BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L21

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612279.1|  PREDICTED: oxygen-evolving enhancer protein ...    281   2e-91   Nicotiana tomentosiformis
ref|XP_009768511.1|  PREDICTED: oxygen-evolving enhancer protein ...    278   4e-90   Nicotiana sylvestris
gb|KDP31833.1|  hypothetical protein JCGZ_12294                         278   7e-90   Jatropha curcas
ref|XP_009604683.1|  PREDICTED: oxygen-evolving enhancer protein ...    277   1e-89   Nicotiana tomentosiformis
ref|XP_011004600.1|  PREDICTED: oxygen-evolving enhancer protein ...    277   1e-89   Populus euphratica
gb|AAX53163.1|  chloroplast photosynthetic oxygen-evolving protei...    277   1e-89   Nicotiana benthamiana
ref|XP_009759927.1|  PREDICTED: oxygen-evolving enhancer protein ...    276   2e-89   Nicotiana sylvestris
gb|AFH58000.1|  chloroplast PsbO4 precursor                             276   2e-89   Nicotiana benthamiana
ref|XP_002307234.1|  O2 evolving complex 33kD family protein            276   2e-89   Populus trichocarpa [western balsam poplar]
ref|XP_011099252.1|  PREDICTED: oxygen-evolving enhancer protein ...    276   3e-89   Sesamum indicum [beniseed]
ref|XP_011085527.1|  PREDICTED: oxygen-evolving enhancer protein ...    276   4e-89   Sesamum indicum [beniseed]
gb|AFH57998.1|  chloroplast PsbO2 precursor                             275   7e-89   Nicotiana benthamiana
gb|ABK96748.1|  unknown                                                 275   1e-88   Populus trichocarpa x Populus deltoides
gb|ADZ75466.1|  oxygen evolving enhancer protein 1                      275   1e-88   Litchi chinensis [litchi]
gb|AFH57997.1|  chloroplast PsbO1 precursor                             274   2e-88   Nicotiana benthamiana
ref|XP_009379152.1|  PREDICTED: oxygen-evolving enhancer protein ...    274   2e-88   Pyrus x bretschneideri [bai li]
ref|XP_008338186.1|  PREDICTED: oxygen-evolving enhancer protein ...    274   2e-88   Malus domestica [apple tree]
ref|XP_007047093.1|  Photosystem II subunit O-2                         273   4e-88   
gb|AFH57999.1|  chloroplast PsbO3 precursor                             273   4e-88   Nicotiana benthamiana
ref|XP_009376463.1|  PREDICTED: oxygen-evolving enhancer protein ...    272   1e-87   Pyrus x bretschneideri [bai li]
ref|XP_009341905.1|  PREDICTED: oxygen-evolving enhancer protein ...    272   1e-87   Pyrus x bretschneideri [bai li]
ref|XP_008241598.1|  PREDICTED: oxygen-evolving enhancer protein ...    270   5e-87   Prunus mume [ume]
gb|AEO21912.1|  chloroplast oxygen-evolving enhancer protein 1          270   9e-87   Dimocarpus longan [longan]
ref|XP_006344816.1|  PREDICTED: oxygen-evolving enhancer protein ...    269   1e-86   Solanum tuberosum [potatoes]
ref|XP_004233415.1|  PREDICTED: oxygen-evolving enhancer protein ...    269   1e-86   
ref|XP_002274796.1|  PREDICTED: oxygen-evolving enhancer protein ...    269   2e-86   Vitis vinifera
ref|XP_007202212.1|  hypothetical protein PRUPE_ppa008420mg             268   3e-86   Prunus persica
ref|XP_009412420.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    269   3e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002522386.1|  Oxygen-evolving enhancer protein 1, chloropl...    268   4e-86   Ricinus communis
gb|AAS55410.1|  photosystem II protein                                  265   5e-86   Brassica rapa
ref|NP_001239736.1|  uncharacterized protein LOC100798485               267   1e-85   Glycine max [soybeans]
ref|XP_010255017.1|  PREDICTED: oxygen-evolving enhancer protein ...    267   1e-85   Nelumbo nucifera [Indian lotus]
sp|P26320.1|PSBO_SOLTU  RecName: Full=Oxygen-evolving enhancer pr...    266   3e-85   Solanum tuberosum [potatoes]
dbj|BAA96365.3|  oxygen evolving enhancer protein 1 precursor           265   4e-85   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_002310188.1|  O2 evolving complex 33kD family protein            265   5e-85   Populus trichocarpa [western balsam poplar]
ref|XP_011025676.1|  PREDICTED: oxygen-evolving enhancer protein ...    265   6e-85   Populus euphratica
ref|XP_010924166.1|  PREDICTED: oxygen-evolving enhancer protein ...    265   9e-85   Elaeis guineensis
gb|KJB43586.1|  hypothetical protein B456_007G208000                    264   1e-84   Gossypium raimondii
emb|CAA35601.1|  33kDa precursor protein of oxygen-evolving complex     263   3e-84   Solanum tuberosum [potatoes]
ref|XP_006856169.1|  hypothetical protein AMTR_s00059p00176390          263   3e-84   Amborella trichopoda
emb|CDP02430.1|  unnamed protein product                                263   4e-84   Coffea canephora [robusta coffee]
gb|KDO79409.1|  hypothetical protein CISIN_1g019870mg                   263   5e-84   Citrus sinensis [apfelsine]
gb|KHG13438.1|  Oxygen-evolving enhancer 1, chloroplastic               263   5e-84   Gossypium arboreum [tree cotton]
ref|XP_006338257.1|  PREDICTED: chloroplast manganese stabilizing...    263   5e-84   Solanum tuberosum [potatoes]
ref|XP_004300575.1|  PREDICTED: oxygen-evolving enhancer protein ...    262   9e-84   Fragaria vesca subsp. vesca
ref|XP_006425778.1|  hypothetical protein CICLE_v10026034mg             262   1e-83   Citrus clementina [clementine]
ref|XP_004232077.1|  PREDICTED: oxygen-evolving enhancer protein ...    261   2e-83   
ref|XP_010263833.1|  PREDICTED: oxygen-evolving enhancer protein ...    261   3e-83   Nelumbo nucifera [Indian lotus]
ref|XP_009103510.1|  PREDICTED: oxygen-evolving enhancer protein ...    261   3e-83   Brassica rapa
ref|XP_009758248.1|  PREDICTED: oxygen-evolving enhancer protein ...    260   4e-83   Nicotiana sylvestris
ref|XP_006280785.1|  hypothetical protein CARUB_v10026754mg             260   5e-83   Capsella rubella
ref|XP_007156865.1|  hypothetical protein PHAVU_002G024000g             260   7e-83   Phaseolus vulgaris [French bean]
gb|KFK34331.1|  hypothetical protein AALP_AA5G131000                    260   7e-83   Arabis alpina [alpine rockcress]
gb|EYU44326.1|  hypothetical protein MIMGU_mgv1a009768mg                259   2e-82   Erythranthe guttata [common monkey flower]
gb|ADR71223.1|  chloroplast manganese stabilizing protein               258   2e-82   Solanum tuberosum [potatoes]
ref|XP_008800919.1|  PREDICTED: oxygen-evolving enhancer protein ...    258   3e-82   Phoenix dactylifera
ref|XP_006393852.1|  hypothetical protein EUTSA_v10004563mg             258   3e-82   Eutrema salsugineum [saltwater cress]
ref|XP_010444775.1|  PREDICTED: oxygen-evolving enhancer protein ...    258   4e-82   Camelina sativa [gold-of-pleasure]
gb|AAD38521.1|AF139818_1  33 kDa oxygen evolving protein of photo...    256   4e-82   Brassica napus [oilseed rape]
emb|CBI19622.3|  unnamed protein product                                256   4e-82   Vitis vinifera
ref|XP_009130561.1|  PREDICTED: oxygen-evolving enhancer protein ...    258   5e-82   Brassica rapa
ref|XP_002877774.1|  photosystem II subunit O-2                         257   6e-82   Arabidopsis lyrata subsp. lyrata
emb|CDY30764.1|  BnaC07g16640D                                          257   7e-82   Brassica napus [oilseed rape]
ref|XP_002866754.1|  oxygen-evolving enhancer 33                        257   1e-81   Arabidopsis lyrata subsp. lyrata
ref|XP_003637254.1|  Oxygen-evolving enhancer protein                   254   1e-81   
ref|XP_010550399.1|  PREDICTED: oxygen-evolving enhancer protein ...    256   2e-81   Tarenaya hassleriana [spider flower]
ref|XP_010028333.1|  PREDICTED: oxygen-evolving enhancer protein ...    256   2e-81   Eucalyptus grandis [rose gum]
ref|NP_190651.1|  oxygen-evolving enhancer protein 1-2                  256   2e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484624.1|  PREDICTED: oxygen-evolving enhancer protein ...    256   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_009112310.1|  PREDICTED: oxygen-evolving enhancer protein ...    256   2e-81   Brassica rapa
ref|XP_009387680.1|  PREDICTED: oxygen-evolving enhancer protein ...    250   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGV54778.1|  oxygen-evolving enhancer protein 1                      256   2e-81   Phaseolus vulgaris [French bean]
emb|CDX81388.1|  BnaC09g07990D                                          256   2e-81   
ref|XP_002283699.1|  PREDICTED: oxygen-evolving enhancer protein ...    256   3e-81   Vitis vinifera
emb|CAN79166.1|  hypothetical protein VITISV_019248                     255   3e-81   Vitis vinifera
ref|XP_010103689.1|  Oxygen-evolving enhancer protein 1                 255   4e-81   Morus notabilis
gb|AAT65501.1|  photosystem II protein                                  256   4e-81   Brassica oleracea
emb|CDY50981.1|  BnaC02g48890D                                          255   5e-81   Brassica napus [oilseed rape]
ref|XP_006403995.1|  hypothetical protein EUTSA_v10010535mg             255   6e-81   Eutrema salsugineum [saltwater cress]
ref|XP_003636084.1|  Oxygen-evolving enhancer protein                   254   1e-80   
gb|KFK28330.1|  hypothetical protein AALP_AA8G502100                    254   1e-80   Arabis alpina [alpine rockcress]
gb|ABG25041.1|  33kDa precursor protein of oxygen-evolving complex      249   1e-80   Nicotiana tabacum [American tobacco]
gb|AAM65169.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    254   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001241522.1|  uncharacterized protein LOC100820458               253   2e-80   Glycine max [soybeans]
ref|XP_007155994.1|  hypothetical protein PHAVU_003G249800g             253   2e-80   Phaseolus vulgaris [French bean]
ref|NP_001043134.1|  Os01g0501800                                       253   2e-80   
ref|XP_006291313.1|  hypothetical protein CARUB_v10017447mg             254   3e-80   
gb|AAK49614.1|AF372898_1  AT5g66570/K1F13_25                            253   5e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201458.1|  PS II oxygen-evolving complex 1                       252   6e-80   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96774.1|  33 kDa polypeptide of oxygen-evolving complex           252   8e-80   Arabidopsis thaliana [mouse-ear cress]
gb|EEC70714.1|  hypothetical protein OsI_02088                          251   1e-79   Oryza sativa Indica Group [Indian rice]
ref|XP_010924332.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    251   1e-79   Elaeis guineensis
gb|AAM96957.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    251   1e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AAL08257.1|  AT5g66570/K1F13_25                                      251   1e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548008.1|  PREDICTED: oxygen-evolving enhancer protein ...    251   2e-79   Glycine max [soybeans]
ref|NP_001240871.1|  uncharacterized protein LOC100811386               250   5e-79   Glycine max [soybeans]
gb|ACS34663.1|  chloroplast manganese stabilizing protein-II            248   7e-79   Solanum tuberosum [potatoes]
ref|XP_010465252.1|  PREDICTED: oxygen-evolving enhancer protein ...    249   9e-79   Camelina sativa [gold-of-pleasure]
ref|XP_004968772.1|  PREDICTED: oxygen-evolving enhancer protein ...    249   1e-78   Setaria italica
gb|AFW90569.1|  chloroplast manganese stabilizing protein-II            248   1e-78   Solanum tuberosum [potatoes]
ref|XP_010424899.1|  PREDICTED: oxygen-evolving enhancer protein ...    249   2e-78   Camelina sativa [gold-of-pleasure]
sp|P14226.1|PSBO_PEA  RecName: Full=Oxygen-evolving enhancer prot...    248   3e-78   Pisum sativum [garden pea]
gb|ABG25040.1|  33kDa precursor protein of oxygen-evolving complex      243   4e-78   Solanum lycopersicum
ref|XP_008440181.1|  PREDICTED: oxygen-evolving enhancer protein ...    248   5e-78   Cucumis melo [Oriental melon]
ref|XP_008787656.1|  PREDICTED: oxygen-evolving enhancer protein ...    247   5e-78   Phoenix dactylifera
ref|XP_006644206.1|  PREDICTED: oxygen-evolving enhancer protein ...    247   5e-78   Oryza brachyantha
ref|XP_009149414.1|  PREDICTED: oxygen-evolving enhancer protein ...    247   9e-78   Brassica rapa
emb|CAA36675.1|  33 kDa oxygen-evolving protein                         247   9e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673597.1|  PREDICTED: oxygen-evolving enhancer protein ...    247   9e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010503753.1|  PREDICTED: oxygen-evolving enhancer protein ...    247   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_003611860.1|  Oxygen evolving enhancer protein                   246   1e-77   Medicago truncatula
ref|XP_004509219.1|  PREDICTED: oxygen-evolving enhancer protein ...    246   2e-77   
ref|XP_004141946.1|  PREDICTED: oxygen-evolving enhancer protein ...    246   3e-77   Cucumis sativus [cucumbers]
emb|CDY33308.1|  BnaA01g19750D                                          247   3e-77   Brassica napus [oilseed rape]
ref|XP_009616099.1|  PREDICTED: oxygen-evolving enhancer protein ...    245   4e-77   
emb|CDY26519.1|  BnaC01g23800D                                          246   7e-77   Brassica napus [oilseed rape]
ref|XP_010515458.1|  PREDICTED: oxygen-evolving enhancer protein ...    244   1e-76   Camelina sativa [gold-of-pleasure]
gb|EMS63035.1|  Oxygen-evolving enhancer protein 1, chloroplastic       243   2e-76   Triticum urartu
gb|AFW69213.1|  oxygen-evolving enhancer protein 1                      244   3e-76   
dbj|BAJ89638.1|  predicted protein                                      243   4e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P27665.1|PSBO_WHEAT  RecName: Full=Oxygen-evolving enhancer pr...    242   4e-76   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001130585.1|  uncharacterized protein LOC100191684               243   4e-76   Zea mays [maize]
gb|EPS61846.1|  oxygen-evolving enhancer protein 1, chloroplastic       242   6e-76   Genlisea aurea
gb|ADB07372.1|  chloroplast managanese stabilizing protein              239   1e-75   Capsicum annuum
gb|ABQ52657.1|  chloroplast oxygen-evolving enhancer protein 1          241   1e-75   Leymus chinensis
gb|AEN02470.1|  oxygen-evolving enhancer protein                        241   1e-75   Camellia sinensis [black tea]
ref|XP_002866983.1|  hypothetical protein ARALYDRAFT_328078             239   1e-74   Arabidopsis lyrata subsp. lyrata
sp|O49079.1|PSBO_FRIAG  RecName: Full=Oxygen-evolving enhancer pr...    238   1e-74   Fritillaria agrestis
gb|AFH40666.1|  chloroplast oxygen-evolving enhancer protein 1          238   2e-74   Saccharum hybrid cultivar [sugarcane]
ref|XP_010557854.1|  PREDICTED: oxygen-evolving enhancer protein ...    237   3e-74   Tarenaya hassleriana [spider flower]
ref|XP_008647514.1|  PREDICTED: hypothetical protein isoform X1         237   5e-74   
sp|P85194.1|PSBO_HELAN  RecName: Full=Oxygen-evolving enhancer pr...    234   4e-73   Helianthus annuus
ref|XP_010446731.1|  PREDICTED: oxygen-evolving enhancer protein ...    234   5e-73   
ref|XP_010432119.1|  PREDICTED: oxygen-evolving enhancer protein ...    234   6e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010432121.1|  PREDICTED: oxygen-evolving enhancer protein ...    234   7e-73   
ref|XP_010446730.1|  PREDICTED: oxygen-evolving enhancer protein ...    234   7e-73   Camelina sativa [gold-of-pleasure]
gb|AFK43771.1|  unknown                                                 234   7e-73   Lotus japonicus
dbj|BAG70021.1|  33 kDa precursor protein of the oxygen-evolving ...    233   2e-72   Salicornia europaea [chicken-claws]
ref|XP_003557544.1|  PREDICTED: oxygen-evolving enhancer protein ...    231   8e-72   Brachypodium distachyon [annual false brome]
emb|CAA29062.1|  unnamed protein product                                229   5e-71   Spinacia oleracea
sp|P12359.1|PSBO_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...    229   5e-71   Spinacia oleracea
gb|KJB43585.1|  hypothetical protein B456_007G208000                    225   2e-69   Gossypium raimondii
ref|XP_006411950.1|  hypothetical protein EUTSA_v10025711mg             224   6e-69   Eutrema salsugineum [saltwater cress]
emb|CAN61828.1|  hypothetical protein VITISV_027630                     223   1e-68   Vitis vinifera
gb|ABS29557.1|  chloroplast photosynthetic water oxidation comple...    219   7e-68   Morus nigra
gb|KJB43587.1|  hypothetical protein B456_007G208000                    216   2e-66   Gossypium raimondii
ref|XP_009138459.1|  PREDICTED: oxygen-evolving enhancer protein ...    211   5e-64   
emb|CDX72613.1|  BnaC07g46350D                                          211   7e-64   
gb|AEH95324.1|  33 kDa manganese stabilizing chloroplast protein        204   3e-62   Allium cepa
emb|CDY42709.1|  BnaA03g53620D                                          204   4e-61   Brassica napus [oilseed rape]
gb|AJG36442.1|  oxygen-evolving enhancer protein 1                      203   1e-60   Pinus sylvestris [Scotch pine]
gb|ACN40581.1|  unknown                                                 196   6e-58   Picea sitchensis
gb|ABR17376.1|  unknown                                                 196   7e-58   Picea sitchensis
gb|ABK24541.1|  unknown                                                 196   7e-58   Picea sitchensis
gb|ABK23365.1|  unknown                                                 196   7e-58   Picea sitchensis
gb|KDO79410.1|  hypothetical protein CISIN_1g019870mg                   180   2e-52   Citrus sinensis [apfelsine]
gb|KCW55052.1|  hypothetical protein EUGRSUZ_I01025                     177   1e-51   Eucalyptus grandis [rose gum]
gb|AIS72812.1|  oxygen evolving activity                                172   7e-51   Rhizophora apiculata
ref|XP_007155995.1|  hypothetical protein PHAVU_003G249800g             173   4e-50   Phaseolus vulgaris [French bean]
gb|ACE98011.1|  putative protein                                        170   5e-50   Populus tremula [European aspen]
prf||2002393A  oxygen-evolving complex protein 1                        169   1e-48
ref|XP_001756893.1|  predicted protein                                  164   5e-46   
ref|XP_004243178.1|  PREDICTED: oxygen-evolving enhancer protein ...    157   7e-45   Solanum lycopersicum
prf||1204192A  photosystem II protein 33kD                              155   3e-43
ref|XP_001763258.1|  predicted protein                                  148   1e-39   
ref|XP_001781590.1|  predicted protein                                  146   5e-39   
gb|ABV57472.1|  chloroplast PsbO                                        139   7e-38   Phyllostachys edulis [kikko-chiku]
ref|WP_039310940.1|  Photosystem II manganese-stabilizing polypep...    140   2e-37   
ref|XP_002992987.1|  hypothetical protein SELMODRAFT_187141             139   3e-36   Selaginella moellendorffii
ref|XP_010531775.1|  PREDICTED: oxygen-evolving enhancer protein ...    136   4e-36   Tarenaya hassleriana [spider flower]
ref|XP_002991827.1|  hypothetical protein SELMODRAFT_272235             136   3e-35   
ref|XP_002994513.1|  hypothetical protein SELMODRAFT_138743             132   2e-34   
dbj|BAF94220.1|  33kDa oxygen evolving protein of photosystem II        132   7e-34   Closterium peracerosum-strigosum-littorale complex
dbj|BAF94218.1|  33kDa oxygen evolving protein of photosystem II        130   1e-32   Chara braunii
ref|NP_001140815.1|  hypothetical protein                               127   1e-32   
ref|XP_001784751.1|  predicted protein                                  125   2e-31   
gb|ACT83791.1|  putative photosystem II oxygen evolving system 33...    120   1e-30   Lemna minor
ref|XP_010550781.1|  PREDICTED: oxygen-evolving enhancer protein ...    111   6e-27   Tarenaya hassleriana [spider flower]
emb|CEG01950.1|  Photosystem II PsbO, manganese-stabilising             109   2e-25   Ostreococcus tauri
ref|XP_005843863.1|  hypothetical protein CHLNCDRAFT_32868              109   2e-25   Chlorella variabilis
gb|AFK37254.1|  unknown                                                 103   3e-25   Medicago truncatula
ref|XP_005644574.1|  33kDa oxygen evolving protein of photosystem II    109   4e-25   Coccomyxa subellipsoidea C-169
ref|XP_003082811.1|  photosystem II oxygen-evolving complex prote...    106   4e-25   
gb|ACU65446.1|  putative oxygen-evolving enhancer                       103   5e-25   Tragopogon dubius [yellow salsify]
ref|XP_001422458.1|  psbO, PSII-O, OEE1, photosystem II polypepti...    108   5e-25   Ostreococcus lucimarinus CCE9901
gb|ADC54897.1|  oxygen-evolving enhancer protein                        105   2e-24   Cladophora coelothrix
gb|ACU65447.1|  putative oxygen-evolving enhancer                       101   3e-24   Tragopogon pratensis [Jack-go-to-bed-at-noon]
gb|ABA01139.1|  chloroplast oxygen-evolving enhancer protein 1          104   2e-23   Chlamydomonas incerta
sp|P12853.1|PSBO_CHLRE  RecName: Full=Oxygen-evolving enhancer pr...    103   2e-23   Chlamydomonas reinhardtii
ref|XP_001694699.1|  oxygen-evolving enhancer protein 1 of photos...    103   2e-23   Chlamydomonas reinhardtii
ref|XP_003063851.1|  photosystem II manganese-stabilizing polypep...    103   5e-23   Micromonas pusilla CCMP1545
dbj|BAF94214.1|  33kDa oxygen evolving protein of photosystem II        102   7e-23   Oedogonium obesum
dbj|BAF94215.1|  33kDa oxygen evolving protein of photosystem II        102   1e-22   Pyramimonas parkeae
gb|KIY92168.1|  Oxygen-evolving enhancer protein 1,chloroplastic      98.2    3e-22   Monoraphidium neglectum
dbj|BAF94213.1|  33kDa oxygen evolving protein of photosystem II        100   3e-22   Hafniomonas montana
ref|XP_002954867.1|  subunit of oxygen evolving complex of photos...  99.0    1e-21   Volvox carteri f. nagariensis
sp|Q9SBN6.1|PSBO_VOLCA  RecName: Full=Oxygen-evolving enhancer pr...  99.0    2e-21   Volvox carteri
ref|XP_011400268.1|  Oxygen-evolving enhancer protein 1, chloropl...  99.0    2e-21   Auxenochlorella protothecoides
gb|KIY97139.1|  Oxygen-evolving enhancer protein 1                    97.4    6e-21   Monoraphidium neglectum
gb|AFK26084.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  95.1    2e-20   Euglena stellata
gb|AFK26083.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  95.1    3e-20   Euglena pseudostellata
ref|XP_002505809.1|  photosystem II manganese-stabilizing polypep...  95.5    3e-20   Micromonas commoda
ref|XP_007513615.1|  predicted protein                                95.1    4e-20   Bathycoccus prasinos
gb|ADC54900.1|  oxygen-evolving enhancer protein                      92.4    5e-20   Entransia fimbriata
gb|AFK26079.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  94.0    5e-20   Cryptoglena skujai
dbj|BAF94212.1|  33kDa oxygen evolving protein of photosystem II      94.7    6e-20   Chlorarachnion reptans
gb|AFK26085.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  94.0    6e-20   Monomorphina pyrum
dbj|BAF94219.1|  33kDa oxygen evolving protein of photosystem II      93.6    1e-19   Bryopsis plumosa
dbj|BAF94217.1|  33kDa oxygen evolving protein of photosystem II      92.8    2e-19   Nephroselmis olivacea
dbj|BAF94216.1|  33kDa oxygen evolving protein of photosystem II      93.2    2e-19   Tetraselmis cordiformis
emb|CCC15104.1|  33kDa oxygen evolving protein of photosystem II      93.2    2e-19   Lepidodinium chlorophorum
gb|ACF24544.1|  photosystem II oxygen evolving enhancer protein 1     92.4    4e-19   Gymnochlora stellata
gb|AFK26080.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  90.5    8e-19   Discoplastis spathirhyncha
dbj|BAA03529.2|  oxygen-evolving enhancer protein 1 precursor         91.7    9e-19   Euglena gracilis
gb|ADC54905.1|  oxygen-evolving enhancer protein                      88.6    1e-18   Ostreococcus tauri
sp|P46483.2|PSBO_EUGGR  RecName: Full=Oxygen-evolving enhancer pr...  90.9    1e-18   Euglena gracilis
gb|ADE06500.1|  oxygen-evolving enhancer                              86.3    1e-18   Tragopogon porrifolius [oyster plant]
gb|AFK26081.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  89.4    2e-18   Euglena archaeoplastidiata
gb|AAP79149.1|  photosystem II protein PsbO                           89.0    7e-18   Bigelowiella natans
gb|ADC54902.1|  oxygen-evolving enhancer protein                      86.3    8e-18   Klebsormidium flaccidum
emb|CCI69514.1|  oxygen-evolving enhancer protein                     86.7    8e-18   Scotinosphaera sp. CAUP H5307
emb|CCI69513.1|  oxygen-evolving enhancer protein                     85.5    1e-17   Chlorochytrium lemnae
gb|ADC54906.1|  oxygen-evolving enhancer protein                      84.7    3e-17   Phyllodictyon orientale
gb|ADC54893.1|  oxygen-evolving enhancer protein                      84.3    5e-17   Boodlea composita
gb|AFK26082.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  85.5    6e-17   Euglena granulata
gb|ADC54901.1|  oxygen-evolving enhancer protein                      83.6    7e-17   Ignatius tetrasporus
gb|ADC54894.1|  oxygen-evolving enhancer protein                      83.2    9e-17   Bornetella sphaerica
gb|ADC54913.1|  oxygen-evolving enhancer protein                      83.2    1e-16   Valonia utricularis
gb|ABR26062.1|  oxygen-evolving enhancer protein 1                    84.0    2e-16   Oryza sativa Indica Group [Indian rice]
dbj|BAF94211.1|  33kDa oxygen evolving protein of photosystem II      84.3    3e-16   Eutreptiella gymnastica
gb|ADC54898.1|  oxygen-evolving enhancer protein                      82.0    4e-16   Codium sp. HEC 15711
gb|ADC54908.1|  oxygen-evolving enhancer protein                      80.9    7e-16   Siphonocladus tropicus
gb|ADC54912.1|  oxygen-evolving enhancer protein                      80.5    1e-15   Ulva intestinalis
ref|XP_005652213.1|  33kDa oxygen evolving protein of photosystem II  81.6    2e-15   Coccomyxa subellipsoidea C-169
emb|CAH04962.1|  oxygen-evolving enhancer protein 1                   82.0    2e-15   Cyanophora paradoxa
gb|AGI15739.1|  collinsiaXIII-like protein                            79.7    2e-15   Collinsia rattanii
gb|AFB34200.1|  hypothetical protein CL304Contig1_01                  77.8    3e-15   Abies alba [abete-blanco]
gb|ADC54904.1|  oxygen-evolving enhancer protein                      78.6    4e-15   Nephroselmis olivacea
gb|AGI15756.1|  collinsiaXIII-like protein                            78.2    1e-14   Collinsia linearis
gb|AGI15761.1|  collinsiaXIII-like protein                            78.2    1e-14   Collinsia linearis
gb|AGI15740.1|  collinsiaXIII-like protein                            78.2    1e-14   Collinsia rattanii
gb|AGI15742.1|  collinsiaXIII-like protein                            78.2    1e-14   Collinsia rattanii
gb|ADC54890.1|  oxygen-evolving enhancer protein                      77.4    1e-14   Acetabularia acetabulum
gb|AEW08532.1|  hypothetical protein CL304Contig1_01                  75.5    2e-14   Pinus radiata
gb|ADC54899.1|  oxygen-evolving enhancer protein                      76.3    3e-14   Derbesia sp. 2773-1
gb|ADC54891.1|  oxygen-evolving enhancer protein                      76.3    3e-14   Ulvella repens
gb|ADC54895.1|  oxygen-evolving enhancer protein                      75.1    9e-14   Bryopsis sp. EE4
gb|ADC54903.1|  oxygen-evolving enhancer protein                      73.2    6e-13   Mesostigma viride
gb|ADC54907.1|  oxygen-evolving enhancer protein                      72.0    1e-12   Tetradesmus obliquus
ref|XP_005847917.1|  hypothetical protein CHLNCDRAFT_22722            72.8    2e-12   Chlorella variabilis
gb|ADC54896.1|  oxygen-evolving enhancer protein                      68.9    1e-11   Parachlorella kessleri
ref|XP_005761454.1|  oxygen-evolving enhancer protein 1 of photos...  70.1    2e-11   Emiliania huxleyi CCMP1516
sp|P83504.1|PSBO_BRACM  RecName: Full=Oxygen-evolving enhancer pr...  65.1    4e-11   Brassica rapa
gb|ADJ93800.1|  chloroplast oxygen-evolving enhancer protein 1 pr...  67.4    7e-11   Euglena gracilis
dbj|BAJ61701.1|  oxygen-evolving enhancer protein                     68.2    1e-10   Botrydium granulatum
gb|ACN35184.1|  unknown                                               66.2    1e-10   Zea mays [maize]
dbj|BAJ61711.1|  oxygen-evolving enhancer protein                     68.2    2e-10   Pyrenomonas helgolandii
gb|ABD51936.1|  chloroplast photosystem II 33 kDa oxygen evolving...  66.6    4e-10   Guillardia theta
gb|EWM24380.1|  oxygen-evolving enhancer protein                      65.5    5e-10   Nannochloropsis gaditana
ref|XP_005824851.1|  hypothetical protein GUITHDRAFT_97111            66.6    5e-10   Guillardia theta CCMP2712
gb|ABF59672.1|  photosystem II extrinsic protein O                    66.6    6e-10   Vaucheria litorea
ref|WP_039205072.1|  Photosystem II manganese-stabilizing polypep...  65.5    9e-10   Nostocales
ref|WP_027404713.1|  Photosystem II manganese-stabilizing polypep...  65.5    9e-10   Aphanizomenon flos-aquae
dbj|BAJ61702.1|  oxygen-evolving enhancer protein                     65.9    9e-10   Vaucheria frigida
gb|ADC54911.1|  oxygen-evolving enhancer protein                      63.5    9e-10   Ulva sp. EE2
gb|AGI15762.1|  collinsiaXIII-like protein                            63.9    1e-09   Collinsia linearis
ref|XP_005853586.1|  photosystem II oxygen-evolving enhancer prot...  65.5    1e-09   Nannochloropsis gaditana CCMP526
emb|CAH25340.1|  oxygen-evolving enhancer                             64.7    1e-09   Guillardia theta
gb|ADC54909.1|  oxygen-evolving enhancer protein                      63.2    1e-09   Tetraselmis striata
gb|EWM24379.1|  oxygen-evolving enhancer protein                      65.5    1e-09   Nannochloropsis gaditana
dbj|BAJ61705.1|  oxygen-evolving enhancer protein                     64.7    1e-09   Porphyridium purpureum
dbj|BAJ61709.1|  oxygen-evolving enhancer protein                     65.5    2e-09   Chroomonas caudata
ref|WP_017322486.1|  Photosystem II manganese-stabilizing polypep...  63.9    3e-09   cyanobacterium PCC 7702
gb|KIE10612.1|  Photosystem II manganese-stabilizing polypeptide      63.2    6e-09   Tolypothrix bouteillei VB521301
ref|WP_015167227.1|  Manganese-stabilising protein / photosystem ...  62.8    8e-09   Synechococcus sp. PCC 7502
gb|AAW33888.1|  plastid oxygen-evolving enhancer 1 precursor          62.8    1e-08   Pyropia yezoensis
gb|ADC54892.1|  oxygen-evolving enhancer protein                      60.5    1e-08   Blastophysa rhizopus
ref|WP_017745622.1|  Photosystem II manganese-stabilizing polypep...  62.0    1e-08   Scytonema hofmannii
ref|WP_015081475.1|  photosystem II manganese-stabilizing protein...  61.6    2e-08   Anabaena sp. 90
ref|WP_019500685.1|  hypothetical protein                             61.6    2e-08   
gb|ABO47876.1|  plastid oxygen-evolving enhancer 1-2 precursor        61.6    2e-08   
ref|WP_016872421.1|  Photosystem II manganese-stabilizing polypep...  61.2    3e-08   
ref|WP_036530244.1|  Photosystem II manganese-stabilizing polypep...  60.8    3e-08   
ref|WP_028090302.1|  Photosystem II manganese-stabilizing polypep...  60.8    3e-08   
ref|WP_026787255.1|  MULTISPECIES: Photosystem II manganese-stabi...  60.5    5e-08   
ref|WP_042156912.1|  Photosystem II manganese-stabilizing polypep...  60.5    5e-08   
gb|KEI69285.1|  PsbO                                                  60.5    5e-08   
gb|ACF28695.1|  oxygen evolving complex protein variant               58.5    5e-08   
gb|ACF28689.1|  oxygen evolving complex protein variant               58.5    5e-08   
ref|XP_005706438.1|  photosystem II PsbO protein                      60.8    5e-08   
gb|ACF28693.1|  oxygen evolving complex protein variant               58.2    6e-08   
dbj|BAJ61707.1|  oxygen-evolving enhancer protein                     60.8    7e-08   
gb|ACF28701.1|  oxygen evolving complex protein variant               58.2    7e-08   
gb|ACF28690.1|  oxygen evolving complex protein variant               58.2    7e-08   
ref|XP_005713751.1|  Plastid oxygen-evolving enhancer 1               59.3    8e-08   
ref|WP_028082855.1|  Photosystem II manganese-stabilizing polypep...  59.7    9e-08   
ref|WP_009631953.1|  Manganese-stabilising protein / photosystem ...  59.7    9e-08   
ref|WP_015153476.1|  photosystem II manganese-stabilizing protein...  59.7    1e-07   
ref|WP_039715746.1|  Photosystem II manganese-stabilizing polypep...  59.7    1e-07   
ref|WP_015204171.1|  photosystem II manganese-stabilizing protein...  59.3    1e-07   
gb|AAM77466.1|  oxygen evolving enhancer 1 precursor                  59.7    1e-07   
ref|WP_015125988.1|  Manganese-stabilising protein / photosystem ...  59.3    1e-07   
gb|AAN11311.1|  oxygen-evolving enhancer 1                            59.3    1e-07   
dbj|BAJ61710.1|  oxygen-evolving enhancer protein                     59.7    1e-07   
ref|XP_005536430.1|  manganese-stabilzing protein precursor           59.7    2e-07   
ref|WP_016949009.1|  Photosystem II manganese-stabilizing polypep...  59.3    2e-07   
ref|WP_016860504.1|  Photosystem II manganese-stabilizing polypep...  58.9    2e-07   
ref|WP_017286598.1|  hypothetical protein                             58.9    2e-07   
gb|ADC54910.1|  oxygen-evolving enhancer protein                      56.6    2e-07   
gb|AAW33887.1|  plastid oxygen-evolving enhancer 1-2 precursor        58.9    2e-07   
gb|ACF28700.1|  oxygen evolving complex protein variant               57.8    2e-07   
ref|WP_012625990.1|  photosystem II manganese-stabilizing protein...  58.5    3e-07   
ref|WP_017656098.1|  Photosystem II manganese-stabilizing polypep...  58.2    3e-07   
gb|AGL79735.1|  chloroplast oxygen-evolving enhancer                  58.5    3e-07   
gb|AGL79736.1|  chloroplast oxygen-evolving enhancer                  58.5    3e-07   
ref|WP_016865127.1|  Photosystem II manganese-stabilizing polypep...  58.2    3e-07   
ref|XP_002894679.1|  predicted protein                                55.5    4e-07   
ref|WP_009456798.1|  MULTISPECIES: photosystem II manganese-stabi...  57.8    4e-07   
ref|WP_017310215.1|  Photosystem II manganese-stabilizing polypep...  57.8    4e-07   
ref|WP_017720228.1|  Photosystem II manganese-stabilizing polypep...  57.8    4e-07   
ref|WP_026733494.1|  Photosystem II manganese-stabilizing polypep...  57.8    4e-07   
ref|WP_026721744.1|  Photosystem II manganese-stabilizing polypep...  57.8    5e-07   
dbj|BAF94210.1|  33kDa oxygen evolving protein of photosystem II      57.8    5e-07   
ref|XP_009033884.1|  hypothetical protein AURANDRAFT_69678            57.8    5e-07   
dbj|BAJ61704.1|  oxygen-evolving enhancer protein                     57.4    8e-07   
ref|WP_015115272.1|  photosystem II manganese-stabilizing protein...  57.0    8e-07   
gb|AAM77465.1|  oxygen evolving enhancer 1 precursor                  57.4    8e-07   
ref|WP_009342897.1|  Photosystem II manganese-stabilizing protein...  57.0    8e-07   
dbj|BAJ61706.1|  oxygen-evolving enhancer protein                     57.4    8e-07   
ref|WP_015127963.1|  photosystem II manganese-stabilizing protein...  57.0    8e-07   
ref|WP_012411115.1|  photosystem II manganese-stabilizing protein...  57.0    9e-07   
ref|WP_011318645.1|  photosystem II manganese-stabilizing protein...  56.6    1e-06   
ref|WP_015212390.1|  photosystem II manganese-stabilizing protein...  56.6    1e-06   
ref|XP_002180309.1|  oxygen-evolving enhancer protein 1 precursor     57.0    1e-06   
gb|AAO43192.1|  oxygen-evolving enhancer protein 1 precursor          57.0    1e-06   
ref|WP_016922728.1|  hypothetical protein                             56.6    1e-06   
emb|CAA33560.1|  manganese-stabilzing protein (MSP) precursor         56.6    1e-06   
ref|WP_013191007.1|  photosystem II manganese-stabilizing protein...  56.6    1e-06   
ref|WP_017314485.1|  Photosystem II manganese-stabilizing polypep...  56.6    1e-06   
ref|WP_015187373.1|  photosystem II manganese-stabilizing protein...  56.6    1e-06   
ref|WP_010997995.1|  manganese-stabilzing protein                     56.2    1e-06   
ref|WP_015139796.1|  Manganese-stabilising protein / photosystem ...  56.2    1e-06   
ref|WP_015209602.1|  Manganese-stabilising protein / photosystem ...  55.8    2e-06   
ref|WP_035997199.1|  Photosystem II manganese-stabilizing polypep...  55.8    2e-06   
ref|WP_010311944.1|  photosystem II manganese-stabilizing protein     55.8    2e-06   
ref|WP_009768009.1|  Manganese-stabilising protein / photosystem ...  55.8    2e-06   
gb|ACF28688.1|  oxygen evolving complex protein variant               53.5    3e-06   
pdb|2AXT|O  Chain O, Crystal Structure Of Photosystem Ii From The...  55.5    3e-06   
sp|D0VWR2.2|PSBO_THEVL  RecName: Full=Photosystem II manganese-st...  55.1    3e-06   
pdb|1S5L|O  Chain O, Architecture Of The Photosynthetic Oxygen Ev...  55.1    3e-06   
ref|WP_011056297.1|  photosystem II manganese-stabilizing polypep...  55.5    3e-06   
ref|WP_041036292.1|  Photosystem II manganese-stabilizing polypep...  55.1    4e-06   
ref|WP_024125094.1|  photosystem II manganese-stabilizing protein...  55.1    5e-06   
ref|WP_009628648.1|  photosystem II manganese-stabilizing protein...  55.1    5e-06   
gb|ACF28697.1|  oxygen evolving complex protein variant               52.8    6e-06   
gb|ACF28692.1|  oxygen evolving complex protein variant               52.8    7e-06   
gb|ACF28698.1|  oxygen evolving complex protein variant               52.4    7e-06   
emb|CBN78902.1|  manganese stabilising protein                        54.7    7e-06   
ref|WP_015165708.1|  photosystem II manganese-stabilizing protein...  54.3    8e-06   
pdb|4PBU|O  Chain O, Serial Time-resolved Crystallography Of Phot...  53.9    8e-06   
pdb|3A0B|O  Chain O, Crystal Structure Of Br-Substituted Photosys...  53.9    8e-06   
gb|KIJ84318.1|  Photosystem II manganese-stabilizing polypeptide      54.3    8e-06   
dbj|BAG85210.1|  extrinsic protein in photosystem II                  54.3    8e-06   
ref|WP_015196540.1|  photosystem II manganese-stabilizing protein...  53.5    1e-05   
gb|ACF28691.1|  oxygen evolving complex protein variant               52.0    1e-05   
ref|WP_007354116.1|  MULTISPECIES: photosystem II manganese-stabi...  53.5    1e-05   
ref|WP_017662186.1|  hypothetical protein                             53.5    1e-05   
ref|WP_006278712.1|  Photosystem II manganese-stabilizing protein...  53.5    1e-05   
ref|WP_006630984.1|  photosystem II manganese-stabilizing protein...  53.5    1e-05   
ref|WP_015117115.1|  Manganese-stabilising protein / photosystem ...  53.5    2e-05   
gb|ACF28699.1|  oxygen evolving complex protein variant               51.6    2e-05   
ref|WP_039748810.1|  Photosystem II manganese-stabilizing polypep...  53.1    2e-05   
dbj|BAJ61708.1|  oxygen-evolving enhancer protein                     52.0    2e-05   
ref|WP_006197397.1|  Photosystem II manganese-stabilizing protein...  52.8    3e-05   
ref|WP_022609298.1|  manganese-stabilising protein / photosystem ...  52.4    3e-05   
emb|CCQ62588.1|  Photosystem II manganese-stabilizing protein (PsbO)  52.4    4e-05   
dbj|BAJ61703.1|  oxygen-evolving enhancer protein                     52.4    4e-05   
ref|WP_006042289.1|  photosystem II manganese-stabilizing polypep...  52.4    4e-05   
ref|WP_007304841.1|  Manganese-stabilizing protein/photosystem II...  52.4    4e-05   
ref|WP_029636438.1|  Photosystem II manganese-stabilizing polypep...  52.0    4e-05   
ref|WP_006518063.1|  Manganese-stabilising protein / photosystem ...  52.0    5e-05   
ref|WP_019494816.1|  Photosystem II manganese-stabilizing polypep...  52.0    5e-05   
ref|WP_015175499.1|  photosystem II manganese-stabilizing protein...  51.2    9e-05   
gb|AAF13997.1|  photosystem II manganese stabilizing protein          50.8    1e-04   
ref|WP_009544738.1|  MULTISPECIES: photosystem II manganese-stabi...  50.8    1e-04   
gb|EAZ89921.1|  photosystem II manganese-stabilizing polypeptide      50.8    1e-04   
ref|WP_035799930.1|  Photosystem II manganese-stabilizing polypep...  50.8    1e-04   
ref|WP_031292620.1|  Photosystem II manganese-stabilizing polypep...  50.8    1e-04   
gb|ESA36696.1|  photosystem ii manganese-stabilizing protein          50.4    1e-04   
gb|ABF73017.1|  oxygen-enhancer 1 protein precursor                   50.8    2e-04   
ref|WP_041596665.1|  Photosystem II manganese-stabilizing polypep...  50.4    2e-04   
gb|AFZ44849.1|  photosystem II manganese-stabilizing protein PsbO     50.4    2e-04   
ref|WP_015161225.1|  Manganese-stabilising protein / photosystem ...  50.4    2e-04   
ref|WP_036486652.1|  Photosystem II manganese-stabilizing polypep...  50.4    2e-04   
ref|WP_015142403.1|  Manganese-stabilising protein / photosystem ...  50.4    2e-04   
ref|WP_010478151.1|  photosystem II manganese-stabilizing protein     50.4    2e-04   
gb|AAM77464.1|  oxygen evolving enhancer 1 precursor                  50.4    2e-04   
ref|WP_012161181.1|  photosystem II manganese-stabilizing protein...  50.1    2e-04   
ref|WP_040939353.1|  Photosystem II manganese-stabilizing polypep...  49.7    3e-04   
ref|WP_035156929.1|  Photosystem II manganese-stabilizing polypep...  49.7    3e-04   
ref|WP_040929652.1|  Photosystem II manganese-stabilizing polypep...  49.7    3e-04   
ref|WP_006909436.1|  photosystem II manganese-stabilizing protein     49.7    3e-04   
ref|WP_028946996.1|  Photosystem II manganese-stabilizing polypep...  49.3    4e-04   
ref|WP_015230300.1|  Manganese-stabilising protein / photosystem ...  49.3    4e-04   
gb|AIE75688.1|  Photosystem II manganese-stabilizing protein (PsbO)   49.3    4e-04   
ref|WP_009783095.1|  Photosystem II manganese-stabilizing protein...  49.3    5e-04   
ref|WP_007099801.1|  photosystem II manganese-stabilizing polypep...  48.9    5e-04   
ref|WP_015180190.1|  Manganese-stabilising protein / photosystem ...  48.5    8e-04   
gb|EJK75097.1|  hypothetical protein THAOC_03193                      48.1    0.001   



>ref|XP_009612279.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q40459.1|PSBO_TOBAC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA45701.1| 33 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=332

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 155/172 (90%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
             F+DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KFTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLD
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLD  172



>ref|XP_009768511.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana sylvestris]
 gb|AAP03871.1| oxygen evolving complex 33 kDa photosystem II protein [Nicotiana 
tabacum]
Length=332

 Score =   278 bits (712),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 154/172 (90%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLD
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLD  172



>gb|KDP31833.1| hypothetical protein JCGZ_12294 [Jatropha curcas]
Length=332

 Score =   278 bits (710),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 150/171 (88%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQPTKVGV  RI    RS Q V KA G++PS ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRISLQLRSSQNVSKAFGLEPSTARISCSLQSDLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            + FA KPGKY+AKKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  DKFAIKPGKYNAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLD  171



>ref|XP_009604683.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=332

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 153/172 (89%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV         RS Q+V KA GV+P+ A++TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQSVSKAFGVEPAAAKLTCSLQSDLKDLAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DAAK+AGFALATSAL++SGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVISGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLD
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLD  172



>ref|XP_011004600.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=331

 Score =   277 bits (709),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 153/171 (89%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  171



>gb|AAX53163.1| chloroplast photosynthetic oxygen-evolving protein 33 kDa subunit 
[Nicotiana benthamiana]
Length=332

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 153/172 (89%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            V +FAFKPGKY+A KFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLD
Sbjct  121  VASFAFKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLD  172



>ref|XP_009759927.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=333

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 153/172 (89%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV         RS Q++ KA GV+P+ AR+TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQSLSKAFGVEPAAARLTCSLQSDLKDLAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            V++FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLD
Sbjct  121  VDSFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLD  172



>gb|AFH58000.1| chloroplast PsbO4 precursor [Nicotiana benthamiana]
Length=333

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV         R  Q+V KA GV+P+ AR+TCSLQS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRLSQSVSKAFGVEPAAARLTCSLQSDLKDLAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLD
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLD  172



>ref|XP_002307234.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95762.1| unknown [Populus trichocarpa]
 gb|ABK96188.1| unknown [Populus trichocarpa]
 gb|EEE94230.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=331

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 152/171 (89%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G +P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLARK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  171



>ref|XP_011099252.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Sesamum indicum]
Length=331

 Score =   276 bits (706),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 154/171 (90%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MA SLQ AATLMQPTKVGV+ R     RS Q+VGK+ GV+P+ AR++CSLQ+ +K+LA  
Sbjct  1    MATSLQAAATLMQPTKVGVSARSSLQLRSVQSVGKSFGVEPASARLSCSLQADLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   CTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFKPGKY+AKKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLD
Sbjct  121  DSFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLD  171



>ref|XP_011085527.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Sesamum indicum]
Length=330

 Score =   276 bits (705),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  39   ASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAA  218
            +SLQ AATLMQPTKVG T    RS QT+GKA GV+P+ AR+TCSLQ+ +K+LAH  +DAA
Sbjct  4    SSLQAAATLMQPTKVGRTSLQLRSVQTLGKAFGVEPAGARMTCSLQADLKDLAHKLTDAA  63

Query  219  KLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAF  398
            K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV++FAF
Sbjct  64   KIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGVDSFAF  123

Query  399  KPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            K GKY+AKKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLD
Sbjct  124  KAGKYNAKKFCLEPTSFTVKAEGVNKNAPPEFQKTKLMTRLTYTLD  169



>gb|AFH57998.1| chloroplast PsbO2 precursor [Nicotiana benthamiana]
Length=332

 Score =   275 bits (704),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MA SLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MATSLQAAATLMQPTKVGVAPARNNLQLRSAQSVSKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            V +FAFKPGKY+A KFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLD
Sbjct  121  VASFAFKPGKYNANKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLD  172



>gb|ABK96748.1| unknown [Populus trichocarpa x Populus deltoides]
Length=331

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 151/171 (88%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G +P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGFEPASARISCSLQSDLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA+K+AGFALATSAL+ SGA+AEGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG 
Sbjct  61   CVDASKIAGFALATSALIASGASAEGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGA  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            E+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  ESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  171



>gb|ADZ75466.1| oxygen evolving enhancer protein 1 [Litchi chinensis]
Length=333

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 149/172 (87%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV+P       RS Q+V KA GVD +  RITCSLQS  K++A 
Sbjct  1    MAASLQAAATLMQPTKVGVSPARSTVQLRSSQSVSKAFGVDSAGGRITCSLQSDFKDMAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
               DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            V++FAFKPGKY AKK CLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  VDSFAFKPGKYQAKKLCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  172



>gb|AFH57997.1| chloroplast PsbO1 precursor [Nicotiana benthamiana]
Length=332

 Score =   274 bits (701),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MA SLQ AATLMQPTKVGV P       RS Q+V KA GV+P+ AR+TCSLQ+++K+LA 
Sbjct  1    MAVSLQAAATLMQPTKVGVAPARNNLQLRSAQSVCKAFGVEPAAARLTCSLQTELKDLAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DAAK+AGFALATSAL+VSGANAEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCTDAAKVAGFALATSALVVSGANAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            V +FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPP+FQ TKLMTRLTYTLD
Sbjct  121  VASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLD  172



>ref|XP_009379152.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   274 bits (701),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|XP_008338186.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Malus domestica]
Length=332

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  TEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|XP_007047093.1| Photosystem II subunit O-2 [Theobroma cacao]
 gb|EOX91250.1| Photosystem II subunit O-2 [Theobroma cacao]
Length=332

 Score =   273 bits (699),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 149/171 (87%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P  AR+TCSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSVQLRSSQSVSKAFGLEPVGARLTCSLQSDLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFKPGKY AKKFCLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLD
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVSKNAPPEFQRTKLMTRLTYTLD  171



>gb|AFH57999.1| chloroplast PsbO3 precursor [Nicotiana benthamiana]
Length=333

 Score =   273 bits (699),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 149/172 (87%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV         RS Q V KA GV+P+ AR+ CS QS +K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVVSARNNLQLRSSQCVSKAFGVEPAAARLNCSFQSDLKDLAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DA K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAVKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            VE+FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLD
Sbjct  121  VESFAFKPGKYNAKKFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLD  172



>ref|XP_009376463.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLD  172



>ref|XP_009341905.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341920.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=332

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV+ R     RS Q+V KA G++PS  AR+TCSLQS +K+LAH
Sbjct  1    MAASLQAAATLMQPTKVGVSARTSVQLRSSQSVSKAFGLEPSASARLTCSLQSDLKDLAH  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
               DA+K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCLDASKIAGFALATSALVVSGAGAEGSPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E FAFKPGKY+AKKFCLEPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  SEAFAFKPGKYTAKKFCLEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLD  172



>ref|XP_008241598.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Prunus mume]
Length=332

 Score =   270 bits (691),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 150/172 (87%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVG   R     RS Q V KA G++PS  AR+TCSLQS +K+ AH
Sbjct  1    MAASLQAAATLMQPTKVGAPARTSLLLRSSQNVSKAFGLEPSASARLTCSLQSDLKDFAH  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
               DA+K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCVDASKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +E FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLD
Sbjct  121  LEAFAFKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLD  172



>gb|AEO21912.1| chloroplast oxygen-evolving enhancer protein 1 [Dimocarpus longan]
Length=333

 Score =   270 bits (690),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 147/172 (85%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVGV+P       RS+Q+V KA G D +  RITCSLQ   K+LA 
Sbjct  1    MAASLQAAATLMQPTKVGVSPARSTVQLRSFQSVSKAFGADSAGGRITCSLQPDFKDLAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DA K+AGFALAT AL+VSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCADATKIAGFALATPALVVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            V++FAFKPGKY AKKFCLEPTSFTVKAE V+KN+PPEFQNTKLMTRLTYTLD
Sbjct  121  VDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNSPPEFQNTKLMTRLTYTLD  172



>ref|XP_006344816.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum tuberosum]
Length=329

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  209
            MAASLQ AATLMQPTKVG    +  RS Q+V KA GV+   AR+TCSLQ++IKELA   +
Sbjct  1    MAASLQAAATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCT  60

Query  210  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  389
            DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +
Sbjct  61   DAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGS  120

Query  390  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLD
Sbjct  121  FAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLD  169



>ref|XP_004233415.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
 sp|P23322.2|PSBO_SOLLC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA78043.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
 prf||2001459A O2 evolving protein complex:SUBUNIT=33kD
Length=329

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 149/169 (88%), Gaps = 1/169 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  209
            MAASLQ AATLMQPTKVGV   +  RS Q+V KA GV+    R+TCSLQ++IKELA   +
Sbjct  1    MAASLQAAATLMQPTKVGVRNNLQLRSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCT  60

Query  210  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  389
            DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +
Sbjct  61   DAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGS  120

Query  390  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLD
Sbjct  121  FAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLD  169



>ref|XP_002274796.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=332

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 148/171 (87%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ AR TCSLQ+ +K+LAH 
Sbjct  1    MAASLQAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKDLAHK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA K+AGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKIAGFALATSALLVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFK GKY  KKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  DSFAFKSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLD  171



>ref|XP_007202212.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
 gb|EMJ03411.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
Length=332

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 149/172 (87%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSP-ARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVG   R     R  Q V KA G++PS  AR+TCSLQS +K+ AH
Sbjct  1    MAASLQAAATLMQPTKVGAPARTSLQLRPSQNVSKAFGLEPSASARLTCSLQSDLKDFAH  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
               DA+K+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG
Sbjct  61   KCVDASKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +E FAFKPGKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLD
Sbjct  121  LEAFAFKPGKYTAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLD  172



>ref|XP_009412420.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=340

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 152/173 (88%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPR-IG----RSYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MAASLQ AATLMQP+KVGV  R IG    RS   + +A G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPSKVGVASRSIGGQQLRSGSHLSRAFGFEPTTARLTCSLQSDLRDLA  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
            H  SDAAKLAGFALATSAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   HKCSDAAKLAGFALATSALVVAGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV++FAFKPGKY+AKKFCLEPTSFTVKAE VSKNAP EFQ TKLMTRLTYTLD
Sbjct  121  GVDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNAPAEFQRTKLMTRLTYTLD  173



>ref|XP_002522386.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF40070.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
Length=334

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MAASLQ AATLMQPTKVG  P        RS Q+V KA G++P+ ARITCSLQS +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGGVPSSRATLQLRSSQSVSKAFGLEPASARITCSLQSDLKDLA  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
                DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            G++ F+FK GKY+AKKFCLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLD
Sbjct  121  GLDKFSFKAGKYNAKKFCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLD  173



>gb|AAS55410.1| photosystem II protein [Brassica rapa]
Length=233

 Score =   265 bits (676),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 147/181 (81%), Gaps = 4/181 (2%)
 Frame = +3

Query  6    ELTLLSDPTMAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSL  173
            EL+      MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS 
Sbjct  7    ELSERHSVAMAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSF  66

Query  174  QSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTA  353
            QS IK+ A   SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTA
Sbjct  67   QSDIKDFAGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTA  126

Query  354  NQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTL  533
            NQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTL
Sbjct  127  NQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTL  186

Query  534  D  536
            D
Sbjct  187  D  187



>ref|NP_001239736.1| uncharacterized protein LOC100798485 [Glycine max]
 gb|ACU19444.1| unknown [Glycine max]
 gb|KHN42036.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MAASLQ AAT MQPTKVG+  R  +S Q + KA G++P+ A++TCSLQ  +KE A    D
Sbjct  1    MAASLQAAATFMQPTKVGIASRNLKSTQCISKAFGLEPAAAKLTCSLQPDLKEFAQKCVD  60

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            A K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSF  120

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            AFKPGKY+A+K CLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLD
Sbjct  121  AFKPGKYNAQKLCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLD  168



>ref|XP_010255017.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 148/171 (87%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQPTKVGV+ R G   RS Q+V KA G + S AR+TCSLQS +K+ A  
Sbjct  1    MAASLQAAATLMQPTKVGVSSRSGQQLRSSQSVCKAFGFETSGARLTCSLQSDLKDFAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA+K+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG+
Sbjct  61   CVDASKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGI  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++F FK GKY+ KKFCLEPTSFTVKAE VSKN+PPEFQ TKLMTRLTYTLD
Sbjct  121  DSFGFKSGKYNMKKFCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLD  171



>sp|P26320.1|PSBO_SOLTU RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum tuberosum]
Length=333

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            V++FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLD
Sbjct  121  VDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLD  172



>dbj|BAA96365.3| oxygen evolving enhancer protein 1 precursor [Bruguiera gymnorhiza]
Length=332

 Score =   265 bits (678),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQP KVGV  R G   RS Q V +A G++P+ ARITCS Q+  K+LA  
Sbjct  1    MAASLQAAATLMQPAKVGVPSRTGLQLRSSQIVSRAFGLEPAAARITCSSQTDFKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA K+AGFALATSAL+VSGA AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGAGAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFKPGKY+ KK CLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLD
Sbjct  121  DSFAFKPGKYNVKKLCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLD  171



>ref|XP_002310188.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95579.1| unknown [Populus trichocarpa]
 gb|ABK96112.1| unknown [Populus trichocarpa]
 gb|ABK96443.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE90638.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=332

 Score =   265 bits (678),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 151/171 (88%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGL  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFKPGKY+AKK CLEPTSFTVKAE ++KN+PP+FQ TKLMTRLTYTLD
Sbjct  121  DSFAFKPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLD  171



>ref|XP_011025676.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=332

 Score =   265 bits (678),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 151/171 (88%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ ARI+CSLQS +K+LA  
Sbjct  1    MAASLQAAATLMQPTKVGVPSRTSLQLRSSQSVSKAFGLEPASARISCSLQSDLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA+K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKGSGTANQCPTI+GG+
Sbjct  61   CVDASKIAGFALATSALVVSGASAEGVPKRLTYEEIQSKTYMEVKGSGTANQCPTIDGGL  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFKPGKY+AKK CLEPTSFTVKAE ++KN+PP+FQ TKLMTRLTYTLD
Sbjct  121  DSFAFKPGKYNAKKICLEPTSFTVKAEGINKNSPPDFQKTKLMTRLTYTLD  171



>ref|XP_010924166.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Elaeis guineensis]
Length=334

 Score =   265 bits (676),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 148/173 (86%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRI--GRSYQT---VGKALGVDPSPARITCSLQSQIKELA  197
            MAASLQ AATLMQP KVG T R   G+  +T   + KA G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPAKVGATGRTLAGQQLRTSSHLSKAFGFEPAGARLTCSLQSDLRDLA  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
            H  +DA KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   HKCADATKLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV++FAFKPGKY  KK CLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLD
Sbjct  121  GVDSFAFKPGKYQMKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLD  173



>gb|KJB43586.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=332

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFKPGKY AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLD
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLD  171



>emb|CAA35601.1| 33kDa precursor protein of oxygen-evolving complex [Solanum tuberosum]
Length=332

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 151/171 (88%), Gaps = 4/171 (2%)
 Frame = +3

Query  36   AASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            AASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A  
Sbjct  1    AASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLD
Sbjct  121  DSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLD  171



>ref|XP_006856169.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
 gb|ERN17636.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
Length=331

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQPTK+G + R G   RS   + KA G +PS AR+TCS+Q  ++ELAH 
Sbjct  1    MAASLQAAATLMQPTKLGGSSRNGLQLRSSSQICKAFGFEPSSARLTCSIQEDLRELAHK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA KLAGFALATSAL+V+GANAEGVPKRLT+DEIQSKTY EVKG+GTANQCP I+GGV
Sbjct  61   CVDATKLAGFALATSALVVAGANAEGVPKRLTYDEIQSKTYTEVKGTGTANQCPAIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            + FAFKPGKY+ KKFCLEPTSFTVKAES++KNAPPEFQ TKLMTRLTYTLD
Sbjct  121  DKFAFKPGKYNMKKFCLEPTSFTVKAESINKNAPPEFQKTKLMTRLTYTLD  171



>emb|CDP02430.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   263 bits (672),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 147/171 (86%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPR---IGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQP KVGV PR   + RS   + KA GV+ S AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLQAAATLMQPAKVGVAPRNNVLLRSSPNLSKAFGVEQSSARLTCSLQADLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             +DAAK+AGFALATSAL+VSGANAEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI+GGV
Sbjct  61   CTDAAKVAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            + FAFKPGKY AKK CLEPTSFTVKAE  +KN+PPEFQ TKLMTRLTYTLD
Sbjct  121  DKFAFKPGKYDAKKLCLEPTSFTVKAEGPNKNSPPEFQKTKLMTRLTYTLD  171



>gb|KDO79409.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=334

 Score =   263 bits (672),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 150/173 (87%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MAASLQ AATLMQPTKVGV P        RS Q+V KA GVD + ARI+CSL + +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCSLNNDLKDLA  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
                DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV++FAFKPGKY AKKFCLEPTSFTVKAESV+KNAPP+FQNTKLMTRLTYTLD
Sbjct  121  GVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLD  173



>gb|KHG13438.1| Oxygen-evolving enhancer 1, chloroplastic [Gossypium arboreum]
Length=332

 Score =   263 bits (671),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVPLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLALK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFKPGKY AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLD
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVKAEGVNKNAPPEFQNTKLMTRLTYTLD  171



>ref|XP_006338257.1| PREDICTED: chloroplast manganese stabilizing protein-II [Solanum 
tuberosum]
Length=333

 Score =   263 bits (671),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 151/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            V++FAFK GKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLD
Sbjct  121  VDSFAFKSGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLD  172



>ref|XP_004300575.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   262 bits (670),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 146/171 (85%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQT--VGKALGVDPSPA-RITCSLQSQIKELAHN  203
            MAAS+Q AATLMQPTK+GV  R     ++  V KA G++P+ + R+TCSLQ+ +KE AH 
Sbjct  1    MAASMQAAATLMQPTKLGVPSRTSLQLRSSNVSKAFGLEPAASSRLTCSLQTDLKEFAHK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA K+AGFALATSAL+VSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG 
Sbjct  61   CVDATKIAGFALATSALVVSGAGAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGS  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            E FAFKPGKY AKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  EAFAFKPGKYVAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  171



>ref|XP_006425778.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
 ref|XP_006466690.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR39018.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
Length=334

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 150/173 (87%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MAASLQ AATLMQPTKVGV P        RS Q+V KA GVD + ARI+C+L + +K+LA
Sbjct  1    MAASLQAAATLMQPTKVGVVPARSSSLQLRSSQSVSKAFGVDSAGARISCTLNNDLKDLA  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
                DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   QKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV++FAFKPGKY AKKFCLEPTSFTVKAESV+KNAPP+FQNTKLMTRLTYTLD
Sbjct  121  GVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLD  173



>ref|XP_004232077.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
Length=333

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 152/172 (88%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATLMQPTKVG V+ R     RS Q++ KA G++PS ++++CSLQ+ +K+ A 
Sbjct  1    MAASLQAAATLMQPTKVGGVSARNNLPLRSAQSLSKAFGLEPSASKLSCSLQADLKDFAQ  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            V++F+FKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLD
Sbjct  121  VDSFSFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLD  172



>ref|XP_010263833.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 145/171 (85%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATL QPTKVGV  + G   RS  TV K  G DPS AR+TCSLQS +KELA  
Sbjct  1    MAASLQAAATLRQPTKVGVPVKGGLQLRSTPTVCKNFGFDPSCARLTCSLQSDLKELAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV
Sbjct  61   CVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFK GKY+ KK CLEPTSFTVKAE VSKNAPPEFQ TKLMTRLTYTLD
Sbjct  121  DSFAFKTGKYNLKKLCLEPTSFTVKAEGVSKNAPPEFQKTKLMTRLTYTLD  171



>ref|XP_009103510.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY45242.1| BnaA07g12480D [Brassica napus]
Length=332

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDIKDFAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|XP_009758248.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=328

 Score =   260 bits (665),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 144/172 (84%), Gaps = 9/172 (5%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATL     +GV P       RS   V KA GV+PS AR+TCSLQ+  K+LA 
Sbjct  1    MAASLQAAATL-----IGVIPSRNNLQFRSSHCVSKAFGVEPSSARLTCSLQADFKDLAQ  55

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  56   KCSDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  115

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            VE FAFKPGKY+AKKFCLEPTSFTVKAE V+KN+PPEFQ TKLMTRLTYTLD
Sbjct  116  VETFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPEFQKTKLMTRLTYTLD  167



>ref|XP_006280785.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
 gb|EOA13683.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
Length=332

 Score =   260 bits (665),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|XP_007156865.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
 gb|AGV54484.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
 gb|ESW28859.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
Length=329

 Score =   260 bits (664),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MA+SLQ AAT MQPTKV +  R  +S Q + KA G++PS  ++TCSL S +K+LA    D
Sbjct  1    MASSLQAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLD  60

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            A KLAGFALATSALLVSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGVE+F
Sbjct  61   ATKLAGFALATSALLVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVESF  120

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            AFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLD
Sbjct  121  AFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLD  168



>gb|KFK34331.1| hypothetical protein AALP_AA5G131000 [Arabis alpina]
Length=331

 Score =   260 bits (664),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 143/171 (84%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D SPAR+TCSL S  K+    
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSPARLTCSLHSDFKDFVGK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  EAFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLD  171



>gb|EYU44326.1| hypothetical protein MIMGU_mgv1a009768mg [Erythranthe guttata]
Length=332

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 147/171 (86%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MA SLQ AATLMQPTKVGV+ R     RS Q V ++ G +P+ +R+TCSLQS +K+LA  
Sbjct  1    MATSLQAAATLMQPTKVGVSARSSLQLRSAQNVSRSFGFEPAGSRLTCSLQSDLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             +DAAK+AGFALATSAL+ SGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPT++GG 
Sbjct  61   CTDAAKIAGFALATSALVASGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTLDGGS  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFK GKY+AKKFCLEPTSFTVKAE VSKN+P EFQ TKLMTRLTYTLD
Sbjct  121  DSFAFKSGKYTAKKFCLEPTSFTVKAEGVSKNSPAEFQKTKLMTRLTYTLD  171



>gb|ADR71223.1| chloroplast manganese stabilizing protein [Solanum tuberosum]
Length=321

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = +3

Query  54   AATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAG  230
            AATLMQPTKVG    +  RS Q+V KA GV+   AR+TCSLQ++IKELA   +DAAK+AG
Sbjct  2    AATLMQPTKVGARNNLQLRSVQSVSKAFGVEQGSARLTCSLQTEIKELAQKCTDAAKIAG  61

Query  231  FALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  410
            FALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGK
Sbjct  62   FALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGK  121

Query  411  YSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            Y+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLD
Sbjct  122  YTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLD  163



>ref|XP_008800919.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Phoenix dactylifera]
Length=334

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 145/173 (84%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPR--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELA  197
            MAASLQ AATLMQP KV  T R   G+  +T   + KA G +P+ AR+TCSLQS +++LA
Sbjct  1    MAASLQAAATLMQPAKVAATGRNLAGQQLRTGSHLSKAFGFEPAGARLTCSLQSDLRDLA  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
               +DA KLAGFALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   QKCADATKLAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV+ FAFKPGKY  KK CLEPTSFTVKAE VSKN+PPEFQ TKLMTRLTYTLD
Sbjct  121  GVDEFAFKPGKYQMKKLCLEPTSFTVKAEGVSKNSPPEFQKTKLMTRLTYTLD  173



>ref|XP_006393852.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
 gb|ESQ31138.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
Length=332

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSAATFLQSAKIATAPSRGGSHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SEIFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|XP_010444775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=332

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 143/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+AAT +Q  K+  TP  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTTPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  172



>gb|AAD38521.1|AF139818_1 33 kDa oxygen evolving protein of photosystem II [Brassica napus]
Length=274

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLD  172



>emb|CBI19622.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 144/171 (84%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLD
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLD  171



>ref|XP_009130561.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Brassica rapa]
 emb|CDY55088.1| BnaA02g34760D [Brassica napus]
Length=332

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+A+T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+LA 
Sbjct  1    MAASLQSASTFLQAAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDLAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLD  172



>ref|XP_002877774.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54033.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
Length=331

 Score =   257 bits (657),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 144/171 (84%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D S AR+TCSL S +K+ A  
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             S+AAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSEAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  ETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLD  171



>emb|CDY30764.1| BnaC07g16640D [Brassica napus]
Length=332

 Score =   257 bits (657),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 143/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+AAT +   K+   P  G    RS QTVGK+ G++ S AR+TCS QS IK+ A 
Sbjct  1    MAASLQSAATFLLSAKISAAPSRGSAHLRSTQTVGKSFGLESSSARLTCSYQSDIKDFAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|XP_002866754.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43013.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
Length=332

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+ AT +Q  K+   P  G    RS Q+VGK+ G+D S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSAHLRSTQSVGKSFGLDTSSARLTCSFQSDFKDFAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|XP_003637254.1| Oxygen-evolving enhancer protein, partial [Medicago truncatula]
Length=255

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +
Sbjct  1    MAASLQAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVE  60

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +FKPGKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLD
Sbjct  121  SFKPGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLD  168



>ref|XP_010550399.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=331

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 144/171 (84%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKV-GVTPRIG--RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASL +AAT +QPTK+   T R G  RS  +V K  G++ S AR+TCS+QS +++ A  
Sbjct  1    MAASLHSAATFLQPTKISAATSRYGHLRSSPSVAKTFGLESSSARLTCSIQSDLRDFAGK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             +DAAK+AGFALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CTDAAKIAGFALATSALVSSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            + FAFKPGKYS KKFC EPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  DEFAFKPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLD  171



>ref|XP_010028333.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55051.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=331

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVG-VTPRIGRSYQTVGKALGVD-PSPARITCSLQSQIKELAHNF  206
            MAASLQ AATLMQPTKVG ++    RS Q V K  G++  + +R+TCSLQ+ +K+LA   
Sbjct  1    MAASLQAAATLMQPTKVGRISSSQLRSSQNVSKTFGLECGAGSRVTCSLQADLKDLAQKC  60

Query  207  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  386
            +DA K+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG++
Sbjct  61   ADATKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLD  120

Query  387  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +FAFKPGKY+AKK CLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SFAFKPGKYNAKKICLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  170



>ref|NP_190651.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
 sp|Q9S841.1|PSBO2_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-2, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
2; Short=MSP-2; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB42911.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 emb|CAB53092.1| precursor of the 33 kDa subunit of the oxygen evolving complex 
[Arabidopsis thaliana]
 gb|AAK91379.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM51568.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM67110.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 gb|AEE78714.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
Length=331

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 142/171 (83%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MA SLQ AAT +QP K+  +P      RS QTVGK+ G+D S AR+TCSL S +K+ A  
Sbjct  1    MATSLQAAATFLQPAKIAASPSRNVHLRSNQTVGKSFGLDSSQARLTCSLHSDLKDFAGK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             SDAAK+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            E F+FK GKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  ETFSFKAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLD  171



>ref|XP_010484624.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Camelina sativa]
Length=332

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|XP_009112310.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY18611.1| BnaA09g07840D [Brassica napus]
Length=332

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLD  172



>ref|XP_009387680.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like, 
partial [Musa acuminata subsp. malaccensis]
Length=170

 Score =   250 bits (639),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSP-ARITCSLQSQIKEL  194
            MAASLQ AATLMQP KVG T R       RS   + KA G++P+  AR+TCSLQS ++E+
Sbjct  1    MAASLQAAATLMQPAKVGATSRTAAGVQLRSSSHLTKAFGLEPAASARLTCSLQSDVREM  60

Query  195  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  374
            A   +D  KLAGFALA SAL+V+GA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+
Sbjct  61   AQKCADGVKLAGFALAASALVVTGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTID  120

Query  375  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLT  524
            GGVE+FAFKPGKY+ KK CLEPTSFTVKAE+VSKNAPPEFQ TKLMTRLT
Sbjct  121  GGVESFAFKPGKYNTKKLCLEPTSFTVKAEAVSKNAPPEFQKTKLMTRLT  170



>gb|AGV54778.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
Length=329

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MA+SLQ AAT MQPTKV +  R  +S Q + KA G++PS  ++TCSL S +K+LA    D
Sbjct  1    MASSLQAAATFMQPTKVPLNSRNLKSTQCISKAFGLEPSAPKLTCSLHSDLKDLAQKCLD  60

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            A KLAGFALATSALLVSGA+AEGVPKRLTFDEI+SKTY+EVKG+GTANQCPTI+GG+E+F
Sbjct  61   ATKLAGFALATSALLVSGASAEGVPKRLTFDEIRSKTYLEVKGTGTANQCPTIDGGLESF  120

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            AFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLD
Sbjct  121  AFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLD  168



>emb|CDX81388.1| BnaC09g07990D [Brassica napus]
Length=332

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+A T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSATTFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLD  172



>ref|XP_002283699.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=331

 Score =   256 bits (653),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 144/171 (84%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLD
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLD  171



>emb|CAN79166.1| hypothetical protein VITISV_019248 [Vitis vinifera]
Length=331

 Score =   255 bits (652),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 144/171 (84%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASL  AATL QPTK G+  + G   +S  +V KA G DP+ AR+TCSLQ+ +K+LA  
Sbjct  1    MAASLHVAATLRQPTKAGLPAKTGLQLKSSPSVCKAFGYDPAGARLTCSLQTHVKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             +DAAK+AGFALATSA LVSGA AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CADAAKIAGFALATSAFLVSGAGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFK G Y+ KKFCLEPTSFTVKAE VSKNAP EFQNTKLMTRLTYTLD
Sbjct  121  DSFAFKTGSYNMKKFCLEPTSFTVKAEGVSKNAPAEFQNTKLMTRLTYTLD  171



>ref|XP_010103689.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
 gb|EXB96701.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
Length=333

 Score =   255 bits (652),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG------RSYQTVGKALGVDPSPARITCSLQSQIKEL  194
            MAASLQTAATL   TKVG+  R G      RS Q V KA GV+P+ AR+TCSLQS  K+L
Sbjct  1    MAASLQTAATLT--TKVGMPARGGGGSLQLRSAQAVSKAFGVEPAGARLTCSLQSDFKDL  58

Query  195  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  374
            A    DA K+AGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+EVKG+GTANQCPTI+
Sbjct  59   AQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYLEVKGTGTANQCPTID  118

Query  375  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GGV++FAFK GKY+ KK CLEPTSFTVKAESV+KNAPPEFQNTKLMTRLTYTLD
Sbjct  119  GGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNAPPEFQNTKLMTRLTYTLD  172



>gb|AAT65501.1| photosystem II protein [Brassica oleracea]
Length=347

 Score =   256 bits (653),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 145/181 (80%), Gaps = 4/181 (2%)
 Frame = +3

Query  6    ELTLLSDPTMAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSL  173
            EL+      MAASLQ+AAT  Q  K+   P  G    RS QTVGK+ G++ S AR+TCS 
Sbjct  7    ELSERHSVAMAASLQSAATFFQSAKISTAPSRGSAHLRSAQTVGKSFGLETSSARLTCSY  66

Query  174  QSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTA  353
            QS IK+ A   SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTA
Sbjct  67   QSDIKDFAGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTA  126

Query  354  NQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTL  533
            NQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLT TL
Sbjct  127  NQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTCTL  186

Query  534  D  536
            D
Sbjct  187  D  187



>emb|CDY50981.1| BnaC02g48890D [Brassica napus]
Length=332

 Score =   255 bits (652),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 143/172 (83%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+A+T +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSASTFLQSAKIITAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLD  172



>ref|XP_006403995.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
 dbj|BAJ34028.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45448.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
Length=331

 Score =   255 bits (651),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 142/171 (83%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MA SLQ A T +QP K+  +P      RS QTV K+ G++ SPAR+TCSL S  K+ A  
Sbjct  1    MATSLQAATTFLQPAKIAASPSRSVHLRSNQTVAKSFGLESSPARLTCSLHSDFKDFAGK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG 
Sbjct  61   CSDAAKVAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGS  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  EAFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLD  171



>ref|XP_003636084.1| Oxygen-evolving enhancer protein [Medicago truncatula]
 gb|KEH20462.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KEL H F +
Sbjct  1    MAASLQAAATLMQPTKLRSNSLQLKSTQSVSKAFGLEHYGAKVTCSLQSDFKELTHKFVE  60

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +FKPGKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLD
Sbjct  121  SFKPGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLD  168



>gb|KFK28330.1| hypothetical protein AALP_AA8G502100 [Arabis alpina]
Length=332

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 141/172 (82%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFIQSAKIATAPSRGGASLRSSQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+ SGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  61   KCSDAVKIAGFALATSALVASGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FK GKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKAGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLD  172



>gb|ABG25041.1| 33kDa precursor protein of oxygen-evolving complex [Nicotiana 
tabacum]
Length=179

 Score =   249 bits (635),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  105  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  284
            RS Q+V KA GV+P+ AR+TCS Q+++K+LA  F+DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEPAAARLTCSSQTELKDLAQKFTDAAKVAGFALATSALVVSGANAEGV  62

Query  285  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  464
            PKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKA 
Sbjct  63   PKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVASFAFKPGKYNAKKFCLEPTSFTVKAG  122

Query  465  SVSKNAPPEFQNTKLMTRLTYTLD  536
            SV+KNAPP+FQ TKLMTRLTYTLD
Sbjct  123  SVNKNAPPDFQKTKLMTRLTYTLD  146



>gb|AAM65169.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKYS KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYSGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|NP_001241522.1| uncharacterized protein LOC100820458 [Glycine max]
 gb|ACU23458.1| unknown [Glycine max]
 gb|KHN36175.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MAASLQ AAT MQPTKVG+  R  +S Q + KA G++P+ A++ CSL+  +K+ A    D
Sbjct  1    MAASLQAAATFMQPTKVGMATRNLKSTQCISKAFGLEPAAAKLICSLKPDLKDFAQKCVD  60

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            A K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGVDSF  120

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            AFK GKY A+K CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLD
Sbjct  121  AFKAGKYKAQKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLD  168



>ref|XP_007155994.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27988.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=330

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  209
            MAASLQ AAT MQPTK+G T  +  +S Q++ KA G++P+ A+I+CSL + +K+ A    
Sbjct  1    MAASLQAAATFMQPTKLGRTNTLQLKSPQSISKAFGLEPAGAKISCSLHADLKDFAQKCV  60

Query  210  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  389
            DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++
Sbjct  61   DATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDS  120

Query  390  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FAFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLD
Sbjct  121  FAFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLD  169



>ref|NP_001043134.1| Os01g0501800 [Oryza sativa Japonica Group]
 dbj|BAB64069.1| putative 33kDa oxygen evolving protein of photosystem II [Oryza 
sativa Japonica Group]
 dbj|BAF05048.1| Os01g0501800 [Oryza sativa Japonica Group]
 gb|EAZ12041.1| hypothetical protein OsJ_01921 [Oryza sativa Japonica Group]
 dbj|BAG96401.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96320.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96862.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96934.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 144/173 (83%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPA-RITCSLQSQIKELA  197
            MAASLQ AATLMQP K+G          R    V +A GVD   A RITCSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVA  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
            +  +DAAKLAGFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EG
Sbjct  61   NKCADAAKLAGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV++FAFK GKY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLD
Sbjct  121  GVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLD  173



>ref|XP_006291313.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
 gb|EOA24211.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
Length=376

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 145/182 (80%), Gaps = 5/182 (3%)
 Frame = +3

Query  6    ELTLLSDPTMAASLQTAATLMQPTKVGVTPRIGR-----SYQTVGKALGVDPSPARITCS  170
             L L+    MA SL  AAT +QP K+  +    R     S QTVGK+ G++ S AR+TCS
Sbjct  35   HLRLVCLVVMATSLHAAATFLQPAKIAASSSPSRNVYLRSNQTVGKSFGLESSSARLTCS  94

Query  171  LQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGT  350
            LQS +K+ A   SDAAK+AGFALATSAL+VSGA AEG PKRLT+DEIQSKTYMEVKG+GT
Sbjct  95   LQSDLKDFAGKCSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGT  154

Query  351  ANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYT  530
            ANQCPTI+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYT
Sbjct  155  ANQCPTIDGGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYT  214

Query  531  LD  536
            LD
Sbjct  215  LD  216



>gb|AAK49614.1|AF372898_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   253 bits (645),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|NP_201458.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
 sp|P23321.2|PSBO1_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
1; Short=MSP-1; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL11619.1|AF424626_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
 emb|CAA75629.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 dbj|BAB10933.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
 gb|AAK96492.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AAL31251.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AED98230.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
Length=332

 Score =   252 bits (644),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLD  172



>gb|AAK96774.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
Length=332

 Score =   252 bits (643),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLD  172



>gb|EEC70714.1| hypothetical protein OsI_02088 [Oryza sativa Indica Group]
Length=333

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPA-RITCSLQSQIKELA  197
            MAASLQ AATLMQP K+G          R    V +A GVD   A RITCSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRASSAALPSRPSSHVARAFGVDTGAAGRITCSLQSDIREVA  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
            +  +DAAKL GFALATSALLVSGA+AEGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EG
Sbjct  61   NKCADAAKLTGFALATSALLVSGASAEGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV++FAFK GKY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLD
Sbjct  121  GVDSFAFKAGKYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLD  173



>ref|XP_010924332.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Elaeis guineensis]
Length=334

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 144/173 (83%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPR--IGRSYQT---VGKALGVDPSPARITCSLQSQIKELA  197
            MAASLQ AATLMQP+ VG T R   G+  +T   + K  G +P+ AR+TCSLQ+ +++L 
Sbjct  1    MAASLQAAATLMQPSTVGATRRSLAGQQLRTSSHLSKTFGFEPAGARLTCSLQTDLRDLV  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
               +DA KLAGFALATSALLV+GANAEGVP RLT+DEIQSKTYMEVKG GTANQCPTIEG
Sbjct  61   QKCADATKLAGFALATSALLVAGANAEGVPSRLTYDEIQSKTYMEVKGIGTANQCPTIEG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV++FAFKPGKY  KKFCLEPTSFTVKAESV+KNAPPEFQ TKLMT LTYTLD
Sbjct  121  GVDSFAFKPGKYQMKKFCLEPTSFTVKAESVNKNAPPEFQKTKLMTCLTYTLD  173



>gb|AAM96957.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 gb|AAN15726.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 139/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K    
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKNFTG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLD  172



>gb|AAL08257.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 140/172 (81%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALA+SAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALASSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|XP_003548008.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Glycine max]
 gb|KHN13352.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=331

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 148/170 (87%), Gaps = 2/170 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPAR-ITCSLQSQIKELAHNF  206
            MAASLQ AAT MQPTK+  +  +  +S Q++ KA G++P  A+ +TCSLQ+ +K+LAH  
Sbjct  1    MAASLQAAATFMQPTKLSRSNTLQQKSTQSISKAFGLEPVGAKKVTCSLQADLKDLAHKC  60

Query  207  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  386
             DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG++
Sbjct  61   VDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLD  120

Query  387  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +FAFKPGKY+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLD
Sbjct  121  SFAFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLD  170



>ref|NP_001240871.1| uncharacterized protein LOC100811386 [Glycine max]
 gb|ACU17834.1| unknown [Glycine max]
 gb|KHN00579.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=326

 Score =   250 bits (638),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 145/169 (86%), Gaps = 5/169 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNFS  209
            MA+SLQ AAT MQPTK        +S Q + KA G++P+   ++TCSLQ+ +K+LAH   
Sbjct  1    MASSLQAAATFMQPTKFLQL----KSTQAISKAFGLEPAGVNKVTCSLQADLKDLAHKCV  56

Query  210  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  389
            DA K+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+E+
Sbjct  57   DATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLES  116

Query  390  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FAFK GKY+AKKFCLEPTSFTVKAE V+KNAPPEFQNTKLMTRLTYTLD
Sbjct  117  FAFKQGKYNAKKFCLEPTSFTVKAEGVAKNAPPEFQNTKLMTRLTYTLD  165



>gb|ACS34663.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=294

 Score =   248 bits (634),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  66   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  233
            MQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  234  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  413
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  414  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLD
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLD  161



>ref|XP_010465252.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=331

 Score =   249 bits (636),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+AAT +Q  K+   P  G    RS QTVGK+ G++ S AR+TCS QS  K+ A 
Sbjct  1    MAASLQSAATFLQSAKISTAPSRGSAHLRSTQTVGKSFGLETSSARLTCSFQSDFKDFAG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AE  PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAE-APKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG  119

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+ KPGKY+ KKFC EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  120  SETFSIKPGKYAGKKFCFEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  171



>ref|XP_004968772.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Setaria italica]
Length=333

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 138/171 (81%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQP K+G         R    V +A GVD    RI+CSLQS ++E+A  
Sbjct  1    MAASLQAAATLMQPAKIGGRASASLPSRQASHVARAFGVDAGAGRISCSLQSDVREVASK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CIDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++F FK GKY  KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLD
Sbjct  121  DSFPFKAGKYQMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLD  171



>gb|AFW90569.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=293

 Score =   248 bits (632),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = +3

Query  66   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  233
            MQPTKVG V+ R     RS Q+V KA G++PS +R++CSLQ+ +K+ A   +DAAK+AGF
Sbjct  1    MQPTKVGGVSARNNLQLRSSQSVSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGF  60

Query  234  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  413
            ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY  120

Query  414  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYTLD
Sbjct  121  NAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLD  161



>ref|XP_010424899.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Camelina sativa]
Length=334

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 142/174 (82%), Gaps = 6/174 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG------RSYQTVGKALGVDPSPARITCSLQSQIKEL  194
            MA SLQ AAT +QP K+  +          RS QT+GK+ G++ S AR+TCSL S +K+ 
Sbjct  1    MATSLQAAATFLQPAKIAASSSPPSRSVHLRSNQTIGKSFGLESSSARLTCSLHSDLKDF  60

Query  195  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  374
            A   S+ AK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+
Sbjct  61   AGKCSEVAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTID  120

Query  375  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  GGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLD  174



>sp|P14226.1|PSBO_PEA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Pisum sativum]
 emb|CAA33408.1| unnamed protein product [Pisum sativum]
 dbj|BAA02554.1| precursor for 33-kDa protein of photosystem II [Pisum sativum]
 prf||1611461A O2 evolving complex 33kD protein
Length=329

 Score =   248 bits (633),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MAASLQ AATLMQPTK+       +S Q+V KA G++   A++TCSLQS  KELAH   +
Sbjct  1    MAASLQAAATLMQPTKLRSNTLQLKSNQSVSKAFGLEHYGAKVTCSLQSDFKELAHKCVE  60

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            A+K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++F
Sbjct  61   ASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSF  120

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +FKPGKY+AKK CLEPTSFTVK+E V+KN P  FQNTKLMTRLTYTLD
Sbjct  121  SFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLD  168



>gb|ABG25040.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
Length=179

 Score =   243 bits (619),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  105  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  284
            RS Q+V KA GV+    R+TCSLQ++IKELA   +DAAK+AGFALATSAL+VSGANAEGV
Sbjct  3    RSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKIAGFALATSALVVSGANAEGV  62

Query  285  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  464
            PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV +FAFKPGKY+AKKFCLEPTSFTVKAE
Sbjct  63   PKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGKYTAKKFCLEPTSFTVKAE  122

Query  465  SVSKNAPPEFQNTKLMTRLTYTLD  536
             VSKN+ P+FQ TKLMTRLTYTLD
Sbjct  123  GVSKNSAPDFQKTKLMTRLTYTLD  146



>ref|XP_008440181.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Cucumis melo]
Length=332

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 148/171 (87%), Gaps = 3/171 (2%)
 Frame = +3

Query  33   MAASLQ-TAATLMQPTKVG--VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAAS+  TAATLMQP+K+    T    RS Q++ KA G++ + AR+TCSL S +K+++  
Sbjct  1    MAASVHATAATLMQPSKLASRTTTSQLRSSQSLSKAFGLESAGARLTCSLHSDLKDVSRK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
            F+DAAK+AGFALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTIEGGV
Sbjct  61   FADAAKIAGFALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFK GKY AKKFCLEPTSFTVKAE VSKN+PPEFQNTKLMTRLTYTLD
Sbjct  121  DSFAFKAGKYQAKKFCLEPTSFTVKAEGVSKNSPPEFQNTKLMTRLTYTLD  171



>ref|XP_008787656.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=334

 Score =   247 bits (631),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 144/173 (83%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPR--IG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MAASLQ AA LMQP K+G T R   G   R++  + KA G +P+ A +TCSLQ+ +++LA
Sbjct  1    MAASLQAAAMLMQPAKIGATGRSLAGQQLRTFSHLSKAFGFEPAGAGLTCSLQTDLRDLA  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
               +DA KLAGFA ATSAL+V+GANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEG
Sbjct  61   LKCADATKLAGFAHATSALVVAGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV++FAFKPGKY  K+FCLEPTSFTVKAE ++KN+P EFQ TKLMTRLTYTLD
Sbjct  121  GVDSFAFKPGKYQMKRFCLEPTSFTVKAEGINKNSPAEFQKTKLMTRLTYTLD  173



>ref|XP_006644206.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Oryza brachyantha]
Length=334

 Score =   247 bits (631),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 141/173 (82%), Gaps = 6/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-----RSYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MAASLQ AATLMQP K+G  P        R    V +A GVD +  R++CSLQS I+E+A
Sbjct  1    MAASLQAAATLMQPAKLGGRPASSAALPSRPSSHVARAFGVD-AGCRVSCSLQSDIREVA  59

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
               +DAAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPT++G
Sbjct  60   SKCADAAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTVDG  119

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV+ F FK GKY+ KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLD
Sbjct  120  GVDTFPFKSGKYNVKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLD  172



>ref|XP_009149414.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Brassica rapa]
Length=333

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFV  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLD  173



>emb|CAA36675.1| 33 kDa oxygen-evolving protein [Arabidopsis thaliana]
Length=332

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ+ AT +Q  K+   P  G    RS Q VGK+ G++ S AR+TCS QS  K+   
Sbjct  1    MAASLQSTATFLQSAKIATAPSRGSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTG  60

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTAN  PTI+GG
Sbjct  61   KCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANHSPTIDGG  120

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  121  SETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLD  172



>ref|XP_010673597.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 138/169 (82%), Gaps = 1/169 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  209
            MAASLQ + T +QPTKV     +  RS   V KA GV+P+  R+  SLQS +KELA+   
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTPNVCKAFGVEPASGRLCLSLQSDLKELANKCV  60

Query  210  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  389
            DA KLAG ALATSAL+ SGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGGV+ 
Sbjct  61   DATKLAGLALATSALIASGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGVDT  120

Query  390  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FAFK GKY+AKKFCLEPT F VKAE VSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  FAFKAGKYNAKKFCLEPTKFAVKAEGVSKNAPPDFQNTKLMTRLTYTLD  169



>ref|XP_010503753.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=336

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 141/176 (80%), Gaps = 8/176 (5%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG--------RSYQTVGKALGVDPSPARITCSLQSQIK  188
            MA SLQ AAT +QP K+  +            RS QTV K+ G++ S AR TCSLQS +K
Sbjct  1    MATSLQAAATFLQPAKIAASSSSSSPSRNVHLRSNQTVAKSFGLESSSARRTCSLQSDLK  60

Query  189  ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  368
            + A   S+AAK+AGF LATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPT
Sbjct  61   DFAGKCSEAAKIAGFTLATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPT  120

Query  369  IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            I+GG E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  IDGGSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLD  176



>ref|XP_003611860.1| Oxygen evolving enhancer protein [Medicago truncatula]
 gb|AES94818.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 147/172 (85%), Gaps = 8/172 (5%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MA SLQ AATLMQPTK+G+  R      +S Q++ KA G++ + A++TCSLQ    ++AH
Sbjct  1    MAVSLQAAATLMQPTKIGINNRSTTLHLKSTQSISKAFGLEHNGAKLTCSLQ----DIAH  56

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
             F+D+AK+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTIEGG
Sbjct  57   RFADSAKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIEGG  116

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             ++F+FK GKY+AKKFCLEPTSFTVK+E ++KN+P +FQNTKLMTRLTYTLD
Sbjct  117  SDSFSFKSGKYNAKKFCLEPTSFTVKSEGITKNSPLDFQNTKLMTRLTYTLD  168



>ref|XP_004509219.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cicer arietinum]
Length=329

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MAASLQ AATLMQPTK+       +S Q++ KA G++ S +++TCSLQ+  K+LAH   +
Sbjct  1    MAASLQAAATLMQPTKLRSNSFQLKSTQSISKAFGLEHSGSKVTCSLQTDFKDLAHKCVE  60

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            A K+AGFALATSAL+VSGA+AEG PKRLTFDEIQSKTY+EVKG+GTANQCPTI+GG+++F
Sbjct  61   ATKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLDSF  120

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            AFK GKY+AKKFCLEPTSFTVKAE V+KN P  FQNTKLMTRLTYTLD
Sbjct  121  AFKAGKYNAKKFCLEPTSFTVKAEGVTKNTPLAFQNTKLMTRLTYTLD  168



>ref|XP_004141946.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004160493.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48464.1| Oxygen-evolving enhancer protein 1 [Cucumis sativus]
Length=332

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 139/161 (86%), Gaps = 2/161 (1%)
 Frame = +3

Query  60   TLMQPTKVG--VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  233
            TLMQP+K+    T    RS Q++ KA G++ S  R+TCSL S +K+++  F+DAAK+AGF
Sbjct  11   TLMQPSKLASRTTTSHLRSSQSLSKAFGLESSGPRLTCSLHSDLKDVSRKFADAAKIAGF  70

Query  234  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  413
            ALATSAL+VSGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFK GKY
Sbjct  71   ALATSALVVSGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKAGKY  130

Query  414  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             AKKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLD
Sbjct  131  QAKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLD  171



>emb|CDY33308.1| BnaA01g19750D [Brassica napus]
Length=381

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSFGLESSPARLTCSIHSDFKDFV  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLD  173



>ref|XP_009616099.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=326

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 139/172 (81%), Gaps = 11/172 (6%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG----RSYQTVGKALGVDPSPARITCSLQSQIKELAH  200
            MAASLQ AATL     +GV P       RS Q+V KA GV+P+  R+TCSLQ   K+LA 
Sbjct  1    MAASLQAAATL-----IGVIPSRNNLQFRSSQSVSKAFGVEPATVRLTCSLQVDFKDLAQ  55

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              SDAAK+AGFA ATSAL+  GANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG
Sbjct  56   KCSDAAKVAGFAFATSALV--GANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGG  113

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             E FAFKPGKY+AKKFCLEPTSFTVKAE V+KN+PP FQ TKLMTRLTYTLD
Sbjct  114  FETFAFKPGKYNAKKFCLEPTSFTVKAEGVNKNSPPAFQKTKLMTRLTYTLD  165



>emb|CDY26519.1| BnaC01g23800D [Brassica napus]
Length=373

 Score =   246 bits (627),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQ-TAATLMQPTKVGVT-PRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MA SL+ T AT +QP K+  + P      RS QTVGK+ G++ SPAR+TCS+ S  K+  
Sbjct  1    MATSLKATTATFLQPAKIATSSPSRNVHLRSNQTVGKSSGLESSPARLTCSIHSDFKDFV  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
               SDAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSDAAKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            G E F+FKPGKY+ KKFC EPTSFTVKA+SVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLD  173



>ref|XP_010515458.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=333

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 140/173 (81%), Gaps = 5/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGR-----SYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MA SL  AAT +QP K+  +    R     S QTVGK+ G++ S  R+TCSL S +KE A
Sbjct  1    MATSLHAAATFLQPAKIAASSSPSRNVHFRSNQTVGKSFGLESSSPRLTCSLHSDLKEFA  60

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
               S++AK+A FALATSAL+VSGA+AEG P+RLT+DEIQSKTYMEVKG+GTANQCPTI+G
Sbjct  61   GKCSESAKIACFALATSALVVSGASAEGAPRRLTYDEIQSKTYMEVKGTGTANQCPTIDG  120

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            G E F+FKPGKY+ KKFC EPTSFTVKAESVSKNAPP+FQNTKLMTRLTYTLD
Sbjct  121  GSETFSFKPGKYTGKKFCFEPTSFTVKAESVSKNAPPDFQNTKLMTRLTYTLD  173



>gb|EMS63035.1| Oxygen-evolving enhancer protein 1, chloroplastic [Triticum urartu]
 gb|EMT33794.1| Oxygen-evolving enhancer protein 1, chloroplastic [Aegilops tauschii]
Length=328

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAD  58

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLD
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLD  166



>gb|AFW69213.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=373

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 141/176 (80%), Gaps = 7/176 (4%)
 Frame = +3

Query  30   TMAASLQT--AATLMQPTKVG-----VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIK  188
            TMAASLQ   AATLMQP K+G      +    R    + +A GVD   ARITCSLQS ++
Sbjct  38   TMAASLQVQAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQSDVR  97

Query  189  ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  368
            ++A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPT
Sbjct  98   DVASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPT  157

Query  369  IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            I+GGV++F FKPGKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLD
Sbjct  158  IDGGVDSFPFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLD  213



>dbj|BAJ89638.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATLM-PAKIGGRASSVRPSSHVARAFGVDAA-ARITCSLQSDIREVASKCAD  58

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLD
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLD  166



>sp|P27665.1|PSBO_WHEAT RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Triticum aestivum]
 pir||S16260 photosystem II oxygen-evolving complex protein 1 - common wheat 
x Sanduri wheat
 emb|CAA40670.1| 33kDa oxygen evolving protein of photosystem II [Triticum aestivum]
Length=325

 Score =   242 bits (618),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MAASLQ AAT+M P K+G      R    V +A GVD + ARITCSLQS I+E+A   +D
Sbjct  1    MAASLQAAATVM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAD  58

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            AAK+AGFALATSALLVSGA AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGATAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLD
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPRFQKTKLMTRLTYTLD  166



>ref|NP_001130585.1| uncharacterized protein LOC100191684 [Zea mays]
 gb|ACF78862.1| unknown [Zea mays]
 gb|ACF88206.1| unknown [Zea mays]
 gb|ACG31799.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN29302.1| unknown [Zea mays]
 gb|ACN33484.1| unknown [Zea mays]
Length=335

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 140/175 (80%), Gaps = 7/175 (4%)
 Frame = +3

Query  33   MAASLQT--AATLMQPTKVG-----VTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKE  191
            MAASLQ   AATLMQP K+G      +    R    + +A GVD   ARITCSLQS +++
Sbjct  1    MAASLQVQAAATLMQPAKIGGRAPSASLPSSRPSSQLARAFGVDAGAARITCSLQSDVRD  60

Query  192  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  371
            +A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCPTI
Sbjct  61   VASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCPTI  120

Query  372  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +GGV++F FKPGKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLD
Sbjct  121  DGGVDSFPFKPGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLD  175



>gb|EPS61846.1| oxygen-evolving enhancer protein 1, chloroplastic [Genlisea aurea]
Length=330

 Score =   242 bits (618),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 139/169 (82%), Gaps = 1/169 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  209
            MA S+Q  ATLMQP ++  T  +  RS    GK+LG++    R TCSL + +K+LA   +
Sbjct  1    MATSMQAVATLMQPARLRSTASVPIRSVPAAGKSLGIESGAGRFTCSLNTDLKQLAVKLA  60

Query  210  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  389
            DAAK+AGFALATSAL+ SGA AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++
Sbjct  61   DAAKIAGFALATSALVASGAGAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDS  120

Query  390  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FAFK GKY+AKK CLEPTSFTVKAE V+KNAPP+FQ TKLMTRLTYTLD
Sbjct  121  FAFKAGKYNAKKLCLEPTSFTVKAEGVNKNAPPDFQKTKLMTRLTYTLD  169



>gb|ADB07372.1| chloroplast managanese stabilizing protein [Capsicum annuum]
Length=281

 Score =   239 bits (611),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 137/161 (85%), Gaps = 4/161 (2%)
 Frame = +3

Query  66   MQPTKVG-VTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGF  233
            MQPTK+G V+ R     RS Q+V K  GV+   AR+TCSLQ  +K+ A   +DAAK+AGF
Sbjct  1    MQPTKIGGVSARNNLQLRSSQSVNKTFGVEQGAARLTCSLQCDLKDFAQKCTDAAKIAGF  60

Query  234  ALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKY  413
            ALATSAL+VSGANAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPT++GGV++FAFKPGKY
Sbjct  61   ALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTVDGGVDSFAFKPGKY  120

Query  414  SAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +AKK CLEPTSFTVKAE V+KN+ PEFQ TKLMTRLTYTLD
Sbjct  121  NAKKLCLEPTSFTVKAEGVNKNSAPEFQKTKLMTRLTYTLD  161



>gb|ABQ52657.1| chloroplast oxygen-evolving enhancer protein 1 [Leymus chinensis]
Length=328

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MAASLQ AATLM P K+G      R    V +A GVD + ARITCSLQS I+E+A   ++
Sbjct  1    MAASLQAAATLM-PAKIGGRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCAE  58

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
            AAK+AGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV++F
Sbjct  59   AAKMAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSF  118

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             FK GKY  KKFCLEPTSFTVKAE + KN PP FQ TKLMTRLTYTLD
Sbjct  119  PFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPAFQKTKLMTRLTYTLD  166



>gb|AEN02470.1| oxygen-evolving enhancer protein [Camellia sinensis]
Length=333

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 145/174 (83%), Gaps = 7/174 (4%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPR-----IGRSYQTVGKALGVDPS-PARITCSLQSQIKEL  194
            MAASLQ AAT+MQPTKVGV  R     + RS Q+V K  GV+ +  AR+TCS+ +  K+L
Sbjct  1    MAASLQAAATMMQPTKVGVQGRSTNVQLLRSSQSVCKVFGVEQTGSARLTCSV-TDAKDL  59

Query  195  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  374
            A   + AAK+AGFALATSAL+VSGA+AEG PKRLTFDEI+SKTY+EVKG+GTANQCPTIE
Sbjct  60   AQKCAVAAKVAGFALATSALVVSGASAEGPPKRLTFDEIRSKTYLEVKGTGTANQCPTIE  119

Query  375  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GGV+ FAFKPGKY  KKFCLEPTSFTVKA+SVSKNA PEFQ TKLMTRLTYTLD
Sbjct  120  GGVDKFAFKPGKYQMKKFCLEPTSFTVKADSVSKNASPEFQRTKLMTRLTYTLD  173



>ref|XP_002866983.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43242.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 134/169 (79%), Gaps = 1/169 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQT-VGKALGVDPSPARITCSLQSQIKELAHNFS  209
            MAA LQ A T +QP +V   PR     +  V K  GV+P  +R++CSL   +K L   F 
Sbjct  1    MAAFLQAAVTTVQPARVDPPPRAAAKLRMCVSKYFGVEPVASRVSCSLHDDLKNLTLKFV  60

Query  210  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  389
            D  K+AGF+LA SAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG+E+
Sbjct  61   DTTKIAGFSLAASALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGLES  120

Query  390  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLD
Sbjct  121  FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLD  169



>sp|O49079.1|PSBO_FRIAG RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Fritillaria agrestis]
 gb|AAC04808.1| photosystem II oxygen evolving complex protein 1 precursor [Fritillaria 
agrestis]
Length=329

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 140/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPA-RITCSLQSQIKELAHNF  206
            MA+SLQ AATL+ P KVG   R   RS   + KA G D S A R+TCS+ S ++++A   
Sbjct  1    MASSLQAAATLI-PAKVGAPARTHLRSNSHLSKAFGFDNSTAGRLTCSINSDLRDIAQKC  59

Query  207  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  386
            +DAAKLAGFALATSAL++SGA+AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG E
Sbjct  60   TDAAKLAGFALATSALVISGASAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGTE  119

Query  387  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +F +K GKY+ KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLD
Sbjct  120  SFGYKTGKYTLKKLCLEPTSFTVKAEGINKNAPPEFQKTKLMTRLTYTLD  169



>gb|AFH40666.1| chloroplast oxygen-evolving enhancer protein 1, partial [Saccharum 
hybrid cultivar]
Length=332

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 136/177 (77%), Gaps = 14/177 (8%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRS---------YQTVGKALGVDPSPARITCSLQSQI  185
            MAASLQ AATLMQP K+G     GR+            + +A GVD   ARITCSLQS  
Sbjct  1    MAASLQAAATLMQPAKIG-----GRAPSASLPSRSSSHLARAFGVDAGAARITCSLQSDF  55

Query  186  KELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCP  365
            + +A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTY+EVKG+GTANQCP
Sbjct  56   RGVASKCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYLEVKGTGTANQCP  115

Query  366  TIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            T +GGVE F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLD
Sbjct  116  TTDGGVEAFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLD  172



>ref|XP_010557854.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Tarenaya hassleriana]
Length=317

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 132/168 (79%), Gaps = 11/168 (7%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSD  212
            MAASLQ AAT +  +K+   P  G   ++           +RITCS+QS +K+ A   SD
Sbjct  1    MAASLQAAATFLHQSKISAAPSRGGHLRS-----------SRITCSIQSDLKDFAGKCSD  49

Query  213  AAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF  392
             AK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GG E F
Sbjct  50   TAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGSETF  109

Query  393  AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             FK G+YS KKFC EPTSFTVKAE +SKNAPPEFQNTKLMTRLTYTLD
Sbjct  110  EFKAGQYSGKKFCFEPTSFTVKAEGISKNAPPEFQNTKLMTRLTYTLD  157



>ref|XP_008647514.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG31595.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN32168.1| unknown [Zea mays]
 gb|AFW75930.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=329

 Score =   237 bits (605),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 137/178 (77%), Gaps = 19/178 (11%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGR----------SYQTVGKALGVDPSPARITCSLQSQ  182
            MAASLQ AATLMQP K+G     GR          S Q   +A GVD   ARITCSLQ  
Sbjct  1    MAASLQAAATLMQPAKIG-----GRAPFASLPSRPSSQLACRAFGVDAGAARITCSLQ--  53

Query  183  IKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQC  362
              ++A    DAAKLAGFALATSALLVSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQC
Sbjct  54   --DVASRCVDAAKLAGFALATSALLVSGASAEGTPKRLTYDEIQSKTYMEVKGTGTANQC  111

Query  363  PTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            PTI+GGVE+F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLD
Sbjct  112  PTIDGGVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLD  169



>sp|P85194.1|PSBO_HELAN RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Helianthus annuus]
Length=324

 Score =   234 bits (598),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 140/169 (83%), Gaps = 6/169 (4%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  209
            MAASLQ AAT M PT      R+  +S  ++ KA G++ + ++++CSLQ+ +K+ A   +
Sbjct  1    MAASLQAAATFMTPTS-----RVQLKSSPSICKAFGIESTGSKVSCSLQADLKDFAQKCT  55

Query  210  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  389
            DAAK+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV  
Sbjct  56   DAAKIAGFALATSALVVSGASAEGSPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVNG  115

Query  390  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FA KPGKY+A+KFCLEPTSFTVKAE +SKN+ PEFQ TKLMTRLTYTLD
Sbjct  116  FAVKPGKYNAQKFCLEPTSFTVKAEGISKNSAPEFQKTKLMTRLTYTLD  164



>ref|XP_010446731.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=329

 Score =   234 bits (598),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 142/174 (82%), Gaps = 7/174 (4%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPA-RITCSLQSQIKEL  194
            MAA LQ A T MQ T+V VTP     ++  S Q+V K  G +P+ A R++CSL + +K L
Sbjct  1    MAAFLQAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNL  59

Query  195  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  374
              +  DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIE
Sbjct  60   IQSCVDATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIE  119

Query  375  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GGV++FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLD
Sbjct  120  GGVDSFAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLD  173



>ref|XP_010432119.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=331

 Score =   234 bits (598),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 141/173 (82%), Gaps = 6/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MAA LQ A T +Q T++ VTP     ++  S Q+V K  GV+   +R++CSL + +K L+
Sbjct  1    MAAFLQAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLS  59

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
             +  DA K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEG
Sbjct  60   QSCVDATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEG  119

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV++F+ KPGKY A+KFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLD
Sbjct  120  GVDSFSIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLD  172



>ref|XP_010432121.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=324

 Score =   234 bits (597),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 141/173 (82%), Gaps = 6/173 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPARITCSLQSQIKELA  197
            MAA LQ A T +Q T++ VTP     ++  S Q+V K  GV+   +R++CSL + +K L+
Sbjct  1    MAAFLQAAVTPVQSTRL-VTPTSSAAKLRTSSQSVSKCFGVNTVASRVSCSLHNDLKNLS  59

Query  198  HNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEG  377
             +  DA K+AGFALATSALLVSGANAEGVPKRLT+ EIQSKTYMEVKG+GTANQCPTIEG
Sbjct  60   QSCVDATKIAGFALATSALLVSGANAEGVPKRLTYKEIQSKTYMEVKGTGTANQCPTIEG  119

Query  378  GVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GV++F+ KPGKY A+KFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLD
Sbjct  120  GVDSFSIKPGKYYARKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLD  172



>ref|XP_010446730.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=332

 Score =   234 bits (597),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 142/174 (82%), Gaps = 7/174 (4%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTP-----RIGRSYQTVGKALGVDPSPA-RITCSLQSQIKEL  194
            MAA LQ A T MQ T+V VTP     ++  S Q+V K  G +P+ A R++CSL + +K L
Sbjct  1    MAAFLQAAVTPMQSTRV-VTPTSAAAKLRTSSQSVSKCFGFEPAVASRVSCSLHNDLKNL  59

Query  195  AHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIE  374
              +  DA K+AGFALATSAL+VSGA+AEGVPKRLT++EIQSKTYMEVKG+GTANQCPTIE
Sbjct  60   IQSCVDATKIAGFALATSALIVSGASAEGVPKRLTYEEIQSKTYMEVKGTGTANQCPTIE  119

Query  375  GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GGV++FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLD
Sbjct  120  GGVDSFAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLD  173



>gb|AFK43771.1| unknown [Lotus japonicus]
Length=332

 Score =   234 bits (597),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 141/175 (81%), Gaps = 11/175 (6%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSY-------QTVGKALGVDPSPARITCSLQSQIKE  191
            MA SLQ AATLMQPTKV        S        Q++ KA G++ + A++TC+LQ    +
Sbjct  1    MATSLQAAATLMQPTKVAAITSTRSSSTLQLKPTQSISKAFGLESTGAKLTCNLQ----D  56

Query  192  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  371
             A+  ++ AK+AGFALATSAL+VSGA+AEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI
Sbjct  57   FANKCAETAKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTI  116

Query  372  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            EGGV++FAFK GKYSAKK CLEPTSFTVKAE V+KN+P +FQNTKLMTRLTYTLD
Sbjct  117  EGGVDSFAFKAGKYSAKKICLEPTSFTVKAEGVTKNSPLDFQNTKLMTRLTYTLD  171



>dbj|BAG70021.1| 33 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=330

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  209
            MA SLQ + T +QPTKV     +  RS   V KA GVDP+  R++ SLQS +K+LA    
Sbjct  1    MATSLQASTTFLQPTKVASRNSLQLRSSPNVCKAFGVDPTAGRVSLSLQSDLKDLASKCV  60

Query  210  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  389
            DA KLAG ALATSAL+ SGA+A+G  KRLT+DEIQSKTY+EVKG+GTANQCPTIEGG+E+
Sbjct  61   DATKLAGLALATSALIASGASADGGTKRLTYDEIQSKTYLEVKGTGTANQCPTIEGGLES  120

Query  390  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            F FK GKY+AKKFCLEPT FTVKAE +SKNAPP+FQ+TKLMTRLTYTLD
Sbjct  121  FGFKAGKYTAKKFCLEPTKFTVKAEGISKNAPPDFQDTKLMTRLTYTLD  169



>ref|XP_003557544.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Brachypodium distachyon]
Length=330

 Score =   231 bits (590),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 137/176 (78%), Gaps = 16/176 (9%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPAR--------ITCSLQSQIK  188
            MAASLQ AATLMQP K+G   R   S   V     + PS AR        I+CSL S ++
Sbjct  1    MAASLQAAATLMQPAKMG---RSASSSSAV-----LLPSSARPSSHAARTISCSLTSDLR  52

Query  189  ELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPT  368
            E+A   +DAAKLAGFALATSALLVSGA+AEG PKRLTFDEIQSKTYMEVKG+GTANQCPT
Sbjct  53   EVATKCADAAKLAGFALATSALLVSGASAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPT  112

Query  369  IEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            I+GGV+ F FK GKY  KKFCLEPTSFTVKAE ++KNAPPEFQ TKLMTRLTYTLD
Sbjct  113  IDGGVDAFPFKAGKYEMKKFCLEPTSFTVKAEGIAKNAPPEFQKTKLMTRLTYTLD  168



>emb|CAA29062.1| unnamed protein product [Spinacia oleracea]
 prf||1404364A protein 33kD
Length=331

 Score =   229 bits (585),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 138/171 (81%), Gaps = 4/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHN  203
            MAASLQ + T +QPTKV     +  RS Q V KA GV+   S  R++ SLQS +KELA+ 
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV
Sbjct  61   CVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGV  119

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFKPGKY+AKKFCLEPT F VKAE +SKN+ P+FQNTKLMTRLTYTLD
Sbjct  120  DSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLD  170



>sp|P12359.1|PSBO_SPIOL RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Spinacia oleracea]
Length=332

 Score =   229 bits (585),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 138/171 (81%), Gaps = 4/171 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG-RSYQTVGKALGVDP--SPARITCSLQSQIKELAHN  203
            MAASLQ + T +QPTKV     +  RS Q V KA GV+   S  R++ SLQS +KELA+ 
Sbjct  1    MAASLQASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA KLAG ALATSAL+ SGANAEG  KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV
Sbjct  61   CVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGV  119

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFKPGKY+AKKFCLEPT F VKAE +SKN+ P+FQNTKLMTRLTYTLD
Sbjct  120  DSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLD  170



>gb|KJB43585.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=316

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 131/171 (77%), Gaps = 19/171 (11%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFKPGKY AKKFCLEPTSFTV                KLMTRLTYTLD
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTV----------------KLMTRLTYTLD  155



>ref|XP_006411950.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
 gb|ESQ53403.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
Length=325

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 132/169 (78%), Gaps = 3/169 (2%)
 Frame = +3

Query  33   MAASLQTAATLMQ-PTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFS  209
            M ASLQ A T +  P++     R    +Q V K+ GV+   +R+ CSL   +K LA    
Sbjct  1    MVASLQAAVTTVALPSRAAANLR--PPFQCVSKSFGVEQVTSRVYCSLHDDLKSLALKCV  58

Query  210  DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN  389
            +  K+AG ALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTIEGG+++
Sbjct  59   ETTKIAGLALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIEGGLDS  118

Query  390  FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FA KPGKY AKKFCLEPTSFTVKAE VSKN+ P+FQNTKLMTRLTYTLD
Sbjct  119  FAIKPGKYYAKKFCLEPTSFTVKAEGVSKNSTPDFQNTKLMTRLTYTLD  167



>emb|CAN61828.1| hypothetical protein VITISV_027630 [Vitis vinifera]
Length=312

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 128/171 (75%), Gaps = 23/171 (13%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MAASLQ AATLMQPTKVGV  R     RS Q+V KA G++P+ AR TCSLQ+ +K L   
Sbjct  1    MAASLQAAATLMQPTKVGVPTRTSLQLRSSQSVCKAFGLEPAGARFTCSLQADLKGLGSQ  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
                                GA+AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   --------------------GASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  100

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FAFK GKY  KKFCLEPTSFTVKAE VSKNAPPEFQNTKLMTRLTYTLD
Sbjct  101  DSFAFKSGKYQLKKFCLEPTSFTVKAEGVSKNAPPEFQNTKLMTRLTYTLD  151



>gb|ABS29557.1| chloroplast photosynthetic water oxidation complex 33kDa subunit 
precursor [Morus nigra]
Length=265

 Score =   219 bits (558),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +3

Query  153  ARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYME  332
            AR+TCSLQS  K+LA    DA K+AG ALATSAL+VSGA+AEGVPKRLT+DEIQSKTY+E
Sbjct  8    ARLTCSLQSDFKDLAQKCVDATKIAGIALATSALVVSGASAEGVPKRLTYDEIQSKTYLE  67

Query  333  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  512
            VKG+GTANQCPTIEGGV++FAFK GKY+ KK CLEPTSFTVKAESV+KN+PPEFQNTKLM
Sbjct  68   VKGTGTANQCPTIEGGVDSFAFKAGKYNVKKLCLEPTSFTVKAESVNKNSPPEFQNTKLM  127

Query  513  TRLTYTLD  536
            TRLTYTLD
Sbjct  128  TRLTYTLD  135



>gb|KJB43587.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=262

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = +3

Query  33   MAASLQTAATLMQPTKVGVTPRIG---RSYQTVGKALGVDPSPARITCSLQSQIKELAHN  203
            MA SLQ AATLMQP KV    R     RS Q+V KA G++P  AR+TCSLQ+ +K+LA  
Sbjct  1    MAVSLQAAATLMQPIKVAAPSRTNVLLRSSQSVSKAFGLEPVGARLTCSLQTDLKDLAQK  60

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
              DA KLAGFALATSAL+VSGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV
Sbjct  61   CVDATKLAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGV  120

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  494
            ++FAFKPGKY AKKFCLEPTSFTVK + V+   P  F
Sbjct  121  DSFAFKPGKYYAKKFCLEPTSFTVK-QLVASGKPDSF  156



>ref|XP_009138459.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Brassica rapa]
Length=314

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 119/144 (83%), Gaps = 2/144 (1%)
 Frame = +3

Query  105  RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGV  284
            RS Q+V K+    P   R++CSL   +K L  N  +A K+AGFALATSAL+VSGA+AEGV
Sbjct  14   RSSQSVSKSF--KPVTRRVSCSLHDDLKNLTLNCVEATKIAGFALATSALVVSGASAEGV  71

Query  285  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  464
            PKRLT+ EIQSKTYMEVKG+GTANQCPTIEGG+E+FA KPGKY AKK CLEPTSFTVKAE
Sbjct  72   PKRLTYKEIQSKTYMEVKGTGTANQCPTIEGGLESFAIKPGKYYAKKVCLEPTSFTVKAE  131

Query  465  SVSKNAPPEFQNTKLMTRLTYTLD  536
             VS+NA P FQNTKLMTRLTYTLD
Sbjct  132  DVSRNATPVFQNTKLMTRLTYTLD  155



>emb|CDX72613.1| BnaC07g46350D [Brassica napus]
Length=319

 Score =   211 bits (536),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 119/141 (84%), Gaps = 2/141 (1%)
 Frame = +3

Query  114  QTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKR  293
            Q+V K+    P   R++CSL   +K L+ N  +A K+AGFALATSAL+VSGA+AEGVPKR
Sbjct  22   QSVSKSF--KPVTRRVSCSLHDDLKNLSLNCVEATKIAGFALATSALVVSGASAEGVPKR  79

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  473
            LT++EIQSKTYMEVKG+GTANQCPTIEGG+E+FA KPGKY AKK CLEPTSFTVKAE VS
Sbjct  80   LTYEEIQSKTYMEVKGTGTANQCPTIEGGLESFAIKPGKYYAKKVCLEPTSFTVKAEGVS  139

Query  474  KNAPPEFQNTKLMTRLTYTLD  536
            KNA P FQNTKLMTRLTYTLD
Sbjct  140  KNAKPVFQNTKLMTRLTYTLD  160



>gb|AEH95324.1| 33 kDa manganese stabilizing chloroplast protein [Allium cepa]
Length=238

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +3

Query  207  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE  386
            +DAAK+AGFALATSAL+VSGANAEGVPKRLTFDEIQSKTYMEVKG+GTANQCPTI+GGV+
Sbjct  2    TDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVD  61

Query  387  NFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +FAFKPGKY+AKKFCLEPTSFTVKAE VSKN+ P+FQ TKLMTRLTYT+D
Sbjct  62   SFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTMD  111



>emb|CDY42709.1| BnaA03g53620D [Brassica napus]
Length=319

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +3

Query  114  QTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKR  293
            Q+V K+    P   R++CSL   +K L  N  +A K+AGFALATSAL+VSGA+AEGVPKR
Sbjct  22   QSVSKSF--KPVTRRVSCSLHDDLKNLTLNCVEATKIAGFALATSALVVSGASAEGVPKR  79

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  473
            LT+ +IQSKTYMEVKG+GTANQCPTIEGG+E+FA KPGKY AKK CLEPTSFTVKAE VS
Sbjct  80   LTYKDIQSKTYMEVKGTGTANQCPTIEGGLESFAIKPGKYYAKKVCLEPTSFTVKAEGVS  139

Query  474  KNAPPEFQNTKLMTRLTYTLD  536
            +NA P F NTKLMTRLTYTLD
Sbjct  140  RNATPFFLNTKLMTRLTYTLD  160



>gb|AJG36442.1| oxygen-evolving enhancer protein 1 [Pinus sylvestris]
Length=340

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 127/171 (74%), Gaps = 4/171 (2%)
 Frame = +3

Query  36   AASLQTAATLMQPTKVGVTPRIGRSYQTVGK---ALGVDPS-PARITCSLQSQIKELAHN  203
             ++LQ AATL+QPTK+ VT    R   +      A G +P+  AR++CSLQ  +KE A  
Sbjct  8    GSALQAAATLLQPTKLSVTRSSSRLSSSSSHVSRAFGFEPATSARVSCSLQDDVKEFAEK  67

Query  204  FSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGV  383
             + A K+A   LA SAL+ SGA AEG PKRLT+DEIQS+TY+EVKGSGTANQCPTI+GGV
Sbjct  68   CAGATKIAAVTLAASALVASGAGAEGPPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGGV  127

Query  384  ENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            E F FK GKY  KK C+EPTSFTVKAES +KN PP+FQ T+LMTRLTYTLD
Sbjct  128  EGFPFKAGKYEMKKLCMEPTSFTVKAESTNKNLPPDFQKTRLMTRLTYTLD  178



>gb|ACN40581.1| unknown [Picea sitchensis]
Length=341

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 132/172 (77%), Gaps = 5/172 (3%)
 Frame = +3

Query  36   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAH  200
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLD
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLD  179



>gb|ABR17376.1| unknown [Picea sitchensis]
Length=327

 Score =   196 bits (497),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 132/172 (77%), Gaps = 5/172 (3%)
 Frame = +3

Query  36   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAH  200
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLD
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLD  179



>gb|ABK24541.1| unknown [Picea sitchensis]
 gb|ABK26154.1| unknown [Picea sitchensis]
 gb|ACN39762.1| unknown [Picea sitchensis]
 gb|ACN40363.1| unknown [Picea sitchensis]
 gb|ACN40484.1| unknown [Picea sitchensis]
Length=341

 Score =   196 bits (498),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 132/172 (77%), Gaps = 5/172 (3%)
 Frame = +3

Query  36   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAH  200
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLD
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLD  179



>gb|ABK23365.1| unknown [Picea sitchensis]
 gb|ABK26094.1| unknown [Picea sitchensis]
 gb|ABR16830.1| unknown [Picea sitchensis]
 gb|ACN39793.1| unknown [Picea sitchensis]
Length=341

 Score =   196 bits (498),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 132/172 (77%), Gaps = 5/172 (3%)
 Frame = +3

Query  36   AASLQTAATLMQPTKVGVT----PRIGRSYQTVGKALGVDP-SPARITCSLQSQIKELAH  200
             ++LQ AATL+QPTK+ VT     R+  S   + +A G +P + AR++CSLQ  +KE A 
Sbjct  8    GSALQAAATLLQPTKLSVTRTSSSRLSSSSSNLSRAFGFEPATSARVSCSLQDDVKEFAE  67

Query  201  NFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGG  380
              + A K+A  ALA S+L+ SGA AEGVPKRLT+DEIQS+TY+EVKGSGTANQCPTI+GG
Sbjct  68   KCAGATKIAALALAASSLVASGAGAEGVPKRLTYDEIQSQTYLEVKGSGTANQCPTIDGG  127

Query  381  VENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            VE F FKPGKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLD
Sbjct  128  VEAFPFKPGKYEMKKLCMEPTSFTVKAEGTNKNQPPDFQKTRLMTRLTYTLD  179



>gb|KDO79410.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=271

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +3

Query  261  SGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEP  440
            SGA+AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GGV++FAFKPGKY AKKFCLEP
Sbjct  19   SGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEP  78

Query  441  TSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            TSFTVKAESV+KNAPP+FQNTKLMTRLTYTLD
Sbjct  79   TSFTVKAESVNKNAPPDFQNTKLMTRLTYTLD  110



>gb|KCW55052.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=247

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +3

Query  255  LVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCL  434
            L  GA AEG PKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG+++FAFKPGKY+AKK CL
Sbjct  9    LSQGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGLDSFAFKPGKYNAKKICL  68

Query  435  EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  69   EPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  102



>gb|AIS72812.1| oxygen evolving activity, partial [Rhizophora apiculata]
Length=147

 Score =   172 bits (435),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 86/90 (96%), Gaps = 0/90 (0%)
 Frame = +3

Query  267  ANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTS  446
            A AEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTIEGGV++FAFKPGKY+ KK CLEPTS
Sbjct  1    AGAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVDSFAFKPGKYNVKKLCLEPTS  60

Query  447  FTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FTVKAE V+KNAPPEFQNTKLMTRLTYTLD
Sbjct  61   FTVKAEGVNKNAPPEFQNTKLMTRLTYTLD  90



>ref|XP_007155995.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27989.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=264

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 94/102 (92%), Gaps = 2/102 (2%)
 Frame = +3

Query  237  LATSALLVS--GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGK  410
            + T +L+V   GA+AEGVPKRLTFDEIQSKTY+EVKG+GTANQCPTI+GGV++FAFKPGK
Sbjct  2    VVTYSLIVKFKGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFAFKPGK  61

Query  411  YSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            Y+AKK CLEPTSFTVKAE V+KNAP EFQNTKLMTRLTYTLD
Sbjct  62   YNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLD  103



>gb|ACE98011.1| putative protein, partial [Populus tremula]
 gb|ACE98012.1| putative protein, partial [Populus tremula]
 gb|ACE98013.1| putative protein, partial [Populus tremula]
 gb|ACE98014.1| putative protein, partial [Populus tremula]
 gb|ACE98015.1| putative protein, partial [Populus tremula]
 gb|ACE98016.1| putative protein, partial [Populus tremula]
 gb|ACE98017.1| putative protein, partial [Populus tremula]
 gb|ACE98018.1| putative protein, partial [Populus tremula]
 gb|ACE98019.1| putative protein, partial [Populus tremula]
 gb|ACE98020.1| putative protein, partial [Populus tremula]
 gb|ACE98021.1| putative protein, partial [Populus tremula]
 gb|ACE98022.1| putative protein, partial [Populus tremula]
 gb|ACE98023.1| putative protein, partial [Populus tremula]
 gb|ACE98024.1| putative protein, partial [Populus tremula]
 gb|ACE98025.1| putative protein, partial [Populus tremula]
 gb|ACE98026.1| putative protein, partial [Populus tremula]
 gb|ACE98027.1| putative protein, partial [Populus tremula]
 gb|ACE98028.1| putative protein, partial [Populus tremula]
 gb|ACE98029.1| putative protein, partial [Populus tremula]
 gb|ACE98030.1| putative protein, partial [Populus tremula]
 gb|ACE98031.1| putative protein, partial [Populus tremula]
 gb|ACE98032.1| putative protein, partial [Populus tremula]
 gb|ACE98033.1| putative protein, partial [Populus tremula]
 gb|ACE98034.1| putative protein, partial [Populus tremula]
 gb|ACE98035.1| putative protein, partial [Populus tremula]
 gb|ACE98036.1| putative protein, partial [Populus tremula]
 gb|ACE98037.1| putative protein, partial [Populus tremula]
 gb|ACE98038.1| putative protein, partial [Populus tremula]
 gb|ACE98039.1| putative protein, partial [Populus tremula]
 gb|ACE98040.1| putative protein, partial [Populus tremula]
 gb|ACE98041.1| putative protein, partial [Populus tremula]
 gb|ACE98042.1| putative protein, partial [Populus tremula]
 gb|ACE98043.1| putative protein, partial [Populus tremula]
 gb|ACE98044.1| putative protein, partial [Populus tremula]
 gb|ACE98045.1| putative protein, partial [Populus tremula]
 gb|ACE98046.1| putative protein, partial [Populus tremula]
Length=170

 Score =   170 bits (431),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/87 (92%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  276  EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  455
            EGVPKRLT+DEIQSKTYMEVKGSGTANQCPT++GG E+FAFK GKY+AKKFCLEPTSFTV
Sbjct  1    EGVPKRLTYDEIQSKTYMEVKGSGTANQCPTLDGGAESFAFKAGKYNAKKFCLEPTSFTV  60

Query  456  KAESVSKNAPPEFQNTKLMTRLTYTLD  536
            KAESVSKNAPPEFQNTKLMTRLTYTLD
Sbjct  61   KAESVSKNAPPEFQNTKLMTRLTYTLD  87



>prf||2002393A oxygen-evolving complex protein 1
Length=247

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +3

Query  276  EGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTV  455
            EGVP+RLTFDEIQSKTYMEVKG+GTANQCPT+EGGV++FAFKPGKY+ KKFCLEPTSFTV
Sbjct  1    EGVPRRLTFDEIQSKTYMEVKGTGTANQCPTVEGGVDSFAFKPGKYNMKKFCLEPTSFTV  60

Query  456  KAESVSKNAPPEFQNTKLMTRLTYTLD  536
            KAE V+KNAPPEFQ TKLMTRLTYTLD
Sbjct  61   KAEGVAKNAPPEFQKTKLMTRLTYTLD  87



>ref|XP_001756893.1| predicted protein [Physcomitrella patens]
 gb|EDQ78124.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%), Gaps = 4/140 (3%)
 Frame = +3

Query  117  TVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRL  296
            ++  A G+ P+ AR++C+L+  +K +  N    AK A   LA+SAL+   A AEGVP+RL
Sbjct  32   SMSNAFGLKPAVARVSCNLEENVKSIVDN----AKAAAIVLASSALVAGAAFAEGVPQRL  87

Query  297  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSK  476
            TFDE+ ++TYM+VKGSGTANQCP +  G + FAFK G Y+ +KFCLEPTSFTVKAES  K
Sbjct  88   TFDEVNAQTYMDVKGSGTANQCPIVAEGSDKFAFKDGNYTMRKFCLEPTSFTVKAESQFK  147

Query  477  NAPPEFQNTKLMTRLTYTLD  536
                 FQ TKLMTRLTYTLD
Sbjct  148  GGNEGFQPTKLMTRLTYTLD  167



>ref|XP_004243178.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Solanum lycopersicum]
Length=177

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  153  ARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYME  332
            +R++ SL++ +K+ +H   D + +AGF+LATS+L+VSGANAE VPKRLT DEIQ+KTYME
Sbjct  64   SRLSFSLEADLKDFSHKCIDTSMIAGFSLATSSLVVSGANAERVPKRLTLDEIQTKTYME  123

Query  333  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  494
            VKG+ TANQCPTI+GGV NFAFK GKY+AKKF LE T F VK E VSKN+  EF
Sbjct  124  VKGTVTANQCPTIDGGVNNFAFKLGKYNAKKFYLETTPFIVKEEGVSKNSALEF  177



>prf||1204192A photosystem II protein 33kD
Length=248

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +3

Query  288  KRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAES  467
            KRLT+DEIQSKTY+EVKG+GTANQCPT+EGGV++FAFKPGKY+AKKFCLEPT F VKAE 
Sbjct  4    KRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEG  63

Query  468  VSKNAPPEFQNTKLMTRLTYTLD  536
            +SKN+ P+FQNTKLMTRLTYTLD
Sbjct  64   ISKNSGPDFQNTKLMTRLTYTLD  86



>ref|XP_001763258.1| predicted protein [Physcomitrella patens]
 gb|EDQ71788.1| predicted protein [Physcomitrella patens]
Length=327

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 100/139 (72%), Gaps = 4/139 (3%)
 Frame = +3

Query  120  VGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLT  299
            V  A G+ P+ +R++CS++  ++ +     D AK A   LA+SAL+   A AEG P+RLT
Sbjct  33   VNSAFGLKPAASRVSCSVEETVRRVV----DGAKAAALVLASSALVAGAALAEGTPQRLT  88

Query  300  FDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKN  479
            FDEI ++TYM+VKGSGTANQCP +  G + F+FK GKY+ KK C+EPTSFTVKAES  K 
Sbjct  89   FDEINAQTYMDVKGSGTANQCPIVPEGSDKFSFKDGKYTMKKLCMEPTSFTVKAESPFKG  148

Query  480  APPEFQNTKLMTRLTYTLD  536
                FQNTKLMTRLTYTLD
Sbjct  149  GSEGFQNTKLMTRLTYTLD  167



>ref|XP_001781590.1| predicted protein [Physcomitrella patens]
 gb|EDQ53641.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 112/167 (67%), Gaps = 6/167 (4%)
 Frame = +3

Query  36   AASLQTAATLMQPTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDA  215
            +AS +T+  L   +K+     I  +  ++  A G+ P+ AR++C+L+  ++ +     D 
Sbjct  7    SASCKTSVALASNSKLEKVQTIKSA--SLSSAFGLTPAAARVSCNLEENVRSVV----DG  60

Query  216  AKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA  395
            AK A   LA+SAL+   A AEGVP+RLTFDEI ++TYM+VKGSGTANQCP +  G   F+
Sbjct  61   AKAAALVLASSALMAGAALAEGVPQRLTFDEINAQTYMDVKGSGTANQCPIVAEGSGQFS  120

Query  396  FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FK G+Y+ +K CLEPTSFTVKAES  K     +Q TKLMTRLTYTLD
Sbjct  121  FKDGEYTMRKLCLEPTSFTVKAESPFKGGSEGYQQTKLMTRLTYTLD  167



>gb|ABV57472.1| chloroplast PsbO [Phyllostachys edulis]
Length=160

 Score =   139 bits (349),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/74 (86%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +3

Query  315  SKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEF  494
            SKTYMEVKG+GTANQCPTI+GGV++F FKPGKY  KKFCLEPTSFTVKAE V+KNAPPEF
Sbjct  1    SKTYMEVKGTGTANQCPTIDGGVDSFPFKPGKYYMKKFCLEPTSFTVKAEGVAKNAPPEF  60

Query  495  QNTKLMTRLTYTLD  536
            Q TKLMTRLTYTLD
Sbjct  61   QKTKLMTRLTYTLD  74



>ref|WP_039310940.1| Photosystem II manganese-stabilizing polypeptide, partial [Paenibacillus 
sp. IHB B 3415]
Length=232

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = +3

Query  321  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  500
            TY+EVKG+GTANQCPTIEGGV+ FAFKPGKY  KKFCLEPTSFTVKA+SVSKNAPPEFQ 
Sbjct  1    TYLEVKGTGTANQCPTIEGGVDKFAFKPGKYQMKKFCLEPTSFTVKADSVSKNAPPEFQR  60

Query  501  TKLMTRLTYTLD  536
            TKLMTRLTYTLD
Sbjct  61   TKLMTRLTYTLD  72



>ref|XP_002992987.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
 ref|XP_002994511.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ04419.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ05933.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
Length=328

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 113/175 (65%), Gaps = 14/175 (8%)
 Frame = +3

Query  33   MAASLQTAA---TLMQPTKVGVTPRIGRSYQ--TVGKALGV--DPSPARITCSLQSQIKE  191
            MAAS+  A    +L+QP K+  +     S +  +V KA G+  +   AR+TCS++  +K 
Sbjct  1    MAASVVAAKAGPSLLQP-KLDASAGSSASLRPVSVSKAFGLRSNGGGARLTCSMEDIVKR  59

Query  192  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  371
                 +D  K+A    A + L+   A A   PKRLT+DE+Q++TY+EVKGSGTANQCP +
Sbjct  60   A----TDVGKVAVATAAATLLVAGTAAAN--PKRLTYDEVQAQTYLEVKGSGTANQCPIL  113

Query  372  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             GG E F FKPG YS KKFCLEPTSFTVK ES  K    ++ +TKLMTRLTYTLD
Sbjct  114  SGGDEGFKFKPGSYSVKKFCLEPTSFTVKKESPFKGGGDQYVDTKLMTRLTYTLD  168



>ref|XP_010531775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Tarenaya hassleriana]
Length=230

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +3

Query  327  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  506
            MEVKG+GTANQCPTI+GG + FAFKPGKYS KKFC EPTSFTVKAE VSKNAPPEFQNTK
Sbjct  1    MEVKGTGTANQCPTIDGGSDEFAFKPGKYSGKKFCFEPTSFTVKAEGVSKNAPPEFQNTK  60

Query  507  LMTRLTYTLD  536
            LMTRLTYTLD
Sbjct  61   LMTRLTYTLD  70



>ref|XP_002991827.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
 gb|EFJ07089.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
Length=328

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 112/175 (64%), Gaps = 14/175 (8%)
 Frame = +3

Query  33   MAASLQTAA---TLMQPTKVGVTPRIGRSYQ--TVGKALGV--DPSPARITCSLQSQIKE  191
            MAAS+  A    +L+QP K+  +     S +  +V KA G+  +   AR+TCS++  +K 
Sbjct  1    MAASVVAAKAGPSLLQP-KLDASAGSSASLRPVSVSKAFGLRSNGGGARLTCSMEDIVKR  59

Query  192  LAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTI  371
                 +D  K+A    A + L+   A A   PKRLT+DE+Q++TY+EVKGSGTANQCP +
Sbjct  60   A----TDVGKVAVATAAATLLVAGTAAAN--PKRLTYDEVQAQTYLEVKGSGTANQCPIL  113

Query  372  EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
             GG   F FKPG YS KKFCLEPTSFTVK ES  K    ++ +TKLMTRLTYTLD
Sbjct  114  SGGDGGFKFKPGSYSVKKFCLEPTSFTVKKESPFKGGGDQYVDTKLMTRLTYTLD  168



>ref|XP_002994513.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
 gb|EFJ04421.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
Length=244

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  285  PKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAE  464
            PKRLT+DE+Q++TY+EVKGSGTANQCP + GG E F FKPG YS KKFCLEPTSFTVK E
Sbjct  1    PKRLTYDEVQAQTYLEVKGSGTANQCPILSGGDEGFKFKPGSYSVKKFCLEPTSFTVKKE  60

Query  465  SVSKNAPPEFQNTKLMTRLTYTLD  536
            S  K    ++ +TKLMTRLTYTLD
Sbjct  61   SPFKGGGDQYVDTKLMTRLTYTLD  84



>dbj|BAF94220.1| 33kDa oxygen evolving protein of photosystem II [Closterium peracerosum-strigosum-littorale 
complex]
Length=325

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 96/139 (69%), Gaps = 2/139 (1%)
 Frame = +3

Query  120  VGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLT  299
            V +A G+  + A+++CS +  ++      +DA K A  ALA++AL+ S A A  VP RL 
Sbjct  30   VSQAFGLKTASAKVSCSAEENVRGFVQKCADAGKAAALALASTALVASSAQA-AVP-RLN  87

Query  300  FDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKN  479
            FDE+QS TY EVKGSG ANQCP I GGV+ FAFK GKY   K CLEPT+FTVKAES  K 
Sbjct  88   FDELQSLTYSEVKGSGIANQCPIIAGGVDGFAFKSGKYQVSKMCLEPTAFTVKAESQFKG  147

Query  480  APPEFQNTKLMTRLTYTLD  536
               EFQ TKLMTRLTYTLD
Sbjct  148  QGEEFQKTKLMTRLTYTLD  166



>dbj|BAF94218.1| 33kDa oxygen evolving protein of photosystem II [Chara braunii]
Length=337

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 92/135 (68%), Gaps = 2/135 (1%)
 Frame = +3

Query  132  LGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEI  311
             G+    +R++CSL  +        +DAAK A  ALATSALL   A A   P RLTFDEI
Sbjct  45   FGLSKCNSRLSCSLDEEASSFVSKVADAAKGAAVALATSALLAQAAVA--APPRLTFDEI  102

Query  312  QSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  491
             SKTY+EVKG+GTANQCP I GG++ F+FKPGKY  +K CLEPT F VKAES  K    E
Sbjct  103  NSKTYLEVKGTGTANQCPAIGGGLDGFSFKPGKYQMQKLCLEPTEFRVKAESQFKGGDTE  162

Query  492  FQNTKLMTRLTYTLD  536
            F  TKLMTRLTYTLD
Sbjct  163  FTKTKLMTRLTYTLD  177



>ref|NP_001140815.1| hypothetical protein [Zea mays]
 gb|ACF84695.1| unknown [Zea mays]
 gb|AFW75931.1| hypothetical protein ZEAMMB73_003972 [Zea mays]
Length=230

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +3

Query  327  MEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  506
            MEVKG+GTANQCPTI+GGVE+F FK GKY  KK CLEPTSFTVKAE ++KNAPPEFQ TK
Sbjct  1    MEVKGTGTANQCPTIDGGVESFPFKAGKYQMKKLCLEPTSFTVKAEGIAKNAPPEFQKTK  60

Query  507  LMTRLTYTLD  536
            LMTRLTYTLD
Sbjct  61   LMTRLTYTLD  70



>ref|XP_001784751.1| predicted protein [Physcomitrella patens]
 gb|EDQ50440.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  452
            AEGVP+RLTFDEI ++TY++VKGSGTANQCP +  G + F  K G Y  KK CLEPTSFT
Sbjct  28   AEGVPQRLTFDEINAQTYLDVKGSGTANQCPIVAEGSDKFNLKDGNYQMKKLCLEPTSFT  87

Query  453  VKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            VKAES  K    ++Q TKLMTRLTYTLD
Sbjct  88   VKAESQFKQGGEDYQPTKLMTRLTYTLD  115



>gb|ACT83791.1| putative photosystem II oxygen evolving system 33 kDa subunit 
[Lemna minor]
Length=151

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  333  VKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  512
            VKG+GTANQCPTI+GGV+ F FK GKY+ KKFCLEPTSFTVKAE VSKN+ PEFQ TKLM
Sbjct  1    VKGTGTANQCPTIDGGVDGFPFKAGKYNLKKFCLEPTSFTVKAEGVSKNSAPEFQKTKLM  60

Query  513  TRLTYTLD  536
            TRLTYTLD
Sbjct  61   TRLTYTLD  68



>ref|XP_010550781.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=195

 Score =   111 bits (278),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 84/129 (65%), Gaps = 19/129 (15%)
 Frame = +3

Query  33   MAASLQTAATLMQ--PTKVGVTPRIGRSYQTVGKALGVDPSPARITCSLQSQIKELAHNF  206
            MAASLQ  A  +   P++     R+ RS  +V KA G+  S AR+TCSL S + + A   
Sbjct  1    MAASLQATAAFLSAAPSRC---VRL-RSSPSVAKAFGLGSSSARLTCSLHSDLSDFARKC  56

Query  207  SDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKG---SGTANQCPTIEG  377
            SDAAK+AGFALATSAL+VSGANAEGVPKRLTFDE    T MEVKG   +GTAN      G
Sbjct  57   SDAAKIAGFALATSALVVSGANAEGVPKRLTFDE----TCMEVKGITTTGTAN------G  106

Query  378  GVENFAFKP  404
              E F F+P
Sbjct  107  HSEKFGFEP  115



>emb|CEG01950.1| Photosystem II PsbO, manganese-stabilising [Ostreococcus tauri]
Length=302

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +3

Query  240  ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  419
            AT +L V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y  
Sbjct  45   ATVSLGVAGAVLAQSASAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKDIKAGDYKL  104

Query  420  KKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FC+EPTSFTVK ES  K    EFQ T+LMTRLTYTLD
Sbjct  105  ERFCMEPTSFTVKEESQFKAGESEFQKTRLMTRLTYTLD  143



>ref|XP_005843863.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
 gb|EFN51761.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
Length=297

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  455
            G    L+FDE+Q  TY++VKGSG AN CPT++GG  N    KPG YS  KFC+EPTSFTV
Sbjct  53   GSANALSFDELQGLTYLQVKGSGIANTCPTLDGGSANIKDLKPGSYSLGKFCMEPTSFTV  112

Query  456  KAESVSKNAPPEFQNTKLMTRLTYTLD  536
            K ES  K    +F +TKLMTRLTYTLD
Sbjct  113  KEESQFKGGDSDFVSTKLMTRLTYTLD  139



>gb|AFK37254.1| unknown [Medicago truncatula]
Length=66

 Score =   103 bits (257),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -3

Query  511  MSLVFWNSGGAFLLTLSAFTVNDVGSKQNFLALYFPGLNAKFSTPPSMVGHWLAVPLPFT  332
            MSLVFWN+ G FL+T SA TVN+VGS+QNFLALYFPGL    STPPSMVGHW AVP+P T
Sbjct  1    MSLVFWNASGVFLVTPSALTVNEVGSRQNFLALYFPGLKENESTPPSMVGHWFAVPVPLT  60

Query  331  SIYVLL  314
            S YVLL
Sbjct  61   SKYVLL  66



>ref|XP_005644574.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20030.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
Length=315

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 79/128 (62%), Gaps = 9/128 (7%)
 Frame = +3

Query  159  ITCSLQSQIKELAHNFS-DAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQSKTYMEV  335
            + C L   ++      + +  K+A   +  S+L+++GA+     + LT+DE+Q  TY++V
Sbjct  37   VVCGLSENVQSAVAAAAANVGKMA--VVVGSSLMLAGAS-----QALTYDELQGLTYLQV  89

Query  336  KGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  512
            KGSG AN CP +EGG  N    K G Y+  KFCLEPTSFTVK ES  K    +F  TKLM
Sbjct  90   KGSGIANTCPVLEGGSSNLKDLKAGDYNISKFCLEPTSFTVKEESQFKGGDTDFVKTKLM  149

Query  513  TRLTYTLD  536
            TRLTYTLD
Sbjct  150  TRLTYTLD  157



>ref|XP_003082811.1| photosystem II oxygen-evolving complex protein 1 precursor-Chlamydomonas 
reinhardtii (ISS) [Ostreococcus tauri]
Length=180

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  473
            +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y  ++FC+EPTSFTVK ES  
Sbjct  9    VTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKDIKAGDYKLERFCMEPTSFTVKEESQF  68

Query  474  KNAPPEFQNTKLMTRLTYTLD  536
            K    EFQ T+LMTRLTYTLD
Sbjct  69   KAGESEFQKTRLMTRLTYTLD  89



>gb|ACU65446.1| putative oxygen-evolving enhancer [Tragopogon dubius]
Length=77

 Score =   103 bits (256),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +3

Query  63   LMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFAL  239
             MQPTKVGV+ R+  +S Q++ KA GVDP+ AR++CSLQS +K+ AH  +DAAK+AGFAL
Sbjct  1    FMQPTKVGVSGRLQLKSSQSICKAFGVDPATARVSCSLQSDLKDFAHKCTDAAKIAGFAL  60

Query  240  ATSALLVSGANAEGVPK  290
            ATSAL+VSGA+AEG PK
Sbjct  61   ATSALVVSGASAEGSPK  77



>ref|XP_001422458.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
 gb|ABP00775.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
Length=302

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 67/99 (68%), Gaps = 0/99 (0%)
 Frame = +3

Query  240  ATSALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSA  419
            A+ AL V+GA        +T+DE+Q  TY++VKG+G AN CP +EGGV     K G Y+ 
Sbjct  44   ASVALGVAGAVLAQSAGAVTYDELQGLTYLQVKGTGLANTCPVVEGGVSGKEIKAGDYAL  103

Query  420  KKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++FC+EPTSFTVK ES  K    EF  T+LMTRLTYTLD
Sbjct  104  ERFCMEPTSFTVKEESQFKQGESEFSKTRLMTRLTYTLD  142



>gb|ADC54897.1| oxygen-evolving enhancer protein, partial [Cladophora coelothrix]
Length=235

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  470
            LT+D+ QS TYM++KG+G AN CP I+GG +N    KPG YS  KFC+EPTSF V+ ES+
Sbjct  1    LTYDQFQSLTYMQIKGTGLANTCPIIDGGSDNPKDIKPGTYSMYKFCMEPTSFKVQEESM  60

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
             + AP  F +TKL+TRLTYTLD
Sbjct  61   QRGAPSFFSDTKLLTRLTYTLD  82



>gb|ACU65447.1| putative oxygen-evolving enhancer [Tragopogon pratensis]
Length=77

 Score =   101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +3

Query  63   LMQPTKVGVTPRIG-RSYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFAL  239
             MQPTKVGV+ R+  +S Q++ KA GV+P+ AR++CSLQS +K+ AH  +DAAK+AGFAL
Sbjct  1    FMQPTKVGVSGRLQLKSSQSICKAFGVEPATARVSCSLQSDLKDFAHKCTDAAKIAGFAL  60

Query  240  ATSALLVSGANAEGVPK  290
            ATSAL+VSGA+AEG PK
Sbjct  61   ATSALVVSGASAEGSPK  77



>gb|ABA01139.1| chloroplast oxygen-evolving enhancer protein 1 [Chlamydomonas 
incerta]
Length=291

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  455
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  456  KAESVSKNAPPEFQNTKLMTRLTYTLD  536
            K ES  K    EF  TKLMTRLTYTLD
Sbjct  107  KEESQFKGGDSEFVKTKLMTRLTYTLD  133



>sp|P12853.1|PSBO_CHLRE RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Chlamydomonas reinhardtii]
 emb|CAA32053.1| OEE1 precursor protein [Chlamydomonas reinhardtii]
 prf||1807335A photosystem II OEE1 protein
Length=291

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  455
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  456  KAESVSKNAPPEFQNTKLMTRLTYTLD  536
            K ES  K    EF  TKLMTRLTYTLD
Sbjct  107  KEESQFKGGETEFVKTKLMTRLTYTLD  133



>ref|XP_001694699.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
 gb|EDP02283.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
Length=291

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  455
            G    LTFDEIQ  TY++VKGSG AN CP +E G  N    K G Y  + FC+EPTSFTV
Sbjct  47   GSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTV  106

Query  456  KAESVSKNAPPEFQNTKLMTRLTYTLD  536
            K ES  K    EF  TKLMTRLTYTLD
Sbjct  107  KEESQFKGGETEFVKTKLMTRLTYTLD  133



>ref|XP_003063851.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
 gb|EEH52224.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
Length=303

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  473
            +T+DE+Q  TY++VKG+G AN CP ++GG  + + K G Y+ +KFC+EPTSFTVK +S  
Sbjct  65   VTYDELQGLTYLQVKGTGLANTCPVVDGGESSKSIKAGDYALEKFCMEPTSFTVKEDSAF  124

Query  474  KNAPPEFQNTKLMTRLTYTLD  536
            K    EF  TKLMTRLTYTLD
Sbjct  125  KAGESEFTKTKLMTRLTYTLD  145



>dbj|BAF94214.1| 33kDa oxygen evolving protein of photosystem II [Oedogonium obesum]
Length=291

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESV  470
            LTFDE+Q  TY++VKG+G AN CP I+GG  N    KPG YS +K CLEPTSFTVK E+ 
Sbjct  54   LTFDELQGLTYLQVKGTGIANTCPVIDGGSTNLKDLKPGTYSFEKLCLEPTSFTVKEENA  113

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
               +  EF +TKLMTRLTYTLD
Sbjct  114  KGES--EFVSTKLMTRLTYTLD  133



>dbj|BAF94215.1| 33kDa oxygen evolving protein of photosystem II [Pyramimonas 
parkeae]
Length=303

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 60/91 (66%), Gaps = 6/91 (7%)
 Frame = +3

Query  264  GANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPT  443
            GANA      LT++E+Q+ TYM+VKG+G AN CP +EG   N     G Y  +K CLEPT
Sbjct  61   GANA------LTYNELQNLTYMQVKGTGIANTCPIVEGAAGNIKLGSGTYKIEKMCLEPT  114

Query  444  SFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            SFTVK ES  K    E+  TKLMTRLTYTLD
Sbjct  115  SFTVKEESQFKGGADEYVQTKLMTRLTYTLD  145



>gb|KIY92168.1| Oxygen-evolving enhancer protein 1,chloroplastic [Monoraphidium 
neglectum]
Length=153

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  455
            G    LT+DE+QS TY++VKGSG AN CP +  G  N    K G Y  ++FC+EPT+F+V
Sbjct  44   GAANALTYDELQSLTYLQVKGSGLANTCPVLSSGSTNLKDLKAGTYKLERFCMEPTAFSV  103

Query  456  KAESVSKNAPPEFQNTKLMTRLTYTLD  536
            K ES  K     F  TKLMTRLTYTLD
Sbjct  104  KEESQFKGGETNFVATKLMTRLTYTLD  130



>dbj|BAF94213.1| 33kDa oxygen evolving protein of photosystem II [Hafniomonas 
montana]
Length=290

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF-AFKPGKYSAKKFCLEPTSFTV  455
            G    LT+DE+Q  TY++VKGSG AN CP +E G  N    K G Y  +K C+EPTSFTV
Sbjct  45   GSANALTYDELQGLTYLQVKGSGIANTCPVVEAGTTNLNELKAGNYKFQKMCMEPTSFTV  104

Query  456  KAESVSKNAPPEFQNTKLMTRLTYTLD  536
            K ES  +    EF  TKLMTRLTYTLD
Sbjct  105  KEESQFRGGDSEFVKTKLMTRLTYTLD  131



>ref|XP_002954867.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
 gb|EFJ44066.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
Length=297

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  455
            G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  52   GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  111

Query  456  KAESVSKNAPPEFQNTKLMTRLTYTLD  536
            K ESV K    EF  TKLMTRLTYTLD
Sbjct  112  KEESVFKGGETEFVKTKLMTRLTYTLD  138



>sp|Q9SBN6.1|PSBO_VOLCA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Volvox carteri]
 gb|AAD55562.1|AF110780_1 oxygen-evolving enhancer protein 1 precursor [Volvox carteri 
f. nagariensis]
Length=293

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +3

Query  279  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTV  455
            G    LT+DE+Q  TY++VKG+G AN CP +E G  + +    G Y  + FC+EPTSFTV
Sbjct  48   GSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTV  107

Query  456  KAESVSKNAPPEFQNTKLMTRLTYTLD  536
            K ESV K    EF  TKLMTRLTYTLD
Sbjct  108  KEESVFKGGETEFVKTKLMTRLTYTLD  134



>ref|XP_011400268.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27301.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=303

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query  297  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVS  473
            TFDE+Q  TY++VKGSG AN CPT+ GG  N    K G YS  K CLEPTSF VK E+  
Sbjct  65   TFDELQGLTYLQVKGSGIANTCPTLSGGSSNIKDLKSGTYSVNKMCLEPTSFKVKEEAQF  124

Query  474  KNAPPEFQNTKLMTRLTYTLD  536
            KN   +F  TKL+TRLTYTLD
Sbjct  125  KNGEADFVPTKLVTRLTYTLD  145



>gb|KIY97139.1| Oxygen-evolving enhancer protein 1 [Monoraphidium neglectum]
Length=289

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 63/98 (64%), Gaps = 7/98 (7%)
 Frame = +3

Query  246  SALLVSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAK  422
            +++L   ANA      LT+DE+QS TY++VKGSG AN CP +  G  N    K G Y  +
Sbjct  40   TSMLAGAANA------LTYDELQSLTYLQVKGSGLANTCPVLSSGSTNLKDLKAGTYKLE  93

Query  423  KFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            +FC+EPT+F+VK ES  K     F  TKLMTRLTYTLD
Sbjct  94   RFCMEPTAFSVKEESQFKGGETNFVATKLMTRLTYTLD  131



>gb|AFK26084.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena stellata]
Length=248

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  470
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  29   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  88

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
                 PEF+ TKLMTRLTYTLD
Sbjct  89   DSKPKPEFEKTKLMTRLTYTLD  110



>gb|AFK26083.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena pseudostellata]
Length=249

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  470
            LTFDEIQS +Y+EVKGSG AN CP +  G       + G Y    FCLEP+SF VK    
Sbjct  30   LTFDEIQSLSYLEVKGSGLANTCPVLADGTGSKLNLRSGNYKIDNFCLEPSSFQVKVPPT  89

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
                 PEF+ TKLMTRLTYTLD
Sbjct  90   DSKPKPEFEKTKLMTRLTYTLD  111



>ref|XP_002505809.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
 gb|ACO67067.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
Length=303

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = +3

Query  273  AEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFT  452
            A G  + +T+DE+Q  TY++VKG+G AN CP +E G    + K G Y+ +KFC+EPTSFT
Sbjct  57   AAGSAQAVTYDELQGLTYLQVKGTGLANTCPVVETGGSGSSIKGGDYALEKFCMEPTSFT  116

Query  453  VKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            VK ES  K    EF  TKLMTRLTYTLD
Sbjct  117  VKEESAFKAGESEFVKTKLMTRLTYTLD  144



>ref|XP_007513615.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16140.1| predicted protein [Bathycoccus prasinos]
Length=331

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  473
            +T+DE+Q  TY++VKG+G AN CP +E G    A K G Y   KFC+EPTSFTVK E   
Sbjct  95   VTYDELQGLTYLQVKGTGLANTCPVVESGSGPKALKAGDYKFDKFCVEPTSFTVKEEKA-  153

Query  474  KNAPPEFQNTKLMTRLTYTLD  536
             +   EF  TKLMTRLTYTLD
Sbjct  154  -DGSTEFAKTKLMTRLTYTLD  173



>gb|ADC54900.1| oxygen-evolving enhancer protein, partial [Entransia fimbriata]
Length=151

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  321  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  500
            TY +VKG+G ANQCP +         KPGKY+ +K CLEPTSFTVKA    K++P  FQ 
Sbjct  1    TYXQVKGTGIANQCPKLGSAEPGLKVKPGKYAVEKLCLEPTSFTVKAPGPLKDSPVAFQK  60

Query  501  TKLMTRLTYTLD  536
            TKLMTRLTYTLD
Sbjct  61   TKLMTRLTYTLD  72



>gb|AFK26079.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Cryptoglena skujae]
Length=236

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  470
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  19   LTFDEIQSLSYLEVKGSGLANTCPIIADGTGAKLSLKSGNYKINNMCLEPSSFQVKVPS-  77

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
            +   P EF+ TKLMTRLTYTLD
Sbjct  78   TDGKPTEFEKTKLMTRLTYTLD  99



>dbj|BAF94212.1| 33kDa oxygen evolving protein of photosystem II [Chlorarachnion 
reptans]
Length=328

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = +3

Query  279  GVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFT  452
            G  K LT+DE Q  +Y++VKGSG AN CP +  G  +   A KPG Y   KFC+EPT F 
Sbjct  81   GASKALTYDEFQGLSYLDVKGSGMANTCPVLSSGTTDVKTALKPGNYKFDKFCIEPTKFQ  140

Query  453  VKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            VK E V K    EF +TKLMTRLTYTLD
Sbjct  141  VK-EDVGK-GKKEFIDTKLMTRLTYTLD  166



>gb|AFK26085.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Monomorphina pyrum]
Length=237

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  470
            LTFDEIQS +Y+EVKGSG AN CP I  G     + K G Y     CLEP+SF VK  S 
Sbjct  20   LTFDEIQSLSYLEVKGSGLANTCPXIADGTGAKLSLKSGNYKINNMCLEPSSFQVKTPS-  78

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
            +   P EF+ TKLMTRLTYTLD
Sbjct  79   TDGKPSEFEKTKLMTRLTYTLD  100



>dbj|BAF94219.1| 33kDa oxygen evolving protein of photosystem II [Bryopsis plumosa]
Length=302

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  473
            +TFDE+Q  TY++VKG+G AN CPT+  G +    K G Y     C+EPT+F VK ES  
Sbjct  63   VTFDELQGLTYLQVKGTGVANTCPTLSTGGDGSTLKAGSYQISGMCIEPTAFKVKEESQF  122

Query  474  KNAPPEFQNTKLMTRLTYTLD  536
            K    EF  TKLMTRLTYTLD
Sbjct  123  KEGTSEFVKTKLMTRLTYTLD  143



>dbj|BAF94217.1| 33kDa oxygen evolving protein of photosystem II, partial [Nephroselmis 
olivacea]
Length=260

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVS  473
            L++D++ + TY++VKG+G AN CP IE  V N   K G YS ++ C+EPTSFTVK ES  
Sbjct  23   LSYDDLNALTYLQVKGTGIANTCPVIEKNV-NDKIKAGDYSIEQLCMEPTSFTVKEESQF  81

Query  474  KNAPPEFQNTKLMTRLTYTLD  536
            K    EF  TKL+TRLTYTLD
Sbjct  82   KAGEAEFVKTKLLTRLTYTLD  102



>dbj|BAF94216.1| 33kDa oxygen evolving protein of photosystem II [Tetraselmis 
cordiformis]
Length=308

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESV  470
            LT+D++Q  TY++VKG+G AN CP I GG  N    P G Y   +FCLEPTSFTVK +S 
Sbjct  67   LTYDQLQGLTYLQVKGTGVANTCPVISGGSTNPKDIPAGNYKFSEFCLEPTSFTVKEDSQ  126

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
             K    E   TKLMTRLTYTLD
Sbjct  127  FKAGESELVKTKLMTRLTYTLD  148



>emb|CCC15104.1| 33kDa oxygen evolving protein of photosystem II [Lepidodinium 
chlorophorum]
Length=341

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFAFKP-GKYSAKKFCLEPTSFTVKAESV  470
            L +D++Q  TY++VKGSG AN CP +  G  N    P G Y+  K CLEPTSF VK ES 
Sbjct  115  LDYDQLQGLTYLQVKGSGLANTCPDLNSGTTNLKELPAGDYAVSKLCLEPTSFKVKEESQ  174

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
             K    +F +TKLMTRLTYTLD
Sbjct  175  FKGGAADFVDTKLMTRLTYTLD  196



>gb|ACF24544.1| photosystem II oxygen evolving enhancer protein 1 [Gymnochlora 
stellata]
Length=331

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 56/82 (68%), Gaps = 4/82 (5%)
 Frame = +3

Query  297  TFDEIQSKTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESV  470
            TFDE Q  +Y++VKGSG AN CP +  G  +   + KPG Y  +KFC+EP+SF VK E V
Sbjct  91   TFDEFQGLSYLDVKGSGMANTCPVLSSGTSDVKGSLKPGTYKFEKFCIEPSSFQVK-EDV  149

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
             K    EF NTKLMTRLTYTLD
Sbjct  150  GK-GKKEFINTKLMTRLTYTLD  170



>gb|AFK26080.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Discoplastis spathirhyncha]
Length=239

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = +3

Query  300  FDEIQSKTYMEVKGSGTANQCPTI-EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSK  476
            +DEIQS +Y+EVKGSG AN CP I EG     A K G Y     CLEP+SF VK  S   
Sbjct  21   YDEIQSLSYLEVKGSGLANTCPIIAEGSGNKLALKAGNYKINNMCLEPSSFQVKVPSPDG  80

Query  477  NAPPEFQNTKLMTRLTYTLD  536
                +F+ TKLMTRLTYTLD
Sbjct  81   KTVTDFEKTKLMTRLTYTLD  100



>dbj|BAA03529.2| oxygen-evolving enhancer protein 1 precursor [Euglena gracilis]
Length=384

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  470
            LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  142  LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  201

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
             K    EF+ TKLMTRLTYTLD
Sbjct  202  EKQQVTEFERTKLMTRLTYTLD  223



>gb|ADC54905.1| oxygen-evolving enhancer protein, partial [Ostreococcus tauri]
Length=148

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  321  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  500
            T  + KG+G AN CP +EGGV     K G Y  ++FC+EPTSFTVK ES  K    EFQ 
Sbjct  2    TXXQXKGTGLANTCPVVEGGVSGKDIKAGDYKLERFCMEPTSFTVKEESQFKAGESEFQK  61

Query  501  TKLMTRLTYTLD  536
            T+LMTRLTYTLD
Sbjct  62   TRLMTRLTYTLD  73



>sp|P46483.2|PSBO_EUGGR RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Euglena gracilis]
Length=338

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  470
            LT+DE+QS +Y+EVK SG A  CP +  GV +  + K GKY    +CLEP+SF VK    
Sbjct  96   LTYDELQSLSYLEVKSSGIAGTCPVLADGVSSKLSLKAGKYEINNWCLEPSSFQVKLPPT  155

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
             K    EF+ TKLMTRLTYTLD
Sbjct  156  EKQQVTEFERTKLMTRLTYTLD  177



>gb|ADE06500.1| oxygen-evolving enhancer [Tragopogon porrifolius]
Length=61

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  108  SYQTVGKALGVDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVP  287
            S Q++ KA GV+P+ AR++CSLQS +K+ AH  +DAAK+AGFALATSAL+VSGA+AEG P
Sbjct  1    SSQSICKAFGVEPATARVSCSLQSDLKDFAHKCTDAAKIAGFALATSALVVSGASAEGSP  60

Query  288  K  290
            K
Sbjct  61   K  61



>gb|AFK26081.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena archaeoplastidiata]
Length=237

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 2/82 (2%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESV  470
            LT+DE+QS +Y+E+KGSG +N CP I  G  N  + K G Y     CLEP SF V++ S 
Sbjct  20   LTYDEMQSLSYLEMKGSGLSNTCPIIADGTGNKLSLKAGDYKILNMCLEPASFQVRSPS-  78

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
            +   P EF+ TKLMTRLTYTLD
Sbjct  79   ADGKPSEFEKTKLMTRLTYTLD  100



>gb|AAP79149.1| photosystem II protein PsbO [Bigelowiella natans]
Length=327

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 70/135 (52%), Gaps = 17/135 (13%)
 Frame = +3

Query  138  VDPSPARITCSLQSQIKELAHNFSDAAKLAGFALATSALLVSGANAEGVPKRLTFDEIQS  317
            V P   R+  S  + +K +A         AG A A     VS     G    LTFDE Q 
Sbjct  47   VAPRQTRVFASKPNAMKNIA---------AGLAAAG----VSSIGFLGASNALTFDEFQG  93

Query  318  KTYMEVKGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  491
             +Y +VKGSG AN CP +  G  +   + K G Y   KFC+EPTSF VK E V K    E
Sbjct  94   LSYTDVKGSGMANTCPILNSGTTDVKGSLKAGTYKFDKFCIEPTSFQVK-EDVGK-GKKE  151

Query  492  FQNTKLMTRLTYTLD  536
            F + KLMTRLTYTLD
Sbjct  152  FIDVKLMTRLTYTLD  166



>gb|ADC54902.1| oxygen-evolving enhancer protein, partial [Klebsormidium flaccidum]
Length=142

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  345  GTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLT  524
            G AN C  I GG + F  K GKY+ KK CLEPTSFTVKAES  K+   +FQ TKLMTRLT
Sbjct  1    GVANTCAIIAGGEDGFKVKAGKYTLKKLCLEPTSFTVKAESQFKDKKEDFQKTKLMTRLT  60

Query  525  YTLD  536
            YTLD
Sbjct  61   YTLD  64



>emb|CCI69514.1| oxygen-evolving enhancer protein, partial [Scotinosphaera sp. 
CAUP H5307]
Length=173

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 47/69 (68%), Gaps = 2/69 (3%)
 Frame = +3

Query  336  KGSGTANQCPTIEGGVENF--AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  509
            + SG AN C  IEGG  N   A KPG Y  ++FCLEPTSFTVK ES  K   PEF  TKL
Sbjct  11   RDSGVANTCAVIEGGSSNVRSALKPGSYKLERFCLEPTSFTVKEESSFKGGEPEFVKTKL  70

Query  510  MTRLTYTLD  536
            MTRLTYTLD
Sbjct  71   MTRLTYTLD  79



>emb|CCI69513.1| oxygen-evolving enhancer protein, partial [Chlorochytrium lemnae]
Length=143

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +3

Query  336  KGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  512
            KGSG AN CP IEGG  N    KPG Y+  K C+EPTSFTVK +S  K    EF  TKLM
Sbjct  1    KGSGIANTCPVIEGGSTNLKDLKPGXYTFDKLCMEPTSFTVKEDSQFKGGETEFVKTKLM  60

Query  513  TRLTYTLD  536
            TRLTYTLD
Sbjct  61   TRLTYTLD  68



>gb|ADC54906.1| oxygen-evolving enhancer protein, partial [Phyllodictyon orientale]
Length=148

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  336  KGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  512
            KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ES+ + A PE+  TKL+
Sbjct  2    KGTGLANTCPIIDGGSDNPKDLKAGNYSMYKFCMEPTSFKVKEESIIRGAAPEYSKTKLL  61

Query  513  TRLTYTLD  536
            TRLTY+LD
Sbjct  62   TRLTYSLD  69



>gb|ADC54893.1| oxygen-evolving enhancer protein, partial [Boodlea composita]
Length=148

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +3

Query  321  TYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQ  497
            T  + KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ES+ +   PE+ 
Sbjct  2    TXXQXKGTGLANTCPIIDGGSDNPKDLKAGTYSMYKFCMEPTSFQVKEESIIRGGAPEYS  61

Query  498  NTKLMTRLTYTLD  536
             TKL+TRLTY+LD
Sbjct  62   KTKLLTRLTYSLD  74



>gb|AFK26082.1| chloroplast oxygen-evolving enhancer protein 1 precursor, partial 
[Euglena granulata]
Length=239

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGV-ENFAFKPGKYSAKKFCLEPTSFTVKAESV  470
            LT++E+QS +Y+E+KG+G +N CP I  G       K GKY     CLEP++F VK    
Sbjct  20   LTYNEMQSLSYLEMKGTGLSNTCPIITDGTGTKLNLKAGKYEINNMCLEPSAFQVKVPPT  79

Query  471  SKNAPPEFQNTKLMTRLTYTLD  536
                 PEF+ TKLMTRLTYTLD
Sbjct  80   DVRPNPEFERTKLMTRLTYTLD  101



>gb|ADC54901.1| oxygen-evolving enhancer protein, partial [Ignatius tetrasporus]
Length=145

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +3

Query  330  EVKGSGTANQCPTIEGGVEN--FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNT  503
            ++KGSG AN CP IEGG  N     K G Y    FC+EPTSF VK ES  K    EF NT
Sbjct  1    QIKGSGIANTCPVIEGGSSNPKSDLKSGTYKFDNFCMEPTSFQVKEESQFKGGNEEFVNT  60

Query  504  KLMTRLTYTLD  536
            KLMTRLTYTLD
Sbjct  61   KLMTRLTYTLD  71



>gb|ADC54894.1| oxygen-evolving enhancer protein, partial [Bornetella sphaerica]
Length=142

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +3

Query  336  KGSGTANQCPTIEGGVENF-AFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  512
            KG+G AN CPTIE G  +  A   G Y   KFC+EPTSFTVK ES  K    EF NTKLM
Sbjct  1    KGTGIANTCPTIETGTTDLSALXAGDYKFSKFCMEPTSFTVKEESQFKGGETEFVNTKLM  60

Query  513  TRLTYTLD  536
            TRLTYTLD
Sbjct  61   TRLTYTLD  68



>gb|ADC54913.1| oxygen-evolving enhancer protein, partial [Valonia utricularis]
Length=147

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  336  KGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLM  512
            KG+G AN CP I+GG +N    K G YS  KFC+EPTSF VK ESV++   P + +TKL+
Sbjct  2    KGTGLANTCPIIDGGSDNPKDLKAGSYSMYKFCMEPTSFKVKEESVARGGAPSYSSTKLL  61

Query  513  TRLTYTLD  536
            TRLTY+LD
Sbjct  62   TRLTYSLD  69



>gb|ABR26062.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=203

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +3

Query  408  KYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            KY+ KKFCLEPTSFTVKAE V+KNAPPEFQ TKLMTRLTYTLD
Sbjct  1    KYNMKKFCLEPTSFTVKAEGVAKNAPPEFQKTKLMTRLTYTLD  43



>dbj|BAF94211.1| 33kDa oxygen evolving protein of photosystem II [Eutreptiella 
gymnastica]
Length=346

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = +3

Query  297  TFDEIQSKTYMEVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVS  473
            T+DEIQS +YME+KG+G +N CP I    E+    + G Y     CLEP+SF VK  S  
Sbjct  106  TYDEIQSLSYMEMKGTGLSNTCPIIADSSESKLNLRAGNYKINNMCLEPSSFQVKVPSPD  165

Query  474  KNAPPEFQNTKLMTRLTYTLD  536
                 +F+ TKLMTRLTYTLD
Sbjct  166  GKTVTDFEKTKLMTRLTYTLD  186



>gb|ADC54898.1| oxygen-evolving enhancer protein, partial [Codium sp. HEC 15711]
Length=151

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +3

Query  321  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  500
            TY ++KG+G AN CPT+  G +  A KPG Y+    C+EPTS  VK ES  K+   +F  
Sbjct  1    TYXQIKGTGLANTCPTLSTGDDAKALKPGSYAVSSMCIEPTSIQVKDESQFKDGVADFVK  60

Query  501  TKLMTRLTYTLD  536
            TKLMTRLTYTLD
Sbjct  61   TKLMTRLTYTLD  72



>gb|ADC54908.1| oxygen-evolving enhancer protein, partial [Siphonocladus tropicus]
Length=145

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +3

Query  330  EVKGSGTANQCPTIEGGVEN-FAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTK  506
            + KG+G AN CP I+GG +N    KPG Y+  KFC+EPTSFTVK +++ +   P +  TK
Sbjct  1    QXKGTGLANTCPIIDGGSDNPKDIKPGSYAMYKFCMEPTSFTVKEQALIRGGEPFYSKTK  60

Query  507  LMTRLTYTLD  536
            L+TRLTY+LD
Sbjct  61   LLTRLTYSLD  70



>gb|ADC54912.1| oxygen-evolving enhancer protein, partial [Ulva intestinalis]
Length=151

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 50/75 (67%), Gaps = 5/75 (7%)
 Frame = +3

Query  321  TYMEVKGSGTANQCPTIE---GGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPE  491
            TY ++KG+G AN CPT+E   G V +   KPG Y   +FC+EP+  TVK ES  K    E
Sbjct  1    TYXQIKGTGRANACPTLEETNGSVSDL--KPGNYKLDRFCMEPSKITVKEESQFKGGVTE  58

Query  492  FQNTKLMTRLTYTLD  536
            F NTKL+TRLTYTLD
Sbjct  59   FVNTKLVTRLTYTLD  73



>ref|XP_005652213.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
 gb|EIE27669.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
Length=270

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESV  470
            +T+D++Q+ +Y EV+G+G A  CP IE G  N A  KPG Y  K  CLEPT   V+ E +
Sbjct  10   ITYDQLQNMSYNEVRGTGLAAVCPLIEEGSTNLADLKPGTYKLKNLCLEPTKIQVQEEGL  69

Query  471  SKNAPPEFQNTKLMTRLTYTL  533
            +K + P++ NTKL+TR T  L
Sbjct  70   TKGSGPQWSNTKLLTRQTTNL  90



>emb|CAH04962.1| oxygen-evolving enhancer protein 1 [Cyanophora paradoxa]
Length=347

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 6/95 (6%)
 Frame = +3

Query  258  VSGANAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGVE-NFAFKPGK-YSAKKFC  431
            VS ANAEG    LTFD++ S  Y+++KG+G +N CPT+      N + + GK Y     C
Sbjct  86   VSQANAEG----LTFDQLNSANYLKLKGTGISNTCPTLGASARGNISLEKGKEYYLTDLC  141

Query  432  LEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            ++PT   VKAES+ K    EFQ T+L+TR TYT+D
Sbjct  142  IQPTEILVKAESLQKGKGEEFQPTRLVTRATYTID  176



>gb|AGI15739.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=167

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/38 (97%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +3

Query  423  KFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            KFCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLD
Sbjct  1    KFCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLD  38



>gb|AFB34200.1| hypothetical protein CL304Contig1_01, partial [Abies alba]
 gb|AFB34201.1| hypothetical protein CL304Contig1_01, partial [Abies alba]
Length=87

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +3

Query  405  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GKY  KK C+EPTSFTVKAES +KN PP+FQ TKLMTRLTYTLD
Sbjct  1    GKYEMKKLCMEPTSFTVKAESTNKNLPPDFQKTKLMTRLTYTLD  44



>gb|ADC54904.1| oxygen-evolving enhancer protein, partial [Nephroselmis olivacea]
Length=142

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +3

Query  330  EVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  509
            + KG+G AN CP IE  V +   K G Y+ ++ CLEPTSFTVK ES  K+   EF  TKL
Sbjct  1    QXKGTGIANTCPVIEKDVSD-KIKGGDYAMEQLCLEPTSFTVKEESQFKDGKSEFVKTKL  59

Query  510  MTRLTYTLD  536
            MTRLTYTLD
Sbjct  60   MTRLTYTLD  68



>gb|AGI15756.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15757.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15758.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15759.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15760.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=166

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  426  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLD
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLD  37



>gb|AGI15761.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=167

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  426  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLD
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLD  37



>gb|AGI15740.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15741.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=160

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  426  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLD
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLD  37



>gb|AGI15742.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15743.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15744.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15745.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15746.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15747.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15748.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15749.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15750.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15751.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15752.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15753.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15754.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15755.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=164

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  426  FCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            FCLEPTSFTVKAESVSKNAPPEFQ TKLMTRLTYTLD
Sbjct  1    FCLEPTSFTVKAESVSKNAPPEFQKTKLMTRLTYTLD  37



>gb|ADC54890.1| oxygen-evolving enhancer protein, partial [Acetabularia acetabulum]
Length=143

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +3

Query  345  GTANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  521
            G AN C  IE G  + +  KPG Y   KFC+EP+SFTVK ES  K    EF NTKLMTRL
Sbjct  1    GVANTCAVIESGSTDLSVLKPGNYKFTKFCMEPSSFTVKEESQFKGGETEFVNTKLMTRL  60

Query  522  TYTLD  536
            TYTLD
Sbjct  61   TYTLD  65



>gb|AEW08532.1| hypothetical protein CL304Contig1_01, partial [Pinus radiata]
 gb|AFG43487.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
 gb|AFG43488.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
 gb|AFG43489.1| hypothetical protein CL304Contig1_01, partial [Pinus taeda]
Length=87

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +3

Query  405  GKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTYTLD  536
            GKY  KK C+EPTSFTVKAE  +KN PP+FQ T+LMTRLTYTLD
Sbjct  1    GKYEMKKLCMEPTSFTVKAEGTNKNLPPDFQKTRLMTRLTYTLD  44



>gb|ADC54899.1| oxygen-evolving enhancer protein, partial [Derbesia sp. 2773-1]
Length=142

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +3

Query  336  KGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMT  515
            KG+G AN CPT+E G +  + K G Y+    C+EPT+F VK ES  ++ P  F +TKLMT
Sbjct  1    KGTGIANTCPTLETGEDGKSLKAGTYTVSGMCIEPTAFQVKEESEFRDQPAAFVDTKLMT  60

Query  516  RLTYTLD  536
            RLTYTLD
Sbjct  61   RLTYTLD  67



>gb|ADC54891.1| oxygen-evolving enhancer protein, partial [Ulvella repens]
Length=140

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = +3

Query  345  GTANQCPTI-EGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRL  521
            G AN C T+ EG  E  A K G Y+  +FC+EPT FTVK ES  K    EF NTKLMTRL
Sbjct  1    GVANTCATLDEGSAEGSALKQGTYALSQFCMEPTKFTVKEESQFKGGVTEFVNTKLMTRL  60

Query  522  TYTLD  536
            TYTLD
Sbjct  61   TYTLD  65



>gb|ADC54895.1| oxygen-evolving enhancer protein, partial [Bryopsis sp. EE4]
Length=144

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +3

Query  330  EVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKL  509
            + KG+G AN CPT+  G +  + K G Y     C+EPTS TVK ES  K+   EF  TKL
Sbjct  1    QXKGTGVANTCPTLATGGDGSSLKAGSYQVTGMCIEPTSITVKEESQFKDGVSEFVKTKL  60

Query  510  MTRLTYTLD  536
            MTRLTYTLD
Sbjct  61   MTRLTYTLD  69



>gb|ADC54903.1| oxygen-evolving enhancer protein, partial [Mesostigma viride]
Length=151

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +3

Query  321  TYMEVKGSGTANQCPTIEGGVENFAFKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQN  500
            T  + KG+G AN C  I+          GKY   K CLEPTS  VK ES+ K   P+F  
Sbjct  2    TXXQXKGTGLANTCAVIDNASTELKVAGGKYKVAKMCLEPTSVKVKEESILKGGAPQFVE  61

Query  501  TKLMTRLTYTLD  536
            TKL+TR+TYTLD
Sbjct  62   TKLLTRMTYTLD  73



>gb|ADC54907.1| oxygen-evolving enhancer protein, partial [Acutodesmus obliquus]
Length=141

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = +3

Query  351  ANQCPTIEGGVENFA-FKPGKYSAKKFCLEPTSFTVKAESVSKNAPPEFQNTKLMTRLTY  527
            AN C  +E G  N    K G Y   KFC+EPTSFTVK ES  K    EF  TKLMTRLTY
Sbjct  1    ANTCAVLESGSTNLKDLKAGTYKVDKFCMEPTSFTVKDESQFKGGETEFVKTKLMTRLTY  60

Query  528  TLD  536
            TLD
Sbjct  61   TLD  63



>ref|XP_005847917.1| hypothetical protein CHLNCDRAFT_22722 [Chlorella variabilis]
 gb|EFN55815.1| hypothetical protein CHLNCDRAFT_22722 [Chlorella variabilis]
Length=272

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 6/85 (7%)
 Frame = +3

Query  294  LTFDEIQSKTYMEVKGSGTANQCPTI----EGGVENFAFKPGKYSAKKFCLEPTSFTVKA  461
            +T+D++QS TY EVKGSG ANQCP +    + G+ N    PG Y    FC+EP SF V  
Sbjct  27   ITYDQLQSMTYKEVKGSGLANQCPILGPSADDGLAN--MPPGSYRMDMFCMEPNSFQVHC  84

Query  462  ESVSKNAPPEFQNTKLMTRLTYTLD  536
                      F+ + L+TR TY+LD
Sbjct  85   RLAVPVGGTRFEPSTLLTRNTYSLD  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800