BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L24

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773539.1|  PREDICTED: protein YLS7                          74.7    2e-12   Nicotiana sylvestris
gb|EYU25007.1|  hypothetical protein MIMGU_mgv1a004026mg              73.6    6e-12   Erythranthe guttata [common monkey flower]
ref|XP_009601844.1|  PREDICTED: protein YLS7                          72.4    1e-11   Nicotiana tomentosiformis
ref|XP_006348059.1|  PREDICTED: uncharacterized protein LOC102605...  70.9    5e-11   Solanum tuberosum [potatoes]
ref|XP_004234160.1|  PREDICTED: protein YLS7                          69.7    1e-10   Solanum lycopersicum
ref|XP_011101136.1|  PREDICTED: protein YLS7-like                     68.2    3e-10   Sesamum indicum [beniseed]
ref|XP_008446697.1|  PREDICTED: protein trichome birefringence-li...  66.6    1e-09   Cucumis melo [Oriental melon]
gb|KGN52141.1|  hypothetical protein Csa_5G611720                     64.3    6e-09   Cucumis sativus [cucumbers]
emb|CDP05671.1|  unnamed protein product                              64.3    7e-09   Coffea canephora [robusta coffee]
ref|XP_010109099.1|  hypothetical protein L484_012975                 63.5    1e-08   Morus notabilis
ref|XP_002510907.1|  conserved hypothetical protein                   62.4    3e-08   
ref|XP_010035007.1|  PREDICTED: protein YLS7                          61.6    4e-08   Eucalyptus grandis [rose gum]
ref|XP_002268776.2|  PREDICTED: protein YLS7 isoform X1               61.6    5e-08   Vitis vinifera
ref|XP_010662376.1|  PREDICTED: protein YLS7 isoform X2               61.2    6e-08   Vitis vinifera
emb|CAN70095.1|  hypothetical protein VITISV_014863                   59.7    2e-07   Vitis vinifera
ref|XP_010671971.1|  PREDICTED: protein YLS7-like isoform X1          59.7    2e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010671972.1|  PREDICTED: protein YLS7-like isoform X2          59.7    2e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011041688.1|  PREDICTED: protein YLS7                          59.3    2e-07   Populus euphratica
ref|XP_002322423.2|  hypothetical protein POPTR_0015s14330g           59.3    3e-07   
ref|XP_004135380.1|  PREDICTED: uncharacterized protein LOC101207313  58.9    4e-07   
emb|CDP05294.1|  unnamed protein product                              56.6    2e-06   Coffea canephora [robusta coffee]
ref|XP_002318271.2|  leaf senescence family protein                   55.5    4e-06   
ref|XP_011029985.1|  PREDICTED: protein trichome birefringence-li...  54.3    1e-05   Populus euphratica
ref|XP_004495424.1|  PREDICTED: uncharacterized protein LOC101492...  53.9    1e-05   Cicer arietinum [garbanzo]
ref|XP_004495423.1|  PREDICTED: uncharacterized protein LOC101492...  53.5    2e-05   Cicer arietinum [garbanzo]
gb|KDO65386.1|  hypothetical protein CISIN_1g009529mg                 52.8    4e-05   Citrus sinensis [apfelsine]
ref|XP_006421756.1|  hypothetical protein CICLE_v10004704mg           52.8    4e-05   Citrus clementina [clementine]
ref|XP_007038468.1|  Trichome birefringence-like 18 isoform 1         51.2    1e-04   
ref|XP_006490253.1|  PREDICTED: protein YLS7-like                     50.8    1e-04   Citrus sinensis [apfelsine]
ref|XP_010536521.1|  PREDICTED: protein trichome birefringence-li...  50.4    2e-04   Tarenaya hassleriana [spider flower]
gb|KJB52917.1|  hypothetical protein B456_008G283500                  50.1    3e-04   Gossypium raimondii
ref|XP_004309268.1|  PREDICTED: protein trichome birefringence-li...  50.1    3e-04   Fragaria vesca subsp. vesca



>ref|XP_009773539.1| PREDICTED: protein YLS7 [Nicotiana sylvestris]
 ref|XP_009773540.1| PREDICTED: protein YLS7 [Nicotiana sylvestris]
Length=545

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  357  MTTASAKDSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGV  521
            M+T S+KD++T SYP++L+SIV +VGGLAVFLILASSFL S PI +AV  ++YGV
Sbjct  1    MSTFSSKDTSTLSYPKSLLSIVTTVGGLAVFLILASSFLVSQPIGAAVHEYFYGV  55



>gb|EYU25007.1| hypothetical protein MIMGU_mgv1a004026mg [Erythranthe guttata]
Length=548

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +3

Query  357  MTTASAKDSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            M++AS K+ +  +YP+TL+SIV S GGLA+FL+LAS+ L S PI S VRG++YGVD+S
Sbjct  1    MSSASTKELSKNAYPKTLLSIVASFGGLAMFLLLASTVLVSQPIGSTVRGYFYGVDSS  58



>ref|XP_009601844.1| PREDICTED: protein YLS7 [Nicotiana tomentosiformis]
 ref|XP_009601845.1| PREDICTED: protein YLS7 [Nicotiana tomentosiformis]
Length=546

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  357  MTTASAKDSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGV  521
            M++ S+KD++T SYP++L+SIV +VGGLAVFLILASSFL S PI +AV  ++YGV
Sbjct  1    MSSFSSKDASTLSYPKSLLSIVTTVGGLAVFLILASSFLVSQPIGTAVHEYFYGV  55



>ref|XP_006348059.1| PREDICTED: uncharacterized protein LOC102605748 isoform X1 [Solanum 
tuberosum]
 ref|XP_006348060.1| PREDICTED: uncharacterized protein LOC102605748 isoform X2 [Solanum 
tuberosum]
Length=556

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +3

Query  357  MTTASAKDSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGV  521
            M++ S+KD +  SYP++L+SIV +VGGLAVFLILASSFL S PI +AV  ++YGV
Sbjct  1    MSSFSSKDPSALSYPKSLLSIVTTVGGLAVFLILASSFLVSQPIGAAVHEYFYGV  55



>ref|XP_004234160.1| PREDICTED: protein YLS7 [Solanum lycopersicum]
 ref|XP_010317468.1| PREDICTED: protein YLS7 [Solanum lycopersicum]
Length=556

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/55 (62%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  357  MTTASAKDSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGV  521
            M++ S KD +  SYP++L+SIV +VGGLAVFLILASSFL S PI +AV  ++YGV
Sbjct  1    MSSFSPKDPSVLSYPKSLLSIVTTVGGLAVFLILASSFLVSQPIGAAVHEYFYGV  55



>ref|XP_011101136.1| PREDICTED: protein YLS7-like [Sesamum indicum]
Length=563

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  357  MTTASAKDSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
            MT  S K+S   ++P++L+SIV SVGGLA+FLI+AS+ L S PI S +RG +YGVD
Sbjct  1    MTLVSTKESTKTAHPKSLLSIVASVGGLALFLIIASTLLVSQPIGSTIRGFFYGVD  56



>ref|XP_008446697.1| PREDICTED: protein trichome birefringence-like 18 [Cucumis melo]
 ref|XP_008446698.1| PREDICTED: protein trichome birefringence-like 18 [Cucumis melo]
 ref|XP_008446699.1| PREDICTED: protein trichome birefringence-like 18 [Cucumis melo]
Length=581

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  357  MTTASAKDSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            MT A  K S   +YPRT+  I ISVGGLA+FLI  S FL S PI S +RG++YGVD+S
Sbjct  1    MTWAMRKGSQMAAYPRTISWIAISVGGLAIFLIFGSWFLVSYPIGSIMRGYFYGVDSS  58



>gb|KGN52141.1| hypothetical protein Csa_5G611720 [Cucumis sativus]
Length=581

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  357  MTTASAKDSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            MT A  K S   +YPRT+  I ISVGGLA+FLI  S FL S PI S +RG++YGV++S
Sbjct  1    MTWAMRKGSQMAAYPRTISWIAISVGGLAIFLIFGSWFLVSYPIGSIMRGYFYGVNSS  58



>emb|CDP05671.1| unnamed protein product [Coffea canephora]
Length=509

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  357  MTTASAKDSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGV  521
            M+++S K+    +YPRTLVSIV S GGLAVFL++ASS L SGPI S    ++YGV
Sbjct  1    MSSSSFKEIPAMAYPRTLVSIVASAGGLAVFLLIASSLLISGPIGSTFSSYFYGV  55



>ref|XP_010109099.1| hypothetical protein L484_012975 [Morus notabilis]
 gb|EXC20899.1| hypothetical protein L484_012975 [Morus notabilis]
Length=609

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +3

Query  360  TTASAKDSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            T++S    A  +YPRT   I++SVGGLAVFLIL S  L S PI S VRG++YGVD S
Sbjct  4    TSSSKGYLAINAYPRTFSWILLSVGGLAVFLILGSCILLSNPIGSTVRGYFYGVDRS  60



>ref|XP_002510907.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51509.1| conserved hypothetical protein [Ricinus communis]
Length=589

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  393  SYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            ++PR+L S+ +SVGGLA+FLILAS  L S PI S V G++YGVDNS
Sbjct  14   AFPRSLSSMAVSVGGLAIFLILASLLLVSYPIGSTVHGYFYGVDNS  59



>ref|XP_010035007.1| PREDICTED: protein YLS7 [Eucalyptus grandis]
 gb|KCW46269.1| hypothetical protein EUGRSUZ_K00144 [Eucalyptus grandis]
Length=542

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 42/57 (74%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  MTTASAK-DSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
            MT +S K  SA  S+PR+L  I +++GGLAVFL++AS  L S P+ S VRG++YGVD
Sbjct  1    MTMSSPKGSSAISSFPRSLSVITVAIGGLAVFLMVASLLLVSHPVGSKVRGYFYGVD  57



>ref|XP_002268776.2| PREDICTED: protein YLS7 isoform X1 [Vitis vinifera]
Length=548

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +3

Query  348  LKRMTTASAKDSATGS-YPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
             K MT AS +   T S +PR+L SI +SVGGLA+FLI AS  L S PI S VRG++YG D
Sbjct  2    FKAMTLASPRGFPTMSAFPRSLSSIAVSVGGLALFLIFASCLLLSYPIGSTVRGYFYGDD  61



>ref|XP_010662376.1| PREDICTED: protein YLS7 isoform X2 [Vitis vinifera]
Length=546

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +3

Query  348  LKRMTTASAKDSATGS-YPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
             K MT AS +   T S +PR+L SI +SVGGLA+FLI AS  L S PI S VRG++YG D
Sbjct  2    FKAMTLASPRGFPTMSAFPRSLSSIAVSVGGLALFLIFASCLLLSYPIGSTVRGYFYGDD  61



>emb|CAN70095.1| hypothetical protein VITISV_014863 [Vitis vinifera]
Length=539

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  MTTASAKDSATGS-YPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
            MT AS +   T S +PR+L SI +SVGGLA+FLI AS  L S PI S VRG++YG D
Sbjct  1    MTLASPRGFPTMSAFPRSLSSIAVSVGGLALFLIFASCLLLSYPIGSTVRGYFYGDD  57



>ref|XP_010671971.1| PREDICTED: protein YLS7-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=585

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  357  MTTASAKDSA-TGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            M   S+KD A T +YPR L SI+ISVG LAVF+  AS  L S PI + V+ ++YGVD +
Sbjct  1    MAVGSSKDYASTSNYPRALSSIIISVGLLAVFITFASWILLSYPIGTVVQSYFYGVDQT  59



>ref|XP_010671972.1| PREDICTED: protein YLS7-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=574

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  357  MTTASAKDSA-TGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            M   S+KD A T +YPR L SI+ISVG LAVF+  AS  L S PI + V+ ++YGVD +
Sbjct  1    MAVGSSKDYASTSNYPRALSSIIISVGLLAVFITFASWILLSYPIGTVVQSYFYGVDQT  59



>ref|XP_011041688.1| PREDICTED: protein YLS7 [Populus euphratica]
 ref|XP_011041689.1| PREDICTED: protein YLS7 [Populus euphratica]
 ref|XP_011041690.1| PREDICTED: protein YLS7 [Populus euphratica]
Length=555

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +3

Query  384  ATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            A  ++PR+L S+  SVGGLA+FL++AS  L S PI S VRG++YG+D+S
Sbjct  17   AMAAFPRSLSSMAASVGGLALFLVIASLLLVSYPIGSTVRGYFYGIDSS  65



>ref|XP_002322423.2| hypothetical protein POPTR_0015s14330g [Populus trichocarpa]
 gb|EEF06550.2| hypothetical protein POPTR_0015s14330g [Populus trichocarpa]
Length=555

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +3

Query  384  ATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            A  ++PR+L S+  SVGGLA+FL++AS  L S PI S VRG++YG+D+S
Sbjct  17   AMAAFPRSLSSMAASVGGLALFLVIASLLLVSYPIGSTVRGYFYGIDSS  65



>ref|XP_004135380.1| PREDICTED: uncharacterized protein LOC101207313 [Cucumis sativus]
Length=571

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  393  SYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            +YPRT+  I ISVGGLA+FLI  S FL S PI S +RG++YGV++S
Sbjct  3    AYPRTISWIAISVGGLAIFLIFGSWFLVSYPIGSIMRGYFYGVNSS  48



>emb|CDP05294.1| unnamed protein product [Coffea canephora]
Length=589

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  357  MTTASAKDSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASA  497
            M + S K +A  +YP+TL+SIV S+GGLA+FLILASS L SGP  S 
Sbjct  1    MASGSRKKTAAMAYPKTLLSIVASLGGLAIFLILASSSLISGPFRSG  47



>ref|XP_002318271.2| leaf senescence family protein [Populus trichocarpa]
 gb|EEE96491.2| leaf senescence family protein [Populus trichocarpa]
Length=482

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = +3

Query  351  KRMTTASAKDSAT---GSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGV  521
            K M  AS+   +     ++PR+L S+  SVGGLAVFL++AS  L S PI S V G++YG+
Sbjct  9    KAMALASSPKESNPTMAAFPRSLSSMAASVGGLAVFLVIASLLLVSYPIGSTVSGYFYGI  68

Query  522  DNS  530
            D++
Sbjct  69   DSA  71



>ref|XP_011029985.1| PREDICTED: protein trichome birefringence-like 18 [Populus euphratica]
 ref|XP_011029986.1| PREDICTED: protein trichome birefringence-like 18 [Populus euphratica]
Length=561

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  393  SYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            ++PR+L S+  S+GGLAVFL++AS  L S PI S V G++YG+D++
Sbjct  26   AFPRSLSSMAASIGGLAVFLVIASLLLVSYPIGSTVSGYFYGMDST  71



>ref|XP_004495424.1| PREDICTED: uncharacterized protein LOC101492967 isoform X2 [Cicer 
arietinum]
Length=562

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +3

Query  357  MTTASAKDSATGSY-PRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            MT  + K S   SY PR+L  IV+ +G LA+FLI AS  L S P+ S V G++YG+D+S
Sbjct  1    MTWGTPKGSPKMSYHPRSLSWIVVLLGALAIFLIYASCVLVSSPVGSTVHGYFYGIDSS  59



>ref|XP_004495423.1| PREDICTED: uncharacterized protein LOC101492967 isoform X1 [Cicer 
arietinum]
Length=598

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +3

Query  357  MTTASAKDSATGSY-PRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVDNS  530
            MT  + K S   SY PR+L  IV+ +G LA+FLI AS  L S P+ S V G++YG+D+S
Sbjct  1    MTWGTPKGSPKMSYHPRSLSWIVVLLGALAIFLIYASCVLVSSPVGSTVHGYFYGIDSS  59



>gb|KDO65386.1| hypothetical protein CISIN_1g009529mg [Citrus sinensis]
Length=532

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  381  SATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
            S   ++PR+L SI++SVGGLA+FL+ AS  L S PI S VR ++ G D
Sbjct  11   SPMAAFPRSLSSILVSVGGLAMFLVFASLLLVSSPIGSTVRVYFTGFD  58



>ref|XP_006421756.1| hypothetical protein CICLE_v10004704mg [Citrus clementina]
 gb|ESR34996.1| hypothetical protein CICLE_v10004704mg [Citrus clementina]
Length=533

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  381  SATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
            S   ++PR+L SI++SVGGLA+FL+ AS  L S PI S VR ++ G D
Sbjct  11   SPMAAFPRSLSSILVSVGGLAMFLVFASLLLVSSPIGSTVRVYFTGFD  58



>ref|XP_007038468.1| Trichome birefringence-like 18 isoform 1 [Theobroma cacao]
 ref|XP_007038469.1| Trichome birefringence-like 18 isoform 1 [Theobroma cacao]
 ref|XP_007038470.1| Trichome birefringence-like 18 isoform 1 [Theobroma cacao]
 gb|EOY22969.1| Trichome birefringence-like 18 isoform 1 [Theobroma cacao]
 gb|EOY22970.1| Trichome birefringence-like 18 isoform 1 [Theobroma cacao]
 gb|EOY22971.1| Trichome birefringence-like 18 isoform 1 [Theobroma cacao]
Length=544

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  MTTASAKDS-ATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
            M+ AS K S    ++PR+L SI  S+  LA+FLI AS  L S PI S VRG++Y VD
Sbjct  1    MSLASPKGSPKMAAFPRSLSSIAASLAVLAMFLIFASWLLVSYPIGSTVRGYFYSVD  57



>ref|XP_006490253.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=532

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  381  SATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
            S   ++P++L SI++SVGGLA+FL+ AS  L S PI S VR ++ G D
Sbjct  11   SPMAAFPQSLSSILVSVGGLAMFLVFASLLLVSSPIGSTVRVYFTGFD  58



>ref|XP_010536521.1| PREDICTED: protein trichome birefringence-like 18 [Tarenaya hassleriana]
Length=555

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  MTTASAKDSAT-GSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
            MT AS + S T   +PR + +I I++GGLA F IL S  L S PI S+  G++YG++
Sbjct  1    MTLASPRVSLTMAGFPRKVSTIAIAIGGLASFFILGSLLLFSYPIGSSFSGYFYGME  57



>gb|KJB52917.1| hypothetical protein B456_008G283500 [Gossypium raimondii]
 gb|KJB52918.1| hypothetical protein B456_008G283500 [Gossypium raimondii]
Length=532

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  MTTASAK-DSATGSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
            MT AS K +    ++P  L SI  SV  LA+FLI AS  L S PI SA+RG++YGVD
Sbjct  1    MTLASPKGNGKMVAFPWGLTSIAASVVILAMFLIFASWLLVSFPIGSAIRGYFYGVD  57



>ref|XP_004309268.1| PREDICTED: protein trichome birefringence-like 18 [Fragaria vesca 
subsp. vesca]
Length=588

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = +3

Query  357  MTTASAKDSAT-GSYPRTLVSIVISVGGLAVFLILASSFLTSGPIASAVRGHYYGVD  524
            MT A+ K S +   YP+ +  I +SV GLA+FL+ AS  L S PI S V G++YGVD
Sbjct  1    MTLATPKGSVSMNQYPKIVSWIGVSVAGLAMFLLFASWVLVSFPIGSTVSGYFYGVD  57



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400