
Sbjct  133  GTVNILRHFIPLMIPSKKGIIVNMSSGWGRSGAALVAPYCASKWAIEGLTRSVAKE  188



>ref|XP_003520921.1| PREDICTED: carbonyl reductase family member 4-like isoform X1 
[Glycine max]
 gb|KHN42173.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Glycine soja]
Length=236

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 148/183 (81%), Gaps = 9/183 (5%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            M+  G  + VLITGV +GLG+ALALELA RGHTIIGCSRSQD LNSL ++L+ +      
Sbjct  2    MNGGGRRRIVLITGVGKGLGRALALELAHRGHTIIGCSRSQDNLNSLQSQLSFS------  55

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
              + HL++  DV SN +V+E+A  VM+N+S+PDI+VNNAGTIN+NN++WEVP EDFD V+
Sbjct  56   -SSNHLLLNADVSSNENVQEMARVVMDNRSVPDIIVNNAGTINKNNKIWEVPPEDFDAVM  114

Query  441  DTNVKGVANVLRHFIPLMI--DKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSI  614
            DTNVKG ANVLRHFIPLMI   K + +IVN+SSGWGRS AA V+PYCASKWAIEGL+KS+
Sbjct  115  DTNVKGTANVLRHFIPLMIAAKKMEAVIVNMSSGWGRSGAALVSPYCASKWAIEGLSKSV  174

Query  615  AKE  623
            AKE
Sbjct  175  AKE  177



>ref|XP_007223751.1| hypothetical protein PRUPE_ppa010537mg [Prunus persica]
 gb|EMJ24950.1| hypothetical protein PRUPE_ppa010537mg [Prunus persica]
Length=245

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 146/181 (81%), Gaps = 14/181 (8%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A + V+ITGVS+GLG+ALA+E+AKRGHT+IGCSR+QDKLN+L +EL+          +KH
Sbjct  14   ASRIVVITGVSKGLGRALAVEMAKRGHTVIGCSRAQDKLNALQSELS---------SDKH  64

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L +  DVRSN+S+ ELA  V E + IPDI+VNNAG IN N +LWEVP E+FD+VIDTNVK
Sbjct  65   LFLNTDVRSNTSIAELARVVKEKRGIPDIIVNNAGIINDNKKLWEVPVEEFDSVIDTNVK  124

Query  456  GVANVLRHFIPLMIDKKQ-----GIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            G+ANVLRHFIPLM+ + +     GIIVN+SSGWGRS AA VAPYCASKWA+EGLT+S+A+
Sbjct  125  GIANVLRHFIPLMLSRNEGKNPAGIIVNMSSGWGRSGAAHVAPYCASKWAVEGLTRSVAR  184

Query  621  E  623
            E
Sbjct  185  E  185



>ref|XP_008218650.1| PREDICTED: carbonyl reductase family member 4 [Prunus mume]
Length=245

 Score =   205 bits (521),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 145/181 (80%), Gaps = 14/181 (8%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A + V+ITGVS+GLG+ALA+E+AKRGHT+IGCSR+QDKLN+L +EL+          +KH
Sbjct  14   ASRIVVITGVSKGLGRALAVEMAKRGHTVIGCSRAQDKLNALQSELS---------SDKH  64

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L +  DVRSN+S+ ELA  V E + IPDI+VNNAG IN N +LWEVP E+FD+VIDTNVK
Sbjct  65   LFLNTDVRSNTSIAELARVVKEKRGIPDIIVNNAGIINDNKKLWEVPVEEFDSVIDTNVK  124

Query  456  GVANVLRHFIPLMIDKKQ-----GIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            G+ANVLRHFIPLM+ +       GIIVN+SSGWGRS AA VAPYCASKWA+EGLT+S+A+
Sbjct  125  GIANVLRHFIPLMLSRNDGKNPAGIIVNMSSGWGRSGAAHVAPYCASKWAVEGLTRSVAR  184

Query  621  E  623
            E
Sbjct  185  E  185



>ref|XP_008347943.1| PREDICTED: carbonyl reductase family member 4-like [Malus domestica]
Length=281

 Score =   206 bits (523),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 144/179 (80%), Gaps = 14/179 (8%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            + V+ITGVS+GLG+ALA+E+AKRGHT+IGCSRSQDKLN+L +EL+          +KHL 
Sbjct  52   RIVVITGVSKGLGRALAVEMAKRGHTVIGCSRSQDKLNALQSELS---------SDKHLF  102

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            +  DVRSN+S+ +LA  VME + IPDI VNNAG IN N +LWEVP E+FD VIDTNVKGV
Sbjct  103  LNADVRSNNSIADLARVVMEKRGIPDIXVNNAGMINDNKKLWEVPVEEFDXVIDTNVKGV  162

Query  462  ANVLRHFIPLMIDKKQ-----GIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLM+ + +     GIIVN+SSGWGRS AA VAPYCASKWA+EGLT+S+A+E
Sbjct  163  ANVLRHFIPLMLSRNEGKNPSGIIVNISSGWGRSGAAHVAPYCASKWAVEGLTRSVARE  221



>ref|XP_008378946.1| PREDICTED: carbonyl reductase family member 4 [Malus domestica]
Length=245

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 143/179 (80%), Gaps = 14/179 (8%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            + V+ITGVS+GLG+ALA+E+AKRGHT+IGCSRSQDKLN+L +EL+          +KHL 
Sbjct  16   QIVVITGVSKGLGRALAVEMAKRGHTVIGCSRSQDKLNALQSELS---------SDKHLF  66

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            +  D RSN+S+ +LA  VME + IPDI VNNAG IN N +LWEVP E+FD VIDTNVKGV
Sbjct  67   LNADXRSNNSIADLARVVMEKRGIPDIXVNNAGMINDNKKLWEVPVEEFDXVIDTNVKGV  126

Query  462  ANVLRHFIPLMIDKKQ-----GIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLM+ + +     GIIVN+SSGWGRS AA VAPYCASKWA+EGLT+S+A+E
Sbjct  127  ANVLRHFIPLMLSRNEGKNPSGIIVNISSGWGRSGAAHVAPYCASKWAVEGLTRSVARE  185



>emb|CDY20642.1| BnaC08g14160D [Brassica napus]
Length=1427

 Score =   218 bits (554),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 150/174 (86%), Gaps = 8/174 (5%)
 Frame = +3

Query  102   KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
             KTVLITGVS+GLG+AL+LE+AKRGHT+IGC+R+Q+K  +L +EL+S           HL+
Sbjct  1203  KTVLITGVSKGLGRALSLEMAKRGHTVIGCARTQEKFTALQSELSS--------PENHLL  1254

Query  282   MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
             +  DV+S+SSV+E+AH +ME K +PDI+VNNAGTIN+N+++WEV AEDFD+V+DTNVKGV
Sbjct  1255  LTADVKSDSSVKEMAHTIMEKKGVPDIIVNNAGTINKNSKIWEVSAEDFDSVMDTNVKGV  1314

Query  462   ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
              NVLRHFIPLM+ +KQGIIVN+SSGWGRS AA VAPYCASKWAIEGL++S+AKE
Sbjct  1315  VNVLRHFIPLMLPRKQGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSRSVAKE  1368



>emb|CAN82350.1| hypothetical protein VITISV_019435 [Vitis vinifera]
Length=310

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 156/226 (69%), Gaps = 51/226 (23%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasasss-----tsss  263
            ++TVLITGV +GLG+ALALE+AKRGHT++GCSRSQD+L SL +EL+S +SS       SS
Sbjct  26   NRTVLITGVGKGLGRALALEIAKRGHTVVGCSRSQDRLTSLQSELSSVASSPQSDSAVSS  85

Query  264  QNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIV--------------------------  365
             ++H  M VDVRSNSSVEELA AVME K +PDI+                          
Sbjct  86   SDRHFFMTVDVRSNSSVEELARAVMEKKGVPDIIGQLGIGRLIRDHSSGVLRAFSSLAIE  145

Query  366  -----------------VNN---AGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLRHFI  485
                             ++N    GTINRNNR+WEVP E+FD VIDTNVKG ANV+R FI
Sbjct  146  AEILALLEELLLAKTLSISNFLIEGTINRNNRIWEVPEEEFDTVIDTNVKGTANVMRQFI  205

Query  486  PLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            PLMI+ KQGIIVN+SSGWGRSAAAQVAPYCASKWA+EGL++S+AKE
Sbjct  206  PLMIENKQGIIVNMSSGWGRSAAAQVAPYCASKWAVEGLSRSVAKE  251



>gb|KEH32750.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=237

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 145/179 (81%), Gaps = 10/179 (6%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
             +K+VLITGVS+G+G+ALA+ELA RGHTIIGCSR+QDKL+SL + L           + H
Sbjct  7    GNKSVLITGVSKGIGRALAIELANRGHTIIGCSRAQDKLDSLQSLLLPN-------NHNH  59

Query  276  LIMKVDVRSNSSVEELAHAVMENKS-IPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNV  452
            L + VDV SN SV+++A  VME K   PD++VN+AGTIN+NN++WEVP+++FD V+DTN+
Sbjct  60   LFLNVDVSSNDSVQQMARTVMEMKGGPPDVIVNSAGTINKNNKMWEVPSQEFDLVMDTNL  119

Query  453  KGVANVLRHFIPLMIDK--KQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            KG ANVLRHFIPLMI+    +GIIVNLSSGWGRS AA VAPYCASKWAIEGLTKS+AKE
Sbjct  120  KGTANVLRHFIPLMINNGGGEGIIVNLSSGWGRSGAALVAPYCASKWAIEGLTKSVAKE  178



>ref|XP_010030947.1| PREDICTED: dehydrogenase/reductase SDR family member 7-like [Eucalyptus 
grandis]
Length=246

 Score =   200 bits (508),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 146/173 (84%), Gaps = 3/173 (2%)
 Frame = +3

Query  105  TVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIM  284
            TVLITGVS+GLG+ALALE AKRGH++IGCSRSQDKL+SL + L+S+S +     + HL++
Sbjct  16   TVLITGVSKGLGQALALEFAKRGHSVIGCSRSQDKLDSLRSLLSSSSDAA---DSPHLLL  72

Query  285  KVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVA  464
             VDV  N S+EELA  VM+ K +PDI+VN+AGTIN+NN +WEVP ++FD VIDTNVKG+A
Sbjct  73   NVDVVRNDSLEELARVVMDKKGVPDIIVNSAGTINKNNNIWEVPEDEFDAVIDTNVKGIA  132

Query  465  NVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            N+LRHF+P M+ +K+GIIVN+SSGWGR  +  VAPYCASKWA+EGL+KS+AKE
Sbjct  133  NMLRHFLPPMVQRKRGIIVNMSSGWGRCGSGLVAPYCASKWAVEGLSKSVAKE  185



>emb|CDO97648.1| unnamed protein product [Coffea canephora]
Length=170

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +3

Query  297  RSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLR  476
            RS+SSV++LA +V+E KSIPDI+VNNAGTINRNN++W+VP E+FD VIDTNVKG+AN+LR
Sbjct  3    RSDSSVQDLARSVVEKKSIPDIIVNNAGTINRNNKIWDVPVEEFDTVIDTNVKGIANMLR  62

Query  477  HFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            HF+PLMI++KQG+IVN+SSGWGRSAAAQVAPYCASKWA+EGLT+S+AKE
Sbjct  63   HFVPLMIERKQGVIVNMSSGWGRSAAAQVAPYCASKWAVEGLTRSVAKE  111



>gb|KEH30263.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=257

 Score =   197 bits (502),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 138/181 (76%), Gaps = 12/181 (7%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
             ++TV+ITGVS+GLG+ALA+ELA RGHTIIGCSR  D           ++       N H
Sbjct  25   GNQTVMITGVSKGLGRALAIELANRGHTIIGCSRDHDNKLDFLQSQLPST-------NHH  77

Query  276  LIMKVDVRSNSSVEELAHAVMENKS-IPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNV  452
            L + VDVR N +VEE+AH VME K   PDI+VN AG IN+N+++WEVP+E+FD+V+DTN+
Sbjct  78   LFISVDVRCNYNVEEMAHIVMEKKGGPPDIIVNGAGVINKNSKMWEVPSEEFDSVMDTNL  137

Query  453  KGVANVLRHFIPLMIDKKQ----GIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            KG ANVLRHFIPLMI K +    GIIVN+SSGWGRS AA VAPYCASKWAIEGLTKS+A+
Sbjct  138  KGTANVLRHFIPLMIAKNKNEMGGIIVNMSSGWGRSGAALVAPYCASKWAIEGLTKSVAE  197

Query  621  E  623
            E
Sbjct  198  E  198



>ref|XP_002981195.1| hypothetical protein SELMODRAFT_113925 [Selaginella moellendorffii]
 ref|XP_002982674.1| hypothetical protein SELMODRAFT_116810 [Selaginella moellendorffii]
 gb|EFJ16427.1| hypothetical protein SELMODRAFT_116810 [Selaginella moellendorffii]
 gb|EFJ17896.1| hypothetical protein SELMODRAFT_113925 [Selaginella moellendorffii]
Length=234

 Score =   197 bits (500),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 138/174 (79%), Gaps = 9/174 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITGV+RGLG+ALALE+A RGHTIIGC R ++KL SL  +L           +KH++
Sbjct  10   RTVLITGVTRGLGRALALEIASRGHTIIGCGRDEEKLTSLQNQLG---------DSKHIL  60

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV S+S+V+E A AV+E K  PDI+VNNAG IN N +LWEV  E+FDNVID N+KG 
Sbjct  61   RAVDVASDSNVQEFARAVIELKGAPDILVNNAGVINSNGKLWEVAREEFDNVIDVNIKGP  120

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN LRHF+P M+ KKQG+IVN SSGWGRSAAA+V+PYCASKWA+EGLT+S+AKE
Sbjct  121  ANCLRHFVPHMMSKKQGVIVNFSSGWGRSAAAEVSPYCASKWAMEGLTRSLAKE  174



>ref|XP_006648744.1| PREDICTED: alcohol dehydrogenase 1-like, partial [Oryza brachyantha]
Length=196

 Score =   195 bits (496),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  270  KHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTN  449
            +H +   DVRS+S++ ELA AV+E K +PDI+VNNAGTIN+NN+ W VPAE+FD V+DTN
Sbjct  20   RHFLTVADVRSDSNMAELAKAVVEKKQVPDIIVNNAGTINKNNKTWCVPAEEFDTVVDTN  79

Query  450  VKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            +KG ANVLRHFIPLMI+KK GIIVNLSSGWGRSAAA+VAPYCASKWAIEGLT+S+AKE
Sbjct  80   IKGTANVLRHFIPLMIEKKHGIIVNLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE  137



>ref|XP_004499366.1| PREDICTED: uncharacterized oxidoreductase YoxD-like [Cicer arietinum]
Length=256

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 146/182 (80%), Gaps = 16/182 (9%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            ++V+ITGVS+G+G+ALA+ELA RGHTIIGCSR+QDKL+SLH++L+ +          HL 
Sbjct  24   RSVMITGVSKGIGRALAIELANRGHTIIGCSRAQDKLDSLHSQLSLSP--------SHLF  75

Query  282  MKVDVRSNSSVEELAHAVMENKS-IPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
            + VDVR N SVEE+A  VME K   PD++VN AGTIN+NN++WEVP E+FD V++TN+KG
Sbjct  76   LNVDVRCNKSVEEMARIVMEKKGGPPDVIVNGAGTINKNNKMWEVPEEEFDLVMETNLKG  135

Query  459  VANVLRHFIPLMIDKKQ-------GIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIA  617
             ANVLRHFIPLMI+ K+       GIIVN+SSGWGRS AA VAPYCASKWAIEGLT+S++
Sbjct  136  TANVLRHFIPLMINNKKKKNGEEGGIIVNMSSGWGRSGAALVAPYCASKWAIEGLTRSVS  195

Query  618  KE  623
            KE
Sbjct  196  KE  197



>ref|XP_008464739.1| PREDICTED: carbonyl reductase family member 4-like isoform X2 
[Cucumis melo]
Length=243

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 146/176 (83%), Gaps = 7/176 (4%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            + +TVLITGVS+GLG+ALALELAKRGH+++GCSRSQDKLNSL+++  S   S+S+    H
Sbjct  16   SQRTVLITGVSKGLGRALALELAKRGHSVVGCSRSQDKLNSLNSDFTSLDLSSSA---NH  72

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
            L++ VDV S+S+V+E A  V+E K +PDI+    GTIN+N+++WEVP E+FD V +TNVK
Sbjct  73   LLLPVDVSSDSNVQEFARVVVERKGVPDII----GTINKNSKIWEVPPEEFDAVYETNVK  128

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            G  N+LRHFIPLMI  K+GIIVN+SSGWGRS AA VAPYCASKWAIEGLT+S+AKE
Sbjct  129  GTVNILRHFIPLMIPSKKGIIVNMSSGWGRSGAALVAPYCASKWAIEGLTRSVAKE  184



>ref|XP_006576299.1| PREDICTED: carbonyl reductase family member 4-like isoform X2 
[Glycine max]
Length=232

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 144/183 (79%), Gaps = 13/183 (7%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            M+  G  + VLITGV +GLG+ALALELA RGHTIIGCSRSQD LNSL ++L+ +      
Sbjct  2    MNGGGRRRIVLITGVGKGLGRALALELAHRGHTIIGCSRSQDNLNSLQSQLSFS------  55

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
              + HL++  DV SN +V+E+A  VM+N+S+PDI+    GTIN+NN++WEVP EDFD V+
Sbjct  56   -SSNHLLLNADVSSNENVQEMARVVMDNRSVPDII----GTINKNNKIWEVPPEDFDAVM  110

Query  441  DTNVKGVANVLRHFIPLMI--DKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSI  614
            DTNVKG ANVLRHFIPLMI   K + +IVN+SSGWGRS AA V+PYCASKWAIEGL+KS+
Sbjct  111  DTNVKGTANVLRHFIPLMIAAKKMEAVIVNMSSGWGRSGAALVSPYCASKWAIEGLSKSV  170

Query  615  AKE  623
            AKE
Sbjct  171  AKE  173



>gb|KCW57162.1| hypothetical protein EUGRSUZ_I02793 [Eucalyptus grandis]
Length=262

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 150/204 (74%), Gaps = 24/204 (12%)
 Frame = +3

Query  75   LSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassst  254
            +S    G  +TVLITGVS+GLG+ALALE AKRGH++IGCSRSQDKL+SL + L+S+S + 
Sbjct  1    MSRGGGGGQRTVLITGVSKGLGQALALEFAKRGHSVIGCSRSQDKLDSLRSLLSSSSDAA  60

Query  255  sssQNKHLIMKVDVRS---------------------NSSVEELAHAVMENKSIPDIVVN  371
                + HL++ VDV                       + S+EELA  VM+ K +PDI+VN
Sbjct  61   ---DSPHLLLNVDVVRIRFPFFFLFLPFSHSLIGSAIHDSLEELARVVMDKKGVPDIIVN  117

Query  372  NAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSA  551
            +AGTIN+NN +WEVP ++FD VIDTNVKG+AN+LRHF+P M+ +K+GIIVN+SSGWGR  
Sbjct  118  SAGTINKNNNIWEVPEDEFDAVIDTNVKGIANMLRHFLPPMVQRKRGIIVNMSSGWGRCG  177

Query  552  AAQVAPYCASKWAIEGLTKSIAKE  623
            +  VAPYCASKWA+EGL+KS+AKE
Sbjct  178  SGLVAPYCASKWAVEGLSKSVAKE  201



>gb|AFW86137.1| hypothetical protein ZEAMMB73_815528 [Zea mays]
Length=151

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +3

Query  297  RSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLR  476
            RS+SSV ELA  V+E K +PDI+VNNAGTIN+NN+ W VPAEDFD V+DTN+KG ANVLR
Sbjct  6    RSDSSVAELAKTVVEKKQVPDIIVNNAGTINKNNKTWNVPAEDFDMVVDTNIKGTANVLR  65

Query  477  HFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            HF+PLMI+K+ GII+NLSSGWGRSA A+VAPYCASKWAIEGLT+S+AKE
Sbjct  66   HFVPLMIEKRHGIIINLSSGWGRSATAEVAPYCASKWAIEGLTRSLAKE  114



>ref|XP_007153913.1| hypothetical protein PHAVU_003G075700g [Phaseolus vulgaris]
 gb|ESW25907.1| hypothetical protein PHAVU_003G075700g [Phaseolus vulgaris]
Length=244

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 146/179 (82%), Gaps = 7/179 (4%)
 Frame = +3

Query  93   GAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNK  272
            G  +TVLITGV +G+G+ALA+ELA RGHT+IGCSRSQ  L+SL  +L+S + +       
Sbjct  12   GTGRTVLITGVGKGIGRALAVELATRGHTVIGCSRSQQNLDSLQTQLSSTNRNL-----N  66

Query  273  HLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNV  452
            H     DV+S+ SV+++A  VM+NK++PDI+VNNAGTIN+NN+LWEVP E+F+ V+DTNV
Sbjct  67   HFFFNADVKSSESVQQMARLVMDNKAVPDIIVNNAGTINKNNKLWEVPEEEFEEVMDTNV  126

Query  453  KGVANVLRHFIPLMID--KKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            KG ANVLRHFIPLMI+  K +GIIVN+SSGWGRS AA VAPYCASKWAIEGL+KS+AKE
Sbjct  127  KGTANVLRHFIPLMIEWKKAEGIIVNMSSGWGRSGAALVAPYCASKWAIEGLSKSVAKE  185



>ref|XP_008464744.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like [Cucumis 
melo]
Length=254

 Score =   187 bits (476),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            + VLITGVS+GLG+ALALELA RGHTIIGCSR Q KL+SL A+L++ S        KHL+
Sbjct  19   RKVLITGVSKGLGRALALELASRGHTIIGCSRDQTKLDSLQAQLSNLS------STKHLL  72

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DVRSN+ VEE A A +EN+ +P+I+VNNAG INRN ++WE+ A +FDNVIDTNVKG+
Sbjct  73   CNLDVRSNTEVEEFARATVENELVPNIIVNNAGLINRNGKMWELDAHEFDNVIDTNVKGI  132

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+RHFIPLMI   +GII+N+SS  GR +   +APYCASKW +EGL+K+IAKE
Sbjct  133  ANVMRHFIPLMISSNKGIIINMSSMAGRDSHELIAPYCASKWGVEGLSKAIAKE  186



>ref|XP_004149138.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
 ref|XP_004159610.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=255

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 139/174 (80%), Gaps = 6/174 (3%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            + VLITGVS+GLG+ALALELA RGHTIIGCSR Q KL+SL A+L++ S         HL+
Sbjct  18   RKVLITGVSKGLGRALALELASRGHTIIGCSRDQTKLDSLQAQLSNLS------STNHLL  71

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDVRSN+ VEE A A +EN+ +P+I+VNNAG INR+ ++WE+ A++FDNVIDTNVKG+
Sbjct  72   YNVDVRSNTKVEEFARATVENELVPNIIVNNAGLINRSCKIWELDAQEFDNVIDTNVKGI  131

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN++RHFIPLMI   +GII+N+SS  GR A   +APYCASKW +EGL+K+IAKE
Sbjct  132  ANIMRHFIPLMISSNKGIIINMSSIAGRDARELIAPYCASKWGVEGLSKAIAKE  185



>gb|EMT28916.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Aegilops tauschii]
Length=182

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +3

Query  318  ELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMI  497
            ELA AV+E K IPDI+VNNAGTIN+NN+ W VPAE+FD V+DTN+KG ANVLRHF+PLMI
Sbjct  3    ELAKAVVERKQIPDIIVNNAGTINKNNKTWNVPAEEFDTVVDTNIKGTANVLRHFVPLMI  62

Query  498  DKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             KK G+I+NLSSGWGRSAAA+VAPYCASKWAIEGLT+S+AKE
Sbjct  63   QKKHGMIINLSSGWGRSAAAEVAPYCASKWAIEGLTRSLAKE  104



>ref|XP_004169581.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like isoform 
1 [Cucumis sativus]
Length=280

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 144/208 (69%), Gaps = 10/208 (5%)
 Frame = +3

Query  9    CSSQLRLKMTTLS-TPTTVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTII  185
            C S L  K +T +  PTT +    +M A    K VLITGVSRGLG+ALALELA  GHT+I
Sbjct  18   CLSSLSKKYSTSTMAPTTTDKASSTMVA--VSKKVLITGVSRGLGRALALELATYGHTVI  75

Query  186  GCSRSQDKlnslhaelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIV  365
            GCSR Q KL+SL  +L+  S +       HL++ +DV+ N SVEE A  VMEN+ IPDI+
Sbjct  76   GCSRDQTKLDSLQLQLSKVSPNA-----NHLLLSIDVKCNRSVEEFARTVMENELIPDII  130

Query  366  VNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGR  545
            VNNAG  N+ + +WE+  +DFDNVIDTN+KG  N+LRHFIPLMI   QGIIVN+SS  GR
Sbjct  131  VNNAGVANKRSNMWEIDVQDFDNVIDTNIKGTTNILRHFIPLMIPYNQGIIVNISSDAGR  190

Query  546  S--AAAQVAPYCASKWAIEGLTKSIAKE  623
                   +APYCASKW IEGL+K IA+E
Sbjct  191  DNIPYKSLAPYCASKWGIEGLSKCIAQE  218



>ref|XP_004169582.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like isoform 
2 [Cucumis sativus]
Length=250

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 138/193 (72%), Gaps = 9/193 (5%)
 Frame = +3

Query  51   PTTVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhae  230
            PTT +    +M+A    K VLITGVSRGLG+ALALELA  GHT+IGCSR Q KL+SL  +
Sbjct  3    PTTTDKASSTMAA--VSKKVLITGVSRGLGRALALELATYGHTVIGCSRDQTKLDSLQLQ  60

Query  231  lasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWE  410
            L+  S +       HL++ +DV+ N SVEE A  VMEN+ IPDI+VNNAG  N+ + +WE
Sbjct  61   LSKVSPNA-----NHLLLSIDVKCNRSVEEFARTVMENELIPDIIVNNAGVANKRSNMWE  115

Query  411  VPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRS--AAAQVAPYCASK  584
            +  +DFDNVIDTN+KG  N+LRHFIPLMI   QGIIVN+SS  GR       +APYCASK
Sbjct  116  IDVQDFDNVIDTNIKGTTNILRHFIPLMIPYNQGIIVNISSDAGRDNIPYKSLAPYCASK  175

Query  585  WAIEGLTKSIAKE  623
            W IEGL+K IA+E
Sbjct  176  WGIEGLSKCIAQE  188



>gb|KGN66094.1| hypothetical protein Csa_1G570190 [Cucumis sativus]
Length=250

 Score =   178 bits (452),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 137/193 (71%), Gaps = 9/193 (5%)
 Frame = +3

Query  51   PTTVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhae  230
            PTT +    +M A    K VLITGVSRGLG+ALALELA  GHT+IGCSR Q KL+SL  +
Sbjct  3    PTTTDKASSTMVA--VSKKVLITGVSRGLGRALALELATYGHTVIGCSRDQTKLDSLQLQ  60

Query  231  lasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWE  410
            L+  S +       HL++ +DV+ N SVEE A  VMEN+ IPDI+VNNAG  N+ + +WE
Sbjct  61   LSKVSPNA-----NHLLLSIDVKCNRSVEEFARTVMENELIPDIIVNNAGVANKRSNMWE  115

Query  411  VPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRS--AAAQVAPYCASK  584
            +  +DFDNVIDTN+KG  N+LRHFIPLMI   QGIIVN+SS  GR       +APYCASK
Sbjct  116  IDVQDFDNVIDTNIKGTTNILRHFIPLMIPYNQGIIVNISSDAGRDNIPYKSLAPYCASK  175

Query  585  WAIEGLTKSIAKE  623
            W IEGL+K IA+E
Sbjct  176  WGIEGLSKCIAQE  188



>ref|XP_006431476.1| hypothetical protein CICLE_v10002114mg [Citrus clementina]
 gb|ESR44716.1| hypothetical protein CICLE_v10002114mg [Citrus clementina]
Length=200

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 127/154 (82%), Gaps = 8/154 (5%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            +TVLITGVSRGLG+ALA ELAKRGHT+IGCSR+QDKL SL +EL +         + HL 
Sbjct  54   RTVLITGVSRGLGRALAQELAKRGHTVIGCSRTQDKLTSLQSELPN--------PDHHLF  105

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + VD+RSNSSVEELA  V+E K +PDI+VNNAGTIN+NN++W+V  E+FD VIDTNVKG+
Sbjct  106  LNVDIRSNSSVEELARLVVEKKGVPDIIVNNAGTINKNNKIWDVSPEEFDTVIDTNVKGI  165

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQV  563
            AN+LRHFIPLMI  KQGIIVN+SSGWGRS AA V
Sbjct  166  ANMLRHFIPLMIPIKQGIIVNMSSGWGRSGAALV  199



>ref|XP_004149130.1| PREDICTED: uncharacterized oxidoreductase YxbG-like [Cucumis 
sativus]
 gb|KGN49562.1| hypothetical protein Csa_5G002570 [Cucumis sativus]
Length=260

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 142/185 (77%), Gaps = 7/185 (4%)
 Frame = +3

Query  69   EELSMSAPGAH-KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasas  245
            E ++++ P +  + VLITGVS+GLG+ALALELA RGHTIIGCSR Q KL+SL  +L++ S
Sbjct  13   ESMAVAEPSSCCRKVLITGVSKGLGRALALELANRGHTIIGCSRDQVKLDSLQQQLSTTS  72

Query  246  sstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAED  425
                   N+H   K+DV+S+++V+E A  V +N  +P I+VNNAG  +++ ++WE+ AE+
Sbjct  73   L------NQHFFFKLDVKSDNNVQEFAQFVAKNNLVPHILVNNAGLAHKSAKIWELDAEE  126

Query  426  FDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLT  605
            FDNVIDTNVKG+AN+LRHFIPLMI    GIIVN+SSG GRSA    APYC+SKWA+EGL+
Sbjct  127  FDNVIDTNVKGIANILRHFIPLMIQNNNGIIVNMSSGAGRSAHEDFAPYCSSKWAVEGLS  186

Query  606  KSIAK  620
            K IAK
Sbjct  187  KCIAK  191



>ref|XP_008464742.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like isoform 
X3 [Cucumis melo]
Length=236

 Score =   176 bits (446),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 132/171 (77%), Gaps = 6/171 (4%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            VLITGVS+GLG+ALALELA RGHTIIGCSR Q KL+SL  +L++ S       N+H   K
Sbjct  3    VLITGVSKGLGRALALELANRGHTIIGCSRDQIKLDSLQQQLSNTS------PNRHFFFK  56

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            +DV S++ V+E A  V +N  +P I+VNNAG  +R+ ++WE+ AE+FDNVIDTNVKG+AN
Sbjct  57   LDVTSDTHVQEFAQFVAKNNLVPRILVNNAGLAHRSAKIWELEAEEFDNVIDTNVKGIAN  116

Query  468  VLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            +LRHF+PLMI    GIIVN+SSG GRSA    APYC+SKWA+EGLTK +AK
Sbjct  117  ILRHFVPLMIQNNNGIIVNMSSGAGRSAHEDFAPYCSSKWAVEGLTKCVAK  167



>ref|XP_008464740.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like isoform 
X1 [Cucumis melo]
Length=274

 Score =   177 bits (448),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 132/171 (77%), Gaps = 6/171 (4%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            VLITGVS+GLG+ALALELA RGHTIIGCSR Q KL+SL  +L++ S       N+H   K
Sbjct  3    VLITGVSKGLGRALALELANRGHTIIGCSRDQIKLDSLQQQLSNTS------PNRHFFFK  56

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            +DV S++ V+E A  V +N  +P I+VNNAG  +R+ ++WE+ AE+FDNVIDTNVKG+AN
Sbjct  57   LDVTSDTHVQEFAQFVAKNNLVPRILVNNAGLAHRSAKIWELEAEEFDNVIDTNVKGIAN  116

Query  468  VLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            +LRHF+PLMI    GIIVN+SSG GRSA    APYC+SKWA+EGLTK +AK
Sbjct  117  ILRHFVPLMIQNNNGIIVNMSSGAGRSAHEDFAPYCSSKWAVEGLTKCVAK  167



>ref|XP_004159599.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized oxidoreductase 
YxbG-like [Cucumis sativus]
Length=260

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 141/185 (76%), Gaps = 7/185 (4%)
 Frame = +3

Query  69   EELSMSAPGAH-KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasas  245
            E ++++ P +  + VLITGVS+GLG+ALALELA RGHTIIGCSR Q KL+SL  +L++ S
Sbjct  13   ESMAVAEPSSCCRKVLITGVSKGLGRALALELANRGHTIIGCSRDQVKLDSLQQQLSTTS  72

Query  246  sstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAED  425
                   N+H   K+DV+S+++V+E A  V +   +P I+VNNAG  +++ ++WE+ AE+
Sbjct  73   L------NQHFFFKLDVKSDNNVQEFAQFVAKTTXVPHILVNNAGLAHKSAKIWELDAEE  126

Query  426  FDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLT  605
            FDNVIDTNVKG+AN+LRHFIPLMI    GIIVN+SSG GRSA    APYC+SKWA+EGL+
Sbjct  127  FDNVIDTNVKGIANILRHFIPLMIQNNNGIIVNMSSGAGRSAHEDFAPYCSSKWAVEGLS  186

Query  606  KSIAK  620
            K IAK
Sbjct  187  KCIAK  191



>gb|KGN49563.1| hypothetical protein Csa_5G002580 [Cucumis sativus]
Length=192

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = +3

Query  300  SNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLRH  479
            S+S+V+E A  V+E K +PDI+VNNAGTIN+N+++WEVP E+FD V +TNVKG  N+LRH
Sbjct  30   SDSNVQEFARVVVERKGVPDIIVNNAGTINKNSKVWEVPPEEFDAVYETNVKGTVNILRH  89

Query  480  FIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            FIPLMI  K+GIIVN+SSGWGRS AA VAPYCASKWAIEGLT+S+AKE
Sbjct  90   FIPLMIPSKKGIIVNMSSGWGRSGAALVAPYCASKWAIEGLTRSVAKE  137



>ref|XP_003606948.1| Dehydrogenase/reductase SDR family member [Medicago truncatula]
 gb|AES89145.1| 3-oxoacyl-[acyl-carrier] reductase FabG-like protein [Medicago 
truncatula]
Length=257

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 113/155 (73%), Gaps = 13/155 (8%)
 Frame = +3

Query  174  HTIIGCSRSQDKlnslhaelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSI  353
            HTIIGCS  QDKL+ L ++L +         N HL + +DVR N+ VEE+A   ME    
Sbjct  52   HTIIGCSCDQDKLDFLQSQLPN--------NNHHLFLNIDVRCNNRVEEMACIFMEKNGG  103

Query  354  P-DIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQ----GII  518
            P DI+VN AG +N+NN++WEVP+E+FD V+DTN+KG ANVLR FIPLM+  K+    GII
Sbjct  104  PSDIIVNGAGVVNKNNKMWEVPSEEFDLVMDTNLKGAANVLRPFIPLMVKNKKYEEGGII  163

Query  519  VNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            VN+SSGWGRS AA VAPYC SKWAIEGLTKS+ +E
Sbjct  164  VNMSSGWGRSVAALVAPYCVSKWAIEGLTKSVVEE  198



>ref|XP_008450668.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like [Cucumis 
melo]
Length=249

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 136/188 (72%), Gaps = 8/188 (4%)
 Frame = +3

Query  69   EELSMSAPGAHKTVLITGVSrglgkalalelakrg-HTIIGCSRSQDKlnslhaelasas  245
            E  S +   + K +LITGVS+GLG+ALALELA    HT+IGCSR Q KL+SLH +L+  S
Sbjct  7    EAYSSTMAVSKKVILITGVSKGLGRALALELATTYGHTVIGCSRDQTKLDSLHLQLSGVS  66

Query  246  sstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAED  425
             +       HL++ VDVR N SVEE A  V EN+ +PDI+VNNAG +N+   +WE+  +D
Sbjct  67   PNA-----NHLLLNVDVRCNRSVEEFARIVKENELVPDIIVNNAGVVNKQGNMWEIDVQD  121

Query  426  FDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGR--SAAAQVAPYCASKWAIEG  599
            FDNVIDTN+KG AN+LRHFIPLMI   +GIIVN+SS  GR  +    +APYCASKW IEG
Sbjct  122  FDNVIDTNIKGSANILRHFIPLMIPYNKGIIVNMSSDAGRDNTPYKMIAPYCASKWGIEG  181

Query  600  LTKSIAKE  623
            ++KSIA+E
Sbjct  182  MSKSIAQE  189



>ref|XP_008460601.1| PREDICTED: dehydrogenase/reductase SDR family member 7-like [Cucumis 
melo]
Length=250

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 132/172 (77%), Gaps = 6/172 (3%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            +LITGVSRGLG++L LELAK GHTI+GCSR+ D L+SL  +L+S S+       +HL++ 
Sbjct  18   ILITGVSRGLGRSLGLELAKLGHTIVGCSRNHDTLHSLQTQLSSVST------KQHLLLN  71

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            +DV SNS VE+L  AV++   IPDI+VNNAG  N  ++ WE+P ++FD+VIDTN+KG AN
Sbjct  72   LDVTSNSGVEDLLQAVLQTNLIPDILVNNAGIANEKSKFWEIPQKEFDSVIDTNIKGTAN  131

Query  468  VLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            VLRHFIP MI +++ IIVN+SS WGR  A   +PY ASKW IEGLTKSIA+E
Sbjct  132  VLRHFIPPMIAREKKIIVNMSSLWGRIGAPMFSPYSASKWGIEGLTKSIAEE  183



>gb|KGN66095.1| hypothetical protein Csa_1G570200 [Cucumis sativus]
Length=243

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 134/191 (70%), Gaps = 7/191 (4%)
 Frame = +3

Query  57   TVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaela  236
            T   ++ S +     K VLITGVS+G+G+ALALELA  GHT+IGCSR Q KL+SL  +L+
Sbjct  3    TTTTDKASSTMAAVSKKVLITGVSKGIGRALALELATYGHTVIGCSRDQTKLDSLQLQLS  62

Query  237  sassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVP  416
              S         HL++ VDV+ N SVEE A  V+EN+ +PDI+VNNAG +N+   +WE+ 
Sbjct  63   KVSPIV-----NHLLLSVDVKCNRSVEEFARTVVENELVPDIIVNNAGVVNKVGNMWEID  117

Query  417  AEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGR--SAAAQVAPYCASKWA  590
             +DFD VID N+KG +N+LRHFIPLMI   QGIIVN+SS  GR  +    VAPYCASKW 
Sbjct  118  VQDFDTVIDINIKGTSNILRHFIPLMIPHNQGIIVNISSLCGRDNNQYKSVAPYCASKWG  177

Query  591  IEGLTKSIAKE  623
            IEGL+K IA+E
Sbjct  178  IEGLSKCIAQE  188



>ref|XP_004169584.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like, 
partial [Cucumis sativus]
Length=224

 Score =   171 bits (433),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 129/176 (73%), Gaps = 7/176 (4%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K VLITGVS+G+G+ALALELA  GHT+IGCSR Q KL+SL  +L+  S         HL+
Sbjct  18   KKVLITGVSKGIGRALALELATYGHTVIGCSRDQTKLDSLQLQLSKVSPIV-----NHLL  72

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + VDV+ N SVEE A  V+EN+ +PDI+VNNAG +N+   +WE+  +DFD VID N+KG 
Sbjct  73   LSVDVKCNRSVEEFARTVVENELVPDIIVNNAGVVNKVGNMWEIDVQDFDTVIDINIKGT  132

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGR--SAAAQVAPYCASKWAIEGLTKSIAKE  623
            +N+LRHFIPLMI   QGIIVN+SS  GR  +    VAPYCASKW IEGL+K IA+E
Sbjct  133  SNILRHFIPLMIPHNQGIIVNISSLCGRDNNQYKSVAPYCASKWGIEGLSKCIAQE  188



>ref|XP_008464746.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like [Cucumis 
melo]
Length=234

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 125/174 (72%), Gaps = 6/174 (3%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGVS+GLG+ALALELA   HTIIGCSR Q KL+SL   L + S       N H +
Sbjct  5    KKILITGVSKGLGRALALELANLNHTIIGCSRDQSKLDSLKPLLFNFS------SNPHFL  58

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV SNSSVE  A AV+EN  +PDI+VNN+    R  ++WE   E+ DNVI+TNVKG 
Sbjct  59   FNVDVTSNSSVEMFAQAVVENNLVPDIIVNNSALACRKCKIWETEVEEVDNVINTNVKGT  118

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             N++RHFIPLMI  KQGII+N+SS  GR+A  + A YC+SKWA+EGL+K +AKE
Sbjct  119  INIMRHFIPLMIHNKQGIIINMSSDAGRAAHGEYALYCSSKWAVEGLSKCVAKE  172



>ref|XP_004156156.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=318

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 132/174 (76%), Gaps = 6/174 (3%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGVSRGLG+ LALELAK GHTI+GCSR+ + L+SL  +L+S S+       +HL+
Sbjct  83   KRLLITGVSRGLGRGLALELAKLGHTIVGCSRNHNTLHSLQTQLSSIST------KQHLL  136

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + +DV SNS VE+L  AV++   IPDI+VNNA  +N  ++ WE+P +DFD+VIDTN+KG 
Sbjct  137  LNLDVTSNSGVEDLLQAVLQTNLIPDILVNNAAVVNEKSKFWEIPQKDFDSVIDTNIKGT  196

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIP MI +++ IIVN+SS WGR  A   + Y ASKW IEGLTKSIA+E
Sbjct  197  ANVLRHFIPPMIAREKKIIVNMSSLWGRIGAPMFSSYSASKWGIEGLTKSIAEE  250



>gb|KGN49700.1| hypothetical protein Csa_5G077190 [Cucumis sativus]
Length=252

 Score =   166 bits (421),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 130/172 (76%), Gaps = 6/172 (3%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            VLITGVSRGLG+ LALELAK GHTI+GCSR+ + L+SL  +L+S S+       +HL++ 
Sbjct  19   VLITGVSRGLGRGLALELAKLGHTIVGCSRNHNTLHSLQTQLSSIST------KQHLLLN  72

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            +DV SNS VE+L  AV++   IPDI+VNNA   N  ++ WE+P +DFD+VIDTN+KG AN
Sbjct  73   LDVTSNSGVEDLLQAVLQTNLIPDILVNNAAIANEKSKFWEIPQKDFDSVIDTNIKGTAN  132

Query  468  VLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            VLRHFIP MI +++ IIVN+SS WGR  A   + Y ASKW IEGLTKSIA+E
Sbjct  133  VLRHFIPPMIAREKKIIVNMSSLWGRIGAPMFSSYSASKWGIEGLTKSIAEE  184



>gb|KGN49575.1| hypothetical protein Csa_5G011650 [Cucumis sativus]
Length=249

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 132/174 (76%), Gaps = 6/174 (3%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++I+GVSRGLG+ALALELAK GHTIIGCSR + KL+SL  +L++AS         HL+
Sbjct  38   KVIVISGVSRGLGRALALELAKLGHTIIGCSRDKIKLDSLQLQLSNAS------PRNHLL  91

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
               DV+SN S+ E+A  V E     DI+VNNA  +  N +LWE+P E FD+VIDTN+KGV
Sbjct  92   FNFDVKSNESIREMAQTVKEKFGSVDIIVNNAAVVAENLKLWEIPNEIFDDVIDTNMKGV  151

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+LRHFIPLM+ K +GIIVN+SS +GR AAA+ + YC+SKW IEGL+KS+AKE
Sbjct  152  ANMLRHFIPLMLPKNKGIIVNVSSLYGRIAAARASAYCSSKWGIEGLSKSVAKE  205



>ref|XP_004142297.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
 ref|XP_004170287.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
 gb|KGN49693.1| hypothetical protein Csa_5G070680 [Cucumis sativus]
Length=243

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 131/181 (72%), Gaps = 6/181 (3%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            M+   + K +LITGVS+GLG+ALALELAKRGHTIIGCSR+Q KL+ L    ++       
Sbjct  1    MAEENSGKKILITGVSQGLGRALALELAKRGHTIIGCSRNQTKLDLLQPIFSNIPPY---  57

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
                HL++ +DV+ +  V+E    ++E   +PDI+VNNA  IN   ++WE+  E+FD+VI
Sbjct  58   ---NHLLLNLDVKLDDKVKETLEIIVEKIGVPDIIVNNAAMINVKAKIWEISREEFDDVI  114

Query  441  DTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            DTN+KG AN+LRHFIPL++ K +GIIVN+SS +GR     V+PYC+SKW IEGL+KSIAK
Sbjct  115  DTNIKGTANILRHFIPLLLPKNKGIIVNISSIFGRMGVPLVSPYCSSKWGIEGLSKSIAK  174

Query  621  E  623
            E
Sbjct  175  E  175



>ref|XP_004149629.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
 ref|XP_004159606.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=268

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 132/174 (76%), Gaps = 6/174 (3%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++I+GVSRGLG+ALALELAK GHTIIGCSR + KL+SL  +L++AS         HL+
Sbjct  32   KVIVISGVSRGLGRALALELAKLGHTIIGCSRDKIKLDSLQLQLSNAS------PRNHLL  85

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
               DV+SN S+ E+A  V E     DI+VNNA  +  N +LWE+P E FD+VIDTN+KGV
Sbjct  86   FNFDVKSNESIREMAQTVKEKFGSVDIIVNNAAVVAENLKLWEIPNEIFDDVIDTNMKGV  145

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+LRHFIPLM+ K +GIIVN+SS +GR AAA+ + YC+SKW IEGL+KS+AKE
Sbjct  146  ANMLRHFIPLMLPKNKGIIVNVSSLYGRIAAARASAYCSSKWGIEGLSKSVAKE  199



>ref|XP_008464743.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like isoform 
X4 [Cucumis melo]
Length=232

 Score =   163 bits (412),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 128/171 (75%), Gaps = 10/171 (6%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            VLITGVS+GLG+ALALELA RGHTIIGCSR Q KL+SL  +L++ S       N+H   K
Sbjct  3    VLITGVSKGLGRALALELANRGHTIIGCSRDQIKLDSLQQQLSNTS------PNRHFFFK  56

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            +DV S++ V+E A  V +N  +P I+    G  +R+ ++WE+ AE+FDNVIDTNVKG+AN
Sbjct  57   LDVTSDTHVQEFAQFVAKNNLVPRIL----GLAHRSAKIWELEAEEFDNVIDTNVKGIAN  112

Query  468  VLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            +LRHF+PLMI    GIIVN+SSG GRSA    APYC+SKWA+EGLTK +AK
Sbjct  113  ILRHFVPLMIQNNNGIIVNMSSGAGRSAHEDFAPYCSSKWAVEGLTKCVAK  163



>ref|XP_008464741.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like isoform 
X2 [Cucumis melo]
Length=270

 Score =   164 bits (414),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 128/171 (75%), Gaps = 10/171 (6%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            VLITGVS+GLG+ALALELA RGHTIIGCSR Q KL+SL  +L++ S       N+H   K
Sbjct  3    VLITGVSKGLGRALALELANRGHTIIGCSRDQIKLDSLQQQLSNTS------PNRHFFFK  56

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            +DV S++ V+E A  V +N  +P I+    G  +R+ ++WE+ AE+FDNVIDTNVKG+AN
Sbjct  57   LDVTSDTHVQEFAQFVAKNNLVPRIL----GLAHRSAKIWELEAEEFDNVIDTNVKGIAN  112

Query  468  VLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            +LRHF+PLMI    GIIVN+SSG GRSA    APYC+SKWA+EGLTK +AK
Sbjct  113  ILRHFVPLMIQNNNGIIVNMSSGAGRSAHEDFAPYCSSKWAVEGLTKCVAK  163



>ref|WP_015155074.1| short-chain dehydrogenase/reductase SDR [Chroococcidiopsis thermalis]
 gb|AFY88528.1| short-chain dehydrogenase/reductase SDR [Chroococcidiopsis thermalis 
PCC 7203]
Length=227

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 118/174 (68%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGVSRGLG A+     + GHT++GC+RS+          A+ +  +    + H  
Sbjct  3    KLIVITGVSRGLGLAMTEGFIQAGHTVVGCARSE----------AAVAKLSQQYNSPHDF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            M VDV  N  V+  A  V+    +PD+++NNA  IN    LW++P E+FD +ID N+KGV
Sbjct  53   MVVDVADNQQVKTWAEQVLSRHGVPDLLINNAAIINPLAPLWQIPVEEFDRLIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+RHF+P M +K +GIIVNLSSGWGRS + +VA YCASKWAIEGLT+S+A+E
Sbjct  113  ANVIRHFVPAMKEKNRGIIVNLSSGWGRSTSPEVASYCASKWAIEGLTRSLAQE  166



>ref|WP_009631629.1| dehydrogenase of unknown specificity [Synechocystis sp. PCC 7509]
Length=227

 Score =   160 bits (404),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 118/174 (68%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGVSRGLG A+A +  ++ +T+IGC+RS             A        + H  
Sbjct  3    KLILITGVSRGLGLAMAEQFVQKKYTVIGCTRSPS----------VAEKLQQKFGSPHKF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV ++S V+  A+ V+   S PD+++NNAG IN+   LW++ A++ D +ID N+KGV
Sbjct  53   TAVDVSNDSQVKTWANQVLTQYSPPDLLINNAGLINQLASLWQISADECDRIIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+RHF+P M++K  G+IVN SSGWGRS + QVAPYCASKWAIEGLT+S+A+E
Sbjct  113  TNVIRHFVPAMVEKNNGVIVNFSSGWGRSTSPQVAPYCASKWAIEGLTRSLAQE  166



>ref|WP_009785739.1| oxidoreductase [Lyngbya sp. PCC 8106]
 gb|EAW35777.1| hypothetical protein L8106_28256 [Lyngbya sp. PCC 8106]
Length=227

 Score =   160 bits (404),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 117/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            KT++ITGVSRGLG+A+  +  + GHT+IGC+RS++          +           H  
Sbjct  3    KTIVITGVSRGLGQAMTEDFIELGHTVIGCARSRE----------AIKELNQKYGKPHHF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV   + V+  A   +   S PDI++NNA  +NR   LWEVP+E+F  +ID N+KGV
Sbjct  53   TVVDVTDENQVKTWAKDFLSKVSAPDILINNAALVNRLAPLWEVPSEEFSQLIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             +V+RH +P MI +KQGI++NLSSGWGRS + QVAPYCASKWAIEGLT+++A+E
Sbjct  113  THVIRHVLPAMIARKQGIVINLSSGWGRSTSPQVAPYCASKWAIEGLTQALAQE  166



>ref|XP_004142335.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=245

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  174  HTIIGCSRSQDKlnslhaelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSI  353
            HTI+GCSR+ + L+SL  +L+S S+       +HL++ +DV SNS VE+L  AV++   I
Sbjct  34   HTIVGCSRNHNTLHSLQTQLSSIST------KQHLLLNLDVTSNSGVEDLLQAVLQTNLI  87

Query  354  PDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSS  533
            PDI+VNNA   N  ++ WE+P +DFD+VIDTN+KG ANVLRHFIP MI +++ IIVN+SS
Sbjct  88   PDILVNNAAIANEKSKFWEIPQKDFDSVIDTNIKGTANVLRHFIPPMIAREKKIIVNMSS  147

Query  534  GWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             WGR  A   + Y ASKW IEGLTKSIA+E
Sbjct  148  LWGRIGAPMFSSYSASKWGIEGLTKSIAEE  177



>gb|KGN49666.1| hypothetical protein Csa_5G054570 [Cucumis sativus]
Length=236

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 123/174 (71%), Gaps = 6/174 (3%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K VLITGV +GLG+AL +ELAK GH IIGCSRSQ  LNSL   L + S       + HL+
Sbjct  2    KKVLITGVGKGLGRALGIELAKFGHIIIGCSRSQTNLNSLKQHLLNIS------SHNHLL  55

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + +DV  + SV+E+   V+E   IPDI+VNNAG IN+  ++WE+P E+FD VID N+KG 
Sbjct  56   LNIDVSCDDSVKEMTRIVVEKIGIPDIIVNNAGVINKKGKIWEIPREEFDKVIDINIKGT  115

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLMI   +GIIVN+S+          +PYC+SKWA EGL+KS+AKE
Sbjct  116  ANVLRHFIPLMIPINKGIIVNISAIVATFGVPMASPYCSSKWATEGLSKSVAKE  169



>ref|WP_010996048.1| oxidoreductase [Nostoc sp. PCC 7120]
 dbj|BAB73583.1| all1884 [Nostoc sp. PCC 7120]
Length=227

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 114/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGVSRGLG AL     + GHTIIGC+RSQ           +    +    + H  
Sbjct  3    KLILITGVSRGLGYALTERFIQEGHTIIGCARSQ----------VTVEKLSHKFGSPHNF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + VDV   + V+  A  +++    PDI++NNA   N+   LWEVP+ DF  +ID N+KGV
Sbjct  53   VAVDVADEAQVKAWAELILKEYEPPDILINNAAIANQPAPLWEVPSTDFSQLIDINIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             +++R+FIP M+ K+ GII+NLSSGWGRS +  VAPYCASKWAIEGLT+++A+E
Sbjct  113  VHIIRYFIPAMVQKRHGIIINLSSGWGRSTSPLVAPYCASKWAIEGLTRALAQE  166



>ref|WP_011321438.1| oxidoreductase [Anabaena variabilis]
 gb|ABA24377.1| Short-chain dehydrogenase/reductase SDR [Anabaena variabilis 
ATCC 29413]
Length=227

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGVSRGLG AL     + GHTIIGC+RSQ           +    +    + H  
Sbjct  3    KLILITGVSRGLGYALTERFIQEGHTIIGCARSQ----------VTVEKLSHKFGSPHNF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV   + V+  A  +++    PD+++NNA   N+   LWEVP+ DF  +ID N+KGV
Sbjct  53   AAVDVADEAQVKAWAELILKEYEPPDLLINNAAIANQPAPLWEVPSTDFSQLIDINIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             +++RHF+P M+ K+ GII+NLSSGWGRS +  VAPYCASKWAIEGLT+++A+E
Sbjct  113  VHIIRHFVPAMVQKRHGIIINLSSGWGRSTSPLVAPYCASKWAIEGLTRALAQE  166



>ref|WP_015222120.1| short-chain dehydrogenase/reductase SDR [Cyanobacterium stanieri]
 gb|AFZ46802.1| short-chain dehydrogenase/reductase SDR [Cyanobacterium stanieri 
PCC 7202]
Length=222

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 119/174 (68%), Gaps = 14/174 (8%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            KT+LITGVS+GLGKAL  +    GHTIIGC+RS + +  L  +             +H  
Sbjct  3    KTILITGVSKGLGKALTEKFIPLGHTIIGCARSYNTIKELQHKYP-----------EHYF  51

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              V+V     V++   ++ +   IPD+V+NNA  IN+   LWE+  EDFD +ID N+KG 
Sbjct  52   SPVNVAHYQEVKKWLKSLPQ---IPDLVINNAALINQPAPLWEISTEDFDQLIDVNIKGT  108

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN++R  +PLM++KK+GIIVNLSSGWGRS + +VAPYCASKWAIEGLTK++A+E
Sbjct  109  ANIIRAIVPLMMNKKEGIIVNLSSGWGRSTSPEVAPYCASKWAIEGLTKALAQE  162



>ref|WP_015227788.1| short-chain dehydrogenase/reductase SDR [Halothece sp. PCC 7418]
 gb|AFZ45917.1| short-chain dehydrogenase/reductase SDR [Halothece sp. PCC 7418]
Length=227

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 111/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGVS+GLG+A+A      G T++GC+R++           +      +    H  
Sbjct  3    KRILITGVSQGLGRAMAENFIAEGCTVVGCARNE----------TAIQDLNQTYGKPHSF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV   + VE+    ++ N   PD+VVNNA  IN++   W VP  +FD +ID N+KGV
Sbjct  53   TAVDVSDEAQVEQWKDQLLANYDPPDLVVNNAALINQSTEFWNVPTAEFDQIIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+R F+P M+ KKQGIIVN SSGWGRS +  VAPYC +KWAIEGLT++IA+E
Sbjct  113  ANVMRQFLPAMMAKKQGIIVNFSSGWGRSTSPHVAPYCTTKWAIEGLTRAIAQE  166



>ref|WP_023068200.1| short chain dehydrogenase family protein [Lyngbya aestuarii]
 gb|ERT05554.1| short chain dehydrogenase family protein [Lyngbya aestuarii BL 
J]
Length=227

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGVSRGLG+A+  +  + GHT+IGC+RS++          +           H  
Sbjct  3    KIIVITGVSRGLGQAMTEDFIELGHTVIGCARSRE----------AIKELNQKYGKPHHF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV   + V+  A   +   S PDI++NNA  +N    LWEVP+E+F  +ID N+KGV
Sbjct  53   TVVDVTDENQVKTWAKEFLSKVSAPDILINNAALVNNLAPLWEVPSEEFSQLIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             +V+RH +P MI +KQGI++NLSSGWGRS + QVAPYCASKWAIEGLT+++A+E
Sbjct  113  THVIRHVLPAMIARKQGIVINLSSGWGRSTSPQVAPYCASKWAIEGLTQALAQE  166



>ref|XP_008465557.1| PREDICTED: zerumbone synthase-like [Cucumis melo]
Length=236

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 123/174 (71%), Gaps = 6/174 (3%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K VLITGV +GLG+AL +ELAK GH IIGCSRSQ  LNSL   L + S       + H +
Sbjct  2    KKVLITGVGKGLGRALGIELAKFGHIIIGCSRSQTNLNSLKQHLLNIS------PHNHCL  55

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            + +DV  + SV+E+A  V++   +PDI+VNNAG IN+  ++WE+P E+F+ VID N+KG 
Sbjct  56   LNIDVSCDDSVKEMARIVVQQIGVPDIIVNNAGVINKKGKIWEIPKEEFEKVIDINIKGT  115

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHFIPLMI   + IIVN+SS          +PYC+SKWA+EGL+KS+AKE
Sbjct  116  ANVLRHFIPLMIPINKAIIVNMSSVMATIGVPMASPYCSSKWAMEGLSKSVAKE  169



>gb|EDL58891.1| Short-chain dehydrogenase/reductase SDR [Planctomyces maris DSM 
8797]
Length=232

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 117/181 (65%), Gaps = 10/181 (6%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            MS     K ++ITGV++GLG+A+   L   GHT+ GC RS DK++ L  +          
Sbjct  1    MSKASMSKVIVITGVTQGLGRAMTQALIAAGHTVAGCGRSADKISELTEQFG--------  52

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
                H    VDV  + +VE  A  +++    PD+++NNA  IN N  LWE+ A++ D +I
Sbjct  53   --TTHHFSAVDVADDRAVENWATTIIDQLGPPDLLLNNAAVINENAPLWEISADEIDQII  110

Query  441  DTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            D N+KG  N +RHF+P M+ ++ G+IVN SSGWGRSA+A+VA YCA+KWAIEGLT+S+A+
Sbjct  111  DVNIKGTINTIRHFVPAMVARQSGVIVNFSSGWGRSASAEVASYCATKWAIEGLTQSLAQ  170

Query  621  E  623
            E
Sbjct  171  E  171



>ref|XP_001639338.1| predicted protein [Nematostella vectensis]
 gb|EDO47275.1| predicted protein [Nematostella vectensis]
Length=236

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 122/182 (67%), Gaps = 8/182 (4%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            M+     + V+ITGVS GLG A+       GHT+IGC+RS DK+  ++ E AS       
Sbjct  1    MATSREREVVVITGVSYGLGLAMVKWFNANGHTVIGCARSHDKIEKINEEFASG------  54

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
             + K     VD+ ++ +V++ +  VM +   P +++NN+G  N+N   WEVP E+F+ V+
Sbjct  55   -KEKRQFYVVDISNDEAVKQWSQQVMLDFGAPSLLINNSGVTNKNANFWEVPTEEFNKVV  113

Query  441  DTNVKGVANVLRHFIPLMID-KKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIA  617
            D N+KG ANVLRHF+P MI+ K++G+IVN +SGWGR  A +VAPYC +KWA+EGL+K++A
Sbjct  114  DINIKGTANVLRHFLPSMIEAKRKGVIVNFTSGWGRCVAPEVAPYCTTKWALEGLSKALA  173

Query  618  KE  623
            +E
Sbjct  174  EE  175



>ref|WP_041398487.1| oxidoreductase [Planctomyces brasiliensis]
Length=224

 Score =   154 bits (390),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITG +RGLG+AL       GH ++GC R+Q  ++SL  +  +           H  
Sbjct  2    KKILITGCTRGLGRALVDRFTDMGHVVVGCGRTQADIDSLSRKYGA----------PHRF  51

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
             ++DV    +V++ A  +  +  +PD+++NN G IN+N  LWEVPA++FDNVI+ NVKGV
Sbjct  52   DRIDVSDRDAVQQWAAELAGDNFVPDLLINNGGVINQNAALWEVPADEFDNVINVNVKGV  111

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLR FIP M+    G+IVN+SSGWGRS + +VAPY  SKWAIEGLTK++A E
Sbjct  112  ANVLRSFIPFMLPFANGVIVNISSGWGRSVSGEVAPYVCSKWAIEGLTKALAAE  165



>ref|WP_044238407.1| oxidoreductase [Planctomyces maris]
Length=227

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGV++GLG+A+   L   GHT+ GC RS DK++ L  +              H  
Sbjct  3    KVIVITGVTQGLGRAMTQALIAAGHTVAGCGRSADKISELTEQFG----------TTHHF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV  + +VE  A  +++    PD+++NNA  IN N  LWE+ A++ D +ID N+KG 
Sbjct  53   SAVDVADDRAVENWATTIIDQLGPPDLLLNNAAVINENAPLWEISADEIDQIIDVNIKGT  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             N +RHF+P M+ ++ G+IVN SSGWGRSA+A+VA YCA+KWAIEGLT+S+A+E
Sbjct  113  INTIRHFVPAMVARQSGVIVNFSSGWGRSASAEVASYCATKWAIEGLTQSLAQE  166



>gb|ADY61252.1| short-chain dehydrogenase/reductase SDR [Planctomyces brasiliensis 
DSM 5305]
Length=259

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITG +RGLG+AL       GH ++GC R+Q  ++SL  +  +           H  
Sbjct  37   KKILITGCTRGLGRALVDRFTDMGHVVVGCGRTQADIDSLSRKYGA----------PHRF  86

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
             ++DV    +V++ A  +  +  +PD+++NN G IN+N  LWEVPA++FDNVI+ NVKGV
Sbjct  87   DRIDVSDRDAVQQWAAELAGDNFVPDLLINNGGVINQNAALWEVPADEFDNVINVNVKGV  146

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLR FIP M+    G+IVN+SSGWGRS + +VAPY  SKWAIEGLTK++A E
Sbjct  147  ANVLRSFIPFMLPFANGVIVNISSGWGRSVSGEVAPYVCSKWAIEGLTKALAAE  200



>ref|WP_015183053.1| dehydrogenase [Microcoleus sp. PCC 7113]
 gb|AFZ18908.1| dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase 
like protein [Microcoleus sp. PCC 7113]
Length=227

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGVSRGLG+A+  +  + GHT++GC+RSQ          A+         + H  
Sbjct  3    KLIVITGVSRGLGQAMTEQFIQLGHTVVGCARSQ----------AAVEQLNEKFGSPHKF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV   + V   A  ++ +   PD+++NNA  IN    LWE+P+EDF  +ID N+KGV
Sbjct  53   TALDVADEAQVMNWAKQMLSDYEPPDLLINNAAMINHLAPLWEIPSEDFSRLIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            A+V+RH++P MI+K  GIIVN SSGWGRS + QVA YCASKWAIEGLT+S+A+E
Sbjct  113  AHVIRHWVPAMIEKGTGIIVNFSSGWGRSTSPQVASYCASKWAIEGLTRSLAQE  166



>ref|WP_017662369.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=229

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 117/175 (67%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K +++TGV+RGLG+A+     + GH + GC+R ++ + SL+ +              H 
Sbjct  4    QKHIVLTGVTRGLGRAMLEGFVEAGHVVYGCARDEEAIASLNQQFG----------RPHH  53

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               V+V  + SV + + AV+  +S PD++VNNAG IN    LWEVPA +FD V+D N+KG
Sbjct  54   FASVNVTDDDSVRQWSEAVLSQRSAPDLLVNNAGFINEPANLWEVPAAEFDRVVDVNLKG  113

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            VAN+LRHF+P M+ + +G+IVN SS WG + + QVAPYCA+KW IEGLT+S+++E
Sbjct  114  VANLLRHFVPAMVRRGEGVIVNFSSTWGHTTSPQVAPYCATKWGIEGLTRSLSQE  168



>ref|WP_006198503.1| oxidoreductase [Nodularia spumigena]
 gb|EAW43341.1| hypothetical protein N9414_06414 [Nodularia spumigena CCY9414]
 gb|AHJ28595.1| putative short-chain dehydrogenase [Nodularia spumigena CCY9414]
Length=227

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 111/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITG+S+GLG A+     + GHT IGC+RS               S   ++ N   +
Sbjct  3    KLILITGISKGLGYAMTERFIQEGHTFIGCARSS--------AAIEKLSQKFTAPNDFTV  54

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV+    VE+ A  V+     PDIV+NNA   N    LW+VPA++F  +ID N+KGV
Sbjct  55   --VDVKKEPQVEKWAKDVLSKYESPDIVINNAAITNYPAPLWQVPADEFSELIDINIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             N++ HF+P M+  K+GIIVN SSGWGRS + +VAPYCASKWAIEGLT+S+A+E
Sbjct  113  FNIIHHFVPAMVKNKRGIIVNFSSGWGRSTSPEVAPYCASKWAIEGLTRSLAQE  166



>ref|XP_001639339.1| predicted protein [Nematostella vectensis]
 gb|EDO47276.1| predicted protein [Nematostella vectensis]
Length=278

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 120/176 (68%), Gaps = 8/176 (5%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             + V+ITGVS GLG A+       GHT+IGC+RS DK+  ++ E AS        + K  
Sbjct  49   REVVVITGVSYGLGLAMVKWFNANGHTVIGCARSHDKIEKINEEFASG-------KEKRQ  101

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               VD+ ++ +V++ +  VM +   P +++NN+G  N+N   WEVP E+F+ V+D N+KG
Sbjct  102  FYVVDISNDEAVKQWSQQVMLDFGAPSLLINNSGVTNKNANFWEVPTEEFNKVVDINIKG  161

Query  459  VANVLRHFIPLMID-KKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             ANVLRHF+P MI+ K++G+IVN +SGWGR  A +VAPYC +KWA+EGL+K++A+E
Sbjct  162  TANVLRHFLPSMIEAKRKGVIVNFTSGWGRCVAPEVAPYCTTKWALEGLSKALAEE  217



>ref|WP_015170533.1| short-chain dehydrogenase/reductase SDR [Geitlerinema sp. PCC 
7407]
 gb|AFY64965.1| short-chain dehydrogenase/reductase SDR [Geitlerinema sp. PCC 
7407]
Length=229

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             + V+ITGVSRGLG+A+  E    GH ++GC ++ +    L A   +           H 
Sbjct  4    QRVVVITGVSRGLGRAMTEEFVLAGHQVLGCVQTPEAAAELQARFGA----------PHD  53

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               VDV     V+  A   +     PD+++NNAG IN    LWEVP+E+F+ VID N+KG
Sbjct  54   FAVVDVTEEDQVQAWAERAIAQYGPPDLLLNNAGVINHLAPLWEVPSEEFNRVIDVNIKG  113

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            VANV+RHF+P M D+  G+IVN SSGWGRS + +VAPYCASKWAIEGLT+S+A+E
Sbjct  114  VANVIRHFLPAMADRNSGVIVNFSSGWGRSTSPEVAPYCASKWAIEGLTQSLAQE  168



>ref|WP_015189582.1| short-chain dehydrogenase/reductase SDR [Gloeocapsa sp. PCC 7428]
 gb|AFZ31713.1| short-chain dehydrogenase/reductase SDR [Gloeocapsa sp. PCC 7428]
Length=227

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 117/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGVSRGLG A+     + GHT+IGC+RSQ  ++ L  +            + H  
Sbjct  3    KLIVITGVSRGLGLAMTEAFIQAGHTVIGCARSQTAVDKLRQQFG----------SPHSF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV  +  V + A  V+ +   PD+++NNAG IN+   LW+VPAE+F  VI  N+ GV
Sbjct  53   TVVDVAVDQQVADWAKHVLTSYEPPDLLLNNAGVINQLAPLWKVPAEEFARVIHVNIIGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+RHF+P MI +KQGIIVN SSGWGRS + QVAPYCASKWAIEGLT+S+A+E
Sbjct  113  TNVIRHFVPAMIQRKQGIIVNFSSGWGRSTSPQVAPYCASKWAIEGLTRSLAQE  166



>ref|WP_015243794.1| oxidoreductase [Singulisphaera acidiphila]
 gb|AGA24609.1| short-chain alcohol dehydrogenase [Singulisphaera acidiphila 
DSM 18658]
Length=232

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 117/177 (66%), Gaps = 10/177 (6%)
 Frame = +3

Query  93   GAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNK  272
            G  K +LITG +RGLG+A+A   A  GHT++GC R+   +  L  EL +           
Sbjct  4    GTRKIILITGATRGLGQAMAAGFAGLGHTVVGCGRTASAVEQLREELGA----------P  53

Query  273  HLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNV  452
            H    VDV  +  V+  A  V++    PD+++NNA  IN N  LW V A++FD V+D N+
Sbjct  54   HDFKAVDVADDGQVKAWATEVLKRFGPPDLLLNNAALINGNAPLWMVAADEFDRVVDVNL  113

Query  453  KGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            KGVANVLR F+P M++++ G+IVN SSGWGRS A +VAPYCA+KWAIEGLT+++A+E
Sbjct  114  KGVANVLRAFVPAMVERQSGVIVNFSSGWGRSTAPEVAPYCATKWAIEGLTRALAQE  170



>ref|WP_006622451.1| MULTISPECIES: oxidoreductase [Arthrospira]
 emb|CCE20030.1| Short-chain dehydrogenase/reductase SDR [Arthrospira sp. PCC 
8005]
 gb|EKD09643.1| putative short-chain dehydrogenase/reductase SDR [Arthrospira 
platensis C1]
 emb|CDM98532.1| Short-chain dehydrogenase/reductase SDR [Arthrospira sp. PCC 
8005]
Length=227

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGVSRGLG+ L       GHT+IGC+RS++ ++ L  +              H  
Sbjct  3    KIILITGVSRGLGRVLTESFIDLGHTVIGCARSREPIDLLTQKYG----------KPHNF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              V+V    +VE   + + +N   PDIV+NNA  IN    LWEVP  +F+ VID N+KGV
Sbjct  53   QVVNVEEPQAVENWINHLFKNYPAPDIVINNAAIINPLAPLWEVPPHEFNQVIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+R+ +P M+ +  GII+NLSSGWGRS + QVAPYC SKWAIEGLT+++A+E
Sbjct  113  ANVIRYLVPAMMKRGTGIIINLSSGWGRSTSPQVAPYCTSKWAIEGLTQALAQE  166



>ref|WP_012376707.1| oxidoreductase [Opitutus terrae]
 ref|YP_001820778.1| short-chain dehydrogenase/reductase SDR [Opitutus terrae PB90-1]
 gb|ACB77178.1| short-chain dehydrogenase/reductase SDR [Opitutus terrae PB90-1]
Length=228

 Score =   152 bits (385),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 116/172 (67%), Gaps = 10/172 (6%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            ++ITG +RGLG+ALA E  + GH +IGC R  +          +      + Q  H    
Sbjct  3    IVITGATRGLGRALAEEFIRGGHAVIGCGRGGE----------AIFDLRMAHQAPHDFSA  52

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            VDV  ++ V   A  V+EN++ PD+++NNAG +NR   LWE+   +F  V+D NV+GVAN
Sbjct  53   VDVAQDTKVAIWAAKVLENEAAPDLLINNAGVMNRLAPLWEIEDREFAKVLDVNVRGVAN  112

Query  468  VLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ++RHF+P M+ +KQG+IVN SSGWGRS + QVAPYCASK+AIEGLTK++A+E
Sbjct  113  MIRHFVPAMVARKQGVIVNFSSGWGRSTSPQVAPYCASKFAIEGLTKALAQE  164



>ref|WP_044205558.1| oxidoreductase [Coleofasciculus chthonoplastes]
Length=227

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 114/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGVSRGLG+A+      +GHT++GC+R++          A+      +    H  
Sbjct  3    KVIVITGVSRGLGRAMTEGFIAQGHTVLGCARNE----------AAIKDLNQAFGPPHNF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VD+     V   A  ++   S PD+++NNA  IN    LWE+P++DF ++ID N+KGV
Sbjct  53   TVVDIADEDQVMAWAKLLLNEYSPPDLLINNAAIINNLAPLWEIPSQDFSDLIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+RHFIP MID+  GIIVNLSSGWGRS + QV+ YC SKWAIEG+T+S+A+E
Sbjct  113  ANVIRHFIPAMIDRGSGIIVNLSSGWGRSTSPQVSSYCTSKWAIEGMTRSLAQE  166



>ref|WP_006670039.1| oxidoreductase [Arthrospira maxima]
 gb|EDZ93211.1| short-chain dehydrogenase/reductase SDR [Arthrospira maxima CS-328]
Length=227

 Score =   152 bits (384),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGVSRGLG+ L       GHT++GC+RS++ ++ L  +              H  
Sbjct  3    KIILITGVSRGLGRVLTESFIDLGHTVLGCARSREPIDLLTQKYG----------KPHNF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              V+V    +VE   + + +N   PDIV+NNA  IN    LWEVP  +F+ VID N+KGV
Sbjct  53   QVVNVEEPQAVENWINHLFKNYPAPDIVINNAAIINPLAPLWEVPPHEFNQVIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+R+ +P M+ +  GII+NLSSGWGRS + QVAPYC SKWAIEGLT+++A+E
Sbjct  113  ANVIRYLVPAMMKRGTGIIINLSSGWGRSTSPQVAPYCTSKWAIEGLTQALAQE  166



>dbj|BAI88001.1| short-chain dehydrogenase/reductase SDR [Arthrospira platensis 
NIES-39]
Length=228

 Score =   152 bits (383),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 114/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGVSRGLG+ L       GHT+IGC+RS + ++ L+ +              H  
Sbjct  4    KIILITGVSRGLGRVLTESFINLGHTVIGCARSPEPIDLLNQQYG----------KPHDF  53

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              V+V  + SVE   + +++N   PDIV+NNA  IN    LWEVP  +F+ VID N+KGV
Sbjct  54   QVVNVEDHQSVENWVNHLLKNYPAPDIVINNAAIINPLAPLWEVPPHEFNQVIDVNIKGV  113

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+R+ +P MI +  GII+NLSSGWGRS + QVA YC SKWAIEGLT+++A+E
Sbjct  114  ANVIRYLVPAMIKRGSGIIINLSSGWGRSTSPQVATYCTSKWAIEGLTQALAQE  167



>ref|WP_006617575.1| oxidoreductase [Arthrospira platensis]
 gb|KDR56359.1| oxidoreductase [Arthrospira platensis str. Paraca]
Length=227

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 114/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGVSRGLG+ L       GHT+IGC+RS + ++ L+ +              H  
Sbjct  3    KIILITGVSRGLGRVLTESFINLGHTVIGCARSPEPIDLLNQQYG----------KPHDF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              V+V  + SVE   + +++N   PDIV+NNA  IN    LWEVP  +F+ VID N+KGV
Sbjct  53   QVVNVEDHQSVENWVNHLLKNYPAPDIVINNAAIINPLAPLWEVPPHEFNQVIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+R+ +P MI +  GII+NLSSGWGRS + QVA YC SKWAIEGLT+++A+E
Sbjct  113  ANVIRYLVPAMIKRGSGIIINLSSGWGRSTSPQVATYCTSKWAIEGLTQALAQE  166



>gb|EDX77088.1| oxidoreductase, short chain dehydrogenase/reductase family [Coleofasciculus 
chthonoplastes PCC 7420]
Length=257

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 114/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGVSRGLG+A+      +GHT++GC+R++          A+      +    H  
Sbjct  33   KVIVITGVSRGLGRAMTEGFIAQGHTVLGCARNE----------AAIKDLNQAFGPPHNF  82

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VD+     V   A  ++   S PD+++NNA  IN    LWE+P++DF ++ID N+KGV
Sbjct  83   TVVDIADEDQVMAWAKLLLNEYSPPDLLINNAAIINNLAPLWEIPSQDFSDLIDVNIKGV  142

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+RHFIP MID+  GIIVNLSSGWGRS + QV+ YC SKWAIEG+T+S+A+E
Sbjct  143  ANVIRHFIPAMIDRGSGIIVNLSSGWGRSTSPQVSSYCTSKWAIEGMTRSLAQE  196



>ref|XP_004169583.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like isoform 
3 [Cucumis sativus]
Length=201

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 125/180 (69%), Gaps = 8/180 (4%)
 Frame = +3

Query  9    CSSQLRLKMTTLS-TPTTVNLEELSMSAPGAHKTVLITGVSrglgkalalelakrgHTII  185
            C S L  K +T +  PTT +    +M A    K VLITGVSRGLG+ALALELA  GHT+I
Sbjct  18   CLSSLSKKYSTSTMAPTTTDKASSTMVA--VSKKVLITGVSRGLGRALALELATYGHTVI  75

Query  186  GCSRSQDKlnslhaelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIV  365
            GCSR Q KL+SL  +L+  S +       HL++ +DV+ N SVEE A  VMEN+ IPDI+
Sbjct  76   GCSRDQTKLDSLQLQLSKVSPNA-----NHLLLSIDVKCNRSVEEFARTVMENELIPDII  130

Query  366  VNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGR  545
            VNNAG  N+ + +WE+  +DFDNVIDTN+KG  N+LRHFIPLMI   QGIIVN+SS  GR
Sbjct  131  VNNAGVANKRSNMWEIDVQDFDNVIDTNIKGTTNILRHFIPLMIPYNQGIIVNISSDAGR  190



>ref|WP_039716170.1| oxidoreductase [Scytonema millei]
 gb|KIF18659.1| oxidoreductase [Scytonema millei VB511283]
Length=227

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGVSRGLG A+     + GH ++GC+RS+          A+ +  +    + H  
Sbjct  3    KLIVITGVSRGLGLAMTEGFIQAGHAVVGCARSE----------AAVAKLSQQHNSPHDF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
            M V+V  N  V+  A  V+    +PD+++NNA  IN    LW++P E+ D +ID N+KGV
Sbjct  53   MVVNVADNQQVKTWAEQVLSRHGVPDLLINNAAIINPLAPLWQIPVEECDRLIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+RHF+P M +K +G+IVNLSSGWGRS + +VA YCASKWAIEGLT+S+A+E
Sbjct  113  VNVIRHFVPAMKEKNRGVIVNLSSGWGRSTSPEVATYCASKWAIEGLTRSLAQE  166



>ref|WP_011613345.1| oxidoreductase [Trichodesmium erythraeum]
 gb|ABG53015.1| short-chain dehydrogenase/reductase SDR [Trichodesmium erythraeum 
IMS101]
Length=226

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 117/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITG+SRGLG+A+  E    GHT+IGC+RS+           +  + T    N H  
Sbjct  3    KLIVITGISRGLGRAITEEFINLGHTVIGCARSKS----------AVENLTHKYSNSHQF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              V+V   ++V+E A   + N S PD+++NNA  IN+   LW+V +E+F  +ID N+KGV
Sbjct  53   SCVNVADENNVQEWAKYTLANYSAPDLLINNAAIINQPAPLWKVDSEEFSQLIDINIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R+F+P MI +  GIIVN+SSGWGRS++ QV PYCASKWAIEGLT ++++E
Sbjct  113  VNVIRYFVPAMISRGSGIIVNISSGWGRSSSPQVGPYCASKWAIEGLTGALSQE  166



>ref|WP_006633506.1| oxidoreductase [Microcoleus vaginatus]
 gb|EGK87195.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Microcoleus vaginatus 
FGP-2]
Length=227

 Score =   150 bits (379),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITG SRGLG A+  +  + GHT++GC+RS + +  L+ + ++           H  
Sbjct  3    KLIVITGASRGLGLAMTEKFIELGHTVVGCARSSESVEKLNQKHSA----------PHHF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV ++  V+  A  ++     PD+++NNAG +N    LW V  E+F  VID N+KG 
Sbjct  53   TCLDVTNDEQVKAWATEILAKNEPPDLLINNAGVVNHLAPLWNVSNEEFSQVIDVNIKGT  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+RHF+P MI +K GIIVN SSGWGRS + +VAPYCASKWAIEGLT+S+A+E
Sbjct  113  ANVIRHFVPAMIARKSGIIVNFSSGWGRSTSPEVAPYCASKWAIEGLTRSLAQE  166



>ref|XP_004154036.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like, partial 
[Cucumis sativus]
Length=149

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +3

Query  297  RSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLR  476
            + N SVEE A  VMEN+ IPDI+VNNAG  N+ + +WE+  +DFDNVIDTN+KG  N+LR
Sbjct  1    KCNRSVEEFARTVMENELIPDIIVNNAGVANKRSNMWEIDVQDFDNVIDTNIKGTTNILR  60

Query  477  HFIPLMIDKKQGIIVNLSSGWGRS--AAAQVAPYCASKWAIEGLTKSIAKE  623
            HFIPLMI   QGIIVN+SS  GR       +APYCASKW IEGL+K IA+E
Sbjct  61   HFIPLMIPYNQGIIVNISSDAGRDNIPYKSLAPYCASKWGIEGLSKCIAQE  111



>gb|KGN49694.1| hypothetical protein Csa_5G072680 [Cucumis sativus]
Length=249

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 131/173 (76%), Gaps = 7/173 (4%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            ++++GVS+G+G+ALALE AK GH I+GCSR+Q++L+SL   L++ SS T      HL++K
Sbjct  14   IVVSGVSKGIGRALALEFAKLGHIIVGCSRNQNQLDSLQHHLSTISSLT------HLLIK  67

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            VDV SN  V+ +A  V++    P I+VNNAG IN N ++WE   ++FDNVIDTN+KG AN
Sbjct  68   VDVSSNDEVKVMAETVLQKVGSPHIIVNNAGVINENVKMWEGCVKEFDNVIDTNIKGTAN  127

Query  468  VLRHFIPLMI-DKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V+R+FIP MI + K+GIIVN+SS +GR+ A QV+ Y  SKW IEGL+KS+AKE
Sbjct  128  VIRNFIPHMISNNKEGIIVNMSSIYGRTGAPQVSAYVCSKWGIEGLSKSLAKE  180



>ref|WP_020470937.1| hypothetical protein [Zavarzinella formosa]
Length=227

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 113/181 (62%), Gaps = 13/181 (7%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            MS P   K +++TG +RGLG+AL       GHT++GC R+  ++  L             
Sbjct  1    MSNP---KIIVLTGATRGLGRALVPRFVAAGHTVVGCGRNASQIAELKTLFG--------  49

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
              + H    +DV    SVE  A  V     IPD+++NNA  +N    LWEVPAEDFD V+
Sbjct  50   --SPHSFTAIDVTDAQSVEGWATGVFAKIGIPDLLINNAALMNDIAPLWEVPAEDFDQVV  107

Query  441  DTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            D N+KG ANV+R F+P M+++  G+IVNLSSGWGRS +  VAPYCASK+AIEG+T ++A+
Sbjct  108  DVNIKGPANVIRAFVPAMVERASGVIVNLSSGWGRSTSPNVAPYCASKYAIEGMTLALAQ  167

Query  621  E  623
            E
Sbjct  168  E  168



>ref|XP_004142298.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=257

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 131/173 (76%), Gaps = 7/173 (4%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            ++++GVS+G+G+ALALE AK GH I+GCSR+Q++L+SL   L++ SS T      HL++K
Sbjct  22   IVVSGVSKGIGRALALEFAKLGHIIVGCSRNQNQLDSLQHHLSTISSLT------HLLIK  75

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            VDV SN  V+ +A  V++    P I+VNNAG IN N ++WE   ++FDNVIDTN+KG AN
Sbjct  76   VDVSSNDEVKVMAETVLQKVGSPHIIVNNAGVINENVKMWEGCVKEFDNVIDTNIKGTAN  135

Query  468  VLRHFIPLMI-DKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V+R+FIP MI + K+GIIVN+SS +GR+ A QV+ Y  SKW IEGL+KS+AKE
Sbjct  136  VIRNFIPHMISNNKEGIIVNMSSIYGRTGAPQVSAYVCSKWGIEGLSKSLAKE  188



>ref|WP_015177499.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Oscillatoria nigro-viridis]
 gb|AFZ08248.1| 3-oxoacyl-(acyl-carrier-protein) reductase [Oscillatoria nigro-viridis 
PCC 7112]
Length=227

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 110/174 (63%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITG+SRGLG A+  +  + GHT++GC+RS           A+           H  
Sbjct  3    KLIVITGISRGLGLAMTEKFIELGHTVLGCARSS----------AAVEKLNQKYSTPHHF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV ++  V+  A  ++     PD+++NNAG  N    LW V  E+F  VID N+KG 
Sbjct  53   TCVDVTNDDRVKAWATEILAKNEPPDLLINNAGVANHLAPLWNVSNEEFSQVIDVNIKGT  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN +RHF+P MI +K GIIVNLSSGWGRS + +VAPYCASKWAIEGLT+S+A+E
Sbjct  113  ANAIRHFVPAMIARKSGIIVNLSSGWGRSTSPEVAPYCASKWAIEGLTRSLAQE  166



>ref|XP_004170843.1| PREDICTED: 3-oxoacyl-[acyl-carrier-protein] reductase FabG-like 
[Cucumis sativus]
Length=243

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 131/173 (76%), Gaps = 7/173 (4%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            ++++GVS+G+G+ALALE AK GH I+GCSR+Q++L+SL   L++ SS T      HL++K
Sbjct  22   IVVSGVSKGIGRALALEFAKLGHIIVGCSRNQNQLDSLQHHLSTISSLT------HLLIK  75

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            VDV SN  V+ +A  V++    P I+VNNAG IN N ++WE   ++FDNVIDTN+KG AN
Sbjct  76   VDVSSNDEVKVMAETVLQKVGSPHIIVNNAGVINENVKMWEGCVKEFDNVIDTNIKGTAN  135

Query  468  VLRHFIPLMI-DKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V+R+FIP MI + K+GIIVN+SS +GR+ A QV+ Y  SKW IEGL+KS+AKE
Sbjct  136  VIRNFIPHMISNNKEGIIVNMSSIYGRTGAPQVSAYVCSKWGIEGLSKSLAKE  188



>ref|WP_009783326.1| oxidoreductase [Lyngbya sp. PCC 8106]
 gb|EAW38068.1| Short-chain dehydrogenase/reductase SDR [Lyngbya sp. PCC 8106]
Length=229

 Score =   147 bits (371),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 110/174 (63%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGVSRGLG+A+     + GHT+IGCS +++ +  L  +              H  
Sbjct  3    KLILITGVSRGLGRAMTEAFIQLGHTVIGCSLNKEAIADLTQKFG----------EPHHF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              V++     V+  + A+      PD+++NNAG ++    LWE+  + FD VID N+KGV
Sbjct  53   TSVNIADEMQVKNWSQAISSKYDAPDLIINNAGIVHELAPLWEIEGQIFDRVIDINIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANVLRHF+P M+ K QG+IVN S+GWGR   A  APYCASKWAIEGLTK++++E
Sbjct  113  ANVLRHFLPQMLPKSQGVIVNFSAGWGRYTTANAAPYCASKWAIEGLTKALSQE  166



>ref|WP_041237617.1| oxidoreductase [Cyanothece sp. PCC 7424]
Length=229

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 117/181 (65%), Gaps = 11/181 (6%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            M+    ++ + ITGV++GLG+A+  +  ++GHTIIGC RSQ ++N L     S       
Sbjct  1    MNKQANNQLIAITGVTKGLGRAMVDQFIEKGHTIIGCGRSQQEINHLKTIYPS-------  53

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
                H    VDV     V++ A+ V+EN   P+ ++NNA  INR + LW +  E+F  +I
Sbjct  54   ----HHFFVVDVSDGKDVQQWANQVIENIGTPEYLINNAAIINRPDALWNITEEEFSQLI  109

Query  441  DTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            D N+KGVAN +R F+P MI+KK G+I+N SSGWGRS + +V PYC SKWAIEGL++ +++
Sbjct  110  DINIKGVANTIRAFLPAMIEKKSGMIINFSSGWGRSTSPEVVPYCTSKWAIEGLSQGLSQ  169

Query  621  E  623
            E
Sbjct  170  E  170



>ref|WP_007357715.1| MULTISPECIES: oxidoreductase [Kamptonema]
 emb|CBN58538.1| conserved hypothetical protein [ [[Oscillatoria] sp. PCC 6506]
Length=227

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 112/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGVSRGLG A+  +  + G+T+ GC+RS + +  L  +              H  
Sbjct  3    KIIVITGVSRGLGLAMTEKFIELGNTVCGCARSPEAVEKLKEKYGL----------PHHF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV + S V+  A  ++     PD+++NNA  IN    LW V  E+F N+ID N+KGV
Sbjct  53   TCVDVANESQVKSWAEQLLATCPPPDLLINNAAIINPLTPLWRVSNEEFSNLIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+R+FIP M+  K GIIVN SSGWGRS + +VAPYCASKWAIEGLT+S+A+E
Sbjct  113  ANVIRYFIPAMLLVKSGIIVNFSSGWGRSTSPEVAPYCASKWAIEGLTRSLAQE  166



>gb|ACK68785.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7424]
Length=246

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 116/181 (64%), Gaps = 11/181 (6%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            M+    ++ + ITGV++GLG+A+  +  ++GHTIIGC RSQ ++N L             
Sbjct  18   MNKQANNQLIAITGVTKGLGRAMVDQFIEKGHTIIGCGRSQQEINHLKTIYP--------  69

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
                H    VDV     V++ A+ V+EN   P+ ++NNA  INR + LW +  E+F  +I
Sbjct  70   ---SHHFFVVDVSDGKDVQQWANQVIENIGTPEYLINNAAIINRPDALWNITEEEFSQLI  126

Query  441  DTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            D N+KGVAN +R F+P MI+KK G+I+N SSGWGRS + +V PYC SKWAIEGL++ +++
Sbjct  127  DINIKGVANTIRAFLPAMIEKKSGMIINFSSGWGRSTSPEVVPYCTSKWAIEGLSQGLSQ  186

Query  621  E  623
            E
Sbjct  187  E  187



>ref|WP_007360508.1| oxidoreductase [Opitutaceae bacterium TAV1]
 gb|EIP97535.1| short-chain alcohol dehydrogenase [Opitutaceae bacterium TAV1]
Length=229

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 111/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGV+RGLGKALA E  + GHT+IGC RS + +  L     +           H  
Sbjct  4    KKILITGVTRGLGKALAEEFIRLGHTVIGCGRSAEGILDLRFAHGA----------PHRF  53

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV   S VE  +  ++ +   PD+++NNAG IN    LW+VPAE+F  VID N+KG 
Sbjct  54   DVLDVAGTSKVEVWSETLLTSHGAPDLLLNNAGLINSPAPLWKVPAEEFARVIDVNIKGP  113

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+ R F+P MI +  G+IVN SSGWGRS  A VAPYCASKWAIEG+T ++A E
Sbjct  114  ANLARAFLPAMIGRGSGVIVNFSSGWGRSVDANVAPYCASKWAIEGMTLALAAE  167



>ref|XP_001639337.1| predicted protein [Nematostella vectensis]
 gb|EDO47274.1| predicted protein [Nematostella vectensis]
Length=228

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 115/174 (66%), Gaps = 7/174 (4%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V ITGVS GLG AL    + +GHT++GC RS  K+  ++ +            N+  +
Sbjct  3    KIVAITGVSTGLGLALTKWFSSQGHTVVGCGRSAAKIAEMNEKYCGKGK-----PNQFYV  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VD+  +S V+E A  V ++   PD V+NNAG +N+N  LWE+ AE+FD V+D N+KG 
Sbjct  58   --VDITDDSVVKEWATNVCKSFGPPDFVLNNAGFVNQNAPLWEITAEEFDKVVDVNLKGS  115

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+R F+P MI   +G+IVN SSG+G++  A++APYCA+KW IEGLT+++A E
Sbjct  116  ANVIRSFLPKMIKAGKGVIVNFSSGYGKAGKAKMAPYCATKWGIEGLTRALAME  169



>ref|WP_009511827.1| oxidoreductase [Opitutaceae bacterium TAV5]
 gb|AHF91616.1| oxidoreductase [Opitutaceae bacterium TAV5]
Length=229

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 111/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +LITGV+RGLGKALA E  + GHT+IGC RS + +  L     +           H  
Sbjct  4    KKILITGVTRGLGKALAEEFIRLGHTVIGCGRSAEGILDLRFAHGA----------PHRF  53

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV   S VE  +  ++ +   PD+++NNAG IN    LW+VPAE+F  VID N+KG 
Sbjct  54   DVLDVAGTSKVEVWSETLLTSHGAPDLLLNNAGLINSPAPLWKVPAEEFARVIDVNIKGP  113

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN+ R F+P MI +  G+IVN SSGWGRS  A VAPYCASKWAIEG+T ++A E
Sbjct  114  ANLARAFLPAMIARGSGVIVNFSSGWGRSVDANVAPYCASKWAIEGMTLALAAE  167



>ref|WP_012912122.1| oxidoreductase [Pirellula staleyi]
 gb|ADB17860.1| short-chain dehydrogenase/reductase SDR [Pirellula staleyi DSM 
6068]
Length=229

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 110/174 (63%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            KT++ITGV+RGLG A+A   A  GHT+IGC R            +  +       ++H I
Sbjct  5    KTIVITGVTRGLGLAMARYFATHGHTVIGCGR----------LASLVAELQQELGSQHAI  54

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV    +V   A A +     PD+++N+A  IN NN LW VP ++F  V+D N+KGV
Sbjct  55   SVVDVTDERAVAAWAEASLAKFGAPDLLLNSAAIINANNSLWNVPTDEFSRVVDINIKGV  114

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             +V +HF P MI ++ G+IVN SSGWGRS +A+VAPYCA+K+AIEGLT ++A E
Sbjct  115  FHVTKHFAPAMIARQSGVIVNFSSGWGRSTSAEVAPYCATKYAIEGLTLALAAE  168



>ref|WP_013320495.1| oxidoreductase [Cyanothece sp. PCC 7822]
 gb|ADN12385.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. PCC 7822]
Length=231

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 115/175 (66%), Gaps = 11/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
            ++ ++ITGV++GLG+A+  +    GHT+IGC RS+ ++ +L                 H 
Sbjct  7    NQLIVITGVTKGLGRAMLDQFIALGHTVIGCGRSKAEIKNLCELYP-----------SHH  55

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               VDV   + V++ A+ V++N   PD ++NNA  INR   LW++   +F  +ID N+KG
Sbjct  56   FAVVDVTQGTEVQQWANQVIKNLGTPDYLINNAAIINRTAALWDISEAEFSQLIDINIKG  115

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            VAN +R F+P M+DKK G+I+N SS WGRS + +VAPYCASKWAIEGL++++++E
Sbjct  116  VANTIRAFLPAMLDKKAGMIINFSSEWGRSTSPEVAPYCASKWAIEGLSQTLSQE  170



>ref|WP_010583909.1| oxidoreductase [Schlesneria paludicola]
Length=231

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 112/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITG +RG G+A+    A+ GHT++GC R+            S         + H  
Sbjct  7    KVIVITGTTRGCGRAMVERFAEAGHTVVGCGRN----------TKSIQELRRQFPSPHRF  56

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV ++  V+  A +V++   IPD+++NNA  INR+  LW + A++F  VID N+ G 
Sbjct  57   DVVDVANDDQVQTWARSVLDANLIPDLLLNNAAVINRSAPLWTISAQEFQQVIDVNIAGT  116

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ANV+RHF+P MID+ +G IVN SSGWGR+ A  VAPYCA+K+AIEGL++++A+E
Sbjct  117  ANVIRHFLPSMIDRNRGTIVNFSSGWGRTTAPDVAPYCATKFAIEGLSQALAQE  170



>ref|WP_035992728.1| oxidoreductase [Leptolyngbya sp. KIOST-1]
Length=227

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 108/174 (62%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGVS+GLG+A+       GH + GC+R    +  L     +           H  
Sbjct  3    KHIVITGVSQGLGRAMVEGFVAEGHRVSGCARRSKAVADLATHYPA----------PHQF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV  +++V+  A A M+   +PD+V+NNAG +NR   LW VP ++ D VI  N+ GV
Sbjct  53   TAVDVCDDTAVQAWAEAAMDANGLPDLVINNAGLVNRPAPLWSVPVDECDAVIAVNLSGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+RHF P M++++ GI VN SSGWGRS +  VAPYCA+KW +EGLT+++A++
Sbjct  113  CNVIRHFAPPMVERRSGIFVNFSSGWGRSTSPGVAPYCATKWGVEGLTQALAQD  166



>ref|WP_022771528.1| short-chain alcohol dehydrogenase-like protein [Candidatus Symbiobacter 
mobilis]
 gb|AGX86707.1| short-chain alcohol dehydrogenase-like protein [Candidatus Symbiobacter 
mobilis CR]
Length=228

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 115/175 (66%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             + +++TG +RGLG+AL  EL   GHT+ GC R+   + +L A   +           H 
Sbjct  4    QRIIVLTGATRGLGRALLTELVAAGHTVAGCGRNARDIETLRATYPA----------PHS  53

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               VDVR++  V   A  V+++  +PD++VNNA  +N    LW+VPA +FD ++  NV G
Sbjct  54   FATVDVRNDDEVAAWAVEVLQSVGVPDLLVNNAALMNTPAPLWKVPASEFDTLMAVNVCG  113

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            VA V+RH +P M+  ++G+IVNLSSGWGRS ++ VAPYCASKWAIEGLTK++A+E
Sbjct  114  VATVIRHVVPAMVQNRRGVIVNLSSGWGRSVSSNVAPYCASKWAIEGLTKALAEE  168



>ref|XP_004151593.1| PREDICTED: oxidoreductase UcpA-like, partial [Cucumis sativus]
Length=147

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = +3

Query  297  RSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLR  476
            + N SV+E    V+EN+ +PDI+VNNAG +N+   +WE+  +DFD VID N+KG +N+LR
Sbjct  1    KCNRSVQEFVRTVVENELVPDIIVNNAGVVNKVGNMWEIDVQDFDTVIDINIKGTSNILR  60

Query  477  HFIPLMIDKKQGIIVNLSSGWGR--SAAAQVAPYCASKWAIEGLTKSIAKE  623
            HFIPLMI   QGIIVN+SS  GR  +    VAPYCASKW IEGL+K IA+E
Sbjct  61   HFIPLMIPHNQGIIVNISSLCGRDNNQYKSVAPYCASKWGIEGLSKCIAQE  111



>ref|WP_010477928.1| oxidoreductase [Acaryochloris sp. CCMEE 5410]
Length=226

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 108/174 (62%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            + ++ITGV++GLG+ALA+   + GHT+ GC R+           AS +       + H  
Sbjct  3    RKIVITGVTQGLGEALAIGFIQAGHTVWGCGRT----------TASINHLAQQYTSPHHF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV     V+  A  +++  + PDIV+NNAG IN    LWEVP  D  +V+D NVKG 
Sbjct  53   STVDVTQAQQVQAWADQLLQTDAPPDIVINNAGVINTVAPLWEVPEPDISDVLDVNVKGT  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             N++R F+P M  K QGII+N SSGWGRS +  VAPYCASKWAIEGL ++ A+E
Sbjct  113  INIIRSFLPSMKTKGQGIIINFSSGWGRSTSPGVAPYCASKWAIEGLNQAFAQE  166



>ref|WP_039723460.1| MULTISPECIES: oxidoreductase [Oscillatoriophycideae]
 gb|KIF26767.1| oxidoreductase [Aphanocapsa montana BDHKU210001]
 gb|KIF43568.1| oxidoreductase [Lyngbya confervoides BDU141951]
Length=227

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 109/172 (63%), Gaps = 10/172 (6%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            ++ITGVSRGLG+A+       GH + GC+R+ + + +L     +           HL   
Sbjct  5    IVITGVSRGLGRAMTEAFIAAGHRVSGCARNAEAIAALSTMYPA----------PHLFTT  54

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            +D+R + SV +    V+     PD+++NNAG IN    LWEVPA +   VI+ N+ G  N
Sbjct  55   LDIRDDVSVSQWCQQVIRQNGPPDLLINNAGLINTPAPLWEVPALECQAVIEVNLNGTIN  114

Query  468  VLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            ++RHF+P M+ + +GIIVN SSGWGRS +  VAPYCA+KWAIEGLT+++++E
Sbjct  115  LIRHFVPPMLKQGRGIIVNFSSGWGRSTSPGVAPYCATKWAIEGLTQALSQE  166



>ref|WP_010038018.1| oxidoreductase [Gemmata obscuriglobus]
Length=226

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 112/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            KT++ITG +RGLG+AL       GHT++GC RS   + +L  +              H  
Sbjct  3    KTIVITGATRGLGRALVAAFVAGGHTVVGCGRSDGHVRALRTDY----------PGPHSF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
             +VDV   ++V + + AV+E    PD++VNNA  +N    LWEVP ++F  ++  N++GV
Sbjct  53   TQVDVTDANAVLDWSAAVLERYGPPDLLVNNAALMNTPAPLWEVPPDEFRALLAVNIEGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M  ++ G++VNLSSGWGRS + +VAPYCA+K+AIEGLT ++A+E
Sbjct  113  FNVVRAFVPAMAGRQSGVVVNLSSGWGRSTSPEVAPYCATKYAIEGLTLALAQE  166



>ref|WP_034641141.1| short-chain dehydrogenase [Bacillus manliponensis]
 gb|KEK18284.1| short-chain dehydrogenase [Bacillus manliponensis]
Length=232

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 116/175 (66%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+AL    A+    I+GC RS +K+  L +E            NKH 
Sbjct  4    QKLVVITGVTQGLGRALVNRFAELDWMIVGCGRSAEKIKHLQSEF----------HNKHD  53

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               VDV    +V   ++ +++    P++++NNA TIN+N  LWE+ A +F+NV++ NV G
Sbjct  54   FQVVDVSDAQAVHSWSNYILKQYGAPNLLINNASTINKNAPLWEISATEFENVMNINVNG  113

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
              NV+R ++P MI+KK+G I+N+SS WGR+  A++APYCASK+A+EGLT+S+A E
Sbjct  114  SVNVIRTYVPAMIEKKRGTIINISSSWGRAGEAELAPYCASKFAVEGLTQSLALE  168



>ref|WP_035614822.1| oxidoreductase [Haloferula sp. BvORR071]
Length=226

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 105/174 (60%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K VLITG +RGLG A+A   A +G T+ GC  +     +L  EL            KH +
Sbjct  2    KHVLITGCTRGLGLAMARGFAAKGWTVSGCGTNGSAAAALAKEL----------GEKHRV  51

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
             + DV S   V   A  ++     PD+++NNA  INRN  LWEVP EDF  VID N+KGV
Sbjct  52   TRCDVTSAEEVAAFAADILAGVGAPDLLLNNAALINRNAPLWEVPPEDFSRVIDVNLKGV  111

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
              + R F+P MI +  G++VN SSGWGRS + +VAPYC +KW +EGLT ++A+E
Sbjct  112  HLICRGFLPAMIARGTGVVVNFSSGWGRSTSPEVAPYCCTKWGVEGLTSALAQE  165



>ref|WP_020035664.1| hypothetical protein [Verrucomicrobia bacterium SCGC AAA164-N20]
Length=226

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            + +LITGVS+GLG+A+A+  AK GHT+IGC R             + S+        H  
Sbjct  3    RLILITGVSKGLGRAMAMGFAKEGHTVIGCGRDS----------MALSALGKVIGAPHDF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VD+  NS+V +    V+     PD+V+NNA  IN N  LWE+ A +FD VID N+KGV
Sbjct  53   QTVDISVNSAVSDWIEHVLAQHGTPDLVLNNAAIINANAPLWEISAPEFDRVIDINIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+RH +P MI++  G+IVN SSGWGRS +  VAPYCA+KWA+EGLT+++A+E
Sbjct  113  QNVIRHVVPPMIERGSGVIVNFSSGWGRSTSPDVAPYCATKWAMEGLTQALAQE  166



>ref|WP_033674877.1| short-chain dehydrogenase [Bacillus gaemokensis]
 gb|KEK24018.1| short-chain dehydrogenase [Bacillus gaemokensis]
Length=235

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+A+     + G T+ GC RSQ+K+  L  +  +           H  
Sbjct  8    KLVVITGVTQGLGRAMVDRFHELGWTVAGCGRSQNKIKQLEDQFHAL----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  + +V+  A  +++    P++++NNA  +N+N  LW + AE+F N+++ NV GV
Sbjct  58   QVIDVSDHKAVDNWARDILQKYGPPNLLINNASLVNKNAPLWAISAEEFTNIMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             +++R F+P MID K+GII+N+SS WGR++ A++APYCASK+AIEGLTKS+A E
Sbjct  118  VHIIRAFVPEMIDNKEGIIINMSSSWGRASEAELAPYCASKFAIEGLTKSMALE  171



>ref|WP_043589787.1| oxidoreductase [Diplosphaera colitermitum]
Length=233

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 109/174 (63%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGV+RGLGKALA E  + GH ++GC RS + +  L     +           H  
Sbjct  8    KKIIITGVTRGLGKALAEEFIRLGHIVVGCGRSAEGVLDLRFAHGA----------PHRF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV   + V+  A  ++     PD+++NNAG  N    LW+V A DF  V+D N+KG 
Sbjct  58   DVLDVSEPNKVDVWAETLLATLGAPDLLLNNAGVFNAMVPLWDVQAADFARVMDVNIKGP  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            AN++R F+P MI++  G+IVN SSGWGRS  A  APYCASKWAIEG+TK++A+E
Sbjct  118  ANLIRAFVPAMIERGSGVIVNFSSGWGRSVDAHAAPYCASKWAIEGMTKALAEE  171



>ref|WP_029631720.1| oxidoreductase [[Scytonema hofmanni] UTEX B 1581]
Length=229

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 106/175 (61%), Gaps = 11/175 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K VLITGVSRGLG+ +A +  + GHT+IGCSR Q ++  L                 H  
Sbjct  3    KLVLITGVSRGLGRVMAEKFIESGHTVIGCSREQVEITKLQQRFG----------KAHYF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIP-DIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
            + +DV   + V   A +V        D+++NNAG +N     W V +  F+ VID N+KG
Sbjct  53   VSLDVTDETGVIAWAESVDSKYGASIDLLINNAGIVNSLAPFWTVNSSIFNQVIDINIKG  112

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            VANV+RHFIP M+++ QG+IVN SSGWGR  +    PYC SKWAIEG T+++A+E
Sbjct  113  VANVVRHFIPKMLERNQGVIVNFSSGWGRYTSPNAVPYCTSKWAIEGFTRALAQE  167



>ref|WP_020149797.1| hypothetical protein [Verrucomicrobia bacterium SCGC AAA164-E04]
Length=226

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            + +LITGV++GLG+A+A+  AK GHT++GC R             + S+   +    H  
Sbjct  3    RLILITGVTKGLGRAMAMGFAKEGHTVVGCGRDS----------TALSALGKALGTPHDF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VD+  N SV +    V+     PD+V+NNA  IN N  LWE+ A +FD VID N+KGV
Sbjct  53   QAVDISVNRSVSDWIEHVLAQHGTPDLVLNNAAIINANAPLWEISAPEFDRVIDVNIKGV  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+RH +P MI++  G+IVN SSGWGRS +  VAPYCA+KWA+EGLT+++A+E
Sbjct  113  QNVIRHVVPPMIERGSGVIVNFSSGWGRSTSPDVAPYCATKWAMEGLTQALAQE  166



>ref|WP_017301486.1| hypothetical protein [Nodosilinea nodulosa]
Length=228

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 109/174 (63%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++ITGVS+GLG+A+       GHT+ GC+RS   +  L A+              H  
Sbjct  3    KHIVITGVSQGLGRAMVDGFIAEGHTLSGCARSAGAVAHLAAQH----------PRPHGF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VD+R +++V   A A +    +PD+V+NNAG +N    LW VPAE+ D VI  N+ G 
Sbjct  53   TVVDIRDDAAVAAWAAAAIAANGLPDLVINNAGLVNHPAPLWSVPAEECDAVIAVNLSGT  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+RHF P M++++ GI VN SSGWGRS +  VAPYCA+KW +EGLT++++++
Sbjct  113  CNVIRHFAPPMVERRSGIFVNFSSGWGRSTSPGVAPYCATKWGVEGLTQALSQD  166



>ref|WP_027360907.1| oxidoreductase [Desulforegula conservatrix]
Length=230

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 112/172 (65%), Gaps = 10/172 (6%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            ++ITGV++GLG+A+A +    G+ + GC RS++++ +L++               H+   
Sbjct  9    IVITGVTKGLGRAMAAKFIDLGYRVFGCGRSENEILALNSLF----------GKMHMFDV  58

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            VDV    SV   A  +     +PDI++NNA  +N  + LW++  +DF N+ID NVKGV N
Sbjct  59   VDVTDFESVNAWALKIAAKAGVPDILINNAAIMNDPHPLWQIRPDDFSNLIDVNVKGVFN  118

Query  468  VLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V+R F+P MI +++G I+N SSGWGR  + +VAPYC SKWA+EG+T+++A+E
Sbjct  119  VVRAFVPEMIKRRKGKIINFSSGWGRFVSPEVAPYCTSKWAVEGMTRALAEE  170



>ref|WP_012160753.1| oxidoreductase [Acaryochloris marina]
 gb|ABW25132.1| short-chain dehydrogenase/reductase SDR [Acaryochloris marina 
MBIC11017]
Length=227

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 108/174 (62%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            + ++ITGV++GLG+ALA+   + GHT+ GC R+           AS +       + H  
Sbjct  3    RKIVITGVTQGLGEALAIGFIQAGHTVWGCGRT----------TASINHLAQQYTSPHHF  52

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV     V+  A+ +++    PDIV+NNAG IN    LWEVP  D  +V+D NVKG 
Sbjct  53   STVDVAQAQQVQAWANQLLQTDEPPDIVINNAGVINTVAPLWEVPEPDISDVLDVNVKGT  112

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             N++R F+P M  K QGII+N SSGWGRS +  VAPYCASKWAIEGL ++ A+E
Sbjct  113  INIIRSFLPSMKTKGQGIIINFSSGWGRSTSPGVAPYCASKWAIEGLNQAFAQE  166



>dbj|BAL52423.1| short-chain dehydrogenase/reductase [uncultured gamma proteobacterium]
 dbj|BAL54521.1| short-chain dehydrogenase/reductase [uncultured gamma proteobacterium]
Length=229

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 115/176 (65%), Gaps = 11/176 (6%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
            A KTVLITGVS+GLG+ALA EL   GH ++GC R++          A         Q K 
Sbjct  3    ASKTVLITGVSKGLGRALAEELFSLGHRVLGCGRNRR---------ALEELQGRWPQGKF  53

Query  276  LIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVK  455
             +  VDV    +V   A  ++E    PD+++NNA  IN N  LWEVP E+F  V+D N+K
Sbjct  54   AV--VDVADPKAVAAWAKELLEAGECPDLLLNNAALINANAPLWEVPVEEFSAVVDVNLK  111

Query  456  GVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            GV  VL++F+P M+ ++ G++VN SSGWGRS + +VAPYCA+KWAIEGLT+++A+E
Sbjct  112  GVFYVLKYFLPAMLRRQTGVVVNFSSGWGRSTSPEVAPYCATKWAIEGLTQALAQE  167



>ref|WP_013011272.1| oxidoreductase [Denitrovibrio acetiphilus]
 gb|ADD68768.1| short-chain dehydrogenase/reductase SDR [Denitrovibrio acetiphilus 
DSM 12809]
Length=218

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 104/174 (60%), Gaps = 17/174 (10%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K ++I+GVS+GLG  LA      GH + GCSRS +    +                  L 
Sbjct  3    KKIVISGVSKGLGYQLAEAFTVMGHKVAGCSRSGEGPCCMV-----------------LC  45

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VD+    SV+  A  V+     PDI++NNA  +NR   +WEVPA++F+ ++D NV G 
Sbjct  46   SSVDITEPLSVKAFADNVISVMGAPDILINNAAVMNRPANVWEVPADEFNMLMDINVSGT  105

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F P M    +G+IVN+SSGWGRS + +VAPYCASK+AIEGL+ ++A+E
Sbjct  106  MNVIRAFYPAMEKSGEGVIVNMSSGWGRSVSPKVAPYCASKYAIEGLSMAMAQE  159



>ref|WP_008273974.1| oxidoreductase [Cyanothece sp. CCY0110]
 gb|EAZ92830.1| hypothetical protein CY0110_22077 [Cyanothece sp. CCY0110]
Length=229

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 110/178 (62%), Gaps = 11/178 (6%)
 Frame = +3

Query  90   PGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQN  269
            P     +++TGV++GLG+AL   L +RGHT+IGC RS +++ +L+               
Sbjct  3    PNKSLKIVVTGVTKGLGRALCEGLIERGHTLIGCGRSVNEIETLNHLYP-----------  51

Query  270  KHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTN  449
            KH    VD+ SN  V+     V+E    PD ++NNA  IN+   LWE+  ++F  + D N
Sbjct  52   KHQFDVVDLSSNQQVQRWGKKVIEKWGTPDFLINNAAVINQPLPLWEISDQEFSQLTDIN  111

Query  450  VKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            + GV   +R F+P MI++ +G+I+N SSGWGRS + +V PYC SKWAIEGL++ +A+E
Sbjct  112  INGVVRTIRVFLPSMIEENKGVIINFSSGWGRSTSPEVVPYCTSKWAIEGLSQGLAQE  169



>ref|WP_009966067.1| oxidoreductase [Verrucomicrobium spinosum]
Length=228

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 108/174 (62%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGVSRGLG+A+       G T+ GC RS D +  L     +           H  
Sbjct  5    KHVVITGVSRGLGRAMVEGFVSLGWTVSGCCRSSDAVEELRRAYPA----------PHAF  54

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
             +VDV  ++ VEEL   ++ +   PD+++NNA  INR+  +WE+ A++  N++D NVKG 
Sbjct  55   SQVDVGRDAEVEELCAGILASHGTPDLLINNAAIINRSVPVWELNADEVANILDVNVKGT  114

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
              ++R   P MI +  G++VN SSGWGRS + +VA YCA+KWAIEGL++++A+E
Sbjct  115  IAMIRGLAPAMIAQGGGVVVNFSSGWGRSTSPEVASYCATKWAIEGLSQAMAQE  168



>ref|WP_018756498.1| hypothetical protein [Paenibacillus terrigena]
Length=231

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 108/174 (62%), Gaps = 11/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+A+     + G T+ GC RS +K+  L  E A            H  
Sbjct  5    KRVVITGVTQGLGRAMVDRFDELGWTVHGCGRSINKVEELRVEFA-----------NHDF  53

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VDV    +V   A  V+     PD+++NNA  +NRN  +W +  E+F +V+  NV G 
Sbjct  54   EAVDVGDAQAVSRWADQVLNAFGAPDLLINNASIVNRNAPIWSISDEEFTDVMRINVNGT  113

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P MID ++G+IVN+SSGWGR   A++APYCASK+AIEGLT+S+A E
Sbjct  114  VNVIRSFVPAMIDAQRGMIVNMSSGWGREGEAELAPYCASKFAIEGLTQSMALE  167



>ref|WP_038161913.1| oxidoreductase [Verrucomicrobium sp. BvORR106]
Length=228

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 108/174 (62%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGVSRGLG+A+       G T+ GC RS D +  L     +           H  
Sbjct  5    KHVVITGVSRGLGRAMVEGFVALGWTVSGCCRSADAVEELRRAYPA----------PHAF  54

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
             +VDV  ++ VE+    ++ +   P++++NNA  INR+  +WE+ A++  N++D NVKG 
Sbjct  55   SQVDVGRDAEVEDFCAGILASHGTPELLINNAAIINRSAPVWELSADEVANILDVNVKGT  114

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             +++R   P MI +  G++VN SSGWGRS A +VA YCA+KWAIEGL++++A+E
Sbjct  115  ISMIRGLAPAMIAQGGGVVVNFSSGWGRSTAPEVASYCATKWAIEGLSQAMAQE  168



>ref|WP_021830966.1| Short chain dehydrogenase [Crocosphaera watsonii]
 emb|CCQ51801.1| Short chain dehydrogenase [Crocosphaera watsonii WH 8502]
Length=229

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 106/172 (62%), Gaps = 11/172 (6%)
 Frame = +3

Query  108  VLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIMK  287
            ++ITGV++GLG+AL     + GHT++GC RS +++  L+                H    
Sbjct  9    IVITGVTKGLGRALCEGFNELGHTVVGCGRSLNEIEKLNHLY-----------QAHQFDV  57

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            VD+ +N  V+  A  V+E    PD +VNNA  +N+   LW++  E+F  + D N+ GV  
Sbjct  58   VDLSNNQQVQTWAKKVIEKWGSPDFLVNNAAIMNQPLPLWKISEEEFIKLTDININGVVR  117

Query  468  VLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             +R F+P MI +K+GIIVN SSGWGRS + +V PYC SKWAIEGL++ +A+E
Sbjct  118  TIRVFLPAMIQQKKGIIVNFSSGWGRSTSPEVVPYCTSKWAIEGLSQGLAQE  169



>ref|XP_009618450.1| PREDICTED: uncharacterized protein LOC104110628 [Nicotiana tomentosiformis]
Length=335

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 8/86 (9%)
 Frame = +3

Query  366  VNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGR  545
            VN+A TINRNN+LWEVP E FD+V+DTN+KG ANVL HFIPLM++KKQG+I+N+SS WGR
Sbjct  216  VNSARTINRNNKLWEVPPEVFDSVVDTNIKGTANVLHHFIPLMLEKKQGVILNMSSFWGR  275

Query  546  SAAAQVAPYCASKWAIEGLTKSIAKE  623
            SAAAQVAPYC S        +S+AKE
Sbjct  276  SAAAQVAPYCTS--------RSVAKE  293



>ref|WP_009543694.1| MULTISPECIES: oxidoreductase [Cyanothece]
 gb|ACB53582.1| short-chain dehydrogenase/reductase SDR [Cyanothece sp. ATCC 
51142]
Length=247

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 108/173 (62%), Gaps = 11/173 (6%)
 Frame = +3

Query  105  TVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIM  284
            T++ITG+++GLGKAL  EL K+GH IIGC RS  ++  L+                H   
Sbjct  26   TIVITGITKGLGKALGEELIKKGHKIIGCGRSVQEIEKLNHLYP-----------DHDFD  74

Query  285  KVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVA  464
             VD+ +N  V+   + V+E    PD ++NNA  IN+   LWE+  EDF  + D N+ GV 
Sbjct  75   VVDLSNNQQVQIWINRVIEQWGSPDFLINNAAIINQPLPLWEISEEDFIQLTDININGVV  134

Query  465  NVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
              +R F+P M+ +K+GIIVN SSGWGRS + +V PYC SKWAIEGL++ +A+E
Sbjct  135  RTIRGFLPAMMAEKKGIIVNFSSGWGRSTSPEVVPYCTSKWAIEGLSQGLAQE  187



>ref|WP_040351871.1| oxidoreductase [Blastopirellula marina]
Length=229

 Score =   126 bits (317),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 107/174 (61%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K +++TG +RGLG+AL  +    GHT+IGC R+ + +  L  +L             H  
Sbjct  5    KVIVVTGATRGLGRALVSKFVDAGHTVIGCGRNAEHIAMLTEQLG----------GPHRF  54

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV    +V      V+     PD++VNNA  +N +  LWE+  E F N++D N+KG+
Sbjct  55   DVLDVTQYEAVAAWGADVIAQYGPPDLLVNNAALMNDSKVLWEIDPEQFSNLMDVNLKGM  114

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
              VLR F+P M++++ G+IVN SSGWGRS + +VAPYC++K+ +EG+T ++AKE
Sbjct  115  FYVLRSFVPAMVERESGVIVNFSSGWGRSVSPKVAPYCSTKFGVEGMTLALAKE  168



>ref|WP_022947702.1| oxidoreductase [Methylohalobius crimeensis]
Length=229

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 117/173 (68%), Gaps = 11/173 (6%)
 Frame = +3

Query  105  TVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLIM  284
            T+LITGVS+GLG+ALA E ++ G+ + GCSR++          A  +  +   Q +  + 
Sbjct  6    TLLITGVSKGLGRALAEEFSRLGYRVWGCSRNR---------RAVEALQSEWPQGRFSV-  55

Query  285  KVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVA  464
             VDV    +V   A  +++ +  PD ++NNA  IN N  LW+VP E+F  V+D N+KGV 
Sbjct  56   -VDVADPQAVSAWADTLLDGRDGPDFLINNAALINANAPLWQVPTEEFAAVVDVNIKGVF  114

Query  465  NVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            +V+++F+P M++++ G+IVN SSGWGR+ + +VAPYC SKWAIEGLT+S+A+E
Sbjct  115  HVIKYFLPAMLERRSGVIVNFSSGWGRATSPEVAPYCTSKWAIEGLTQSLAQE  167



>gb|EAQ76885.1| Short-chain dehydrogenase/reductase SDR [Blastopirellula marina 
DSM 3645]
Length=209

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 91/150 (61%), Gaps = 10/150 (7%)
 Frame = +3

Query  174  HTIIGCSRSQDKlnslhaelasassstsssQNKHLIMKVDVRSNSSVEELAHAVMENKSI  353
            HT+IGC R+ + +  L  +L             H    +DV    +V      V+     
Sbjct  9    HTVIGCGRNAEHIAMLTEQLG----------GPHRFDVLDVTQYEAVAAWGADVIAQYGP  58

Query  354  PDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSS  533
            PD++VNNA  +N +  LWE+  E F N++D N+KG+  VLR F+P M++++ G+IVN SS
Sbjct  59   PDLLVNNAALMNDSKVLWEIDPEQFSNLMDVNLKGMFYVLRSFVPAMVERESGVIVNFSS  118

Query  534  GWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            GWGRS + +VAPYC++K+ +EG+T ++AKE
Sbjct  119  GWGRSVSPKVAPYCSTKFGVEGMTLALAKE  148



>ref|WP_007311547.1| short-chain dehydrogenase/reductase SDR [Crocosphaera watsonii]
 gb|EHJ11776.1| short-chain dehydrogenase/reductase SDR [Crocosphaera watsonii 
WH 0003]
 emb|CCQ53679.1| Short chain dehydrogenase [Crocosphaera watsonii WH 0005]
 emb|CCQ64925.1| probable short-chain dehydrogenase [Crocosphaera watsonii WH 
0402]
Length=173

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 0/112 (0%)
 Frame = +3

Query  288  VDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVAN  467
            VD+ +N  V+  A  V+E    PD +VNNA  +N+   LW++  E+F  + D N+ GV  
Sbjct  2    VDLSNNQQVQTWAKKVIEKWGSPDFLVNNAAIMNQPLPLWKISEEEFIKLTDININGVVR  61

Query  468  VLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             +R F+P MI +K+GIIVN SSGWGRS + +V PYC SKWAIEGL++ +A+E
Sbjct  62   TIRVFLPAMIQQKKGIIVNFSSGWGRSTSPEVVPYCTSKWAIEGLSQGLAQE  113



>ref|WP_041096310.1| short-chain dehydrogenase [Bacillus badius]
 gb|KIL74695.1| 3-oxoacyl-[acyl-carrier protein] reductase [Bacillus badius]
Length=232

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 108/174 (62%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG++L     + G  + GC RS+                    + KH  
Sbjct  5    KLVIITGVTKGLGRSLVNRFDELGWRVAGCGRSKH----------LIEEMNLQFKGKHDF  54

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              VD+ + + VE+ A +V+    +PD+++NNA  IN+N   W++ +++F +V++ NV GV
Sbjct  55   QPVDITNETEVEKWAKSVIALYGLPDLLINNASIINKNTSTWKIASKEFKDVMNINVMGV  114

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV++ F+P M+ K +G+I+N+SS WGR   A +A YCASK+AIEGLT+S+A E
Sbjct  115  VNVIQAFVPEMVTKNKGMIINISSSWGRKGEAGLAAYCASKFAIEGLTQSMAME  168



>ref|WP_000810932.1| short-chain dehydrogenase [Bacillus thuringiensis]
 gb|ABK85392.1| short chain dehydrogenase [Bacillus thuringiensis str. Al Hakam]
 gb|AJH71350.1| short chain dehydrogenase family protein [Bacillus thuringiensis]
Length=235

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 116/181 (64%), Gaps = 10/181 (6%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            M    + K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L             
Sbjct  1    MKQKSSGKSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKYYG--------  52

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
              N H+   +DV  +  V + A+ ++     PD+++NNA  +N+N  LW+V AE+F+NV+
Sbjct  53   --NTHVFQIIDVSDSQQVSDWANYILHRNRAPDLLINNASIVNKNAPLWKVTAEEFENVM  110

Query  441  DTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            + NV GV NV+R F+P M+ +K G+I+N+SS WGR   A++APYCASK+AIEG+TKS+A 
Sbjct  111  NVNVNGVVNVIRAFVPAMVARKAGMIINMSSSWGREGEAELAPYCASKFAIEGITKSLAL  170

Query  621  E  623
            E
Sbjct  171  E  171



>ref|XP_008649107.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like [Zea mays]
 gb|AFW76421.1| hypothetical protein ZEAMMB73_204207 [Zea mays]
Length=122

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +3

Query  435  VIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSI  614
            ++DTN+KG ANVLRHF+PLMI+K+ GII+NLSSGWGRSAAA+VAPYCASKWAIEGLT+S+
Sbjct  1    MVDTNIKGTANVLRHFVPLMIEKRHGIIINLSSGWGRSAAAEVAPYCASKWAIEGLTRSL  60

Query  615  AKE  623
            AKE
Sbjct  61   AKE  63



>gb|EEL87964.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus AH1272]
 gb|EEL93762.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus AH1273]
Length=237

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+AL     + G  I+GC RS++K+  L+    +           H  
Sbjct  10   KLVIITGVTQGLGRALVDRFHELGWNIVGCGRSKNKIEELNKYYGA----------SHDF  59

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV ++  V + A +++     PD+++NNA  +N+N  LW+VPA++F++V+  NV GV
Sbjct  60   QIIDVSNHQQVSKWASSILNKYRAPDMLINNASIVNQNAPLWKVPAQEFESVMSVNVNGV  119

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P MI +K+GII+N+SS WGR   A++APYCASK+AIEG+T+S+A E
Sbjct  120  VNVIRAFVPAMIARKKGIIINMSSSWGREGEAELAPYCASKFAIEGITQSMAME  173



>ref|WP_000440729.1| short chain dehydrogenase [Bacillus cereus]
 gb|EOP55649.1| short chain dehydrogenase [Bacillus cereus VDM053]
Length=235

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+AL     + G  I+GC RS++K+  L+    +           H  
Sbjct  8    KLVIITGVTQGLGRALVDRFHELGWNIVGCGRSKNKIEELNKYYGA----------SHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV ++  V + A +++     PD+++NNA  +N+N  LW+VPA++F++V+  NV GV
Sbjct  58   QIIDVSNHQQVSKWASSILNKYRAPDMLINNASIVNQNAPLWKVPAQEFESVMSVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P MI +K+GII+N+SS WGR   A++APYCASK+AIEG+T+S+A E
Sbjct  118  VNVIRAFVPAMIARKKGIIINMSSSWGREGEAELAPYCASKFAIEGITQSMAME  171



>ref|WP_000440728.1| short-chain dehydrogenase [Bacillus cereus]
 gb|EJQ12733.1| hypothetical protein IE3_03142 [Bacillus cereus BAG3X2-1]
Length=235

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 115/175 (66%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+AL     + G  I+GC RS++K+  L+    +           H 
Sbjct  7    EKLVIITGVTQGLGRALVDRFHELGWNIVGCGRSKNKIEELNKYYGA----------SHD  56

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV ++  V + A  ++     PD+++NNA  +N+N  LW+VPA++F++V+  NV G
Sbjct  57   FQIIDVSNHQQVSKWASCILNKYRAPDMLINNASIVNQNAPLWKVPAQEFESVMSVNVNG  116

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P MI +K+GII+N+SS WGR   A++APYCASK+AIEG+T+S+A E
Sbjct  117  VVNVIRAFVPAMIARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITQSMAME  171



>ref|WP_000440730.1| short-chain dehydrogenase [Bacillus cereus]
 gb|EJS54982.1| hypothetical protein ICG_03244 [Bacillus cereus BAG1X1-3]
 gb|EOO77746.1| short chain dehydrogenase [Bacillus cereus BAG1O-1]
Length=235

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 114/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+ L     + G  I+GC RS++K+  L+    +           H  
Sbjct  8    KLVIITGVTQGLGRVLVDRFHELGWNIVGCGRSKNKIEELNKYYGA----------SHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV ++  V + A  ++     PD+++NNA  +N+N  LW+VPA++F++V+  NV GV
Sbjct  58   QIIDVSNHQQVSKWASCILNKYRAPDMLINNASIVNQNAPLWKVPAQEFESVMSVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P MI +K+GII+N+SS WGR   A++APYCASK+AIEG+T+S+A E
Sbjct  118  VNVIRAFVPAMIARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITQSMAME  171



>ref|XP_003606949.1| short-chain dehydrogenase/reductase (SDR) family protein, putative 
[Medicago truncatula]
 gb|AES89146.1| 3-oxoacyl-(acyl-carrier) reductase, putative [Medicago truncatula]
Length=216

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 105/177 (59%), Gaps = 45/177 (25%)
 Frame = +3

Query  96   AHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKH  275
             ++TV+ITGVS+GLG+ALA+ELA   HTIIGCS                           
Sbjct  25   GNRTVMITGVSKGLGRALAIELAYHDHTIIGCSD--------------------------  58

Query  276  LIMKVDVRSNSSVEELAHAVME-NKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNV  452
                         EE+A  VME N   P+I+VN+AG IN+NN++WEV +E+FD V+DTN+
Sbjct  59   -------------EEMACIVMEKNGGPPNIIVNDAGVINKNNKMWEVLSEEFDLVMDTNL  105

Query  453  KGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            KG  NVLRHFI LM+ K +        G  RS AA VAPY ASKW IEGLTKS+A+E
Sbjct  106  KGNVNVLRHFISLMVKKNKN-----EEGGIRSGAALVAPYFASKWEIEGLTKSVAEE  157



>ref|WP_035430161.1| short-chain dehydrogenase [Bacillus sp. UNC322MFChir4.1]
Length=232

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG++L    ++ G  I+GC RS+ K+  +               NKH  
Sbjct  8    KLVVITGVTQGLGRSLIDRFSELGWLIVGCGRSKSKIEQIKRHF----------DNKHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  + +V+     +++    PD+++NNA  +N+N  LW + +E+F NV++ NV GV
Sbjct  58   QSIDVSDDKAVKAWGEYILQQYGAPDLLINNASIVNKNATLWTISSEEFANVMNINVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R FIP MI  K+GII+N+SS WGRS  A++APYCASK+AIEGLT+S+A E
Sbjct  118  VNVIRSFIPAMIHNKRGIIINISSSWGRSGEAELAPYCASKFAIEGLTQSMALE  171



>ref|WP_000810931.1| MULTISPECIES: short-chain dehydrogenase [Bacillus]
 gb|EDX64375.1| short chain dehydrogenase [Bacillus cereus 03BB108]
 gb|EDX67831.1| short chain dehydrogenase [Bacillus cereus NVH0597-99]
 gb|ACO29329.1| short chain dehydrogenase [Bacillus cereus 03BB102]
 gb|EEK56582.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus BGSC 
6E1]
 gb|EEM89776.1| Short-chain dehydrogenase/reductase SDR [Bacillus thuringiensis 
serovar pulsiensis BGSC 4CC1]
 gb|ADK04937.1| short chain dehydrogenase [Bacillus cereus biovar anthracis str. 
CI]
 gb|AEW55455.1| 3-oxoacyl-(acyl-carrier protein) reductase [Bacillus cereus F837/76]
 gb|EJQ93814.1| hypothetical protein IGW_02527 [Bacillus cereus ISP3191]
 gb|AJG55275.1| short chain dehydrogenase family protein [Bacillus cereus 03BB102]
 gb|AJG58205.1| short chain dehydrogenase family protein [Bacillus cereus D17]
 gb|AJI12986.1| short chain dehydrogenase family protein [Bacillus cereus 03BB108]
Length=235

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 115/181 (64%), Gaps = 10/181 (6%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            M    + K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L             
Sbjct  1    MKQKSSGKSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKYYG--------  52

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
              N H    +DV  +  V + A+ ++     PD+++NNA  +N+N  LW+V AE+F+NV+
Sbjct  53   --NTHDFQIIDVSDSQQVSDWANYILHRNRAPDLLINNASIVNKNAPLWKVTAEEFENVM  110

Query  441  DTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            + NV GV NV+R F+P M+ +K G+I+N+SS WGR   A++APYCASK+AIEG+TKS+A 
Sbjct  111  NVNVNGVVNVIRAFVPAMVARKAGMIINMSSSWGREGEAELAPYCASKFAIEGITKSMAL  170

Query  621  E  623
            E
Sbjct  171  E  171



>ref|WP_000810933.1| short-chain dehydrogenase [Bacillus cereus]
 gb|EEL45824.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus Rock3-42]
Length=235

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 114/181 (63%), Gaps = 10/181 (6%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            M    + K+V+ITGV++GLG+ +     + G  I GC RS+DK+  L             
Sbjct  1    MKQKSSGKSVIITGVTQGLGRVMVDRFHELGWNIYGCGRSKDKIEELKKYYG--------  52

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
              N H    +DV  +  V + A+ ++     PD+++NNA  +N+N  LW+V AE+F+NV+
Sbjct  53   --NTHDFQIIDVSDSQQVSDWANYILHRNRAPDLLINNASIVNKNAPLWKVTAEEFENVM  110

Query  441  DTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            + NV GV NV+R F+P M+ +K G+I+N+SS WGR   A++APYCASK+AIEG+TKS+A 
Sbjct  111  NVNVNGVVNVIRAFVPAMVARKAGMIINMSSSWGREGEAELAPYCASKFAIEGITKSMAL  170

Query  621  E  623
            E
Sbjct  171  E  171



>ref|WP_025151198.1| short-chain dehydrogenase [Bacillus sp. H1a]
Length=235

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG++L    ++ G  I+GC RS+ K+  +               NKH  
Sbjct  8    KLVIITGVTQGLGRSLIDRFSELGWLIVGCGRSKSKIKQIKRHF----------DNKHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  + +V+     +++    PD+++NNA  +N+N  LW + +E+F NV++ NV GV
Sbjct  58   QSIDVSDDKAVKAWGEYILQRYGAPDLLINNASIVNKNATLWTISSEEFANVMNINVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P MI  K+GII+N+SS WGRS  A++APYCASK+AIEGLT+S+A E
Sbjct  118  VNVIRAFVPAMIHNKRGIIINISSSWGRSGEAELAPYCASKFAIEGLTQSMALE  171



>ref|WP_001189039.1| short-chain dehydrogenase [Bacillus thuringiensis]
 gb|AEA15922.1| Short chain dehydrogenase [Bacillus thuringiensis serovar chinensis 
CT-43]
 gb|AFV18048.1| short-chain dehydrogenase/reductase SDR [Bacillus thuringiensis 
Bt407]
 gb|AGG00990.1| 3-oxoacyl-[acyl-carrier protein] reductase [Bacillus thuringiensis 
serovar thuringiensis str. IS5056]
 gb|ERI01854.1| 3-oxoacyl-[acyl-carrier-protein] reductase FabG [Bacillus thuringiensis 
T01-328]
Length=235

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFDELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD++VNNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNRHTAPDMIVNNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPTMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>gb|EEM29033.1| Short-chain dehydrogenase/reductase SDR [Bacillus thuringiensis 
Bt407]
 gb|EEM35319.1| Short-chain dehydrogenase/reductase SDR [Bacillus thuringiensis 
serovar thuringiensis str. T01001]
 gb|EEM66218.1| Short-chain dehydrogenase/reductase SDR [Bacillus thuringiensis 
serovar berliner ATCC 10792]
Length=238

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  11   KSVIITGVTQGLGRAMVDRFDELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  60

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD++VNNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  61   QVIDVSDSQQVNNWANYILNRHTAPDMIVNNASIVNQNAQLWKITAQEFENVMNVNVNGV  120

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  121  VNVIRAFVPTMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  174



>ref|WP_000812262.1| short chain dehydrogenase [Bacillus cereus]
Length=233

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 110/174 (63%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+ +     + G  I GC RS+DK+  L               N H  
Sbjct  8    KLVIITGVTQGLGRVMVERFHELGWNICGCGRSKDKIEELKKHYG----------NTHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A  V+   S PD+++NNA  +N+N  +W+V A +FDNV++ NV GV
Sbjct  58   QIIDVSDSQQVSSWASYVLHKYSPPDLLINNASIVNQNAPIWKVTASEFDNVMNINVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>gb|EEK67628.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus MM3]
Length=245

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 114/185 (62%), Gaps = 10/185 (5%)
 Frame = +3

Query  69   EELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasass  248
            EE  M      K V+ITGV++GLG+A+     + G  I GC RS+DK+  L         
Sbjct  7    EERYMQRNETGKIVMITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKYYG----  62

Query  249  stsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDF  428
                  N H    +DV  +  V   A+ ++     PD+++NNA  +N+N  LW+V A++F
Sbjct  63   ------NIHDFQIIDVSDSQQVSNWANYILHRYRAPDLLINNASIVNKNAPLWKVTAQEF  116

Query  429  DNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTK  608
            +NV+  NV GV NV+R F+P M+ +K+G+I+N+SS WGR   A++APYCASK+AIEG+TK
Sbjct  117  ENVMSVNVNGVVNVIRAFVPAMVARKEGMIINMSSSWGREGEAELAPYCASKFAIEGITK  176

Query  609  SIAKE  623
            S+A E
Sbjct  177  SMALE  181



>ref|WP_001189038.1| MULTISPECIES: short-chain dehydrogenase [Bacillus]
 gb|EJS60256.1| hypothetical protein ICE_01466 [Bacillus cereus BAG1X1-2]
 gb|EJV79298.1| hypothetical protein IGE_03385 [Bacillus cereus HuB1-1]
 gb|EPF11365.1| short chain dehydrogenase [Bacillus cereus BAG1O-3]
Length=235

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFDELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNRHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_016087986.1| short chain dehydrogenase [Bacillus cereus]
 gb|EOP09598.1| short chain dehydrogenase [Bacillus cereus BAG2O-3]
 gb|EOQ12612.1| short chain dehydrogenase [Bacillus cereus B5-2]
Length=235

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G  I GC RS+DK+  L               N H 
Sbjct  7    RKIVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKYYG----------NTHD  56

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+ ++     PD+++NNA  +N+N +LW++ A +F+N+++ NV G
Sbjct  57   FQIIDVSDSQQVSSWANYILNRHRAPDLLINNASIVNKNAQLWKITAREFENIMNVNVNG  116

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  117  VVNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>gb|EEK89651.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus m1550]
Length=238

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  11   KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  60

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  61   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  120

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  121  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  174



>ref|WP_016134418.1| short chain dehydrogenase [Bacillus cereus]
 gb|EOQ32099.1| short chain dehydrogenase [Bacillus cereus BAG3O-1]
Length=235

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 112/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+A+     + G  I GC RS+DK+  L               N H  
Sbjct  8    KIVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKYYG----------NTHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++     PD+++NNA  +N+N +LW++ A +F+N+++ NV GV
Sbjct  58   QIIDVSDSQQVSSWANYILNRHRAPDLLINNASIVNKNAQLWKITAREFENIMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>gb|EEL11646.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus BDRD-Cer4]
Length=238

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  11   KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  60

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  61   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  120

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  121  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  174



>ref|WP_016081735.1| MULTISPECIES: short chain dehydrogenase [Bacillus]
 gb|EOO27269.1| short chain dehydrogenase [Bacillus cereus BAG1X1-1]
 gb|EOO49607.1| short chain dehydrogenase [Bacillus cereus BAG1X2-1]
 gb|EOO51387.1| short chain dehydrogenase [Bacillus cereus BAG1X2-2]
 gb|EOO60277.1| short chain dehydrogenase [Bacillus cereus BAG1X2-3]
 gb|EOP06526.1| short chain dehydrogenase [Bacillus cereus BAG2O-1]
 gb|KIQ86689.1| short-chain dehydrogenase [Bacillus sp. L_1B0_5]
 gb|KIQ90332.1| short-chain dehydrogenase [Bacillus sp. L_1B0_8]
Length=235

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNRHTAPDLIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_043322963.1| short-chain dehydrogenase [Bacillus thuringiensis]
Length=235

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 113/175 (65%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G  I GC RS+DK+  L  +            N H 
Sbjct  7    RKLVIITGVTQGLGRAMVDRFHELGWNICGCGRSKDKIEELKKQYG----------NTHD  56

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+ ++    +PD+++NNA  +N+N  +W+V A +F+NV++ NV G
Sbjct  57   FQIIDVSDSQQVSSWANDILTKYRVPDLLINNASIVNQNAPIWKVTAGEFENVMNVNVNG  116

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+D+K+GII+N+SS WGR   A +APYCASK+AIEG+TKS+A E
Sbjct  117  VVNVIRAFVPAMVDRKEGIIINMSSSWGREGEADLAPYCASKFAIEGITKSMALE  171



>ref|WP_000823063.1| short chain dehydrogenase [Bacillus cereus]
Length=235

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_000823061.1| short-chain dehydrogenase [Bacillus cereus]
 ref|NP_832041.1| Short chain dehydrogenase [Bacillus cereus ATCC 14579]
 gb|AAP09242.1| Short chain dehydrogenase [Bacillus cereus ATCC 14579]
Length=235

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_023521865.1| 3-oxoacyl-[acyl-carrier protein] reductase [Bacillus thuringiensis]
 gb|AHA71707.1| 3-oxoacyl-[acyl-carrier protein] reductase [Bacillus thuringiensis 
YBT-1518]
Length=235

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L    +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKRYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNRHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPTMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>gb|EEL29063.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus Rock1-15]
 gb|EEL76550.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus AH676]
Length=238

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  11   KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  60

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  61   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  120

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  121  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  174



>ref|WP_025709714.1| short-chain dehydrogenase [Bacillus subtilis]
Length=235

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_000823062.1| MULTISPECIES: short-chain dehydrogenase [Bacillus]
 gb|ACK63612.1| short chain dehydrogenase [Bacillus cereus B4264]
 gb|ADH06863.1| Short chain dehydrogenase [Bacillus thuringiensis BMB171]
 gb|EJR81556.1| hypothetical protein IK9_02599 [Bacillus cereus VD166]
 gb|EJR91029.1| hypothetical protein IKA_02013 [Bacillus cereus VD169]
 gb|EJR99790.1| hypothetical protein IKG_02102 [Bacillus cereus VD200]
 gb|EOO69323.1| short chain dehydrogenase [Bacillus cereus VD196]
 gb|EOQ15365.1| short chain dehydrogenase [Bacillus cereus VD184]
 gb|ETT74788.1| Short chain dehydrogenase [Bacillus weihenstephanensis FSL R5-860]
 gb|KIZ27486.1| short-chain dehydrogenase [Bacillus cereus]
Length=235

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>gb|EEK78948.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus R309803]
Length=247

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 110/174 (63%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+ +     + G  I GC RS+DK+  L               N H  
Sbjct  22   KLVIITGVTQGLGRVMVERFHELGWNICGCGRSKDKIEELKKHYG----------NTHDF  71

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A  V+   S PD+++NNA  +N+N  +W+V A +FDNV++ NV GV
Sbjct  72   QIIDVSDSQQVSSWASYVLHKYSPPDLLINNASIVNQNAPIWKVTASEFDNVMNINVNGV  131

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  132  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  185



>gb|AFU12973.1| Short-chain dehydrogenase/reductase SDR [Bacillus thuringiensis 
MC28]
Length=242

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 113/175 (65%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G  I GC RS+DK+  L  +            N H 
Sbjct  14   RKLVIITGVTQGLGRAMVDRFHELGWNICGCGRSKDKIEELKKQYG----------NTHD  63

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+ ++    +PD+++NNA  +N+N  +W+V A +F+NV++ NV G
Sbjct  64   FQIIDVSDSQQVSSWANDILTKYRVPDLLINNASIVNQNAPIWKVTAGEFENVMNVNVNG  123

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+D+K+GII+N+SS WGR   A +APYCASK+AIEG+TKS+A E
Sbjct  124  VVNVIRAFVPAMVDRKEGIIINMSSSWGREGEADLAPYCASKFAIEGITKSMALE  178



>ref|WP_000823058.1| MULTISPECIES: short-chain dehydrogenase [Bacillus cereus group]
 gb|EDZ50778.1| short chain dehydrogenase [Bacillus cereus AH1134]
 gb|EJQ31772.1| hypothetical protein IE9_01961 [Bacillus cereus BAG4X12-1]
 gb|EOP82448.1| short chain dehydrogenase [Bacillus cereus BAG5X12-1]
Length=235

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ +    + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYIFNRHTAPDLIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_029438176.1| short-chain dehydrogenase [Bacillus thuringiensis]
Length=235

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 113/181 (62%), Gaps = 10/181 (6%)
 Frame = +3

Query  81   MSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstss  260
            M   G  K V+ITGV++GLG+A+     + G  I GC RS+DK+  L             
Sbjct  1    MERKGIGKIVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKYYG--------  52

Query  261  sQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVI  440
              N H    +DV ++  V   A+ ++     PD+++NNA  +N+N  LW V  ++F+NV+
Sbjct  53   --NTHDFQIIDVSNSQQVSSWANDILNRHGAPDLLINNASIVNKNAPLWRVTVQEFENVM  110

Query  441  DTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAK  620
            + NV GV NV+R F+P M+ +K+G+I+N+SS WGR   A++APYCASK+AIEG+TKS+A 
Sbjct  111  NINVNGVVNVIREFVPAMVARKEGMIINMSSSWGREGEAELAPYCASKFAIEGITKSMAL  170

Query  621  E  623
            E
Sbjct  171  E  171



>ref|WP_001189477.1| short-chain dehydrogenase [Bacillus cereus]
 gb|EEL82225.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus AH1271]
Length=235

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 112/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+A+     + G  I GC RS+DK+  L               N H  
Sbjct  8    KIVMITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKYYG----------NIHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++     PD+++NNA  +N+N  LW+V A++F+NV++ NV GV
Sbjct  58   QIIDVSDSQQVSSWANYILHRNRAPDLLINNASIVNKNGPLWKVTAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+G+I+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGMIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>gb|EEL56307.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus Rock4-2]
 gb|EEM96316.1| Short-chain dehydrogenase/reductase SDR [Bacillus thuringiensis 
IBL 200]
Length=238

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  11   KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  60

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ +    + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  61   QVIDVSDSQQVNNWANYIFNRHTAPDLIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  120

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  121  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  174



>ref|WP_002119222.1| short-chain dehydrogenase [Bacillus cereus]
 gb|EJQ51037.1| hypothetical protein IEQ_01977 [Bacillus cereus BAG6X1-2]
Length=235

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+A+     + G  I GC RS++K+  L+    +           H  
Sbjct  8    KLVIITGVTQGLGRAMVDRFHELGWNIAGCGRSKNKIEELNKYYGA----------SHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV ++  V E A  ++     PD+++NNA  +N+N  LW+V A++F++V+  NV GV
Sbjct  58   QIIDVSNHHQVSEWASRILNRYRAPDMLINNASIVNQNAPLWKVTAQEFESVMSVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P MI +K+GII+N+SS WGR   A++APYCASK+AIEG+T+S+A E
Sbjct  118  VNVIRAFVPAMIARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITQSMAME  171



>gb|EEL70927.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus AH603]
Length=252

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 119/185 (64%), Gaps = 10/185 (5%)
 Frame = +3

Query  69   EELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasass  248
            EE+ +      K V+ITGV++GLG+A+     + G  I GC RS++K+  L+    ++  
Sbjct  14   EEMKLERNDIGKLVIITGVTQGLGRAMVDRFHELGWKIAGCGRSKNKIEELNKYYGAS--  71

Query  249  stsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDF  428
                    H    +DV ++  V + A  ++     PD+++NNA  +N++  LW+VPA++F
Sbjct  72   --------HDFQIIDVSNHHQVSKWASRIINRYRAPDMLINNASIVNQSAPLWKVPAQEF  123

Query  429  DNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTK  608
            ++V+  NV GV NV+R F+P MI +K+GII+N+SS WGR   A++APYCASK+A+EG+T+
Sbjct  124  ESVMSVNVNGVVNVIRAFVPTMIARKEGIIINMSSSWGREGEAELAPYCASKFAVEGITQ  183

Query  609  SIAKE  623
            S+A E
Sbjct  184  SMAME  188



>ref|WP_033666829.1| short-chain dehydrogenase [Bacillus cereus]
Length=235

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G +I GC RS+DK+  L  +            N H 
Sbjct  7    RKLVIITGVTQGLGRAMVDRFHELGWSICGCGRSKDKIEELKKKYG----------NTHD  56

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+ ++     PD ++NNA  +N+N  +W+V A +F+NV++ NV G
Sbjct  57   FQIIDVSDSQQVSSWANDILNKYRTPDFLINNASIVNQNAPIWKVTAGEFENVMNVNVNG  116

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+D+K+GII+N+SS WGR   A +APYCASK+AIEG+TKS+A E
Sbjct  117  VVNVIRAFVPAMVDRKEGIIINMSSSWGREGEADLAPYCASKFAIEGITKSMALE  171



>ref|WP_016117759.1| short chain dehydrogenase [Bacillus cereus]
 gb|EOP99603.1| short chain dehydrogenase [Bacillus cereus VD140]
Length=235

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + P++++NNA  +N+N +LW++ A++F++V++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNRHTAPNLIINNASIVNQNAQLWKITAQEFESVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVSRKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_001189475.1| short-chain dehydrogenase [Bacillus cereus]
 gb|EJS66857.1| hypothetical protein ICW_03450 [Bacillus cereus BAG2X1-2]
 gb|EJV66318.1| hypothetical protein IEO_01759 [Bacillus cereus BAG6X1-1]
Length=235

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 112/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+A+     + G  I GC RS+DK+  L               N H  
Sbjct  8    KIVMITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKYYG----------NIHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++     PD+++NNA  +N+N  LW+V A++F+NV++ NV GV
Sbjct  58   QIIDVSDSQQVSNWANYILHRYRAPDLLINNASIVNKNAPLWKVTAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+G+I+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGMIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>gb|EJR61835.1| hypothetical protein IIO_02743 [Bacillus cereus VD115]
Length=242

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G +I GC RS+DK+  L  +            N H 
Sbjct  14   RKLVIITGVTQGLGRAMVDRFHELGWSICGCGRSKDKIEELKKKYG----------NTHD  63

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+ ++     PD ++NNA  +N+N  +W+V A +F+NV++ NV G
Sbjct  64   FQIIDVSDSQQVSSWANDILNKYRTPDFLINNASIVNQNAPIWKVTAGEFENVMNVNVNG  123

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+D+K+GII+N+SS WGR   A +APYCASK+AIEG+TKS+A E
Sbjct  124  VVNVIRAFVPAMVDRKEGIIINMSSSWGREGEADLAPYCASKFAIEGITKSMALE  178



>gb|EEK51007.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus ATCC 
10876]
Length=238

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  11   KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  60

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + P++++NNA  +N+N +LW++ A++F++V++ NV GV
Sbjct  61   QVIDVSDSQQVNNWANYILNRHTAPNLIINNASIVNQNAQLWKITAQEFESVMNVNVNGV  120

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  121  VNVIRAFVPAMVSRKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  174



>ref|WP_000823059.1| short chain dehydrogenase [Bacillus cereus]
 gb|KFL72561.1| short chain dehydrogenase family protein [Bacillus cereus ATCC 
10876]
Length=235

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + P++++NNA  +N+N +LW++ A++F++V++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNRHTAPNLIINNASIVNQNAQLWKITAQEFESVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVSRKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>gb|EEK73393.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus AH621]
Length=252

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 119/185 (64%), Gaps = 10/185 (5%)
 Frame = +3

Query  69   EELSMSAPGAHKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasass  248
            EE+ +      K V+ITGV++GLG+A+     + G  I GC RS++K+  L+    ++  
Sbjct  14   EEMKLERNDIGKLVIITGVTQGLGRAMVDRFHELGWKIAGCGRSKNKIEELNKYYGAS--  71

Query  249  stsssQNKHLIMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDF  428
                    H    +DV ++  V + A  ++     PD+++NNA  +N++  LW+VPA++F
Sbjct  72   --------HDFQIIDVSNHHQVSKWASRIINRYRAPDMLINNASIVNQSAPLWKVPAQEF  123

Query  429  DNVIDTNVKGVANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTK  608
            ++V+  NV GV NV+R F+P MI +K+GII+N+SS WGR   A++APYCASK+A+EG+T+
Sbjct  124  ESVMSVNVNGVVNVIRAFVPAMIARKEGIIINMSSSWGREGEAELAPYCASKFAVEGITQ  183

Query  609  SIAKE  623
            S+A E
Sbjct  184  SMAME  188



>ref|WP_001189476.1| short chain dehydrogenase [Bacillus cereus]
Length=235

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 111/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+A+     + G  I GC RS+DK+  L               N H  
Sbjct  8    KIVMITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKYYG----------NIHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++     PD+++NNA  +N+N  LW+V A++F+NV+  NV GV
Sbjct  58   QIIDVSDSQQVSNWANYILHRYRAPDLLINNASIVNKNAPLWKVTAQEFENVMSVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+G+I+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGMIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_000823060.1| short-chain dehydrogenase [Bacillus cereus]
 gb|EJR35012.1| hypothetical protein IIE_02654 [Bacillus cereus VD045]
Length=235

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N + W++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQFWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|XP_008460623.1| PREDICTED: uncharacterized oxidoreductase YMR226C-like [Cucumis 
melo]
Length=170

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +3

Query  354  PDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGVANVLRHFIPLMI-DKKQGIIVNLS  530
            P  +VNNAG IN N ++WE   E+FDNVIDTN+KG ANV+R+FIP MI + K+GIIVN+S
Sbjct  12   PICIVNNAGVINENVKMWEGCVEEFDNVIDTNIKGTANVIRNFIPHMISNNKKGIIVNMS  71

Query  531  SGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            S +GR+AA  ++ Y +SKW IEGL+KS+AKE
Sbjct  72   SIYGRTAAPLISAYGSSKWGIEGLSKSLAKE  102



>ref|WP_033663273.1| short-chain dehydrogenase [Bacillus cereus]
Length=236

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G  I GC RS+DK+  L  +            N H 
Sbjct  7    RKLVIITGVTQGLGRAMVDRFHELGWNICGCGRSKDKIEELKKQYG----------NTHD  56

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+ ++     PD+++NNA  +N+N  +W+V A +F+NV++ NV G
Sbjct  57   FQIIDVSDSQQVSSWANEILTKYRTPDLLINNASIVNQNAPIWKVTAGEFENVMNVNVNG  116

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+D+K+GII+N+SS WGR   A +APYCASK+AIEG+TKS+A E
Sbjct  117  VVNVIRAFVPAMVDRKEGIIINMSSSWGREGEANLAPYCASKFAIEGITKSMALE  171



>ref|WP_017674104.1| short-chain dehydrogenase [Bacillus sp. WBUNB004]
Length=235

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NVI+ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQLWKITAQEFENVINVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_001189474.1| short-chain dehydrogenase [Bacillus cereus]
 gb|EJQ50389.1| hypothetical protein IEI_02796 [Bacillus cereus BAG5X2-1]
Length=235

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 112/174 (64%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+A+     + G  I GC RS+DK+  L               N H  
Sbjct  8    KIVMITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKYYG----------NIHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++     PD+++NNA  +N+N  LW+V A++F+NV++ NV GV
Sbjct  58   QIIDVSDSQQVSNWANYILHRYRAPDLLINNASIVNKNAPLWKVTAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+G+I+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGMIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_002200587.1| short-chain dehydrogenase [Bacillus cereus]
 gb|EJQ43732.1| hypothetical protein IEE_02963 [Bacillus cereus BAG5X1-1]
Length=235

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+A+     + G  I GC RS++K+  L+    +           H  
Sbjct  8    KLVIITGVTQGLGRAMVDRFHELGWKIAGCGRSKNKIEELNKYYGA----------SHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV ++  V E A  ++     PD+++NNA  +N+N  LW+V A++F++V+  NV GV
Sbjct  58   QIIDVSNHHQVSEWASRILNRYRAPDMLINNASIVNQNAPLWKVTAQEFESVMSVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P MI +K+GII+N+SS WGR   A++APYCASK+AIEG+T+S+A E
Sbjct  118  VNVIRAFVPAMIARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITQSMAME  171



>ref|WP_033668583.1| short-chain dehydrogenase [Bacillus cereus]
Length=235

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G  I GC RS+DK+  L  +            N H 
Sbjct  7    RKLVIITGVTQGLGRAMVDRFHELGWNICGCGRSKDKIEELKKQYG----------NTHD  56

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+  +     PD+++NNA  +N+N  +W+V A +F+NV++ NV G
Sbjct  57   FQIIDVSDSQQVSSWANDTLTKYRAPDLLINNASIVNQNAPIWKVTAGEFENVMNVNVNG  116

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+D+K+GII+N+SS WGR A A +APYCASK+AIEG+TKS+A E
Sbjct  117  VVNVIRAFVPAMVDRKEGIIINMSSSWGREAEADLAPYCASKFAIEGITKSMALE  171



>gb|KGT44065.1| short-chain dehydrogenase [Bacillus cereus]
Length=235

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 114/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
               DV  +  V   A+ +    + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVTDVSDSQQVNNWANYIFNRHTAPDLIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_033661284.1| short-chain dehydrogenase [Bacillus cereus]
Length=235

 Score =   118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G  I GC RS+DK+  L  +            N H 
Sbjct  7    RKLVIITGVTQGLGRAMVDRFHELGWNICGCGRSKDKIEELKKQYG----------NTHD  56

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+ ++     PD+++NNA  +N+N  +W+V A +F+NV++ NV G
Sbjct  57   FQIIDVSDSQQVSSWANDILTKYRTPDLLINNASIVNQNAPIWKVTAGEFENVMNVNVNG  116

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+D+K+GII+N+SS WGR   A +APYCASK+AIEG+TKS+A E
Sbjct  117  VVNVIRAFVPAMVDRKEGIIINMSSSWGREGEANLAPYCASKFAIEGITKSMALE  171



>ref|WP_016092666.1| short chain dehydrogenase [Bacillus cereus]
 gb|EOO16605.1| short chain dehydrogenase [Bacillus cereus HuA2-9]
Length=235

 Score =   118 bits (296),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 114/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+A+     + G  I GC RS++K+  L+    +           H  
Sbjct  8    KLVIITGVTQGLGRAMVDRFHELGWNIAGCGRSKNKIEELNKYYGA----------SHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV ++  V + A  ++     PD+++NNA  +N++  LW+VPA++F++V+  NV GV
Sbjct  58   QIIDVSNHHQVSKWASRIINRYRAPDMLINNASIVNQSAPLWKVPAQEFESVMSVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P MI +K+GII+N+SS WGR   A++APYCASK+AIEG+T+S+A E
Sbjct  118  VNVIRAFVPAMIARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITQSMAME  171



>gb|EEL34695.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus Rock3-28]
Length=242

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G  I GC RS+DK+  L  +            N H 
Sbjct  14   RKLVIITGVTQGLGRAMVDRFHELGWNICGCGRSKDKIEELKKQYG----------NTHD  63

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+ ++     PD+++NNA  +N+N  +W+V A +F+NV++ NV G
Sbjct  64   FQIIDVSDSQQVSSWANDILTKYRTPDLLINNASIVNQNAPIWKVTAGEFENVMNVNVNG  123

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+D+K+GII+N+SS WGR   A +APYCASK+AIEG+TKS+A E
Sbjct  124  VVNVIRAFVPAMVDRKEGIIINMSSSWGREGEANLAPYCASKFAIEGITKSMALE  178



>ref|WP_033657367.1| MULTISPECIES: short-chain dehydrogenase [Bacillus cereus group]
Length=235

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G  I GC RS+DK+  L  +            N H 
Sbjct  7    RKLVIITGVTQGLGRAMVDRFHELGWNICGCGRSKDKIEELKKQYG----------NTHD  56

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+ ++     PD+++NNA  +N+N  +W+V A +F+NV++ NV G
Sbjct  57   FQIIDVSDSQQVSSWANDILTKYRAPDLLINNASIVNQNAPIWKVTAGEFENVMNVNVNG  116

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+D+K+GII+N+SS WGR   A +APYCASK+AIEG+TKS+A E
Sbjct  117  VVNVIRAFVPAMVDRKEGIIINMSSSWGREGEADLAPYCASKFAIEGITKSMALE  171



>gb|EEM47916.1| Short-chain dehydrogenase/reductase SDR [Bacillus thuringiensis 
serovar pakistani str. T13001]
Length=238

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  11   KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  60

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  61   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  120

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++ PYCASK+AIEG+TKS+A E
Sbjct  121  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELVPYCASKFAIEGITKSMALE  174



>gb|EOP25422.1| short chain dehydrogenase [Bacillus cereus VD131]
Length=242

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G  I GC RS+DK+  L  +            N H 
Sbjct  14   RKLVIITGVTQGLGRAMVDRFHELGWNICGCGRSKDKIEELKKQYG----------NTHD  63

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+  +     PD+++NNA  +N+N  +W+V A +F+NV++ NV G
Sbjct  64   FQIIDVSDSQQVSSWANDTLTKYRAPDLLINNASIVNQNAPIWKVTAGEFENVMNVNVNG  123

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+D+K+GII+N+SS WGR A A +APYCASK+AIEG+TKS+A E
Sbjct  124  VVNVIRAFVPAMVDRKEGIIINMSSSWGREAEADLAPYCASKFAIEGITKSMALE  178



>ref|WP_006926006.1| 3-oxoacyl-[acyl-carrier protein] reductase [Bacillus sp. GeD10]
 emb|CCW07856.1| 3-oxoacyl-[acyl-carrier protein] reductase [Bacillus sp. GeD10]
Length=235

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+ IEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFTIEGITKSMALE  171



>ref|WP_002136176.1| short-chain dehydrogenase [Bacillus cereus]
 gb|EJV86896.1| hypothetical protein IG3_01786 [Bacillus cereus HuA2-1]
Length=236

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 114/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K V+ITGV++GLG+A+     + G  I+GC RS++K+  L+    +           H  
Sbjct  8    KLVIITGVTQGLGRAMVDRFHELGWNIVGCGRSKNKIEELNKYYGA----------SHDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV ++  V + A  ++     PD+++NNA  +N+N  LW+V A++F++V+  NV GV
Sbjct  58   QIIDVSNHHQVSKWASRILNKYRAPDMLINNASIVNQNAPLWKVTAQEFESVMSVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P MI +K+GII+N+SS WGR   A++APYCASK+A+EG+T+S+A E
Sbjct  118  VNVIRAFVPAMIARKEGIIINMSSSWGREGEAELAPYCASKFAVEGITQSMAME  171



>gb|EEM83894.1| Short-chain dehydrogenase/reductase SDR [Bacillus thuringiensis 
serovar huazhongensis BGSC 4BD1]
Length=238

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS++K+  L  + +            H  
Sbjct  11   KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKNKIEELKKQHSKI----------HDF  60

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  61   QVIDVSDSQQVNNWANYILNRHTAPDLIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  120

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  121  VNVIRAFVPAMVSRKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  174



>ref|WP_000238413.1| short-chain dehydrogenase [Bacillus cereus]
 gb|EEL23129.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus Rock1-3]
 gb|EEL40572.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus Rock3-29]
 gb|EJQ39427.1| hypothetical protein IEC_01507 [Bacillus cereus BAG5O-1]
 gb|EJQ82629.1| hypothetical protein IGK_01525 [Bacillus cereus HuB4-10]
 gb|EJQ89592.1| hypothetical protein IGO_02088 [Bacillus cereus HuB5-5]
 gb|EJR62916.1| hypothetical protein IK3_03236 [Bacillus cereus VD148]
 gb|EJS50132.1| hypothetical protein IC9_03221 [Bacillus cereus BAG1O-2]
 gb|EJV45999.1| hypothetical protein IEA_03234 [Bacillus cereus BAG4X2-1]
 gb|EJV48516.1| hypothetical protein IEK_03191 [Bacillus cereus BAG6O-1]
 gb|EJV93819.1| hypothetical protein IGI_03152 [Bacillus cereus HuB2-9]
 gb|EOP28397.1| short chain dehydrogenase [Bacillus cereus HuA2-3]
 gb|EOP43635.1| short chain dehydrogenase [Bacillus cereus VD214]
 gb|EPF06128.1| hypothetical protein ICQ_02091 [Bacillus cereus BAG2O-2]
 gb|AHA10776.1| 3-oxoacyl-[acyl-carrier protein] reductase [Bacillus toyonensis 
BCT-7112]
Length=242

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 112/175 (64%), Gaps = 10/175 (6%)
 Frame = +3

Query  99   HKTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHL  278
             K V+ITGV++GLG+A+     + G  I GC RS+DK+  L  +            N H 
Sbjct  14   RKLVIITGVTQGLGRAMVDRFHELGWNICGCGRSKDKIEELKKQYG----------NTHD  63

Query  279  IMKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKG  458
               +DV  +  V   A+ ++     PD+++NNA  +N+N  +W+V A +F+NV++ NV G
Sbjct  64   FQIIDVSDSQQVSSWANDILTKYRAPDLLINNASIVNQNAPIWKVTAGEFENVMNVNVNG  123

Query  459  VANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
            V NV+R F+P M+D+K+GII+N+SS WGR   A +APYCASK+AIEG+TKS+A E
Sbjct  124  VVNVIRAFVPAMVDRKEGIIINMSSSWGREGEADLAPYCASKFAIEGITKSMALE  178



>ref|WP_000823069.1| MULTISPECIES: short chain dehydrogenase [Bacillus]
 emb|CDN35739.1| unnamed protein product [Bacillus thuringiensis DB27]
 gb|AHX18419.1| short-chain dehydrogenase [Bacillus bombysepticus str. Wang]
Length=235

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS++K+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKNKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V + A+ ++     PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNDWANYILNRHMAPDLIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_000823067.1| MULTISPECIES: short-chain dehydrogenase [Bacillus cereus group]
 gb|EJR23593.1| hypothetical protein IIA_02091 [Bacillus cereus VD014]
 gb|EJR79787.1| hypothetical protein IK7_03346 [Bacillus cereus VD156]
Length=235

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS++K+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKNKIEELKKQHSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNRHTAPDLIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVSRKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  171



>ref|WP_000823064.1| MULTISPECIES: short-chain dehydrogenase [Bacillus cereus group]
 gb|EJR77926.1| hypothetical protein IK5_00227 [Bacillus cereus VD154]
 gb|KIU76050.1| Short chain dehydrogenase [Bacillus thuringiensis Sbt003]
Length=235

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 115/174 (66%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  8    KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  57

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + PD+++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  58   QVIDVSDSQQVNNWANYILNTHTAPDMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  117

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++ PYCASK+AIEG+TKS+A E
Sbjct  118  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELVPYCASKFAIEGITKSMALE  171



>gb|EEK95073.1| Short-chain dehydrogenase/reductase SDR [Bacillus cereus BDRD-ST24]
Length=238

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +3

Query  102  KTVLITGVSrglgkalalelakrgHTIIGCSRSQDKlnslhaelasassstsssQNKHLI  281
            K+V+ITGV++GLG+A+     + G  I GC RS+DK+  L  + +            H  
Sbjct  11   KSVIITGVTQGLGRAMVDRFHELGWNIYGCGRSKDKIEELKKQYSKI----------HDF  60

Query  282  MKVDVRSNSSVEELAHAVMENKSIPDIVVNNAGTINRNNRLWEVPAEDFDNVIDTNVKGV  461
              +DV  +  V   A+ ++   + P++++NNA  +N+N +LW++ A++F+NV++ NV GV
Sbjct  61   QVIDVSDSQQVNNWANYILNTHTAPNMIINNASIVNQNAQLWKITAQEFENVMNVNVNGV  120

Query  462  ANVLRHFIPLMIDKKQGIIVNLSSGWGRSAAAQVAPYCASKWAIEGLTKSIAKE  623
             NV+R F+P M+ +K+GII+N+SS WGR   A++APYCASK+AIEG+TKS+A E
Sbjct  121  VNVIRAFVPAMVARKEGIIINMSSSWGREGEAELAPYCASKFAIEGITKSMALE  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380