BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L20

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW71392.1|  hypothetical protein EUGRSUZ_F04463                     300   1e-98   Eucalyptus grandis [rose gum]
gb|KCW71391.1|  hypothetical protein EUGRSUZ_F04463                     300   6e-98   Eucalyptus grandis [rose gum]
ref|XP_004139837.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    300   1e-97   Cucumis sativus [cucumbers]
ref|XP_010064085.1|  PREDICTED: phosphoglycerate kinase, cytosolic      300   1e-97   Eucalyptus grandis [rose gum]
gb|ACJ11718.1|  phosphoglycerate kinase                                 300   2e-97   Gossypium hirsutum [American cotton]
ref|XP_008447095.1|  PREDICTED: phosphoglycerate kinase, cytosolic      299   3e-97   Cucumis melo [Oriental melon]
ref|XP_010557291.1|  PREDICTED: phosphoglycerate kinase, cytosolic      300   4e-97   Tarenaya hassleriana [spider flower]
gb|ACU18322.1|  unknown                                                 292   8e-97   Glycine max [soybeans]
ref|XP_011095716.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    298   9e-97   Sesamum indicum [beniseed]
ref|XP_010544342.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    298   1e-96   Tarenaya hassleriana [spider flower]
gb|KDP25066.1|  hypothetical protein JCGZ_22601                         298   1e-96   Jatropha curcas
ref|XP_011086347.1|  PREDICTED: phosphoglycerate kinase, cytosolic      298   1e-96   Sesamum indicum [beniseed]
gb|ADV16380.1|  cytosolic phosphoglycerate kinase 2                     297   2e-96   Helianthus annuus
ref|XP_011016588.1|  PREDICTED: phosphoglycerate kinase, cytosolic      297   2e-96   Populus euphratica
gb|ACJ84593.1|  unknown                                                 290   4e-96   Medicago truncatula
gb|EYU33791.1|  hypothetical protein MIMGU_mgv1a006853mg                297   4e-96   Erythranthe guttata [common monkey flower]
gb|KJB14019.1|  hypothetical protein B456_002G107200                    296   5e-96   Gossypium raimondii
ref|XP_002312237.1|  hypothetical protein POPTR_0008s08400g             296   8e-96   
gb|ABK92531.1|  unknown                                                 296   9e-96   Populus trichocarpa [western balsam poplar]
ref|XP_010324204.1|  PREDICTED: phosphoglycerate kinase, cytosolic      295   1e-95   
ref|XP_009777860.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    295   1e-95   Nicotiana sylvestris
gb|AAO63774.1|  3-phosphoglycerate kinase                               295   1e-95   Populus tremuloides
ref|XP_002263950.1|  PREDICTED: phosphoglycerate kinase, cytosolic      295   1e-95   Vitis vinifera
ref|XP_007149209.1|  hypothetical protein PHAVU_005G050800g             295   2e-95   Phaseolus vulgaris [French bean]
emb|CDP16886.1|  unnamed protein product                                295   2e-95   Coffea canephora [robusta coffee]
ref|XP_003531483.1|  PREDICTED: phosphoglycerate kinase, cytosolic      294   3e-95   
gb|KDO61597.1|  hypothetical protein CISIN_1g040813mg                   294   3e-95   Citrus sinensis [apfelsine]
ref|XP_006422250.1|  hypothetical protein CICLE_v10005101mg             294   3e-95   Citrus clementina [clementine]
ref|XP_008805982.1|  PREDICTED: phosphoglycerate kinase, cytosolic      294   4e-95   Phoenix dactylifera
ref|XP_007022579.1|  Phosphoglycerate kinase isoform 1                  294   4e-95   
ref|XP_010936568.1|  PREDICTED: phosphoglycerate kinase, cytosolic      293   5e-95   Elaeis guineensis
gb|ABI18157.1|  cytosolic phosphoglycerate kinase                       293   8e-95   Helianthus annuus
ref|XP_004488762.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    293   1e-94   Cicer arietinum [garbanzo]
dbj|BAA33801.1|  cytosolic phosphoglycerate kinase 1                    293   1e-94   Populus nigra [black poplar]
ref|XP_010275944.1|  PREDICTED: phosphoglycerate kinase, cytosolic      293   1e-94   Nelumbo nucifera [Indian lotus]
ref|XP_011468861.1|  PREDICTED: phosphoglycerate kinase, cytosolic      293   1e-94   Fragaria vesca subsp. vesca
ref|NP_001275451.1|  phosphoglycerate kinase, cytosolic-like            292   1e-94   Solanum tuberosum [potatoes]
gb|AAF85975.1|AF275639_1  cytosolic phosphoglycerate kinase             292   2e-94   Pisum sativum [garden pea]
ref|XP_003546821.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    292   2e-94   Glycine max [soybeans]
ref|XP_009417722.1|  PREDICTED: phosphoglycerate kinase, cytosolic      292   2e-94   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009791377.1|  PREDICTED: phosphoglycerate kinase, cytosolic      292   3e-94   Nicotiana sylvestris
ref|XP_002513352.1|  phosphoglycerate kinase, putative                  292   3e-94   Ricinus communis
ref|XP_003596092.1|  Phosphoglycerate kinase                            291   3e-94   Medicago truncatula
gb|AFK46712.1|  unknown                                                 291   4e-94   Medicago truncatula
ref|XP_002315067.1|  cytosolic phosphoglycerate kinase family pro...    291   4e-94   
ref|XP_008383158.1|  PREDICTED: phosphoglycerate kinase, cytosolic      291   6e-94   Malus domestica [apple tree]
ref|XP_008798227.1|  PREDICTED: phosphoglycerate kinase, cytosolic      291   6e-94   Phoenix dactylifera
ref|XP_007213914.1|  hypothetical protein PRUPE_ppa005669mg             292   9e-94   
ref|XP_008226131.1|  PREDICTED: phosphoglycerate kinase, cytosolic      290   1e-93   Prunus mume [ume]
ref|XP_009607754.1|  PREDICTED: phosphoglycerate kinase, cytosolic      290   1e-93   Nicotiana tomentosiformis
ref|XP_011013882.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    290   2e-93   Populus euphratica
dbj|BAA33802.1|  cytosolic phosphoglycerate kinase 1                    290   2e-93   Populus nigra [black poplar]
ref|XP_011013868.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    290   3e-93   Populus euphratica
gb|EPS64076.1|  phosphoglycerate kinase                                 289   4e-93   Genlisea aurea
gb|ABF69999.1|  phosphoglycerate kinase, putative                       289   4e-93   Musa acuminata [banana]
ref|XP_009399252.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    288   8e-93   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003596093.1|  Phosphoglycerate kinase                            288   9e-93   Medicago truncatula
gb|AFW70285.1|  hypothetical protein ZEAMMB73_319281                    280   1e-92   
gb|AIN39803.1|  hypothetical protein                                    284   1e-92   Zoysia matrella [Japanese carpet grass]
gb|AIZ68220.1|  phosphoglycerate kinase                                 287   2e-92   Ornithogalum longebracteatum [sea-onion]
ref|XP_010941661.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    286   6e-92   Elaeis guineensis
ref|XP_010941660.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    286   7e-92   
emb|CDP13576.1|  unnamed protein product                                285   9e-92   Coffea canephora [robusta coffee]
ref|XP_009106677.1|  PREDICTED: phosphoglycerate kinase, cytosolic      285   1e-91   Brassica rapa
ref|XP_009128369.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    284   2e-91   Brassica rapa
emb|CDX87375.1|  BnaA07g34980D                                          284   2e-91   
ref|XP_010669985.1|  PREDICTED: phosphoglycerate kinase, cytosolic      284   2e-91   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY70232.1|  BnaC02g46710D                                          284   2e-91   Brassica napus [oilseed rape]
ref|XP_009414502.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    284   3e-91   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006300323.1|  hypothetical protein CARUB_v10020404mg             284   3e-91   
ref|XP_009384174.1|  PREDICTED: phosphoglycerate kinase, cytosolic      283   4e-91   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002889253.1|  hypothetical protein ARALYDRAFT_477124             283   4e-91   
gb|AAM61185.1|  phosphoglycerate kinase, putative                       283   5e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389877.1|  hypothetical protein EUTSA_v10018657mg             283   5e-91   Eutrema salsugineum [saltwater cress]
ref|XP_006656354.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    283   5e-91   Oryza brachyantha
ref|NP_178073.1|  phosphoglycerate kinase                               283   5e-91   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001142404.1|  uncharacterized protein LOC100274579               283   6e-91   Zea mays [maize]
ref|XP_003570108.1|  PREDICTED: phosphoglycerate kinase, cytosolic      283   7e-91   Brachypodium distachyon [annual false brome]
ref|XP_010472814.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    282   1e-90   Camelina sativa [gold-of-pleasure]
ref|XP_010417621.1|  PREDICTED: phosphoglycerate kinase, cytosolic      282   1e-90   Camelina sativa [gold-of-pleasure]
ref|XP_009104523.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    282   2e-90   Brassica rapa
ref|XP_010094705.1|  Phosphoglycerate kinase                            282   2e-90   Morus notabilis
ref|XP_010537804.1|  PREDICTED: phosphoglycerate kinase, cytosolic      281   3e-90   Tarenaya hassleriana [spider flower]
ref|XP_006646936.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    281   4e-90   Oryza brachyantha
gb|EMS46092.1|  Phosphoglycerate kinase, cytosolic                      281   6e-90   Triticum urartu
ref|NP_001046020.1|  Os02g0169300                                       281   6e-90   
gb|ABI74567.1|  phosphoglycerate kinase                                 280   7e-90   Oryza sativa Indica Group [Indian rice]
ref|XP_004966316.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    280   7e-90   Setaria italica
ref|XP_004951776.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    280   9e-90   Setaria italica
ref|NP_001058317.1|  Os06g0668200                                       280   2e-89   
sp|P12783.1|PGKY_WHEAT  RecName: Full=Phosphoglycerate kinase, cy...    280   2e-89   Triticum aestivum [Canadian hard winter wheat]
gb|ABB86242.1|  phosphoglycerate kinase-like                            279   3e-89   Solanum tuberosum [potatoes]
gb|ABI74568.1|  phosphoglycerate kinase                                 278   7e-89   Oryza sativa Indica Group [Indian rice]
gb|EMT29203.1|  Phosphoglycerate kinase, cytosolic                      281   7e-89   
ref|XP_006858233.1|  hypothetical protein AMTR_s00062p00191350          275   9e-88   Amborella trichopoda
gb|KDO61595.1|  hypothetical protein CISIN_1g011942mg                   272   3e-87   Citrus sinensis [apfelsine]
ref|XP_009124670.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    276   5e-87   Brassica rapa
emb|CDY00798.1|  BnaC03g37820D                                          275   7e-87   
emb|CDY43401.1|  BnaA01g30320D                                          275   8e-87   Brassica napus [oilseed rape]
gb|AFW70281.1|  phosphoglycerate kinase                                 277   9e-87   
emb|CDX73803.1|  BnaA03g32440D                                          275   1e-86   
ref|XP_006407295.1|  hypothetical protein EUTSA_v10020621mg             275   1e-86   Eutrema salsugineum [saltwater cress]
ref|XP_009135249.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    274   2e-86   Brassica rapa
ref|XP_002315066.1|  PHOSPHOGLYCERATE KINASE 1 family protein           274   3e-86   
ref|XP_009618219.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    271   4e-86   Nicotiana tomentosiformis
emb|CDY24247.1|  BnaC01g38270D                                          273   4e-86   Brassica napus [oilseed rape]
gb|KDO61594.1|  hypothetical protein CISIN_1g011942mg                   273   5e-86   Citrus sinensis [apfelsine]
ref|XP_006422251.1|  hypothetical protein CICLE_v10004891mg             273   5e-86   Citrus clementina [clementine]
ref|NP_187884.1|  phosphoglycerate kinase 1                             273   6e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002513353.1|  phosphoglycerate kinase, putative                  273   7e-86   Ricinus communis
emb|CBI24182.3|  unnamed protein product                                270   9e-86   Vitis vinifera
ref|XP_009146585.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    272   1e-85   Brassica rapa
ref|XP_006858226.1|  hypothetical protein AMTR_s00062p00189550          272   1e-85   Amborella trichopoda
gb|AGL76992.1|  phosphoglycerate kinase                                 268   2e-85   Anisodus luridus
gb|ABR16231.1|  unknown                                                 271   2e-85   Picea sitchensis
ref|XP_002884926.1|  hypothetical protein ARALYDRAFT_478641             271   2e-85   Arabidopsis lyrata subsp. lyrata
ref|XP_011013857.1|  PREDICTED: phosphoglycerate kinase, chloropl...    271   2e-85   Populus euphratica
sp|P29409.2|PGKH_SPIOL  RecName: Full=Phosphoglycerate kinase, ch...    270   3e-85   Spinacia oleracea
gb|AAF02830.1|AC009894_1  phosphoglycerate kinase                       266   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805983.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    271   3e-85   Phoenix dactylifera
ref|XP_006297559.1|  hypothetical protein CARUB_v10013582mg             271   3e-85   Capsella rubella
emb|CBL95264.1|  phosphoglycerate kinase 1                              271   4e-85   Pinus pinaster [cluster pine]
gb|ABK24564.1|  unknown                                                 271   4e-85   Picea sitchensis
ref|XP_010487004.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    270   6e-85   Camelina sativa [gold-of-pleasure]
gb|AIZ74346.1|  phosphoglycerate kinase 1                               271   6e-85   Pinus massoniana [Chinese red pine]
gb|AGH55660.1|  phosphoglycerate kinase                                 266   6e-85   Atropa belladonna [deadly nightshade]
gb|EMT08517.1|  Phosphoglycerate kinase, cytosolic                      268   7e-85   
ref|XP_002263796.1|  PREDICTED: phosphoglycerate kinase, chloropl...    270   7e-85   Vitis vinifera
ref|XP_011095719.1|  PREDICTED: phosphoglycerate kinase, chloropl...    270   1e-84   Sesamum indicum [beniseed]
ref|XP_002891879.1|  hypothetical protein ARALYDRAFT_474689             270   1e-84   
ref|XP_010060861.1|  PREDICTED: phosphoglycerate kinase, chloropl...    270   1e-84   Eucalyptus grandis [rose gum]
gb|KHG01489.1|  hypothetical protein F383_22605                         270   1e-84   Gossypium arboreum [tree cotton]
ref|XP_010936574.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    269   2e-84   Elaeis guineensis
ref|XP_010465058.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    269   2e-84   Camelina sativa [gold-of-pleasure]
gb|KJB14026.1|  hypothetical protein B456_002G107300                    269   2e-84   Gossypium raimondii
gb|KJB14025.1|  hypothetical protein B456_002G107300                    269   2e-84   Gossypium raimondii
ref|XP_011016496.1|  PREDICTED: phosphoglycerate kinase, chloropl...    268   3e-84   Populus euphratica
ref|XP_002312238.1|  hypothetical protein POPTR_0008s08410g             268   3e-84   Populus trichocarpa [western balsam poplar]
ref|XP_011086346.1|  PREDICTED: phosphoglycerate kinase, chloropl...    268   3e-84   Sesamum indicum [beniseed]
ref|XP_009763674.1|  PREDICTED: phosphoglycerate kinase, chloropl...    268   3e-84   Nicotiana sylvestris
ref|XP_008456300.1|  PREDICTED: phosphoglycerate kinase, chloropl...    268   3e-84   Cucumis melo [Oriental melon]
ref|XP_010499471.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    268   3e-84   Camelina sativa [gold-of-pleasure]
gb|ABK96267.1|  unknown                                                 268   3e-84   Populus trichocarpa x Populus deltoides
gb|EMS52006.1|  Phosphoglycerate kinase, cytosolic                      270   3e-84   Triticum urartu
gb|EAY98560.1|  hypothetical protein OsI_20474                          262   4e-84   Oryza sativa Indica Group [Indian rice]
emb|CDP13575.1|  unnamed protein product                                278   4e-84   Coffea canephora [robusta coffee]
emb|CDP13574.1|  unnamed protein product                                266   4e-84   Coffea canephora [robusta coffee]
ref|XP_004139904.1|  PREDICTED: phosphoglycerate kinase, chloropl...    268   6e-84   Cucumis sativus [cucumbers]
ref|XP_010923458.1|  PREDICTED: phosphoglycerate kinase, chloropl...    268   8e-84   Elaeis guineensis
ref|NP_176015.1|  phosphoglycerate kinase                               267   1e-83   Arabidopsis thaliana [mouse-ear cress]
gb|AAB60303.1|  phosphoglycerate kinase                                 265   1e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010269369.1|  PREDICTED: phosphoglycerate kinase, chloropl...    267   1e-83   Nelumbo nucifera [Indian lotus]
gb|ADV16381.1|  chloroplast phosphoglycerate kinase 3                   267   1e-83   Helianthus annuus
ref|NP_001117503.1|  phosphoglycerate kinase                            264   1e-83   Arabidopsis thaliana [mouse-ear cress]
sp|Q42961.1|PGKH_TOBAC  RecName: Full=Phosphoglycerate kinase, ch...    266   1e-83   Nicotiana tabacum [American tobacco]
dbj|BAJ85222.1|  predicted protein                                      264   2e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008786111.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    267   2e-83   Phoenix dactylifera
ref|XP_003596091.1|  Phosphoglycerate kinase                            266   2e-83   Medicago truncatula
gb|EPS66037.1|  phosphoglycerate kinase, chloroplastic                  266   2e-83   Genlisea aurea
ref|XP_003531482.1|  PREDICTED: phosphoglycerate kinase, chloropl...    266   2e-83   Glycine max [soybeans]
ref|XP_003546820.1|  PREDICTED: phosphoglycerate kinase, chloropl...    266   3e-83   
ref|XP_009622055.1|  PREDICTED: phosphoglycerate kinase, chloropl...    265   5e-83   Nicotiana tomentosiformis
ref|XP_007149208.1|  hypothetical protein PHAVU_005G050700g             265   5e-83   Phaseolus vulgaris [French bean]
ref|XP_007022578.1|  Phosphoglycerate kinase 1                          265   6e-83   
ref|XP_009397212.1|  PREDICTED: phosphoglycerate kinase, chloropl...    265   6e-83   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP25067.1|  hypothetical protein JCGZ_22602                         265   7e-83   Jatropha curcas
gb|EYU33792.1|  hypothetical protein MIMGU_mgv1a005422mg                265   9e-83   Erythranthe guttata [common monkey flower]
ref|XP_004961633.1|  PREDICTED: phosphoglycerate kinase, chloropl...    265   9e-83   Setaria italica
ref|XP_004243968.1|  PREDICTED: phosphoglycerate kinase, chloropl...    265   1e-82   Solanum lycopersicum
ref|XP_010669994.1|  PREDICTED: phosphoglycerate kinase, chloropl...    265   1e-82   Beta vulgaris subsp. vulgaris [field beet]
gb|AGV54662.1|  phosphoglycerate kinase chloroplastic-like protein      264   1e-82   Phaseolus vulgaris [French bean]
ref|XP_004488763.1|  PREDICTED: phosphoglycerate kinase, chloropl...    264   1e-82   Cicer arietinum [garbanzo]
gb|ADR71054.1|  phosphoglycerate kinase                                 264   1e-82   Nicotiana benthamiana
ref|XP_006654593.1|  PREDICTED: phosphoglycerate kinase, chloropl...    261   2e-82   Oryza brachyantha
ref|XP_009402843.1|  PREDICTED: phosphoglycerate kinase, chloropl...    263   3e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008372155.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    260   4e-82   
gb|AAC26785.1|  phosphoglycerate kinase precursor                       263   4e-82   Solanum tuberosum [potatoes]
gb|ACN32155.1|  unknown                                                 261   5e-82   Zea mays [maize]
sp|P12782.1|PGKH_WHEAT  RecName: Full=Phosphoglycerate kinase, ch...    262   7e-82   Triticum aestivum [Canadian hard winter wheat]
gb|AFW82396.1|  hypothetical protein ZEAMMB73_945417                    262   8e-82   
ref|XP_010094703.1|  Phosphoglycerate kinase                            261   1e-81   Morus notabilis
gb|ABB86255.1|  phosphoglycerate kinase precursor-like                  261   1e-81   Solanum tuberosum [potatoes]
ref|NP_001275227.1|  phosphoglycerate kinase, chloroplastic-like        261   2e-81   Solanum tuberosum [potatoes]
ref|XP_003568189.1|  PREDICTED: phosphoglycerate kinase, chloropl...    261   2e-81   
ref|NP_001147628.1|  phosphoglycerate kinase                            261   2e-81   
gb|AFW78532.1|  phosphoglycerate kinase                                 261   2e-81   
ref|XP_010544343.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoglyce...    261   3e-81   Tarenaya hassleriana [spider flower]
gb|AFW78533.1|  phosphoglycerate kinase                                 261   3e-81   
ref|XP_008346077.1|  PREDICTED: phosphoglycerate kinase, chloropl...    260   3e-81   
ref|XP_008371996.1|  PREDICTED: phosphoglycerate kinase, chloropl...    260   3e-81   
gb|EMS54865.1|  Phosphoglycerate kinase, chloroplastic                  259   5e-81   Triticum urartu
ref|XP_008226130.1|  PREDICTED: phosphoglycerate kinase, chloropl...    260   6e-81   Prunus mume [ume]
ref|XP_007213965.1|  hypothetical protein PRUPE_ppa005031mg             259   7e-81   Prunus persica
ref|XP_004306579.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    258   2e-80   Fragaria vesca subsp. vesca
ref|XP_008349091.1|  PREDICTED: phosphoglycerate kinase, chloropl...    258   4e-80   
ref|XP_008383150.1|  PREDICTED: phosphoglycerate kinase, chloropl...    258   4e-80   Malus domestica [apple tree]
ref|XP_002972334.1|  hypothetical protein SELMODRAFT_231942             256   5e-80   
ref|XP_002971814.1|  hypothetical protein SELMODRAFT_267533             257   6e-80   
ref|XP_004970259.1|  PREDICTED: phosphoglycerate kinase, chloropl...    257   8e-80   Setaria italica
ref|XP_008656415.1|  PREDICTED: phosphoglycerate kinase, chloropl...    260   1e-79   
ref|XP_002441313.1|  hypothetical protein SORBIDRAFT_09g024340          256   1e-79   Sorghum bicolor [broomcorn]
ref|XP_004970258.1|  PREDICTED: phosphoglycerate kinase, chloropl...    253   2e-78   Setaria italica
dbj|BAJ88371.1|  predicted protein                                      250   4e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT16255.1|  phosphoglycerate kinase                                 245   5e-75   Saccharum hybrid cultivar R570
dbj|BAJ87335.1|  predicted protein                                      232   2e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_017323648.1|  phosphoglycerate kinase                            231   7e-71   cyanobacterium PCC 7702
emb|CDX79325.1|  BnaC06g19780D                                          229   9e-71   
ref|XP_002951648.1|  phosphoglycerate kinase                            232   2e-70   Volvox carteri f. nagariensis
ref|WP_015204810.1|  phosphoglycerate kinase                            228   1e-69   Crinalium epipsammum
emb|CDY52872.1|  BnaCnng23600D                                          236   1e-69   Brassica napus [oilseed rape]
ref|WP_035157181.1|  phosphoglycerate kinase                            227   5e-69   Calothrix sp. 336/3
ref|WP_039205250.1|  phosphoglycerate kinase                            227   6e-69   Aphanizomenon flos-aquae
ref|XP_005851391.1|  hypothetical protein CHLNCDRAFT_48457              226   8e-69   Chlorella variabilis
ref|WP_015140688.1|  phosphoglycerate kinase                            226   9e-69   Nostoc sp. PCC 7524
ref|WP_016949614.1|  phosphoglycerate kinase                            226   1e-68   Anabaena sp. PCC 7108
ref|WP_016873269.1|  phosphoglycerate kinase                            226   1e-68   Chlorogloeopsis fritschii
ref|WP_011317630.1|  phosphoglycerate kinase                            225   2e-68   Trichormus variabilis
ref|WP_010998270.1|  phosphoglycerate kinase                            225   2e-68   Nostocaceae
gb|KIY97385.1|  phosphoglycerate kinase                                 220   2e-68   Monoraphidium neglectum
gb|AAW79325.1|  phosphoglycerate kinase                                 226   3e-68   Isochrysis galbana
ref|WP_006633515.1|  phosphoglycerate kinase                            225   3e-68   Microcoleus vaginatus
ref|WP_026734580.1|  phosphoglycerate kinase                            225   3e-68   Fischerella sp. PCC 9605
ref|WP_017309094.1|  MULTISPECIES: phosphoglycerate kinase              224   3e-68   Hapalosiphonaceae
ref|WP_015127481.1|  phosphoglycerate kinase                            224   3e-68   Calothrix sp. PCC 7507
ref|WP_015177490.1|  phosphoglycerate kinase                            224   4e-68   Oscillatoria nigro-viridis
ref|WP_015162225.1|  phosphoglycerate kinase                            224   4e-68   Chamaesiphon minutus
ref|WP_013192657.1|  phosphoglycerate kinase                            224   5e-68   Trichormus azollae
ref|XP_002972143.1|  hypothetical protein SELMODRAFT_96742              224   5e-68   Selaginella moellendorffii
ref|WP_026719925.1|  phosphoglycerate kinase                            224   5e-68   Fischerella sp. PCC 9431
ref|XP_001699523.1|  phosphoglycerate kinase                            226   6e-68   Chlamydomonas reinhardtii
ref|WP_009454679.1|  MULTISPECIES: phosphoglycerate kinase              224   8e-68   Fischerella thermalis
ref|WP_016865730.1|  phosphoglycerate kinase                            224   9e-68   Fischerella muscicola
sp|P41758.1|PGKH_CHLRE  RecName: Full=Phosphoglycerate kinase, ch...    224   1e-67   Chlamydomonas reinhardtii
ref|XP_005791258.1|  phosphoglycerate kinase                            219   1e-67   Emiliania huxleyi CCMP1516
ref|WP_026098466.1|  phosphoglycerate kinase                            223   2e-67   Oscillatoria sp. PCC 10802
ref|WP_007352879.1|  MULTISPECIES: phosphoglycerate kinase              223   2e-67   Kamptonema
ref|WP_028089947.1|  phosphoglycerate kinase                            223   2e-67   Dolichospermum circinale
ref|WP_019495207.1|  phosphoglycerate kinase                            223   2e-67   Calothrix sp. PCC 7103
ref|WP_009628155.1|  phosphoglycerate kinase                            223   2e-67   Pseudanabaena biceps
gb|KIE11439.1|  phosphoglycerate kinase                                 223   2e-67   Tolypothrix bouteillei VB521301
ref|WP_015217208.1|  phosphoglycerate kinase                            222   3e-67   Anabaena cylindrica
ref|XP_005855869.1|  phosphoglycerate kinase                            215   4e-67   Nannochloropsis gaditana CCMP526
ref|WP_009631644.1|  phosphoglycerate kinase                            222   5e-67   Synechocystis sp. PCC 7509
ref|WP_017655761.1|  phosphoglycerate kinase                            221   5e-67   Fortiea contorta
ref|WP_016861411.1|  phosphoglycerate kinase                            221   5e-67   Fischerella muscicola
ref|WP_027404640.1|  phosphoglycerate kinase                            221   6e-67   Aphanizomenon flos-aquae
ref|WP_015080710.1|  phosphoglycerate kinase                            221   6e-67   Anabaena sp. 90
ref|WP_028085373.1|  phosphoglycerate kinase                            221   1e-66   Dolichospermum circinale
ref|WP_015205969.1|  phosphoglycerate kinase                            220   1e-66   Cylindrospermum stagnale
ref|WP_026156411.1|  phosphoglycerate kinase                            220   3e-66   Dehalobacter sp. FTH1
ref|WP_019224946.1|  MULTISPECIES: phosphoglycerate kinase              219   3e-66   Dehalobacter
ref|WP_015190859.1|  phosphoglycerate kinase                            219   3e-66   Gloeocapsa sp. PCC 7428
ref|WP_017317549.1|  phosphoglycerate kinase                            219   4e-66   Mastigocladopsis repens
ref|WP_006716909.1|  phosphoglycerate kinase                            219   4e-66   Desulfitobacterium metallireducens
ref|XP_002977295.1|  hypothetical protein SELMODRAFT_107116             219   5e-66   Selaginella moellendorffii
ref|WP_006199298.1|  phosphoglycerate kinase                            219   5e-66   Nodularia spumigena
gb|EMT12348.1|  Phosphoglycerate kinase, chloroplastic                  218   7e-66   
ref|WP_027249107.1|  phosphoglycerate kinase                            219   7e-66   Planktothrix agardhii
ref|WP_017803962.1|  phosphoglycerate kinase                            219   7e-66   Nodularia spumigena
ref|WP_026794289.1|  MULTISPECIES: phosphoglycerate kinase              219   7e-66   Planktothrix
ref|WP_029637902.1|  phosphoglycerate kinase [                          219   7e-66   [Scytonema hofmanni] UTEX B 1581
ref|WP_015149149.1|  phosphoglycerate kinase                            218   9e-66   Oscillatoria acuminata
gb|EEC71648.1|  hypothetical protein OsI_04088                          219   9e-66   Oryza sativa Indica Group [Indian rice]
ref|WP_009343450.1|  phosphoglycerate kinase                            218   1e-65   Raphidiopsis brookii
ref|WP_015111043.1|  phosphoglycerate kinase                            218   1e-65   Nostoc sp. PCC 7107
ref|WP_015153171.1|  phosphoglycerate kinase                            218   2e-65   Cyanobacteria [blue-green bacteria]
ref|WP_039715776.1|  phosphoglycerate kinase                            218   2e-65   
ref|XP_005822051.1|  hypothetical protein GUITHDRAFT_80135              218   2e-65   Guillardia theta CCMP2712
ref|WP_039739530.1|  phosphoglycerate kinase                            217   2e-65   
gb|ABH10990.1|  phosphoglycerate kinase                                 213   3e-65   Polytomella parva
ref|WP_042152714.1|  phosphoglycerate kinase                            217   3e-65   Planktothrix agardhii
ref|WP_011194377.1|  phosphoglycerate kinase                            217   3e-65   Symbiobacterium thermophilum
ref|WP_013626203.1|  phosphoglycerate kinase                            217   3e-65   Syntrophobotulus glycolicus
ref|NP_001172606.1|  Os01g0800266                                       216   4e-65   
gb|KIJ83619.1|  phosphoglycerate kinase                                 217   4e-65   Scytonema tolypothrichoides VB-61278
gb|EWM26407.1|  phosphoglycerate kinase                                 219   5e-65   Nannochloropsis gaditana
ref|XP_001418373.1|  predicted protein                                  217   6e-65   Ostreococcus lucimarinus CCE9901
ref|WP_014829391.1|  phosphoglycerate kinase                            216   6e-65   Desulfosporosinus acidiphilus
gb|EEE55536.1|  hypothetical protein OsJ_03768                          217   7e-65   Oryza sativa Japonica Group [Japonica rice]
ref|WP_036005350.1|  phosphoglycerate kinase                            216   8e-65   
ref|WP_026135280.1|  phosphoglycerate kinase                            216   9e-65   
ref|WP_041032823.1|  phosphoglycerate kinase                            216   9e-65   
ref|WP_024545807.1|  phosphoglycerate kinase                            216   9e-65   
ref|WP_018397328.1|  phosphoglycerate kinase                            216   1e-64   
ref|WP_006528046.1|  phosphoglycerate kinase                            216   1e-64   
ref|WP_014187636.1|  phosphoglycerate kinase                            215   1e-64   
ref|WP_012626442.1|  phosphoglycerate kinase                            215   2e-64   
ref|WP_028051679.1|  phosphoglycerate kinase                            215   2e-64   
ref|WP_006278490.1|  phosphoglycerate kinase                            214   3e-64   
gb|AFN75153.1|  phosphoglycerate kinase                                 214   3e-64   
ref|WP_012583493.1|  phosphoglycerate kinase                            214   3e-64   
ref|WP_034613156.1|  phosphoglycerate kinase                            214   4e-64   
ref|WP_034143280.1|  phosphoglycerate kinase                            214   5e-64   
ref|WP_041356046.1|  phosphoglycerate kinase                            214   5e-64   
ref|WP_015198799.1|  phosphoglycerate kinase                            214   5e-64   
ref|WP_003867203.1|  MULTISPECIES: phosphoglycerate kinase              213   7e-64   
ref|WP_029688634.1|  phosphoglycerate kinase                            213   8e-64   
ref|XP_005535003.1|  phosphoglycerate kinase                            215   1e-63   
emb|CDX79326.1|  BnaC06g19770D                                          211   1e-63   
ref|XP_002500825.1|  phosphoglycerate kinase                            214   1e-63   
ref|WP_011612823.1|  phosphoglycerate kinase                            213   1e-63   
emb|CBY84995.1|  phosphoglycerate kinase                                213   2e-63   
ref|WP_009543708.1|  MULTISPECIES: phosphoglycerate kinase              212   2e-63   
ref|WP_037220338.1|  phosphoglycerate kinase                            212   2e-63   
ref|WP_008275737.1|  phosphoglycerate kinase                            212   2e-63   
ref|WP_019502041.1|  phosphoglycerate kinase                            212   2e-63   
ref|WP_015193656.1|  phosphoglycerate kinase                            212   3e-63   
gb|ACB53567.1|  phosphoglycerate kinase                                 212   3e-63   
ref|WP_015173530.1|  phosphoglycerate kinase                            212   3e-63   
ref|WP_011343229.1|  phosphoglycerate kinase                            211   3e-63   
ref|WP_026097925.1|  phosphoglycerate kinase                            212   3e-63   
ref|WP_013150545.1|  phosphoglycerate kinase                            211   3e-63   
ref|WP_012995536.1|  phosphoglycerate kinase                            211   4e-63   
ref|WP_028992663.1|  phosphoglycerate kinase                            211   4e-63   
ref|WP_040940054.1|  phosphoglycerate kinase                            211   4e-63   
ref|WP_010471014.1|  phosphoglycerate kinase                            211   4e-63   
ref|WP_025980178.1|  phosphoglycerate kinase                            204   4e-63   
ref|WP_040931032.1|  phosphoglycerate kinase                            211   4e-63   
ref|WP_011142310.1|  phosphoglycerate kinase                            211   5e-63   
ref|WP_012161281.1|  phosphoglycerate kinase                            211   5e-63   
ref|XP_011401929.1|  Phosphoglycerate kinase, cytosolic                 219   6e-63   
ref|WP_015044861.1|  MULTISPECIES: phosphoglycerate kinase              211   6e-63   
emb|CDY49746.1|  BnaA02g19260D                                          211   7e-63   
ref|WP_008189591.1|  phosphoglycerate kinase                            211   7e-63   
emb|CBN79775.1|  Phosphoglycerate kinase                                213   8e-63   
ref|WP_017300589.1|  phosphoglycerate kinase                            211   8e-63   
ref|WP_030007016.1|  phosphoglycerate kinase                            211   8e-63   
ref|WP_012307199.1|  phosphoglycerate kinase                            211   9e-63   
ref|WP_017289328.1|  phosphoglycerate kinase                            211   9e-63   
ref|WP_015167138.1|  phosphoglycerate kinase                            211   9e-63   
ref|WP_026789199.1|  phosphoglycerate kinase                            210   1e-62   
gb|AAK40345.1|  phosphoglycerate kinase                                 212   1e-62   
ref|WP_025980855.1|  phosphoglycerate kinase                            204   1e-62   
ref|WP_012546923.1|  phosphoglycerate kinase                            210   1e-62   
ref|WP_014560136.1|  phosphoglycerate kinase                            210   1e-62   
ref|XP_005715401.1|  unnamed protein product                            212   1e-62   
ref|XP_011396717.1|  Phosphoglycerate kinase, chloroplastic             211   2e-62   
emb|CEF98237.1|  Phosphoglycerate kinase, conserved site                209   2e-62   
ref|WP_014455673.1|  phosphoglycerate kinase                            209   2e-62   
ref|WP_009623623.1|  phosphoglycerate kinase                            209   2e-62   
ref|WP_015119342.1|  phosphoglycerate kinase                            209   3e-62   
ref|WP_023068245.1|  phosphoglycerate kinase                            209   3e-62   
ref|WP_012412172.1|  phosphoglycerate kinase                            209   3e-62   
ref|XP_002296699.1|  phosphoglycerate kinase precursor                  209   3e-62   
ref|WP_022483437.1|  phosphoglycerate kinase                            209   3e-62   
ref|XP_001776160.1|  predicted protein                                  211   3e-62   
ref|XP_005821497.1|  phosphoglycerate kinase, plastid-targeted          211   4e-62   
ref|WP_006626244.1|  MULTISPECIES: phosphoglycerate kinase              209   4e-62   
ref|WP_013276604.1|  phosphoglycerate kinase                            209   4e-62   
ref|WP_025951358.1|  phosphoglycerate kinase                            204   5e-62   
ref|XP_005851590.1|  hypothetical protein CHLNCDRAFT_29609              209   5e-62   
ref|WP_032517310.1|  phosphoglycerate kinase                            208   6e-62   
ref|WP_023175125.1|  phosphoglycerate kinase                            209   6e-62   
ref|XP_005646469.1|  phosphoglycerate kinase precursor                  209   7e-62   
gb|AAT07576.1|  putative chloroplast phosphoglycerate kinase            205   9e-62   
ref|WP_025747855.1|  phosphoglycerate kinase                            207   9e-62   
emb|CDX88547.1|  BnaC06g39910D                                          206   1e-61   
ref|XP_003059407.1|  predicted protein                                  208   1e-61   
ref|WP_007304168.1|  phosphoglycerate kinase                            207   1e-61   
ref|WP_007309560.1|  phosphoglycerate kinase                            207   1e-61   
ref|WP_018212134.1|  phosphoglycerate kinase                            207   1e-61   
ref|WP_011341056.1|  phosphoglycerate kinase                            207   1e-61   
ref|WP_015145174.1|  phosphoglycerate kinase                            207   1e-61   
dbj|BAG09537.1|  phosphoglycerate kinase                                209   1e-61   
ref|WP_032523967.1|  phosphoglycerate kinase                            207   1e-61   
ref|WP_015359732.1|  phosphoglycerate kinase [                          207   2e-61   
ref|WP_015263720.1|  phosphoglycerate kinase                            207   2e-61   
ref|WP_016482862.1|  phosphoglycerate kinase                            207   2e-61   
ref|WP_011876527.1|  phosphoglycerate kinase                            207   2e-61   
ref|WP_009786889.1|  phosphoglycerate kinase                            207   3e-61   
ref|WP_003870199.1|  MULTISPECIES: phosphoglycerate kinase              206   3e-61   
ref|WP_004402126.1|  MULTISPECIES: phosphoglycerate kinase              206   3e-61   
ref|WP_035399540.1|  phosphoglycerate kinase                            206   3e-61   
ref|WP_035992253.1|  phosphoglycerate kinase                            206   3e-61   
ref|WP_035214477.1|  phosphoglycerate kinase                            206   4e-61   
emb|CDX04982.1|  Phosphoglycerate kinase                                206   4e-61   
gb|EHL05013.1|  phosphoglycerate kinase                                 206   5e-61   
gb|EWM26113.1|  phosphoglycerate kinase                                 207   5e-61   
ref|WP_011375763.1|  phosphoglycerate kinase                            206   5e-61   
ref|WP_035248630.1|  phosphoglycerate kinase                            206   6e-61   
ref|WP_041272149.1|  phosphoglycerate kinase                            206   6e-61   
gb|ACL22713.1|  Phosphoglycerate kinase                                 206   6e-61   
ref|WP_006507734.1|  phosphoglycerate kinase                            206   6e-61   
ref|WP_025955128.1|  MULTISPECIES: phosphoglycerate kinase              206   7e-61   
ref|WP_041272950.1|  phosphoglycerate kinase                            205   8e-61   
dbj|BAE86630.1|  hypothetical protein                                   205   8e-61   
ref|WP_006620004.1|  phosphoglycerate kinase                            206   8e-61   
gb|ABH04835.1|  phosphoglycerate kinase                                 205   9e-61   
ref|WP_025921366.1|  phosphoglycerate kinase                            206   9e-61   
ref|WP_025945011.1|  phosphoglycerate kinase                            203   1e-60   
gb|KJB14020.1|  hypothetical protein B456_002G107200                    204   1e-60   
ref|WP_025960818.1|  phosphoglycerate kinase                            205   1e-60   
ref|WP_025971650.1|  phosphoglycerate kinase                            205   1e-60   
ref|WP_032526506.1|  phosphoglycerate kinase                            205   1e-60   
ref|WP_014254443.1|  phosphoglycerate kinase [                          205   1e-60   
ref|WP_013121535.1|  phosphoglycerate kinase                            205   1e-60   
ref|WP_015759304.1|  phosphoglycerate kinase                            205   1e-60   
ref|WP_028947361.1|  phosphoglycerate kinase                            205   1e-60   
ref|WP_032519696.1|  phosphoglycerate kinase                            205   1e-60   
ref|WP_027622719.1|  phosphoglycerate kinase [                          205   1e-60   
ref|WP_025924106.1|  phosphoglycerate kinase                            205   2e-60   
ref|XP_005709175.1|  phosphoglycerate kinase                            207   2e-60   
ref|WP_014905210.1|  phosphoglycerate kinase                            204   2e-60   
ref|WP_041765481.1|  phosphoglycerate kinase                            204   2e-60   
ref|WP_042849696.1|  phosphoglycerate kinase                            204   2e-60   
ref|WP_017551319.1|  phosphoglycerate kinase                            204   2e-60   
ref|WP_013860188.1|  phosphoglycerate kinase                            204   2e-60   
ref|WP_026487158.1|  phosphoglycerate kinase                            204   2e-60   
sp|P74421.2|PGK_SYNY3  RecName: Full=Phosphoglycerate kinase            204   2e-60   
ref|WP_018132099.1|  phosphoglycerate kinase                            204   3e-60   
ref|WP_012007002.1|  phosphoglycerate kinase                            204   3e-60   
gb|AFY38465.1|  phosphoglycerate kinase                                 204   3e-60   
ref|WP_025934740.1|  phosphoglycerate kinase                            204   3e-60   
ref|WP_025932306.1|  phosphoglycerate kinase                            204   3e-60   
ref|WP_014759315.1|  MULTISPECIES: phosphoglycerate kinase              204   3e-60   
ref|WP_025963501.1|  phosphoglycerate kinase                            204   4e-60   
ref|WP_025925003.1|  MULTISPECIES: phosphoglycerate kinase              204   4e-60   
ref|XP_001777571.1|  predicted protein                                  204   4e-60   
emb|CBI24183.3|  unnamed protein product                                202   4e-60   
ref|WP_025893926.1|  phosphoglycerate kinase                            204   4e-60   
ref|WP_025922089.1|  MULTISPECIES: phosphoglycerate kinase              204   4e-60   
ref|WP_025913196.1|  MULTISPECIES: phosphoglycerate kinase              204   4e-60   
ref|WP_025933014.1|  phosphoglycerate kinase                            204   4e-60   
ref|WP_006569976.1|  phosphoglycerate kinase                            203   4e-60   
ref|WP_025937957.1|  phosphoglycerate kinase                            204   4e-60   
ref|WP_014063090.1|  phosphoglycerate kinase                            203   4e-60   
ref|WP_025965230.1|  phosphoglycerate kinase                            204   4e-60   
ref|WP_013485438.1|  phosphoglycerate kinase                            203   4e-60   
ref|WP_025927303.1|  MULTISPECIES: phosphoglycerate kinase              204   5e-60   
ref|WP_022182979.1|  phosphoglycerate kinase                            203   5e-60   
ref|WP_003540618.1|  MULTISPECIES: phosphoglycerate kinase              203   5e-60   
ref|WP_025962791.1|  phosphoglycerate kinase                            203   5e-60   
ref|WP_011817688.1|  MULTISPECIES: phosphoglycerate kinase              203   5e-60   
ref|WP_023076270.1|  phosphoglycerate kinase                            203   6e-60   
ref|WP_011819547.1|  phosphoglycerate kinase                            203   6e-60   
ref|WP_025968960.1|  phosphoglycerate kinase                            203   7e-60   
ref|WP_025934229.1|  phosphoglycerate kinase                            203   7e-60   
emb|CDX67989.1|  BnaA07g20290D                                          201   8e-60   
ref|XP_006359791.1|  PREDICTED: uncharacterized protein LOC102577647    211   8e-60   
ref|WP_010873144.1|  phosphoglycerate kinase                            203   9e-60   
ref|WP_025937298.1|  phosphoglycerate kinase                            203   9e-60   
ref|WP_042833404.1|  phosphoglycerate kinase                            202   9e-60   
ref|WP_017872268.1|  phosphoglycerate kinase                            202   9e-60   
ref|WP_013787604.1|  phosphoglycerate kinase                            202   9e-60   
ref|WP_025922800.1|  phosphoglycerate kinase                            203   1e-59   
ref|WP_025906011.1|  MULTISPECIES: phosphoglycerate kinase              203   1e-59   
ref|WP_034842773.1|  phosphoglycerate kinase [                          208   1e-59   
gb|AIS52787.1|  phosphoglycerate kinase Pgk                             202   1e-59   
ref|WP_025927908.1|  phosphoglycerate kinase                            202   1e-59   
ref|WP_013779025.1|  phosphoglycerate kinase                            202   1e-59   
ref|WP_025943564.1|  MULTISPECIES: phosphoglycerate kinase              202   1e-59   
ref|WP_012598967.1|  phosphoglycerate kinase                            202   1e-59   
ref|WP_015224558.1|  phosphoglycerate kinase                            202   1e-59   
ref|WP_006456361.1|  phosphoglycerate kinase                            202   2e-59   
ref|WP_014097473.1|  phosphoglycerate kinase                            202   2e-59   
ref|WP_032515804.1|  phosphoglycerate kinase                            202   2e-59   
ref|WP_007787478.1|  phosphoglycerate kinase                            202   2e-59   
ref|WP_029142774.1|  phosphoglycerate kinase                            202   2e-59   
ref|WP_006515662.1|  phosphoglycerate kinase                            202   2e-59   
ref|WP_015184203.1|  phosphoglycerate kinase                            202   2e-59   
ref|WP_017303631.1|  phosphoglycerate kinase                            201   3e-59   
ref|WP_017294263.1|  phosphoglycerate kinase                            201   3e-59   
ref|WP_024125258.1|  phosphoglycerate kinase                            201   3e-59   
gb|ADI87680.1|  phosphoglycerate kinase                                 201   3e-59   
ref|WP_022412440.1|  phosphoglycerate kinase                            201   3e-59   
gb|AAP79195.1|  phosphoglycerate kinase 1                               203   3e-59   
dbj|GAE88155.1|  phosphoglycerate kinase [ [                            201   3e-59   
ref|WP_017888984.1|  phosphoglycerate kinase                            201   4e-59   
ref|WP_008311068.1|  phosphoglycerate kinase                            201   4e-59   
ref|WP_015785332.1|  MULTISPECIES: phosphoglycerate kinase              201   4e-59   
ref|WP_013298468.1|  phosphoglycerate kinase                            201   4e-59   
ref|WP_032514621.1|  phosphoglycerate kinase                            201   4e-59   
ref|WP_015312128.1|  phosphoglycerate kinase                            201   5e-59   
ref|WP_011025957.1|  phosphoglycerate kinase                            201   5e-59   
ref|WP_034601689.1|  phosphoglycerate kinase                            200   6e-59   
ref|WP_011879284.1|  phosphoglycerate kinase                            200   7e-59   
ref|WP_036484843.1|  phosphoglycerate kinase                            200   7e-59   
ref|WP_014624636.1|  phosphoglycerate kinase                            200   7e-59   
ref|WP_041737991.1|  phosphoglycerate kinase                            200   8e-59   
ref|WP_015124821.1|  phosphoglycerate kinase                            200   8e-59   
ref|WP_013321558.1|  phosphoglycerate kinase                            200   8e-59   
ref|WP_008234716.1|  phosphoglycerate kinase                            200   8e-59   
gb|ACF24541.1|  phosphoglycerate kinase 1                               199   8e-59   
ref|WP_025929681.1|  phosphoglycerate kinase                            200   8e-59   
ref|WP_027842190.1|  phosphoglycerate kinase                            200   8e-59   
ref|WP_021328183.1|  phosphoglycerate kinase                            200   9e-59   
ref|WP_002806351.1|  phosphoglycerate kinase                            200   1e-58   
ref|WP_009769345.1|  phosphoglycerate kinase                            200   1e-58   
ref|WP_027714084.1|  phosphoglycerate kinase                            200   1e-58   
ref|WP_022587093.1|  phosphoglycerate kinase                            200   1e-58   
ref|WP_011862240.1|  phosphoglycerate kinase                            200   1e-58   
ref|WP_038547249.1|  phosphoglycerate kinase                            200   1e-58   
ref|WP_004162197.1|  phosphoglycerate kinase                            200   1e-58   
ref|WP_029917892.1|  phosphoglycerate kinase                            199   1e-58   
ref|WP_006000743.1|  phosphoglycerate kinase                            199   2e-58   
ref|WP_015049826.1|  phosphoglycerate kinase                            199   2e-58   
ref|WP_039763984.1|  phosphoglycerate kinase                            199   2e-58   
ref|WP_008206385.1|  phosphoglycerate kinase                            199   2e-58   
ref|WP_028991098.1|  phosphoglycerate kinase                            199   2e-58   
ref|WP_036922086.1|  phosphoglycerate kinase                            199   2e-58   



>gb|KCW71392.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=304

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVGSLKEADLKGKRVFVRVDLNVPLDD   ITDDTR+RAAVPTIKYL  +GA VI
Sbjct  1    MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHGAIVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVKMANDCIGEEVVK+VAE P+GGV+LLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVVKLVAETPEGGVILLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|KCW71391.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=378

 Score =   300 bits (769),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVGSLKEADLKGKRVFVRVDLNVPLDD   ITDDTR+RAAVPTIKYL  +GA VI
Sbjct  1    MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHGAIVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVKMANDCIGEEVVK+VAE P+GGV+LLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVVKLVAETPEGGVILLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_004139837.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 ref|XP_004159164.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cucumis sativus]
 gb|KGN44288.1| hypothetical protein Csa_7G239010 [Cucumis sativus]
Length=401

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVG+LKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTI+YL  +GARVI
Sbjct  1    MATKKSVGTLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIQYLLSHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV KMVAE+P+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGLQVVMANDCIGEEVEKMVAELPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_010064085.1| PREDICTED: phosphoglycerate kinase, cytosolic [Eucalyptus grandis]
 gb|KCW71390.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=401

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVGSLKEADLKGKRVFVRVDLNVPLDD   ITDDTR+RAAVPTIKYL  +GA VI
Sbjct  1    MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHGAIVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVKMANDCIGEEVVK+VAE P+GGV+LLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVVKLVAETPEGGVILLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|ACJ11718.1| phosphoglycerate kinase [Gossypium hirsutum]
 gb|KHG14087.1| Phosphoglycerate kinase, cytosolic [Gossypium arboreum]
Length=401

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVG LKEADLKGK+VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +G++VI
Sbjct  1    MATKKSVGDLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGSKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG EVKMANDCIGEEV KMVA +PDGGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_008447095.1| PREDICTED: phosphoglycerate kinase, cytosolic [Cucumis melo]
Length=401

 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTI+YL  +GARVI
Sbjct  1    MATKRSVGTLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIQYLLSHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV KMVAE+P+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGLQVIMANDCIGEEVEKMVAELPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_010557291.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=432

 Score =   300 bits (768),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTI YL QNGARVI
Sbjct  32   MATKRSVGTLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTISYLMQNGARVI  91

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG EVKMANDCIGEEV  +V  +P+GGVLLLEN
Sbjct  92   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVENLVVALPEGGVLLLEN  151

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  152  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  191



>gb|ACU18322.1| unknown [Glycine max]
Length=233

 Score =   292 bits (748),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKE DLKGKRVFVRVDLNVPLDD+L ITDDTR+RAAVPTIKYLT +GA+VI
Sbjct  1    MATKRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLS+LLG EV MAND IGEEV K+VA++P+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSQLLGIEVTMANDSIGEEVEKLVAQLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_011095716.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095717.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095718.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
Length=401

 Score =   298 bits (763),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 155/160 (97%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVGSLKEADLKGKRV VRVDLNVPLDD+LKITDDTRIRAAVPTIKYL ++GA+VI
Sbjct  1    MATKKSVGSLKEADLKGKRVLVRVDLNVPLDDNLKITDDTRIRAAVPTIKYLMEHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L++HLGRPKGVTPKYSLKPLVPRLSELLG EVKMA+DCIGEEV K+VA +P+GGVLLLEN
Sbjct  61   LTTHLGRPKGVTPKYSLKPLVPRLSELLGLEVKMADDCIGEEVEKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_010544342.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Tarenaya 
hassleriana]
Length=401

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGKRVFVRVDLNVPLD+   ITDDTRIRAAVPTI YL QNGARVI
Sbjct  1    MATKRSVGTLKEADLKGKRVFVRVDLNVPLDESFNITDDTRIRAAVPTINYLIQNGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELL  EVKMANDCIGEEV K+VA +PDGGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLCIEVKMANDCIGEEVEKLVAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLANLADLYVNDAFGTAHRAHAST  160



>gb|KDP25066.1| hypothetical protein JCGZ_22601 [Jatropha curcas]
Length=401

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKEADLKGKRVFVRVDLNVPLDD+L ITDDTRIRAAVPTIKYL  +GARVI
Sbjct  1    MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLRDHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L++HLGRPKGVTPKYSLKPLVPRLSELLG EVKMANDCIGEEV K+VAEIP+GGVLLLEN
Sbjct  61   LATHLGRPKGVTPKYSLKPLVPRLSELLGIEVKMANDCIGEEVEKLVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLADVYVNDAFGTAHRAHAST  160



>ref|XP_011086347.1| PREDICTED: phosphoglycerate kinase, cytosolic [Sesamum indicum]
Length=401

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVGSLKEADLKGKRVFVRVDLNVPLDD   ITDDTRIRAAVPTIKYL  +GA+VI
Sbjct  1    MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDTFHITDDTRIRAAVPTIKYLIDHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG EV++ANDCIGEEV K+VA +P+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVRVANDCIGEEVEKLVASLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|ADV16380.1| cytosolic phosphoglycerate kinase 2 [Helianthus annuus]
Length=400

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKEADLKGKRVFVR DLNVPLDD  KITDDTRIRAAVPTIKYL  NGARVI
Sbjct  1    MATKKSVSSLKEADLKGKRVFVRADLNVPLDDTFKITDDTRIRAAVPTIKYLMSNGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG EVKMA+DC+G EV K+VA IP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMADDCVGPEVEKLVAGIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_011016588.1| PREDICTED: phosphoglycerate kinase, cytosolic [Populus euphratica]
Length=401

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +GARVI
Sbjct  1    MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG +VKMANDCIG EVVK+VAEIP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVVKIVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLA++YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHAST  160



>gb|ACJ84593.1| unknown [Medicago truncatula]
Length=226

 Score =   290 bits (743),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEA+LKGKRVFVRVDLNVPLDD+L ITDDTRIRAAVPTIKYLT  GA+VI
Sbjct  1    MATKRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG +VK+A+D IGEEV K+VA+IP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGTQVKIADDSIGEEVEKLVAQIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|EYU33791.1| hypothetical protein MIMGU_mgv1a006853mg [Erythranthe guttata]
Length=429

 Score =   297 bits (761),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVGSLKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  N A+VI
Sbjct  1    MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLIGNAAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG EVKMANDCIGEEV K+VA +P+GGV+LLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGLEVKMANDCIGEEVEKLVAGLPEGGVILLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|KJB14019.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14021.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14022.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14023.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14024.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=401

 Score =   296 bits (758),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVG LKEADLKGK+VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +G++VI
Sbjct  1    MATKKSVGDLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGSKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELL  EVKMANDCIGEEV KMVA +PDGGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLEVEVKMANDCIGEEVEKMVAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_002312237.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
 gb|EEE89604.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
Length=401

 Score =   296 bits (757),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +GARVI
Sbjct  1    MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG +VKMANDCIG EV K+VAEIP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLA++YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHAST  160



>gb|ABK92531.1| unknown [Populus trichocarpa]
Length=401

 Score =   296 bits (757),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +GARVI
Sbjct  1    MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG +VKMANDCIG EV K+VAEIP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLA++YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHAST  160



>ref|XP_010324204.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
 ref|XP_010324205.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
Length=401

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA KKSVGSLKEADLKGKRVFVRVDLNVPLDD+ KITDDTRIRAAVPTIKYL QNGARVI
Sbjct  1    MAVKKSVGSLKEADLKGKRVFVRVDLNVPLDDNFKITDDTRIRAAVPTIKYLMQNGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVKMAND +G EV  +VA +P+GGV+LLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGIEVKMANDSVGPEVENLVAGLPEGGVVLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_009777860.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
sylvestris]
Length=401

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA KKSVGSLKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL Q+G+ VI
Sbjct  1    MAVKKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHGSHVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVKMA+DCIG EV K+VAEIP+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGLEVKMADDCIGPEVEKLVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|AAO63774.1| 3-phosphoglycerate kinase [Populus tremuloides]
Length=401

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +GARVI
Sbjct  1    MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG +VKMANDCIG EV K+VAEIP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLA++YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHAST  160



>ref|XP_002263950.1| PREDICTED: phosphoglycerate kinase, cytosolic [Vitis vinifera]
 emb|CAN81988.1| hypothetical protein VITISV_000723 [Vitis vinifera]
Length=401

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG LKEADLKGKRVFVRVDLNVPLD+ LKITDDTR+RAAVPTIKYL  +GA+VI
Sbjct  1    MATKRSVGDLKEADLKGKRVFVRVDLNVPLDESLKITDDTRVRAAVPTIKYLMGHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVKMANDCIGEEV  +VA+IP+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVKILVAKIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_007149209.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 ref|XP_007149210.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21203.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21204.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
Length=401

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKE DLKGKRVFVRVDLNVPLDD+L ITDDTR+RAAVPTIKYLT  GA+VI
Sbjct  1    MATKRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGYGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLS+LLG EVK+ANDCIGEEV K+VA +P+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSQLLGIEVKIANDCIGEEVEKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADVYVNDAFGTAHRAHAST  160



>emb|CDP16886.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   295 bits (754),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVGSLKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +GA+VI
Sbjct  1    MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLIGHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLV RLSELLG EVKMA+DCIGE+V K+VA +P+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVGRLSELLGVEVKMADDCIGEQVEKLVATLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_003531483.1| PREDICTED: phosphoglycerate kinase, cytosolic [Glycine max]
 gb|KHN21385.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   294 bits (753),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKE DLKGKRVFVRVDLNVPLDD+L ITDDTR+RAAVPTIKYLT +GA+VI
Sbjct  1    MATKRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLS+LLG EV MAND IGEEV K+VA++P+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSQLLGIEVTMANDSIGEEVEKLVAQLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|KDO61597.1| hypothetical protein CISIN_1g040813mg [Citrus sinensis]
Length=401

 Score =   294 bits (753),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA KKSV  LKEADLKGKRVFVRVDLNVPLDD+L ITDD R+RAAVPTIKYL  +GA+VI
Sbjct  1    MAAKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG EVKMANDCIGEEV KMVAEIP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLADLYVNDAFG+AHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHAST  160



>ref|XP_006422250.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
 ref|XP_006493790.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Citrus sinensis]
 gb|ESR35490.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
Length=401

 Score =   294 bits (753),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA KKSV  LKEADLKGKRVFVRVDLNVPLDD+L ITDD R+RAAVPTIKYL  +GA+VI
Sbjct  1    MAAKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG EVKMANDCIGEEV KMVAEIP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLADLYVNDAFG+AHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHAST  160



>ref|XP_008805982.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
 ref|XP_008776888.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=400

 Score =   294 bits (752),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SV +LKEADLKGKRVFVRVDLNVPLDD L ITDD RIRAAVPTIKYL  +GARVI
Sbjct  1    MATKRSVSTLKEADLKGKRVFVRVDLNVPLDDSLNITDDNRIRAAVPTIKYLMDHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG  V+MANDCIGEEV KMVA +P+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVSVEMANDCIGEEVEKMVAALPNGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_007022579.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022580.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022581.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14104.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14105.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14106.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
Length=401

 Score =   294 bits (752),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVG+LKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +G++VI
Sbjct  1    MATKKSVGALKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGSKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG EVKMANDCIG EV K+VAEIPDGGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGAEVEKLVAEIPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKN PEFAKKLASLAD+YVNDAFGTAHR HAST
Sbjct  121  VRFYKEEEKNVPEFAKKLASLADVYVNDAFGTAHRPHAST  160



>ref|XP_010936568.1| PREDICTED: phosphoglycerate kinase, cytosolic [Elaeis guineensis]
Length=401

 Score =   293 bits (751),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SV +L EADLKGKRVFVRVDLNVPLDD+LKITDDTRIRAAVPTI+YL   GARVI
Sbjct  1    MATKRSVSTLTEADLKGKRVFVRVDLNVPLDDNLKITDDTRIRAAVPTIEYLMDRGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG  V+MANDCIGEEV KMVA +PDGGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVNVEMANDCIGEEVEKMVAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDP FAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPAFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|ABI18157.1| cytosolic phosphoglycerate kinase [Helianthus annuus]
Length=401

 Score =   293 bits (750),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SL E DLKGKRVFVRVDLNVPLDD  KITDDTRIRAAVPTIKYL  +GARVI
Sbjct  1    MATKKSVSSLTEGDLKGKRVFVRVDLNVPLDDTFKITDDTRIRAAVPTIKYLMSHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPK+SLKPLVPRLSELLG EVKMA+DCIG +V K+VAEIP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKFSLKPLVPRLSELLGIEVKMADDCIGPDVEKLVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_004488762.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cicer arietinum]
Length=401

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKE DLKGK+VFVRVDLNVPLDD+L ITDDTRIRAAVPTIKYL+  GA+VI
Sbjct  1    MATKRSVGTLKEGDLKGKKVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLSGFGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG EVK+A+DCIGEEV K+VA+IP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGIEVKIADDCIGEEVEKLVAQIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>dbj|BAA33801.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +GARVI
Sbjct  1    MATKKSVSSLKEADLKGKSVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG +VKMANDCIG EV K+VAEIP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLA++YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHAST  160



>ref|XP_010275944.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nelumbo nucifera]
Length=402

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG LKEADLKGK+VFVRVDLNVPLD++LKITDDTR+RAAVPTIKYL  + A+VI
Sbjct  1    MATKRSVGDLKEADLKGKKVFVRVDLNVPLDENLKITDDTRVRAAVPTIKYLMGHKAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG +V+MANDCIGEEV K+VA IP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGIQVEMANDCIGEEVEKLVAAIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_011468861.1| PREDICTED: phosphoglycerate kinase, cytosolic [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SV +LKEADLKGKRVFVRVDLNVPLD+  KITDDTRIRAAVPTIKYL  NGA+VI
Sbjct  1    MATKRSVSTLKEADLKGKRVFVRVDLNVPLDESCKITDDTRIRAAVPTIKYLQGNGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVK+ANDC+GEEV K+VA +P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCVGEEVEKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADVYVNDAFGTAHRAHAST  160



>ref|NP_001275451.1| phosphoglycerate kinase, cytosolic-like [Solanum tuberosum]
 gb|ABB87110.1| unknown [Solanum tuberosum]
Length=401

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA KKSVGSLKEADLKGKRVFVRVDLNVPLDD   ITDDTRIRAAVPTIKYL QNGARVI
Sbjct  1    MAVKKSVGSLKEADLKGKRVFVRVDLNVPLDDIFNITDDTRIRAAVPTIKYLMQNGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELL  EVKMAND IG EV  +VAE+P+GGV+LLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLAIEVKMANDSIGPEVENLVAELPEGGVVLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|AAF85975.1|AF275639_1 cytosolic phosphoglycerate kinase [Pisum sativum]
Length=401

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGKRVFVRVDLNVPLDD+L ITDDTRIRAA+PTIKYLT  GA+VI
Sbjct  1    MATKRSVGTLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAIPTIKYLTGYGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG+EV +A D IGEEV K+VA+IP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGSEVTIAGDSIGEEVEKLVAQIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_003546821.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Glycine max]
 gb|KHN48876.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKE DLKGKRVFVRVDLNVPLDD+L ITDDTR+RAAVPTIKYLT  GA+VI
Sbjct  1    MATKRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGYGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLS+LLG EV MAND IGEEV K+V ++P+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSQLLGIEVTMANDSIGEEVEKLVTQLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_009417722.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417729.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG LKE DLKGKRVFVRVDLNVPLDD  KITDDTR+RAAVPTIK L ++GARVI
Sbjct  1    MATKRSVGDLKEDDLKGKRVFVRVDLNVPLDDSQKITDDTRVRAAVPTIKSLMEHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG +V+MANDCIGEEV KMVA +PDGGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVDVEMANDCIGEEVEKMVAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_009791377.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana sylvestris]
Length=401

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA KKSVGSLKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL Q+G+ VI
Sbjct  1    MAVKKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHGSHVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVK+AND IG EV K+VAEIP+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDSIGPEVEKLVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_002513352.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48755.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=401

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKEADLKGKRVFVRVDLNVPLDD+L ITDDTRIRAAVPTIKYL  +GARVI
Sbjct  1    MATKKSVSSLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLMDHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L +HLGRPKGVTPKYSLKPLVPRLSELLG EVKMA+DCIGEEV K+VAEIP+GGVLLLEN
Sbjct  61   LCTHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMASDCIGEEVEKLVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKN+PEFAKKLA LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNEPEFAKKLAGLADVYVNDAFGTAHRAHAST  160



>ref|XP_003596092.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66343.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score =   291 bits (746),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEA+LKGKRVFVRVDLNVPLDD+L ITDDTRIRAAVPTIKYLT  GA+VI
Sbjct  1    MATKRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG +VK+A+D IGEEV K+VA+IP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGTQVKIADDSIGEEVEKLVAQIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|AFK46712.1| unknown [Medicago truncatula]
Length=401

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEA+LKGKRVFVRVDLNVPLDD+L ITDDTRIRAAVPTIKYLT  GA+VI
Sbjct  1    MATKRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG +VK+A+D IGEEV K+VA+IP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGTQVKIADDSIGEEVEKLVAQIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_002315067.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
 gb|EEF01238.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
Length=401

 Score =   291 bits (745),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKE DLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +GARVI
Sbjct  1    MATKKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG EVK+ANDCIGEEV K+VAEIP GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAEIPGGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLA++YVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHAST  160



>ref|XP_008383158.1| PREDICTED: phosphoglycerate kinase, cytosolic [Malus domestica]
Length=401

 Score =   291 bits (745),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV +LKEA+LKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +GA+VI
Sbjct  1    MATKKSVSTLKEAELKGKRVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLLGHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVK+ANDCIGEEV K+VA++P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGLEVKIANDCIGEEVEKLVAQLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADVYVNDAFGTAHRAHAST  160



>ref|XP_008798227.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=401

 Score =   291 bits (744),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SV +L  ADLKGK+VFVRVDLNVPLDD+LKITDDTR+RAAVPTIKYL Q+GA+VI
Sbjct  1    MATKRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMQHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELLG  V+MA+DCIGE V KMVA +PDGGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLGVNVEMADDCIGEGVQKMVAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_007213914.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
 gb|EMJ15113.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
Length=449

 Score =   292 bits (747),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SV +LKEA+LKGKRVFVRVDLNVPLDD+ KITDDTR+RAAVPTIKYL  +GA+VI
Sbjct  49   MATKRSVSTLKEAELKGKRVFVRVDLNVPLDDNSKITDDTRVRAAVPTIKYLQGHGAKVI  108

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVK+ANDCIGEEV K+VA++PDGGVLLLEN
Sbjct  109  LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAQLPDGGVLLLEN  168

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEF+KKLASLAD+YVNDAFGTAHRAHAST
Sbjct  169  VRFYKEEEKNDPEFSKKLASLADVYVNDAFGTAHRAHAST  208



>ref|XP_008226131.1| PREDICTED: phosphoglycerate kinase, cytosolic [Prunus mume]
Length=401

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SV +LKEA+LKGKRVFVRVDLNVPLDD+ KITDDTR+RAAVPTIKYL  +GA+VI
Sbjct  1    MATKRSVSTLKEAELKGKRVFVRVDLNVPLDDNSKITDDTRVRAAVPTIKYLQGHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVK+ANDCIGEEV K+VA++P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAQLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEF+KKLASLAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFSKKLASLADVYVNDAFGTAHRAHAST  160



>ref|XP_009607754.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana tomentosiformis]
 sp|Q42962.1|PGKY_TOBAC RecName: Full=Phosphoglycerate kinase, cytosolic [Nicotiana tabacum]
 emb|CAA88840.1| phosphoglycerate kinase (PGK) [Nicotiana tabacum]
Length=401

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA KKSVGSLKEADLKGKRVFVRVDLNVPLD++  ITDDTRIRAAVPTIKYL Q+G+ VI
Sbjct  1    MAVKKSVGSLKEADLKGKRVFVRVDLNVPLDENFNITDDTRIRAAVPTIKYLMQHGSHVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EVK+AND IG EV K+VAEIP+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDSIGPEVEKLVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_011013882.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Populus euphratica]
Length=401

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKE DLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +GARVI
Sbjct  1    MATKKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG EVK+ANDCIGEEV K+VAEIP GG LLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAEIPGGGALLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLA++YVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHAST  160



>dbj|BAA33802.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKE DLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPT+KYL  +GARVI
Sbjct  1    MATKKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTVKYLMDHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG EVK+ANDCIGEEV K+VAEIP GGV+LLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAEIPGGGVVLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLA++YVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHAST  160



>ref|XP_011013868.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
 ref|XP_011013875.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
Length=429

 Score =   290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSV SLKE DLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  +GARVI
Sbjct  1    MATKKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG EVK+ANDCIGEEV K+VAEIP GG LLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAEIPGGGALLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLA++YVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHAST  160



>gb|EPS64076.1| phosphoglycerate kinase [Genlisea aurea]
Length=401

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVGSLKEADLKGKRV VRVDLNVPLDD+  ITDDTRIRAAVPTI YL  +GARVI
Sbjct  1    MATKKSVGSLKEADLKGKRVLVRVDLNVPLDDNFNITDDTRIRAAVPTINYLIGHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L++HLGRPKGVTPKYSLKPL+PRLS+LLG EV + NDCIGEEV K+VAE+PDGGV+LLEN
Sbjct  61   LTTHLGRPKGVTPKYSLKPLIPRLSQLLGVEVAITNDCIGEEVEKVVAELPDGGVVLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|ABF69999.1| phosphoglycerate kinase, putative [Musa acuminata]
Length=401

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVG+L EADLKGK+VFVRVDLNVPLD++LK+TDDTRIRA+VPTIKYL + GAR+I
Sbjct  1    MATKKSVGALTEADLKGKKVFVRVDLNVPLDENLKVTDDTRIRASVPTIKYLMERGARII  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKP+VPRLSELLG  V MANDCIG EV K+++ +PDGGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPVVPRLSELLGVNVAMANDCIGVEVEKLISALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_009399252.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   288 bits (737),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVG+L EADLKGK+VFVRVDLNVPLD+ LK+TDDTRIRA+VPTIKYL + GAR+I
Sbjct  1    MATKKSVGALTEADLKGKKVFVRVDLNVPLDETLKVTDDTRIRASVPTIKYLMERGARII  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKP+VPRLSELLG  V MANDCIG EV K+++ +PDGGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPVVPRLSELLGVNVAMANDCIGVEVEKLISALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_003596093.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66344.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score =   288 bits (736),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKE +LKGKRVFVRVDLNVPLDD+L ITDDTRIRAAVPTIKYLT  GA+VI
Sbjct  1    MATKRSVGTLKEGELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSLKPLVPRLSELL  +VK+++DCIGEEV K+VA+IP+GGVLLLEN
Sbjct  61   LSSHLGRPKGVTPKYSLKPLVPRLSELLETQVKISDDCIGEEVEKLVAQIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>gb|AFW70285.1| hypothetical protein ZEAMMB73_319281 [Zea mays]
Length=186

 Score =   280 bits (716),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+L EADLKGK+VFVR DLNVPLDD  KITDDTRIRA+VPTIK+L + GA+VI
Sbjct  1    MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EV MANDCIGEEV K+ A +P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDCIGEEVEKLAAALPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKN+PEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>gb|AIN39803.1| hypothetical protein, partial [Zoysia matrella]
Length=290

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVGSL EADLKGK+VFVR DLNVPLDD+ KITDDTRIRA+VPTIK+L + GA+V+
Sbjct  1    MATKRSVGSLGEADLKGKKVFVRADLNVPLDDNQKITDDTRIRASVPTIKFLLEKGAKVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV K+ A +P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>gb|AIZ68220.1| phosphoglycerate kinase [Ornithogalum saundersiae]
Length=401

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVGSLK ADLKGK+VFVRVDLNVPLDD+ KITDDTRIRAAVPTIKYL ++GAR+I
Sbjct  1    MATKKSVGSLKAADLKGKKVFVRVDLNVPLDDNQKITDDTRIRAAVPTIKYLMEHGARII  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG  V+MA+DCIGEEV K VA + DG VLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVNVEMADDCIGEEVEKKVAALKDGNVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_010941661.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X2 [Elaeis 
guineensis]
Length=401

 Score =   286 bits (731),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SV +L  ADLKGK+VFVRVDLNVPLDD+LKITDDTR+RAAVPTIKYL ++GA+VI
Sbjct  1    MATKRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMEHGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG  V+MA+DCIGE V KMV+ +PDGGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVNVEMADDCIGEGVQKMVSALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_010941660.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   286 bits (731),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SV +L  ADLKGK+VFVRVDLNVPLDD+LKITDDTR+RAAVPTIKYL ++GA+VI
Sbjct  9    MATKRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMEHGAKVI  68

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG  V+MA+DCIGE V KMV+ +PDGGVLLLEN
Sbjct  69   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVNVEMADDCIGEGVQKMVSALPDGGVLLLEN  128

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  129  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  168



>emb|CDP13576.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   285 bits (730),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATKKSVGSLKEADLKGK+VFVRVDLNVPLDD+  ITDDTRIRAAVPTI YL    A++I
Sbjct  1    MATKKSVGSLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTINYLIGCSAKII  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EV +ANDCIGEEV K+VA +P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVIIANDCIGEEVEKLVASLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRF+KEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFHKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_009106677.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
 ref|XP_009106678.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
Length=401

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAA+PTIKYL +NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAIPTIKYLMENGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPK+SLKPLVPRLSELLG EV MAND IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKFSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>ref|XP_009128369.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPK+SLKPLVPRLSELLG EV MAND IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKFSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>emb|CDX87375.1| BnaA07g34980D [Brassica napus]
Length=401

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPK+SLKPLVPRLSELLG EV MAND IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKFSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>ref|XP_010669985.1| PREDICTED: phosphoglycerate kinase, cytosolic [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SV +L+E+DLKGKRVFVRVDLNVPLDD+  ITDDTRIRAA+PTIKYL+  GA+VI
Sbjct  1    MATKRSVSTLQESDLKGKRVFVRVDLNVPLDDNCNITDDTRIRAAIPTIKYLSGYGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPK+SLKPLVPRLSELLG EVKMA D IGEEV KMVAE+P+GGV+LLEN
Sbjct  61   LCSHLGRPKGVTPKFSLKPLVPRLSELLGCEVKMAKDSIGEEVEKMVAELPEGGVVLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADVYVNDAFGTAHRAHAST  160



>emb|CDY70232.1| BnaC02g46710D [Brassica napus]
Length=401

 Score =   284 bits (727),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPK+SLKPLVPRLSELLG EV MAND IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKFSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>ref|XP_009414502.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG LK  DLKGKRVFVRVDLNVPLDD+LKITDDTR+RAAVPTIKYL ++GARVI
Sbjct  1    MATKRSVGDLKGDDLKGKRVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLLEHGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLS+LLG  V+MA+DCIGEEV K+VA +PDGGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSDLLGVNVEMADDCIGEEVEKIVAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFY+EEEKN PEFAKKLASLAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYREEEKNAPEFAKKLASLADVYVNDAFGTAHRAHAST  160



>ref|XP_006300323.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 ref|XP_006300324.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33221.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33222.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
Length=401

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG EV MAND IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAALPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFY EEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYTEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>ref|XP_009384174.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   283 bits (725),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG LKEAD+KGKRVFVRVDLNVPLD++LK+TDDTRIRA VPTIKYL + GAR+I
Sbjct  1    MATKRSVGDLKEADVKGKRVFVRVDLNVPLDENLKVTDDTRIRATVPTIKYLMERGARII  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKP+VPRLSELLG  V+MAND IGEEV K +A +P+GG++LLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPVVPRLSELLGVNVEMANDSIGEEVEKSIAALPNGGIVLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  160



>ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65512.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   283 bits (725),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG EV MAND IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFY EEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
Length=401

 Score =   283 bits (725),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG EV MAND IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFY EEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>ref|XP_006389877.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
 gb|ESQ27163.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
Length=401

 Score =   283 bits (725),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPK+SLKPLVPRLSELLG EV MAND +GEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKFSLKPLVPRLSELLGVEVVMANDTVGEEVQKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>ref|XP_006656354.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=401

 Score =   283 bits (725),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SV +L E+DLKGK+VFVR DLNVPLDD  KITDDTRIRA+VPTIKYL + GA+VI
Sbjct  1    MATKRSVSTLAESDLKGKKVFVRADLNVPLDDGQKITDDTRIRASVPTIKYLMEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG  V MANDCIGEEV K+ A +PDGGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVNVVMANDCIGEEVQKLAATLPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>ref|NP_178073.1| phosphoglycerate kinase [Arabidopsis thaliana]
 ref|NP_849907.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAD30221.1|AC007202_3 Is a member of the PF|00162 Phosphoglycerate kinase family. ESTs 
gb|N38721, gb|T22178, gb|R90345, gb|R90715, gb|T21140, gb|T46295, 
gb|H37082, gb|T46076, gb|N37132, gb|AA597649, gb|AI100648 
and gb|Z48462 come from this gene [Arabidopsis thaliana]
 gb|AAF70260.1|AF247560_1 cytosolic phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK15553.1|AF348582_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL32941.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37845.1| At1g79550 [Arabidopsis thaliana]
 gb|AEE36262.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE36263.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=401

 Score =   283 bits (725),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG EV MAND IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFY EEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>ref|NP_001142404.1| uncharacterized protein LOC100274579 [Zea mays]
 ref|XP_008681565.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 ref|XP_008681566.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 gb|ACF87897.1| unknown [Zea mays]
 gb|ACF88413.1| unknown [Zea mays]
 gb|ACG36709.1| phosphoglycerate kinase, cytosolic [Zea mays]
 gb|AFW70282.1| phosphoglycerate kinase isoform 1 [Zea mays]
 gb|AFW70283.1| phosphoglycerate kinase isoform 2 [Zea mays]
 gb|AFW70284.1| phosphoglycerate kinase isoform 3 [Zea mays]
Length=402

 Score =   283 bits (724),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+L EADLKGK+VFVR DLNVPLDD  KITDDTRIRA+VPTIK+L + GA+VI
Sbjct  1    MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG EV MANDCIGEEV K+ A +P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDCIGEEVEKLAAALPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKN+PEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>ref|XP_003570108.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brachypodium distachyon]
Length=401

 Score =   283 bits (724),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+L EADLKGK+VFVR DLNVPLDD  KITDDTRIRA+VPTIK+L + GA+VI
Sbjct  1    MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPK+SLKPLVPRLSELLG +V MANDCIGEEV K+ A +PDGGVLLLEN
Sbjct  61   LASHLGRPKGVTPKFSLKPLVPRLSELLGIDVVMANDCIGEEVEKLAAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>ref|XP_010472814.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Camelina 
sativa]
Length=401

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLS+LLG EV MAND IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSQLLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFY EEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>ref|XP_010417621.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429848.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429849.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
Length=401

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL  NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLS+LLG EV MAND IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSQLLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFY EEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>ref|XP_009104523.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFVRVDLNVPLDD+  ITDDTRIRAAVPT+KYL +NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTVKYLMENGSRVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPK+SLKPLVPRLSELLG EV MAND IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKFSLKPLVPRLSELLGIEVVMANDSIGEEVQKLVAGLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEE KNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEAKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>ref|XP_010094705.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56751.1| Phosphoglycerate kinase [Morus notabilis]
Length=401

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEA+LKGKRVFVRVDLNVPLDD+L ITDDTRIR A+PTI+YL   GA+VI
Sbjct  1    MATKRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRGALPTIQYLIGYGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG EVK+A DCIGEEV K+VAE+P+GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGFEVKIAPDCIGEEVEKLVAELPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
             RF+KEEEKNDPEFAKKLASLA++YVNDAFGTAHRAHAST
Sbjct  121  ARFHKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHAST  160



>ref|XP_010537804.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
 ref|XP_010537805.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=401

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MAT  SV +LKEADLKGKRVFVRVDLNVPLDD   ITDDTRIRAAVPTIKYL  NGARVI
Sbjct  1    MATXXSVSTLKEADLKGKRVFVRVDLNVPLDDHSNITDDTRIRAAVPTIKYLMSNGARVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGRPKGVTPKYSLKPLVPRLSELLG EVKMAND IGEEV  +VA + +GGVLLLEN
Sbjct  61   LCSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDSIGEEVETLVAGLSEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLA+LAD+YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHAST  160



>ref|XP_006646936.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=402

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+L EADL+GK+VFVR DLNVPLDD  KITDDTRIRA+VPT+K+L + GA+V+
Sbjct  1    MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV K+ A +P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>gb|EMS46092.1| Phosphoglycerate kinase, cytosolic [Triticum urartu]
Length=429

 Score =   281 bits (720),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+L EADLKGK+VFVR DLNVPLDD  KITDDTRIRA++PTIKYL + GA+VI
Sbjct  1    MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPK+SLKPLVPRLSELLG EV MA DCIGEEV K+ A +PDGGVLLLEN
Sbjct  61   LASHLGRPKGVTPKFSLKPLVPRLSELLGLEVVMAPDCIGEEVEKLAAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>ref|NP_001046020.1| Os02g0169300 [Oryza sativa Japonica Group]
 dbj|BAD25722.1| putative phosphoglycerate kinase, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF07934.1| Os02g0169300 [Oryza sativa Japonica Group]
 gb|ABL74575.1| phosphoglycerate kinase [Oryza sativa Japonica Group]
 gb|EEC72574.1| hypothetical protein OsI_06015 [Oryza sativa Indica Group]
 gb|EEE56393.1| hypothetical protein OsJ_05543 [Oryza sativa Japonica Group]
Length=402

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+L EADL+GK+VFVR DLNVPLDD  KITDDTRIRA+VPT+K+L + GA+VI
Sbjct  1    MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV K+ A +P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLA++ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHAST  160



>gb|ABI74567.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   280 bits (717),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+L EADL+GK+VFVR DLNVPLDD  KITDDTRIRA+VPT+K+L + GA+VI
Sbjct  1    MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV K+ A +P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLA++ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHAST  160



>ref|XP_004966316.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=401

 Score =   280 bits (717),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA K+SVG+L EADLKGK+VF+R DLNVPLDD+ KITDD RIRA+VPTIK+L + GA+VI
Sbjct  1    MAIKRSVGTLSEADLKGKKVFLRADLNVPLDDNQKITDDNRIRASVPTIKFLMEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG  V MANDCIGEEV K+ A +PDGGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVNVVMANDCIGEEVHKLAASLPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>ref|XP_004951776.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=402

 Score =   280 bits (717),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+L EADL+GK+VFVR DLNVPLDD  KITDDTRIRA+VPT+K+L + GA+VI
Sbjct  1    MATKRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV K+ A +P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLAS ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASAADLYVNDAFGTAHRAHAST  160



>ref|NP_001058317.1| Os06g0668200 [Oryza sativa Japonica Group]
 dbj|BAD45436.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAD45421.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20231.1| Os06g0668200 [Oryza sativa Japonica Group]
 gb|EAZ02017.1| hypothetical protein OsI_24050 [Oryza sativa Indica Group]
 gb|EAZ37949.1| hypothetical protein OsJ_22300 [Oryza sativa Japonica Group]
 dbj|BAG95158.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92099.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA+K+SVG+L E+DLKGK+VF+R DLNVPLDD  KITDDTRIRA+VPTIK+L   GA+VI
Sbjct  1    MASKRSVGTLTESDLKGKKVFLRADLNVPLDDSQKITDDTRIRASVPTIKFLMGKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV K+ A +PDGGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVQKLAATLPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFA KLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFANKLASVADLYVNDAFGTAHRAHAST  160



>sp|P12783.1|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic [Triticum aestivum]
 emb|CAA33302.1| unnamed protein product [Triticum aestivum]
Length=401

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+L EADLKGK+VFVR DLNVPLDD  KITDDTRIRA++PTIKYL + GA+VI
Sbjct  1    MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPK+SLKPLV RLSELLG EV MA DCIGEEV K+ A +PDGGVLLLEN
Sbjct  61   LASHLGRPKGVTPKFSLKPLVARLSELLGLEVVMAPDCIGEEVEKLAAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>gb|ABB86242.1| phosphoglycerate kinase-like [Solanum tuberosum]
Length=402

 Score =   279 bits (713),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA KKSVGSLKEADLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL QNGARVI
Sbjct  1    MAVKKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQNGARVI  60

Query  262  LSSHLGRPKG-VTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            L+SHLGRPKG V PK  LKP VPRLSELLG EVKMAND IG EV  +VAE+P+GGV+LLE
Sbjct  61   LASHLGRPKGLVHPKVQLKPFVPRLSELLGIEVKMANDSIGPEVENLVAELPEGGVVLLE  120

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKND EFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  NVRFYKEEEKNDLEFAKKLASLADLYVNDAFGTAHRAHAST  161



>gb|ABI74568.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   278 bits (711),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SV +L EADL+GK+VFVR DLNVPLDD  KITDDTRIRA+VPT+K+L + GA+VI
Sbjct  1    MATKRSVWTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV K+ A +P+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLA++ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHAST  160



>gb|EMT29203.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=494

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+L EADLKGK+VFVR DLNVPLDD  KITDDTRIRA++PTIKYL + GA+VI
Sbjct  1    MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPK+SLKPLVPRLSELLG EV MA DCIGEEV K+ A +PDGGVLLLEN
Sbjct  61   LASHLGRPKGVTPKFSLKPLVPRLSELLGLEVVMAPDCIGEEVEKLAAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>ref|XP_006858233.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
 gb|ERN19700.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
Length=401

 Score =   275 bits (703),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA KKSVG L  +DLKGKRVFVRVDLNVPLDD+ KITDDTRIRAAVPTIKYL +NGA+VI
Sbjct  1    MARKKSVGDLSPSDLKGKRVFVRVDLNVPLDDNQKITDDTRIRAAVPTIKYLMENGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG  V  A+DCIGE V K+VA + +GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVPVLTADDCIGEAVEKLVASLTEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEF+KKLA+LADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFSKKLAALADLYVNDAFGTAHRAHAST  160



>gb|KDO61595.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
 gb|KDO61596.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=360

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAAVPTIK+L QNGA+VILSS
Sbjct  72   KKSVGELSGADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNGAKVILSS  131

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  132  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF  191

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  192  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  228



>ref|XP_009124670.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Brassica 
rapa]
Length=480

 Score =   276 bits (705),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL +NGA+VILS+
Sbjct  78   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILST  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EVK A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  138  HLGRPKGVTPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  234



>emb|CDY00798.1| BnaC03g37820D [Brassica napus]
Length=482

 Score =   275 bits (704),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAAVPTIKYL +NGA+VILS+
Sbjct  80   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAVPTIKYLIENGAKVILST  139

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EVK A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  140  HLGRPKGVTPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRF  199

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  200  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  236



>emb|CDY43401.1| BnaA01g30320D [Brassica napus]
Length=480

 Score =   275 bits (703),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL +NGA+VILS+
Sbjct  78   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILST  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EVK A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  138  HLGRPKGVTPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  234



>gb|AFW70281.1| phosphoglycerate kinase [Zea mays]
Length=572

 Score =   277 bits (709),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            TK+SVG+L EADLKGK+VFVR DLNVPLDD  KITDDTRIRA+VPTIK+L + GA+VIL+
Sbjct  173  TKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILA  232

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SHLGRPKGVTPKYSLKPLVPRLSELLG EV MANDCIGEEV K+ A +P+GGVLLLENVR
Sbjct  233  SHLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDCIGEEVEKLAAALPEGGVLLLENVR  292

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKN+PEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  293  FYKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHAST  330



>emb|CDX73803.1| BnaA03g32440D [Brassica napus]
Length=484

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL +NGA+VILS+
Sbjct  82   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILST  141

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EVK A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  142  HLGRPKGVTPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRF  201

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  202  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  238



>ref|XP_006407295.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
 gb|ESQ48748.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
Length=481

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL  NGA+VILS+
Sbjct  79   KKSVGDLSSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILST  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EVK A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  235



>ref|XP_009135249.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=484

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL +NGA+VILS+
Sbjct  82   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILST  141

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EVK A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  142  HLGRPKGVTPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRF  201

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  202  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  238



>ref|XP_002315066.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
 gb|EEF01237.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
Length=481

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL  NGA+VILSS
Sbjct  79   KKSVGDLTAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLISNGAKVILSS  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +PDGGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  235



>ref|XP_009618219.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
tomentosiformis]
Length=401

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA KKSVGSLKE DLKGKRVFVRVDLNVPLDD+  ITDDTRIRAAVPTIKYL Q+G+RVI
Sbjct  1    MAVKKSVGSLKEGDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHGSRVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG +VKMA+DCIG EV K+VAEIP+GGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGLDVKMADDCIGPEVEKLVAEIPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKN+ EFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNEFEFAKKLASLADLYVNDAFGTAHRAHAST  160



>emb|CDY24247.1| BnaC01g38270D [Brassica napus]
Length=481

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL +NGA+VILS+
Sbjct  79   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILST  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EVK A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDP+FAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNDPDFAKKLASLADLYVNDAFGTAHRAHAST  235



>gb|KDO61594.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=474

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAAVPTIK+L QNGA+VILSS
Sbjct  72   KKSVGELSGADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNGAKVILSS  131

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  132  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF  191

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  192  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  228



>ref|XP_006422251.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
 ref|XP_006493789.1| PREDICTED: phosphoglycerate kinase 2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR35491.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
Length=474

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAAVPTIK+L QNGA+VILSS
Sbjct  72   KKSVGELSGADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNGAKVILSS  131

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  132  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF  191

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  192  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  228



>ref|NP_187884.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
 sp|Q9LD57.1|PGKH1_ARATH RecName: Full=Phosphoglycerate kinase 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF70258.1|AF247558_1 phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK25944.1|AF360234_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL16186.1|AF428418_1 AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAB02423.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK73981.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAL24323.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL33785.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM16259.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAM47957.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM83218.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAE99262.1| phosphoglycerate kinase like protein [Arabidopsis thaliana]
 dbj|BAH19627.1| AT3G12780 [Arabidopsis thaliana]
 gb|AEE75246.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
Length=481

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL +NGA+VILS+
Sbjct  79   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILST  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EV  A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  235



>ref|XP_002513353.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48756.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=479

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+ KITDDTRIRAA+PT+K+L QNGA+VILSS
Sbjct  77   KKSVGDLTAADLKGKKVFVRADLNVPLDDNQKITDDTRIRAAIPTVKHLIQNGAKVILSS  136

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  137  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF  196

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  197  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  233



>emb|CBI24182.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   270 bits (690),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVRVDLNVPLDD+ KITDDTR+RAA+PTIKYL  NGA+VILSS
Sbjct  3    KKSVGDLTGADLKGKKVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNGAKVILSS  62

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG ++  A+DCIG EV K+V  +PDGGVLLLENVRF
Sbjct  63   HLGRPKGVTPKFSLAPLVPRLSELLGIQIVKADDCIGPEVEKLVTALPDGGVLLLENVRF  122

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  123  YKEEEKNEPEFAKKLASIADLYVNDAFGTAHRAHAST  159



>ref|XP_009146585.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=477

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL  NGA+VILS+
Sbjct  80   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILST  139

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EVK A+DCIG EV  +V  +P+GGVLLLENVRF
Sbjct  140  HLGRPKGVTPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVGSLPEGGVLLLENVRF  199

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  200  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  236



>ref|XP_006858226.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
 gb|ERN19693.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
Length=481

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  +DLKGK+VFVR DLNVPLDD+  ITDDTRIRAAVPTIK+L  NGA+VILSS
Sbjct  79   KKSVGDLTASDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIGNGAKVILSS  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSLKPLVPRLSELLG  V  A+DCIGEEV K+VA +PDGGVLLLENVRF
Sbjct  139  HLGRPKGVTPKYSLKPLVPRLSELLGVTVVKADDCIGEEVEKLVASLPDGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLAD+YVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFAKKLASLADIYVNDAFGTAHRAHAST  235



>gb|AGL76992.1| phosphoglycerate kinase, partial [Anisodus luridus]
Length=361

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  127  KGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSSHLGRPKGVTPKY  306
            KGKRVFVRVDLNVPLDD+  ITDDTRIRAA+PTI YL QNGARVIL+SHLGRPKGVTPKY
Sbjct  1    KGKRVFVRVDLNVPLDDNFNITDDTRIRAALPTINYLMQNGARVILASHLGRPKGVTPKY  60

Query  307  SLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRFYKEEEKNDPEFA  486
            SLKPLVPRLSELLG EVKMAND +G EV K+VAE+P+GGVLLLENVRFYKEEEKN+PEFA
Sbjct  61   SLKPLVPRLSELLGLEVKMANDSVGPEVEKLVAELPEGGVLLLENVRFYKEEEKNEPEFA  120

Query  487  KKLASLADLYVNDAFGTAHRAHAST  561
            KKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  KKLASLADLYVNDAFGTAHRAHAST  145



>gb|ABR16231.1| unknown [Picea sitchensis]
Length=472

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG LKE+DLKGKRVFVR DLNVPLD++  ITDDTRIRAAVPTIKYL  NGA+VIL+S
Sbjct  105  KKSVGDLKESDLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKYLIGNGAKVILAS  164

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSLKPLVPRL+ELLG  V   +DCIGEEV K VA +PDGGVLLLEN+RF
Sbjct  165  HLGRPKGVTPKYSLKPLVPRLTELLGVNVLKTDDCIGEEVEKAVASLPDGGVLLLENLRF  224

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            +KEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  225  HKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  261



>ref|XP_002884926.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61185.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL  NGA+VILS+
Sbjct  79   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILST  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EV  A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  235



>ref|XP_011013857.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIK+L  NGA+VILSS
Sbjct  79   KKSVGDLTAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLISNGAKVILSS  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +PDGGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  235



>sp|P29409.2|PGKH_SPIOL RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor, partial [Spinacia oleracea]
 emb|CAA48479.1| phosphoglycerate kinase [Spinacia oleracea]
Length=433

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L  NGA+VILSS
Sbjct  31   KKSVGDLTSADLKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLINNGAKVILSS  90

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG +V K+VAE+P+GGVLLLENVRF
Sbjct  91   HLGRPKGVTPKFSLAPLVPRLSELLGLQVVKADDCIGPDVEKLVAELPEGGVLLLENVRF  150

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  151  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  187



>gb|AAF02830.1|AC009894_1 phosphoglycerate kinase [Arabidopsis thaliana]
Length=320

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L   DLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIK+L +NGA+V
Sbjct  73   TMA-KKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKV  131

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILS+HLGRPKGVTPK+SL PLVPRLSELLG EV  A+DCIG EV  +VA +P+GGVLLLE
Sbjct  132  ILSTHLGRPKGVTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLE  191

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKN+P+FAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  192  NVRFYKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHAST  232



>ref|XP_008805983.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
 ref|XP_008776889.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=488

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L  ADLKGKRVFVR DLNVPLD++  ITDDTRIRAAVPTIK+L  NGA+V
Sbjct  83   TMA-KKSVGDLTAADLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGNGAKV  141

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILSSHLGRPKGVTPKYSL PLV RLSELLG +V+ A+DCIG EV KMVA IP+GGVLLLE
Sbjct  142  ILSSHLGRPKGVTPKYSLSPLVARLSELLGIKVEKADDCIGPEVEKMVAAIPEGGVLLLE  201

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  202  NVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  242



>ref|XP_006297559.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
 gb|EOA30457.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
Length=481

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL +NGA+VILS+
Sbjct  79   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILST  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIQVTKADDCIGPEVESLVASLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNDPEFAKKLAALADLYVNDAFGTAHRAHAST  235



>emb|CBL95264.1| phosphoglycerate kinase 1 [Pinus pinaster]
Length=507

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            K+SVG LKE+DLKGK+VFVR DLNVPLD++  ITDDTRIRAAVPTIKYL  NGA+VIL+S
Sbjct  105  KRSVGDLKESDLKGKKVFVRADLNVPLDENQNITDDTRIRAAVPTIKYLISNGAKVILTS  164

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSLKPLVPRL+ELLG  V  A+DCIG EV K VA +P+GGVLLLENVRF
Sbjct  165  HLGRPKGVTPKYSLKPLVPRLTELLGVNVVKADDCIGAEVEKAVASLPNGGVLLLENVRF  224

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  225  YKEEEKNDPEFAKKLASIADLYVNDAFGTAHRAHAST  261



>gb|ABK24564.1| unknown [Picea sitchensis]
Length=507

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG LKE+DLKGKRVFVR DLNVPLD++  ITDDTRIRAAVPTIKYL  NGA+VIL+S
Sbjct  105  KKSVGDLKESDLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKYLIGNGAKVILAS  164

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSLKPLVPRL+ELLG  V   +DCIGEEV K VA +PDGGVLLLEN+RF
Sbjct  165  HLGRPKGVTPKYSLKPLVPRLTELLGVNVLKTDDCIGEEVEKAVASLPDGGVLLLENLRF  224

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            +KEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  225  HKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  261



>ref|XP_010487004.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   270 bits (691),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL +NGA+VILS+
Sbjct  79   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILST  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIQVTKADDCIGPEVESLVAALPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNDPEFAKKLAALADLYVNDAFGTAHRAHAST  235



>gb|AIZ74346.1| phosphoglycerate kinase 1 [Pinus massoniana]
Length=507

 Score =   271 bits (693),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            K+SVG LKE+DLKGK+VFVR DLNVPLD++  ITDDTRIRAAVPTIKYL  NGA+VIL+S
Sbjct  105  KRSVGDLKESDLKGKKVFVRADLNVPLDENQNITDDTRIRAAVPTIKYLISNGAKVILTS  164

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSLKPLVPRL+ELLG  V  A+DCIG EV K VA +P+GGVLLLENVRF
Sbjct  165  HLGRPKGVTPKYSLKPLVPRLTELLGVNVVKADDCIGPEVEKAVASLPNGGVLLLENVRF  224

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  225  YKEEEKNDPEFAKKLASIADLYVNDAFGTAHRAHAST  261



>gb|AGH55660.1| phosphoglycerate kinase, partial [Atropa belladonna]
Length=363

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +1

Query  127  KGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSSHLGRPKGVTPKY  306
            KGKRVFVRVDLNVPLDD+  ITDDTRIRAA+PTI YL QNGARVIL+SHLGRPKGVTPKY
Sbjct  1    KGKRVFVRVDLNVPLDDNFNITDDTRIRAAIPTIXYLMQNGARVILASHLGRPKGVTPKY  60

Query  307  SLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRFYKEEEKNDPEFA  486
            SLKPL PRLSELLG EVKMAND +G EV K+VAE+P+GGVLL+ENVRFYKEEEKN+PEFA
Sbjct  61   SLKPLAPRLSELLGLEVKMANDSVGPEVEKLVAELPEGGVLLMENVRFYKEEEKNEPEFA  120

Query  487  KKLASLADLYVNDAFGTAHRAHAST  561
            KKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  KKLASLADLYVNDAFGTAHRAHAST  145



>gb|EMT08517.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=401

 Score =   268 bits (684),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            M TK+SVG+L + DL GKRV +R DLNVPLDD  +I DD RIRA+VPTIK+L   GARV+
Sbjct  1    MPTKRSVGTLGDKDLSGKRVLLRADLNVPLDDGQRIADDNRIRASVPTIKFLMGKGARVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV K+   +PDGGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLATALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>ref|XP_002263796.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Vitis vinifera]
 emb|CAN81990.1| hypothetical protein VITISV_000725 [Vitis vinifera]
Length=478

 Score =   270 bits (690),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVRVDLNVPLDD+ KITDDTR+RAA+PTIKYL  NGA+VILSS
Sbjct  76   KKSVGDLTGADLKGKKVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNGAKVILSS  135

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG ++  A+DCIG EV K+V  +PDGGVLLLENVRF
Sbjct  136  HLGRPKGVTPKFSLAPLVPRLSELLGIQIVKADDCIGPEVEKLVTALPDGGVLLLENVRF  195

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  196  YKEEEKNEPEFAKKLASIADLYVNDAFGTAHRAHAST  232



>ref|XP_011095719.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAAVPTIK+L  NGA+VILS+
Sbjct  79   KKSVGDLTAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLISNGAKVILST  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  235



>ref|XP_002891879.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68138.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIK+L +NGA+V
Sbjct  73   TMA-KKSVGDLTSADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKV  131

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILS+HLGRPKGVTPK+SL PLVPRLSELLG EV  A+DCIG +V  +VA +P+GGVLLLE
Sbjct  132  ILSTHLGRPKGVTPKFSLAPLVPRLSELLGIEVVKADDCIGPQVESLVASLPEGGVLLLE  191

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  192  NVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  232



>ref|XP_010060861.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW67742.1| hypothetical protein EUGRSUZ_F01476 [Eucalyptus grandis]
Length=484

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L    LKGK+VFVR DLNVPLDD+  ITDDTR+RAAVPTIKYL QNGARVILSS
Sbjct  82   KKSVGDLTGPALKGKKVFVRADLNVPLDDNQNITDDTRVRAAVPTIKYLIQNGARVILSS  141

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  142  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF  201

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  202  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  238



>gb|KHG01489.1| hypothetical protein F383_22605 [Gossypium arboreum]
Length=488

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L QNGA+VILSS
Sbjct  86   KKSVGDLTAADLKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNGAKVILSS  145

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  146  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVAALPEGGVLLLENVRF  205

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHAST
Sbjct  206  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHAST  242



>ref|XP_010936574.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Elaeis guineensis]
Length=490

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
             KKSVG L  ADLKGKRVFVR DLNVPLD++  ITDDTRIRAAVPTIK+L   GA+VILS
Sbjct  87   AKKSVGDLTAADLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGKGAKVILS  146

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SHLGRPKGVTPKYSL PLVPRLSELLG +V+ A+DCIG EV KMVA +P+GGVLLLENVR
Sbjct  147  SHLGRPKGVTPKYSLSPLVPRLSELLGIKVEKADDCIGPEVEKMVAALPEGGVLLLENVR  206

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  207  FYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  244



>ref|XP_010465058.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL  NGA+VILS+
Sbjct  79   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILST  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIQVTKADDCIGPEVESLVAALPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNDPEFAKKLAALADLYVNDAFGTAHRAHAST  235



>gb|KJB14026.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=488

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L QNGA+VILSS
Sbjct  86   KKSVGDLTAADLKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNGAKVILSS  145

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  146  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVAALPEGGVLLLENVRF  205

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHAST
Sbjct  206  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHAST  242



>gb|KJB14025.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=491

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L QNGA+VILSS
Sbjct  86   KKSVGDLTAADLKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNGAKVILSS  145

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  146  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVAALPEGGVLLLENVRF  205

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHAST
Sbjct  206  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHAST  242



>ref|XP_011016496.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLD++ KITDDTRIRAAVPTIKYL  NGA+VILSS
Sbjct  79   KKSVGDLTAADLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISNGAKVILSS  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +P+G VLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGSVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFAKKLASMADLYVNDAFGTAHRAHAST  235



>ref|XP_002312238.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
 dbj|BAA33803.1| chloroplast phosphoglycerate kinase [Populus nigra]
 gb|EEE89605.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
Length=481

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLD++ KITDDTRIRAAVPTIKYL   GA+VILSS
Sbjct  79   KKSVGDLTAADLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKGAKVILSS  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFAKKLASMADLYVNDAFGTAHRAHAST  235



>ref|XP_011086346.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAAVPTIK+L  NGA+VILSS
Sbjct  79   KKSVGDLSGADLKGKKVFVRADLNVPLDDSQNITDDTRIRAAVPTIKHLISNGAKVILSS  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHAST  235



>ref|XP_009763674.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
sylvestris]
Length=481

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGK+VFVR DLNVPLDD+  ITDDTRIRAAVPTIK+L  NGA+VILSS
Sbjct  78   KKSVGDLTAAELKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLMANGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  138  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKAEDCIGPEVEKLVASLPEGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  234



>ref|XP_008456300.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Cucumis melo]
Length=485

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIK+LT+ GA+VILSS
Sbjct  83   KKSVGDLTAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLTEKGAKVILSS  142

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  143  HLGRPKGVTPKYSLAPLVPRLSELLGFQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF  202

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHAST
Sbjct  203  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHAST  239



>ref|XP_010499471.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Camelina 
sativa]
Length=481

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL +NGA+VILS+
Sbjct  79   KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILST  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV  +V+ +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIQVTKADDCIGPEVESLVSALPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNDPEFAKKLAALADLYVNDAFGTAHRAHAST  235



>gb|ABK96267.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96531.1| unknown [Populus trichocarpa x Populus deltoides]
Length=481

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLD++ KITDDTRIRAAVPTIKYL   GA+VILSS
Sbjct  79   KKSVGDLTAADLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKGAKVILSS  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFAKKLASMADLYVNDAFGTAHRAHAST  235



>gb|EMS52006.1| Phosphoglycerate kinase, cytosolic [Triticum urartu]
Length=520

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +1

Query  76   ETMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGAR  255
            E M TK+SVG+L + DL GK+V +R DLNVPLDD  +I DD RIRA+VPTIK+L   GAR
Sbjct  42   EEMPTKRSVGTLGDKDLSGKKVLLRADLNVPLDDGQRIADDNRIRASVPTIKFLMGKGAR  101

Query  256  VILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLL  435
            V+L+SHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV K+ A +PDGGVLLL
Sbjct  102  VVLASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPDGGVLLL  161

Query  436  ENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            ENVRFYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  162  ENVRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  203



>gb|EAY98560.1| hypothetical protein OsI_20474 [Oryza sativa Indica Group]
Length=284

 Score =   262 bits (669),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
             KKSVG L  ADL+GKRVFVR DLNVPLDD+  ITDDTR+RAA+PTI+YL +NGA+VILS
Sbjct  2    AKKSVGDLTAADLEGKRVFVRADLNVPLDDNQNITDDTRVRAAIPTIQYLIKNGAKVILS  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SHLGRPKGVTPK+SL PLVPRLSELLG +V  A D IG +V K+V+E+P+G VLLLENVR
Sbjct  62   SHLGRPKGVTPKFSLAPLVPRLSELLGIQVTKAEDVIGPDVEKLVSELPNGSVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  159



>emb|CDP13575.1| unnamed protein product [Coffea canephora]
Length=947

 Score =   278 bits (711),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MA ++S+GSLKE DLKGKRVFVRVDLNVPLDD+  ITDD RIRAAVPTI YL   GA+VI
Sbjct  1    MAAQRSMGSLKEPDLKGKRVFVRVDLNVPLDDNFNITDDARIRAAVPTINYLIAYGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLG PKGVTPKYSLKPLVPRLSELLG EVKMANDCIGEEV K+VA +P+GGVLLLEN
Sbjct  61   LASHLGCPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKLVASLPEGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEE+KNDPEFAKKLASLADLYVND  GTAHRAHAST
Sbjct  121  VRFYKEEDKNDPEFAKKLASLADLYVNDVSGTAHRAHAST  160



>emb|CDP13574.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK VFVR D NVPLDD+  ITDDTRIRAA+PTIK+L  NGA+V+LSS
Sbjct  3    KKSVGDLAAADLKGKNVFVRADFNVPLDDNQNITDDTRIRAAIPTIKHLISNGAKVVLSS  62

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+DCIG EV K+VA +PDGGVLLLENVRF
Sbjct  63   HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  122

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLAD+YVNDAFGTAHRAHAST
Sbjct  123  YKEEEKNEPEFAKKLASLADIYVNDAFGTAHRAHAST  159



>ref|XP_004139904.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004154567.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN46797.1| hypothetical protein Csa_6G136020 [Cucumis sativus]
Length=485

 Score =   268 bits (684),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIK+LT+ GA+VILSS
Sbjct  83   KKSVGDLSAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLTEKGAKVILSS  142

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELL  +V  A+DCIG EV K+VA +PDGGVLLLENVRF
Sbjct  143  HLGRPKGVTPKYSLAPLVPRLSELLSIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  202

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHAST
Sbjct  203  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHAST  239



>ref|XP_010923458.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Elaeis 
guineensis]
Length=492

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
             KKSVG L  ADLKGKRVFVR DLNVPLD++  ITDDTRIRAAVPTIK+L  NGA+VILS
Sbjct  89   AKKSVGDLTAADLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKHLIGNGAKVILS  148

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SHLGRPKGVTPK+SL PLVPRLSELLG +V+ A+DCIG EV KMVA +P+GGVLLLENVR
Sbjct  149  SHLGRPKGVTPKFSLNPLVPRLSELLGVKVEKADDCIGPEVEKMVAALPEGGVLLLENVR  208

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYK+EEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  209  FYKDEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  246



>ref|NP_176015.1| phosphoglycerate kinase [Arabidopsis thaliana]
 sp|P50318.3|PGKH2_ARATH RecName: Full=Phosphoglycerate kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG50920.1|AC069159_21 phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAL07140.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM20449.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAN15569.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AEE33356.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=478

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L   DLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIK+L +NGA+V
Sbjct  73   TMA-KKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKV  131

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILS+HLGRPKGVTPK+SL PLVPRLSELLG EV  A+DCIG EV  +VA +P+GGVLLLE
Sbjct  132  ILSTHLGRPKGVTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLE  191

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKN+P+FAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  192  NVRFYKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHAST  232



>gb|AAB60303.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=399

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  103  GSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSSHLGR  282
            G L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL +NGA+VILS+HLGR
Sbjct  1    GDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGR  60

Query  283  PKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRFYKEE  462
            PKGVTPK+SL PLVPRLSELLG EV  A+DCIG EV  +VA +P+GGVLLLENVRFYKEE
Sbjct  61   PKGVTPKFSLAPLVPRLSELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRFYKEE  120

Query  463  EKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            EKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  121  EKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  153



>ref|XP_010269369.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Nelumbo 
nucifera]
Length=486

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLD +  ITDDTR+RAAVPTIK+L  NGA+VILSS
Sbjct  84   KKSVGDLTAADLKGKKVFVRADLNVPLDGNQNITDDTRVRAAVPTIKHLIGNGAKVILSS  143

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSLKPLVPRLSELLG  V  A DCIG EV K VA +P+GGVLLLENVRF
Sbjct  144  HLGRPKGVTPKYSLKPLVPRLSELLGVTVVKAEDCIGPEVEKQVAALPEGGVLLLENVRF  203

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  204  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  240



>gb|ADV16381.1| chloroplast phosphoglycerate kinase 3 [Helianthus annuus]
Length=481

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
             A KKSVG L  A+LKGK+VFVR DLNVPLDD+  ITDDTRIRAAVPTIK+L  NGA+VI
Sbjct  75   FAAKKSVGDLSPAELKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLISNGAKVI  134

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            LSSHLGRPKGVTPKYSL PLVPRL+EL+G EV  A+DCIG +V K+VA +PDGGVLLLEN
Sbjct  135  LSSHLGRPKGVTPKYSLAPLVPRLTELIGVEVVKADDCIGPDVEKLVASLPDGGVLLLEN  194

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDP FA+KLASLADLYVNDAFGTAHRAHAST
Sbjct  195  VRFYKEEEKNDPGFAEKLASLADLYVNDAFGTAHRAHAST  234



>ref|NP_001117503.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE33357.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=405

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L   DLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIK+L +NGA+VILS+
Sbjct  3    KKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVILST  62

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EV  A+DCIG EV  +VA +P+GGVLLLENVRF
Sbjct  63   HLGRPKGVTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLENVRF  122

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+P+FAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  123  YKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHAST  159



>sp|Q42961.1|PGKH_TOBAC RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA88841.1| phosphoglycerate kinase [Nicotiana tabacum]
Length=481

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGK+VFVR DLNVPLDD+  ITDDTRIRAAVPTIK+L  NGA+VILSS
Sbjct  78   KKSVGDLTAAELKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLMANGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V    DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  138  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKVEDCIGPEVEKLVASLPEGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  234



>dbj|BAJ85222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            M TK+SVG+L + DL GK+V +R DLNVPLDD  +I DD RIRA+VPTIK+L   GA+V+
Sbjct  1    MPTKRSVGTLGDKDLGGKKVLLRADLNVPLDDGQRIADDNRIRASVPTIKFLMGKGAKVV  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLGRPKGVTPKYSLKPLVPRLSELLG +V MANDCIGEEV  + A +PDGGVLLLEN
Sbjct  61   LASHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVENLAAALPDGGVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  160



>ref|XP_008786111.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=491

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  +DLKGKRVFVR DLNVPLD++  ITDDTRIRAAVPTIK+L   GA+VILSS
Sbjct  89   KKSVGDLTASDLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGKGAKVILSS  148

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V+ A+DCIG EV KMVA +P+GGVLLLENVRF
Sbjct  149  HLGRPKGVTPKYSLSPLVPRLSELLGIKVEKADDCIGPEVEKMVAALPEGGVLLLENVRF  208

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  209  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  245



>ref|XP_003596091.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66342.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=479

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL QNGA+VILSS
Sbjct  77   KKSVGDLSGAELKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLIQNGAKVILSS  136

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSEL+G EV  A D IG EV K+VA +PDGGVLLLENVRF
Sbjct  137  HLGRPKGVTPKYSLAPLVPRLSELIGIEVIKAEDSIGPEVEKLVASLPDGGVLLLENVRF  196

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  197  YKEEEKNDPEHAKKLAALADLYVNDAFGTAHRAHAST  233



>gb|EPS66037.1| phosphoglycerate kinase, chloroplastic [Genlisea aurea]
Length=487

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKG+RVFVR DLNVPLDD+  ITDDTRIRAAVPTIK+L  NGA+VILSS
Sbjct  85   KKSVGDLSAADLKGRRVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLINNGAKVILSS  144

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A+D IG EV K+VA +P+GGVLLLENVRF
Sbjct  145  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDVIGPEVEKLVASLPEGGVLLLENVRF  204

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  205  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  241



>ref|XP_003531482.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Glycine 
max]
Length=485

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIK+L QNGA+VILSS
Sbjct  83   KKSVGDLSAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLIQNGAKVILSS  142

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSEL+G ++  A D IG EV K+VA +PDGGVLLLENVRF
Sbjct  143  HLGRPKGVTPKYSLAPLVPRLSELIGIQIVKAEDSIGPEVEKLVASLPDGGVLLLENVRF  202

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLASLADLYVNDAFGTAHRAHAST
Sbjct  203  YKEEEKNDPEHAKKLASLADLYVNDAFGTAHRAHAST  239



>ref|XP_003546820.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Glycine max]
Length=483

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
             KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIK+L QNGA+VILS
Sbjct  80   AKKSVGELSAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLIQNGAKVILS  139

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SHLGRPKGVTPKYSL PLVPRLSEL+G +V  A D IG EV K+VA +PDGGVLLLENVR
Sbjct  140  SHLGRPKGVTPKYSLAPLVPRLSELIGIQVVKAEDSIGPEVEKLVASLPDGGVLLLENVR  199

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPE AKKLASLADL+VNDAFGTAHRAHAST
Sbjct  200  FYKEEEKNDPEHAKKLASLADLFVNDAFGTAHRAHAST  237



>ref|XP_009622055.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=481

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAAVPTIK+L  NGA+VILSS
Sbjct  78   KKSVGDLTAAELKGKKVFVRADLNVPLDDSQNITDDTRIRAAVPTIKHLMANGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A DCIG EV K+VA +P+G VLLLENVRF
Sbjct  138  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKAEDCIGPEVEKLVASLPEGSVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  234



>ref|XP_007149208.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
 gb|ESW21202.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
Length=477

 Score =   265 bits (677),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL QNGA+VILSS
Sbjct  75   KKSVGDLSAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLIQNGAKVILSS  134

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSEL+G  V  A D IG EV K+VA +PDGGVLLLENVRF
Sbjct  135  HLGRPKGVTPKYSLGPLVPRLSELIGFPVVKAEDSIGPEVEKLVASLPDGGVLLLENVRF  194

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLASLADL+VNDAFGTAHRAHAST
Sbjct  195  YKEEEKNDPEHAKKLASLADLFVNDAFGTAHRAHAST  231



>ref|XP_007022578.1| Phosphoglycerate kinase 1 [Theobroma cacao]
 gb|EOY14103.1| Phosphoglycerate kinase 1 [Theobroma cacao]
Length=491

 Score =   265 bits (678),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR D NVPLDD+  ITDDTR+RAA+PTIK+L QNGA+VILSS
Sbjct  86   KKSVGDLSGADLKGKKVFVRADFNVPLDDNQNITDDTRVRAAIPTIKHLIQNGAKVILSS  145

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLV RLSELLG +V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  146  HLGRPKGVTPKFSLAPLVSRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRF  205

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  206  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  242



>ref|XP_009397212.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 gb|ABF70168.1| phosphoglycerate kinase, chloroplast, putative [Musa acuminata]
Length=479

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLD+D  ITDDTRIRAAVPTIK+L  NGA+VILSS
Sbjct  77   KKSVGDLTAADLKGKKVFVRADLNVPLDEDRNITDDTRIRAAVPTIKHLISNGAKVILSS  136

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V+ A+DCIG EV K+V  +P+GGVLLLENVRF
Sbjct  137  HLGRPKGVTPKFSLSPLVPRLSELLGIKVEKADDCIGPEVEKLVNALPEGGVLLLENVRF  196

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  197  YKEEEKNEPEFAKKLAALADLYVNDAFGTAHRAHAST  233



>gb|KDP25067.1| hypothetical protein JCGZ_22602 [Jatropha curcas]
Length=487

 Score =   265 bits (677),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGKRVFVR DLNVPLDD+  ITDDTRIRAA+PTIK+L QNGA+VILS+
Sbjct  85   KKSVGDLTGADLKGKRVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLIQNGAKVILST  144

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+D IG EV K+VA +P+GGVLLLENVRF
Sbjct  145  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDSIGPEVEKLVASLPEGGVLLLENVRF  204

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLASLADLYVNDAFGTAHRAHAST
Sbjct  205  YKEEEKNDPEHAKKLASLADLYVNDAFGTAHRAHAST  241



>gb|EYU33792.1| hypothetical protein MIMGU_mgv1a005422mg [Erythranthe guttata]
Length=484

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGKRVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L  NGA+V+LSS
Sbjct  82   KKSVGDLTAAELKGKRVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLISNGAKVLLSS  141

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A+DCIG +V  +VA +P+GGVLLLENVRF
Sbjct  142  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPDVEALVAALPEGGVLLLENVRF  201

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFA+KLASLADLYVNDAFGTAHRAHAST
Sbjct  202  YKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHAST  238



>ref|XP_004961633.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Setaria 
italica]
Length=480

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L EADL+GKRVFVR DLNVPLD++  ITDDTR+RAAVPTI+YL   GA+V
Sbjct  76   TMA-KKSVGDLTEADLEGKRVFVRADLNVPLDENQNITDDTRVRAAVPTIQYLIGKGAKV  134

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILSSHLGRPKGVTPK+SL P+VPRLSELLG +V+ A+D IG EV K+V+ +P+GGVLLLE
Sbjct  135  ILSSHLGRPKGVTPKFSLAPIVPRLSELLGIQVQKADDVIGPEVEKLVSALPNGGVLLLE  194

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKNDPEFA+KLASLADLYVNDAFGTAHRAHAST
Sbjct  195  NVRFYKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHAST  235



>ref|XP_004243968.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Solanum lycopersicum]
Length=482

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  +DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L  NGA+VILSS
Sbjct  79   KKSVGDLSSSDLKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIANGAKVILSS  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A+DCIG EV K+V  +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVDKLVDSLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  235



>ref|XP_010669994.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGKRVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L  NGA+VILSS
Sbjct  80   KKSVGDLTSAELKGKRVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLMNNGAKVILSS  139

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A+DCIG +V K+V  +P+GGVLLLENVRF
Sbjct  140  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPDVEKLVGGLPEGGVLLLENVRF  199

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  200  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  236



>gb|AGV54662.1| phosphoglycerate kinase chloroplastic-like protein [Phaseolus 
vulgaris]
Length=477

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
             KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL QNGA+VILS
Sbjct  74   AKKSVGDLSAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLIQNGAKVILS  133

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SHLGRPKGVTPKYSL PLVPRLSEL+G  V  A D IG EV K+VA +PDGGVLLLENVR
Sbjct  134  SHLGRPKGVTPKYSLGPLVPRLSELIGFPVVKAEDSIGPEVEKLVASLPDGGVLLLENVR  193

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPE AKKLASLADL+VNDAFGTAHRAHAST
Sbjct  194  FYKEEEKNDPEHAKKLASLADLFVNDAFGTAHRAHAST  231



>ref|XP_004488763.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cicer 
arietinum]
Length=479

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIK+L QNGA+VILSS
Sbjct  77   KKSVGDLSAAELKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLIQNGAKVILSS  136

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSEL+G +V  A+D IG EV K+VA +P+GGVLLLENVRF
Sbjct  137  HLGRPKGVTPKYSLAPLVPRLSELIGIQVIKADDSIGPEVEKLVASLPEGGVLLLENVRF  196

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLASLADLYVNDAFGTAHRAHAST
Sbjct  197  YKEEEKNDPEHAKKLASLADLYVNDAFGTAHRAHAST  233



>gb|ADR71054.1| phosphoglycerate kinase [Nicotiana benthamiana]
Length=481

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGK VFVR DLNVPLDD+  ITDDTRIRAAVPTIK+L  NGA+VILS+
Sbjct  78   KKSVGDLTAAELKGKNVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLMANGAKVILST  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V    DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  138  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKVEDCIGPEVEKLVASLPEGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  234



>ref|XP_006654593.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Oryza 
brachyantha]
Length=405

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADL+GKRVFVR DLNVPLD++  ITDDTR+RAA+PTI+YL +NGA+VILSS
Sbjct  3    KKSVGDLTAADLEGKRVFVRADLNVPLDENQNITDDTRVRAAIPTIQYLIKNGAKVILSS  62

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EV  A D IG EV K+V+ +P+G VLLLENVRF
Sbjct  63   HLGRPKGVTPKFSLAPLVPRLSELLGIEVTKAEDVIGPEVEKLVSGLPNGSVLLLENVRF  122

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  123  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  159



>ref|XP_009402843.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLD++  ITDDTRIRAAVPTIK+L  NGA+VILSS
Sbjct  78   KKSVGDLTAADLKGKKVFVRADLNVPLDENRNITDDTRIRAAVPTIKHLISNGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL P+VPRLSELLG +V+ A+DCIG EV K+V  +P+GGVLLLENVRF
Sbjct  138  HLGRPKGVTPKFSLNPIVPRLSELLGIKVEKADDCIGPEVEKLVNALPEGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKL +LADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNDPEFAKKLGALADLYVNDAFGTAHRAHAST  234



>ref|XP_008372155.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Malus 
domestica]
Length=396

 Score =   260 bits (665),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L +NGA+VILSS
Sbjct  78   KKSVGDLSAAELKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A D IG EV K+VA +P+GGVLLLENVRF
Sbjct  138  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKAEDSIGPEVEKLVASLPEGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNDPEHAKKLAALADLYVNDAFGTAHRAHAST  234



>gb|AAC26785.1| phosphoglycerate kinase precursor [Solanum tuberosum]
Length=482

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  +DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L  NGA+VILSS
Sbjct  79   KKSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRAAIPTIKHLIANGAKVILSS  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A+DCIG EV K+V  +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVDSLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHAST  235



>gb|ACN32155.1| unknown [Zea mays]
Length=411

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L EADL+GKRVFVR DLNVPLD++  ITDDTRIRAA+PTI+Y+   GA+V
Sbjct  3    TMA-KKSVGELTEADLEGKRVFVRADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKV  61

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILSSHLGRPKG TPK+SL PLV RLSELLG +V+ A+D IG EV K+VA +P+GGVLLLE
Sbjct  62   ILSSHLGRPKGFTPKFSLAPLVGRLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLE  121

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKNDPEFA+KLASLADLYVNDAFGTAHRAHAST
Sbjct  122  NVRFYKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHAST  162



>sp|P12782.1|PGKH_WHEAT RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Triticum aestivum]
 emb|CAA33303.1| unnamed protein product [Triticum aestivum]
 emb|CAA51931.1| phosphoglycerate kinase [Triticum aestivum]
Length=480

 Score =   262 bits (670),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L  ADL+GKRV VR DLNVPLDD+  ITDDTRIRAA+PTIKYL  NGA+V
Sbjct  72   TMA-KKSVGDLTAADLEGKRVLVRADLNVPLDDNQNITDDTRIRAAIPTIKYLLSNGAKV  130

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            IL+SHLGRPKGVTPK+SL PLVPRLSELLG EVK A D IG EV K+VA++ +G VLLLE
Sbjct  131  ILTSHLGRPKGVTPKFSLAPLVPRLSELLGIEVKKAEDVIGPEVEKLVADLANGAVLLLE  190

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKNDPEFAKKLASLADL+VNDAFGTAHRAHAST
Sbjct  191  NVRFYKEEEKNDPEFAKKLASLADLFVNDAFGTAHRAHAST  231



>gb|AFW82396.1| hypothetical protein ZEAMMB73_945417 [Zea mays]
Length=477

 Score =   262 bits (669),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L EADLKGKRVFVR DLNVPLD++  ITDDTRIRAA+PTI+YL   GA+V
Sbjct  72   TMA-KKSVGDLTEADLKGKRVFVRADLNVPLDENQNITDDTRIRAAIPTIQYLLGKGAKV  130

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILSSHLGRPKG TPK+SL PLV RLSELLG +V+ A+D IG EV K+VA +P+GGVLLLE
Sbjct  131  ILSSHLGRPKGFTPKFSLAPLVARLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLE  190

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKNDPEFA+KLAS+ADLYVNDAFGTAHRAHAST
Sbjct  191  NVRFYKEEEKNDPEFAQKLASVADLYVNDAFGTAHRAHAST  231



>ref|XP_010094703.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56749.1| Phosphoglycerate kinase [Morus notabilis]
Length=478

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKS G L  ADLKGK+VFVR DLNVPL D+  ITDDTR+RAAVPTIK+L QNGA+VILSS
Sbjct  76   KKSGGDLTAADLKGKKVFVRADLNVPLGDNQNITDDTRVRAAVPTIKHLIQNGAKVILSS  135

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A+D IG EV K+VA +PDG VLLLENVRF
Sbjct  136  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDVIGPEVEKLVASLPDGSVLLLENVRF  195

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  196  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  232



>gb|ABB86255.1| phosphoglycerate kinase precursor-like [Solanum tuberosum]
Length=482

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L  NGA+VILS+
Sbjct  79   KKSVGDLSSADLKGKKVFVRADLNVPLDDAQNITDDTRIRAAIPTIKHLIANGAKVILST  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +   A+DCIG EV K+V  +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKYSLAPLVPRLSELLGIQGVKADDCIGPEVEKLVDSLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  235



>ref|NP_001275227.1| phosphoglycerate kinase, chloroplastic-like [Solanum tuberosum]
 gb|ABB72817.1| phosphoglycerate kinase precursor-like protein [Solanum tuberosum]
Length=482

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  +DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L  NGA+VILS+
Sbjct  79   KKSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRAAIPTIKHLIANGAKVILST  138

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A+DCIG EV K+V  +P+GGVLLLENVRF
Sbjct  139  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVDSLPEGGVLLLENVRF  198

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKN+PEF KKLASLADLYVNDAFGTAHRAHAST
Sbjct  199  YKEEEKNEPEFXKKLASLADLYVNDAFGTAHRAHAST  235



>ref|XP_003568189.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Brachypodium 
distachyon]
Length=482

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 142/161 (88%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L  ADL+GKRV VR DLNVPLDD   ITDDTRIRAA+PTIKYL  NGA+V
Sbjct  74   TMA-KKSVGDLGPADLEGKRVLVRADLNVPLDDSQNITDDTRIRAAIPTIKYLLSNGAKV  132

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            IL+SHLGRPKGVTPK+SL PLVPRLSELLG +V+ A+D IG EV K+VA +P+G VLLLE
Sbjct  133  ILTSHLGRPKGVTPKFSLAPLVPRLSELLGIQVQKADDVIGPEVEKLVAALPNGAVLLLE  192

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKN+PEFAKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  193  NVRFYKEEEKNEPEFAKKLAALADLYVNDAFGTAHRAHAST  233



>ref|NP_001147628.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28158.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28313.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L EADL+GKRVFVR DLNVPLD++  ITDDTRIRAA+PTI+Y+   GA+V
Sbjct  75   TMA-KKSVGELTEADLEGKRVFVRADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKV  133

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILSSHLGRPKG TPK+SL PLV RLSELLG +V+ A+D IG EV K+VA +P+GGVLLLE
Sbjct  134  ILSSHLGRPKGFTPKFSLAPLVGRLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLE  193

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKNDPEFA+KLASLADLYVNDAFGTAHRAHAST
Sbjct  194  NVRFYKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHAST  234



>gb|AFW78532.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L EADL+GKRVFVR DLNVPLD++  ITDDTRIRAA+PTI+Y+   GA+V
Sbjct  75   TMA-KKSVGELTEADLEGKRVFVRADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKV  133

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILSSHLGRPKG TPK+SL PLV RLSELLG +V+ A+D IG EV K+VA +P+GGVLLLE
Sbjct  134  ILSSHLGRPKGFTPKFSLAPLVGRLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLE  193

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKNDPEFA+KLASLADLYVNDAFGTAHRAHAST
Sbjct  194  NVRFYKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHAST  234



>ref|XP_010544343.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglycerate kinase 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=480

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +1

Query  97   SVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSSHL  276
            S G L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIKYL +NGA+VILSSHL
Sbjct  78   SXGDLTSADLKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKYLIENGAKVILSSHL  137

Query  277  GRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRFYK  456
            GRPKGVTPKYSL PLVPRLSELLG +V  A+DCIG EV  ++  +P+GGVLLLENVRFYK
Sbjct  138  GRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVESLLDSLPEGGVLLLENVRFYK  197

Query  457  EEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            EEEKN+PEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  198  EEEKNEPEFAKKLASLADLYVNDAFGTAHRAHAST  232



>gb|AFW78533.1| phosphoglycerate kinase [Zea mays]
Length=483

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L EADL+GKRVFVR DLNVPLD++  ITDDTRIRAA+PTI+Y+   GA+V
Sbjct  75   TMA-KKSVGELTEADLEGKRVFVRADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKV  133

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILSSHLGRPKG TPK+SL PLV RLSELLG +V+ A+D IG EV K+VA +P+GGVLLLE
Sbjct  134  ILSSHLGRPKGFTPKFSLAPLVGRLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLE  193

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKNDPEFA+KLASLADLYVNDAFGTAHRAHAST
Sbjct  194  NVRFYKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHAST  234



>ref|XP_008346077.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Malus domestica]
Length=480

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L +NGA+VILSS
Sbjct  78   KKSVGDLSAAELKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A D IG EV K+VA +P+GGVLLLENVRF
Sbjct  138  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKAEDSIGPEVEKLVASLPEGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNDPEHAKKLAALADLYVNDAFGTAHRAHAST  234



>ref|XP_008371996.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L +NGA+VILSS
Sbjct  78   KKSVGDLSAAELKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A D IG EV K+VA +P+GGVLLLENVRF
Sbjct  138  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKAEDSIGPEVEKLVASLPEGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNDPEHAKKLAALADLYVNDAFGTAHRAHAST  234



>gb|EMS54865.1| Phosphoglycerate kinase, chloroplastic [Triticum urartu]
Length=460

 Score =   259 bits (663),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADL+GKRV VR DLNVPLDD+  ITDDTRIRAA+PTIKYL  NGA+VIL+S
Sbjct  3    KKSVGDLTAADLEGKRVLVRADLNVPLDDNQNITDDTRIRAAIPTIKYLLSNGAKVILTS  62

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EVK A D IG EV K+VA++ +G VLLLENVRF
Sbjct  63   HLGRPKGVTPKFSLAPLVPRLSELLGIEVKKAEDVIGPEVEKLVADLANGAVLLLENVRF  122

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFAKKLASLADL+VNDAFGTAHRAHAST
Sbjct  123  YKEEEKNDPEFAKKLASLADLFVNDAFGTAHRAHAST  159



>ref|XP_008226130.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Prunus mume]
Length=480

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            K+SVG L  ADLKGKRVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L + GA+VILSS
Sbjct  78   KRSVGDLSAADLKGKRVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A D IG EV K+VA +PDG VLLLENVRF
Sbjct  138  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKAEDSIGPEVEKLVASLPDGSVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLASLADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNDPEHAKKLASLADLYVNDAFGTAHRAHAST  234



>ref|XP_007213965.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
 gb|EMJ15164.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
Length=480

 Score =   259 bits (663),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            K+SVG L  ADLKGKRVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L + GA+VILSS
Sbjct  78   KRSVGDLSAADLKGKRVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A D IG EV K+VA +PDG VLLLENVRF
Sbjct  138  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKAEDSIGPEVEKLVASLPDGSVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLASLADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNDPEHAKKLASLADLYVNDAFGTAHRAHAST  234



>ref|XP_004306579.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Fragaria 
vesca subsp. vesca]
Length=480

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L EADLKGK+VFVR DLNVPLDD   ITDDTRIRAAVPTIKYL   GA+VILSS
Sbjct  78   KKSVGDLSEADLKGKKVFVRADLNVPLDDSQNITDDTRIRAAVPTIKYLMDKGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG ++  A D IG EV K+   +PDGGVLLLENVRF
Sbjct  138  HLGRPKGVTPKFSLAPLVPRLSELLGIQIVKAEDSIGPEVEKLATSLPDGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLAS+ADL+VNDAFGTAHRAHAST
Sbjct  198  YKEEEKNDPEHAKKLASVADLFVNDAFGTAHRAHAST  234



>ref|XP_008349091.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L + GA+VILSS
Sbjct  78   KKSVGDLTAAELKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A D IG EV K+VA +P+GGVLLLENVRF
Sbjct  138  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKAEDSIGPEVEKLVASLPEGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNDPEHAKKLAALADLYVNDAFGTAHRAHAST  234



>ref|XP_008383150.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L + GA+VILSS
Sbjct  78   KKSVGDLTAAELKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSS  137

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A D IG EV K+VA +P+GGVLLLENVRF
Sbjct  138  HLGRPKGVTPKFSLAPLVPRLSELLGIQVVKAEDSIGPEVEKLVASLPEGGVLLLENVRF  197

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPE AKKLA+LADLYVNDAFGTAHRAHAST
Sbjct  198  YKEEEKNDPEHAKKLAALADLYVNDAFGTAHRAHAST  234



>ref|XP_002972334.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
 gb|EFJ26420.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
Length=412

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 140/163 (86%), Gaps = 6/163 (4%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG LKEADLKGKRVFVR DLNVPLD DLKITDDTRIRAAVPTIKYL  NGA+VILSS
Sbjct  3    KKSVGDLKEADLKGKRVFVRADLNVPLDGDLKITDDTRIRAAVPTIKYLISNGAKVILSS  62

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLG------NEVKMANDCIGEEVVKMVAEIPDGGVLL  432
            HLGRPKGVT KY L PLVPRLSELLG      ++V+ A+D IG EV K VA +PDGGVLL
Sbjct  63   HLGRPKGVTDKYRLTPLVPRLSELLGIKASLFSQVEKADDSIGPEVEKKVAALPDGGVLL  122

Query  433  LENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            LENVRFY EEEKN PE A+KLA++ADLYVNDAFGTAHRAHAST
Sbjct  123  LENVRFYPEEEKNVPEHAQKLAAVADLYVNDAFGTAHRAHAST  165



>ref|XP_002971814.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
 gb|EFJ26731.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
Length=472

 Score =   257 bits (657),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 140/163 (86%), Gaps = 6/163 (4%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG LKEADLKGKRVFVR DLNVPLD DLKITDDTRIRAAVPTIKYL  NGA+VILSS
Sbjct  63   KKSVGDLKEADLKGKRVFVRADLNVPLDGDLKITDDTRIRAAVPTIKYLISNGAKVILSS  122

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLG------NEVKMANDCIGEEVVKMVAEIPDGGVLL  432
            HLGRPKGVT KY L PLVPRLSELLG      ++V+ A+D IG EV K VA +PDGGVLL
Sbjct  123  HLGRPKGVTDKYRLTPLVPRLSELLGIKASLFSQVEKADDSIGPEVEKKVAALPDGGVLL  182

Query  433  LENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            LENVRFY EEEKN PE A+KLA+LADLYVNDAFGTAHRAHAST
Sbjct  183  LENVRFYPEEEKNVPEHAQKLAALADLYVNDAFGTAHRAHAST  225



>ref|XP_004970259.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X2 [Setaria italica]
Length=484

 Score =   257 bits (656),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L  ADL+GKRV VR DLNVPLDD   ITDDTR+RAA+PTIK+L  NGA+V
Sbjct  84   TMA-KKSVGDLAAADLEGKRVLVRADLNVPLDDRQNITDDTRVRAAIPTIKHLVTNGAKV  142

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            IL SHLGRPKGVT K+SL PLVPRLSELLG +V+ A+D IG EV K+V+E+P+G +LLLE
Sbjct  143  ILCSHLGRPKGVTAKFSLAPLVPRLSELLGIQVQKADDVIGPEVEKLVSELPNGSILLLE  202

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  203  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  243



>ref|XP_008656415.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Zea mays]
Length=627

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L EADLKGKRVFVR DLNVPLD++  ITDDTRIRAA+PTI+YL   GA+V
Sbjct  222  TMA-KKSVGDLTEADLKGKRVFVRADLNVPLDENQNITDDTRIRAAIPTIQYLLGKGAKV  280

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILSSHLGRPKG TPK+SL PLV RLSELLG +V+ A+D IG EV K+VA +P+GGVLLLE
Sbjct  281  ILSSHLGRPKGFTPKFSLAPLVARLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLE  340

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKNDPEFA+KLAS+ADLYVNDAFGTAHRAHAST
Sbjct  341  NVRFYKEEEKNDPEFAQKLASVADLYVNDAFGTAHRAHAST  381



>ref|XP_002441313.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
 gb|EES19743.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
Length=483

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 140/161 (87%), Gaps = 1/161 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L EADL+GKRVFVR DLNVPLD++  ITDDTRIRAAVPTI+YL   GA+V
Sbjct  78   TMA-KKSVGDLTEADLEGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIQYLISKGAKV  136

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            ILSSHLGRPKG TPK+SL P+V RLSELLG +V+ A D IG EV K+V  +P GGVLLLE
Sbjct  137  ILSSHLGRPKGFTPKFSLGPIVGRLSELLGIQVQKAEDVIGPEVEKLVDALPIGGVLLLE  196

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKNDPEFA+KLASLADLYVNDAFGTAHRAHAST
Sbjct  197  NVRFYKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHAST  237



>ref|XP_004970258.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X1 [Setaria italica]
Length=485

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 141/162 (87%), Gaps = 2/162 (1%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARV  258
            TMA KKSVG L  ADL+GKRV VR DLNVPLDD   ITDDTR+RAA+PTIK+L  NGA+V
Sbjct  84   TMA-KKSVGDLAAADLEGKRVLVRADLNVPLDDRQNITDDTRVRAAIPTIKHLVTNGAKV  142

Query  259  ILSSHLGRPKGVTPKYSLKPLVPRLSELLG-NEVKMANDCIGEEVVKMVAEIPDGGVLLL  435
            IL SHLGRPKGVT K+SL PLVPRLSELLG  +V+ A+D IG EV K+V+E+P+G +LLL
Sbjct  143  ILCSHLGRPKGVTAKFSLAPLVPRLSELLGIQKVQKADDVIGPEVEKLVSELPNGSILLL  202

Query  436  ENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            ENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST
Sbjct  203  ENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  244



>dbj|BAJ88371.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +1

Query  139  VFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSSHLGRPKGVTPKYSLKP  318
            VFVR DLNVPLDD  KITDDTRIRA++PTIKYL + GA+VIL+SHLGRPKGVTPK+SLKP
Sbjct  1    VFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILASHLGRPKGVTPKFSLKP  60

Query  319  LVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRFYKEEEKNDPEFAKKLA  498
            LVPRLSELLG EV MA DCIG+EV K+ A +PDGGVLLLENVRFYKEEEKN+PEFAKKLA
Sbjct  61   LVPRLSELLGLEVVMAPDCIGQEVEKLAAALPDGGVLLLENVRFYKEEEKNEPEFAKKLA  120

Query  499  SLADLYVNDAFGTAHRAHAST  561
            S+ADLYVNDAFGTAHRAHAST
Sbjct  121  SVADLYVNDAFGTAHRAHAST  141



>gb|AGT16255.1| phosphoglycerate kinase [Saccharum hybrid cultivar R570]
Length=489

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 140/169 (83%), Gaps = 9/169 (5%)
 Frame = +1

Query  79   TMATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGAR-  255
            TMA KKSVG L  A+L+GKRV VR D NVPLDD   ITDDTR+RAA+PTIK+L  NGAR 
Sbjct  81   TMA-KKSVGDLAAAELEGKRVLVRADRNVPLDDSQNITDDTRVRAAIPTIKHLINNGARH  139

Query  256  -------VILSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIP  414
                   VIL+SHLGRPKGV+PK+SL PLVPRLSELLG +V+ A+D +G EV K+V+ +P
Sbjct  140  LINNGARVILTSHLGRPKGVSPKFSLAPLVPRLSELLGIQVQKADDVVGPEVEKLVSALP  199

Query  415  DGGVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            +G V+LLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAH ST
Sbjct  200  NGNVVLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHVST  248



>dbj|BAJ87335.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=370

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            M  +KS+ +L +ADLKGK+VFVR DL+VPLD+  +ITDDTRIRA+VPTIK+L + GA+VI
Sbjct  1    MKIEKSLRTLGDADLKGKKVFVRADLDVPLDNA-QITDDTRIRASVPTIKFLIKKGAKVI  59

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SHLG PKGVTPK+SLKPLVPRL ELLG +V MANDCIG EV K+ A +P+GGVLLLEN
Sbjct  60   LASHLGCPKGVTPKFSLKPLVPRLFELLGVDVVMANDCIGAEVEKLAAALPEGGVLLLEN  119

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYK E  ND +FAKKLAS+ADLYVNDAFGT H  HAST
Sbjct  120  VRFYKGEVNNDLKFAKKLASVADLYVNDAFGTPHWHHAST  159



>ref|WP_017323648.1| phosphoglycerate kinase [cyanobacterium PCC 7702]
Length=400

 Score =   231 bits (590),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ SL  ADL GKR FVRVD NVP+DD   ITDDTRIRAA+PTIK L + GA+VIL+
Sbjct  2    SKKTLASLSAADLSGKRAFVRVDFNVPVDDAGNITDDTRIRAALPTIKDLVRKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   NDCIGEEV   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQEVIKTNDCIGEEVAAKVAALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEE+NDPEFAKKLAS ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEQNDPEFAKKLASNADLYVNDAFGTAHRAHAST  159



>emb|CDX79325.1| BnaC06g19780D [Brassica napus]
Length=334

 Score =   229 bits (584),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            MATK+SVG+LKEADLKGK VFV VDL+VPLDD+  ITDDTRIRAAVPTIKYL  NG+RV+
Sbjct  1    MATKRSVGTLKEADLKGKSVFVSVDLSVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVL  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L SHLGR   VTPK+SLK LVPRLSELLG EV MAN+ IGEEV K+VA +P+GGVLLLEN
Sbjct  61   LCSHLGR--RVTPKFSLKILVPRLSELLGVEVVMANNSIGEEVQKLVAALPEGGVLLLEN  118

Query  442  VRFYKEEEKNDPEFAKKLASLADLY  516
            VRFYKEEEKNDPEFAKKLA+LADLY
Sbjct  119  VRFYKEEEKNDPEFAKKLAALADLY  143



>ref|XP_002951648.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
 sp|Q9SBN4.1|PGKH_VOLCA RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Volvox carteri]
 gb|AAD55564.1|AF110782_1 phosphoglycerate kinase precursor [Volvox carteri f. nagariensis]
 gb|EFJ47459.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
Length=462

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 132/161 (82%), Gaps = 2/161 (1%)
 Frame = +1

Query  85   ATKKSVGSLKEADLKGKRVFVRVDLNVPLDD-DLKITDDTRIRAAVPTIKYLTQNGARVI  261
            A KKSVG L +ADL+GKRVFVR DLNVPLD   L ITDDTRIRAAVPT+KYL  NGA+V+
Sbjct  61   AVKKSVGDLGKADLEGKRVFVRADLNVPLDKKTLAITDDTRIRAAVPTLKYLLDNGAKVL  120

Query  262  LSSHLGRPKGVTP-KYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            L+SHLGRPKG    KY L P+V RLSELLG EVK  +DCIG  V + VA +  G +LLLE
Sbjct  121  LTSHLGRPKGGPEDKYRLTPVVARLSELLGKEVKKVDDCIGPSVEQAVASLKSGELLLLE  180

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKNDPEFAKKLAS ADLYVNDAFGTAHRAHAST
Sbjct  181  NVRFYKEEEKNDPEFAKKLASNADLYVNDAFGTAHRAHAST  221



>ref|WP_015204810.1| phosphoglycerate kinase [Crinalium epipsammum]
 gb|AFZ14710.1| phosphoglycerate kinase [Crinalium epipsammum PCC 9333]
Length=400

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKSV +L  +DL GKRV VRVD NVPLDD   ITDDTRIRAA+PTI+ LT  GA+VIL+
Sbjct  2    SKKSVANLSASDLSGKRVLVRVDFNVPLDDAGNITDDTRIRAALPTIQDLTGKGAKVILT  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG +V   +DCIG+EV   V  + DG V LLENVR
Sbjct  62   SHFGRPKGVDDKLRLTPVAKRLSELLGQDVIKCDDCIGDEVTSSVGAMQDGQVALLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHAST  159



>emb|CDY52872.1| BnaCnng23600D [Brassica napus]
Length=797

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTRIRAA+PTIKYL  NGA+VILS+
Sbjct  433  KKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILST  492

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            HLGRPKGVTPK+SL PLVPRLSELLG EVK A+DCIG EV  +V  +P+GGVLLLENVRF
Sbjct  493  HLGRPKGVTPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVGSLPEGGVLLLENVRF  552

Query  451  YKEEEKNDPEFAKKLASLADLY  516
            Y+EEEKNDPEFAKKLASLADLY
Sbjct  553  YQEEEKNDPEFAKKLASLADLY  574



>ref|WP_035157181.1| phosphoglycerate kinase [Calothrix sp. 336/3]
 gb|KFB85656.1| phosphoglycerate kinase [Calothrix sp. 336/3]
Length=400

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ +L  ADL GKR FVRVD NVP+DD   ITDDTRIRAA+PTI+ LTQ GA+VIL+
Sbjct  2    SKKTLANLSAADLAGKRAFVRVDFNVPVDDAGNITDDTRIRAALPTIQDLTQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG++V   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVDDKLRLTPVAKRLSELLGQEVIKTDDCIGDDVAAKVAAMSNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFA+KLA+ ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAQKLAANADLYVNDAFGTAHRAHAST  159



>ref|WP_039205250.1| phosphoglycerate kinase [Aphanizomenon flos-aquae]
 gb|KHG38880.1| phosphoglycerate kinase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=401

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 126/160 (79%), Gaps = 0/160 (0%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVI  261
            M  KKS+ SL  AD+ GKR  VRVD NVP+DD   ITDDTRIRAA+PTI+ LTQ GA+VI
Sbjct  1    MCLKKSLASLSAADISGKRALVRVDFNVPVDDQGNITDDTRIRAALPTIQDLTQKGAKVI  60

Query  262  LSSHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLEN  441
            L+SH GRPKGV  K  L P+  RLSELLG EV   +DCIG++V   VA + +G VLLLEN
Sbjct  61   LTSHFGRPKGVDEKLRLTPVAKRLSELLGQEVIKTDDCIGDDVAAKVAALDNGQVLLLEN  120

Query  442  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            VRFYKEEEKNDPEFA+KLA+ AD YVNDAFGTAHRAHAST
Sbjct  121  VRFYKEEEKNDPEFAQKLAANADFYVNDAFGTAHRAHAST  160



>ref|XP_005851391.1| hypothetical protein CHLNCDRAFT_48457 [Chlorella variabilis]
 gb|EFN59289.1| hypothetical protein CHLNCDRAFT_48457 [Chlorella variabilis]
Length=399

 Score =   226 bits (577),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L +ADL+GK VFVR DLNVPLD D KITDDTRIRAAVPT+KYL  NGA+V+L+S
Sbjct  3    KKSVGDLSKADLEGKVVFVRADLNVPLDGD-KITDDTRIRAAVPTLKYLVDNGAKVLLTS  61

Query  271  HLGRPK-GVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            HLGRPK G   K+ L P+V RLSEL+G  V+ A DCIGE V   +A++ +G VLLLENVR
Sbjct  62   HLGRPKKGPEDKFRLTPVVGRLSELMGAAVEKAEDCIGEAVTSKLAKMSNGSVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FY EEEKNDPEFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  122  FYPEEEKNDPEFAKKLAAPADLYVNDAFGTAHRAHAST  159



>ref|WP_015140688.1| phosphoglycerate kinase [Nostoc sp. PCC 7524]
 gb|AFY50278.1| 3-phosphoglycerate kinase [Nostoc sp. PCC 7524]
Length=400

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ SL  AD+ GKR FVRVD NVP+DD   ITDDTRIRAA+PTI  LTQ GA+VIL+
Sbjct  2    SKKTLASLSAADISGKRAFVRVDFNVPVDDQGNITDDTRIRAALPTINDLTQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG+EV   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVDDKLRLTPVAKRLSELLGQEVIKTDDCIGDEVAAKVAALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKN+PEFAKKLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNEPEFAKKLAANADFYVNDAFGTAHRAHAST  159



>ref|WP_016949614.1| phosphoglycerate kinase [Anabaena sp. PCC 7108]
Length=400

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ SL  AD+ GKR  VRVD NVP+DD   ITDDTRIRAA+PTIK LT+ GA+VIL+
Sbjct  2    SKKSLASLSAADISGKRALVRVDFNVPVDDQGNITDDTRIRAALPTIKDLTEKGAKVILT  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGVT K  L P+  RLSELLG EV   +DCIG++V   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVTEKLRLTPVAKRLSELLGQEVVKTDDCIGDDVAAKVAALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FY EEEKNDPEFAKKLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYPEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHAST  159



>ref|WP_016873269.1| phosphoglycerate kinase [Chlorogloeopsis fritschii]
Length=400

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ +L  +DL GKR FVRVD NVP+DD   ITDDTRIRAA+PTIK L Q GA+VIL+
Sbjct  2    SKKTLANLSASDLSGKRAFVRVDFNVPVDDSGNITDDTRIRAALPTIKDLMQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIGEEV   V+ + +G VLLLENVR
Sbjct  62   SHFGRPKGVDDKLRLTPVAKRLSELLGQEVVKTDDCIGEEVAAKVSALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDP+FA+KLA+ ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPDFAQKLAANADLYVNDAFGTAHRAHAST  159



>ref|WP_011317630.1| phosphoglycerate kinase [Anabaena variabilis]
 sp|Q3MF40.1|PGK_ANAVT RecName: Full=Phosphoglycerate kinase [Anabaena variabilis ATCC 
29413]
 gb|ABA20396.1| phosphoglycerate kinase [Anabaena variabilis ATCC 29413]
Length=400

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK+V SL  AD+ GKR  VRVD NVPLDD   ITDDTRIRAA+PTI+ LTQ GA+VIL+
Sbjct  2    SKKTVASLSAADISGKRALVRVDFNVPLDDQGNITDDTRIRAALPTIQDLTQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +D IG+EV   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDSIGDEVAAKVAALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHAST  159



>ref|WP_010998270.1| phosphoglycerate kinase [Nostoc sp. PCC 7120]
 sp|Q8YPR1.1|PGK_NOSS1 RecName: Full=Phosphoglycerate kinase [Nostoc sp. PCC 7120]
 dbj|BAB75830.1| phosphoglycerate kinase [Nostoc sp. PCC 7120]
Length=400

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK+V SL  AD+ GKR  VRVD NVPLDD   ITDDTRIRAA+PTI+ LTQ GA+VIL+
Sbjct  2    SKKTVASLSAADISGKRALVRVDFNVPLDDQGNITDDTRIRAALPTIQDLTQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +D IG+EV   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQEVIKTDDSIGDEVAAKVATLQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHAST  159



>gb|KIY97385.1| phosphoglycerate kinase [Monoraphidium neglectum]
Length=229

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 130/162 (80%), Gaps = 2/162 (1%)
 Frame = +1

Query  82   MATKKSVGSLKEADLKGKRVFVRVDLNVPLDDD-LKITDDTRIRAAVPTIKYLTQNGARV  258
            ++ KKSVG L + DL+GKRVFVR DLNVPLD   L ITDDTRIRAAVPT+KYL  NGA+V
Sbjct  33   LSAKKSVGDLTKDDLEGKRVFVRADLNVPLDKQTLAITDDTRIRAAVPTLKYLLDNGAKV  92

Query  259  ILSSHLGRPK-GVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLL  435
            +L+SHLGRPK G   K+ L P+ PRLSELLG  V   +DCIG EV K V +  +G +LLL
Sbjct  93   LLTSHLGRPKSGPEDKFRLTPVAPRLSELLGKPVTKLDDCIGAEVEKAVVDAKNGELLLL  152

Query  436  ENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            ENVRFYKEEEKN+ EFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  153  ENVRFYKEEEKNEAEFAKKLAANADLYVNDAFGTAHRAHAST  194



>gb|AAW79325.1| phosphoglycerate kinase [Isochrysis galbana]
Length=436

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 129/158 (82%), Gaps = 2/158 (1%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L +ADL+GKRV VR DLNVPLD    ITDDTRIRA++PTIKYL  NGA+V+LSS
Sbjct  39   KKSVGDLTKADLEGKRVLVRCDLNVPLDGK-TITDDTRIRASIPTIKYLIDNGAKVLLSS  97

Query  271  HLGRPKGVTP-KYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            HLGRPKG    K+SL P+ PRLSELLG EV MA DCIG+ V   V ++ +G VLLLEN R
Sbjct  98   HLGRPKGGPEDKFSLGPVAPRLSELLGKEVTMAPDCIGDAVADCVTKMANGDVLLLENTR  157

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFA+KLA+ AD++VNDAFGTAHRAH ST
Sbjct  158  FYKEEEKNDPEFAEKLAANADMFVNDAFGTAHRAHGST  195



>ref|WP_006633515.1| phosphoglycerate kinase [Microcoleus vaginatus]
 gb|EGK87204.1| Phosphoglycerate kinase [Microcoleus vaginatus FGP-2]
Length=399

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 125/158 (79%), Gaps = 1/158 (1%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            TKK+V +L  +DL GKRV VR D NVPLD+   ITDDTRIRAA+PTI+ L   GA+VIL 
Sbjct  2    TKKTVANLSASDLSGKRVLVRADFNVPLDNG-NITDDTRIRAALPTIQDLASKGAKVILC  60

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGVT K  L P+  RLSELLG EVK  +DCIG+EV   VA + DG VLLLENVR
Sbjct  61   SHFGRPKGVTEKLRLTPVAKRLSELLGKEVKKTDDCIGDEVAATVAGMQDGDVLLLENVR  120

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FY EEE NDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  FYPEEEANDPEFAKKLASVADLYVNDAFGTAHRAHAST  158



>ref|WP_026734580.1| phosphoglycerate kinase [Fischerella sp. PCC 9605]
Length=400

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ +L   DL GKR FVRVD NVP+DD   ITDDTRIRAA+PTI+ L Q GA+VIL+
Sbjct  2    SKKTLANLSATDLSGKRAFVRVDFNVPMDDAGNITDDTRIRAALPTIQDLMQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG+EV   V  + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDCIGDEVAAKVGALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHAST  159



>ref|WP_017309094.1| MULTISPECIES: phosphoglycerate kinase [Stigonematales]
 gb|KIY12309.1| phosphoglycerate kinase [Mastigocladus laminosus UU774]
Length=400

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ +L   DL GKR FVRVD NVP+DD   ITDDTRIRAA+PTI+ L Q GA+VIL+
Sbjct  2    SKKTLANLSATDLSGKRAFVRVDFNVPVDDAGNITDDTRIRAALPTIQDLVQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV  A+DCIG++V   V  + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKADDCIGDDVAAKVGSLQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHAST  159



>ref|WP_015127481.1| phosphoglycerate kinase [Calothrix sp. PCC 7507]
 gb|AFY31659.1| phosphoglycerate kinase [Calothrix sp. PCC 7507]
Length=400

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ SL  AD+ GKR  VRVD NVP+DD   ITDDTRIRAA+PTI+ LTQ GA+VIL 
Sbjct  2    SKKSLASLSAADISGKRALVRVDFNVPVDDQGNITDDTRIRAALPTIQDLTQKGAKVILV  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   ND IG+EV   V  + +G VLLLENVR
Sbjct  62   SHFGRPKGVDDKLRLTPVAKRLSELLGQEVVKTNDSIGDEVAAAVGNLQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLAS AD YVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLASNADFYVNDAFGTAHRAHAST  159



>ref|WP_015177490.1| phosphoglycerate kinase [Oscillatoria nigro-viridis]
 gb|AFZ08239.1| phosphoglycerate kinase [Oscillatoria nigro-viridis PCC 7112]
Length=399

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 125/158 (79%), Gaps = 1/158 (1%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            TKK+V +L  +DL GKRV VR D NVPLD+   ITDDTRIRAA+PTI+ L   GA+VIL 
Sbjct  2    TKKTVANLSASDLSGKRVLVRADFNVPLDNG-NITDDTRIRAALPTIQDLASKGAKVILC  60

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGVT K  L P+  RLSELLG EVK  +DCIG+EV   VA + DG VLLLENVR
Sbjct  61   SHFGRPKGVTEKLRLTPVAVRLSELLGKEVKKTDDCIGDEVAATVAAMQDGDVLLLENVR  120

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FY EEE NDPEFAKKLAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  FYPEEEANDPEFAKKLASVADLYVNDAFGTAHRAHAST  158



>ref|WP_015162225.1| phosphoglycerate kinase [Chamaesiphon minutus]
 gb|AFY96141.1| 3-phosphoglycerate kinase [Chamaesiphon minutus PCC 6605]
Length=400

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ SL  ADL GKRV VR D NVP+DD   ITDDTRIRAA+PTIK LT  GA+VILS
Sbjct  2    SKKSIASLSAADLTGKRVLVRADFNVPVDDAGNITDDTRIRAALPTIKDLTGKGAKVILS  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG +V    DCIG+EV + +A + +G V LLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQDVVACKDCIGDEVARQIAAMSNGQVALLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FY EEEKNDPEFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  122  FYPEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHAST  159



>ref|WP_013192657.1| phosphoglycerate kinase [Trichormus azollae]
 gb|ADI65646.1| Phosphoglycerate kinase ['Nostoc azollae' 0708]
Length=400

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ SL  AD+ GKR  VRVD NVP+DD   ITDDTRIRAAVPTI+ LT+ GA+VIL+
Sbjct  2    SKKSLASLSAADISGKRALVRVDFNVPVDDQGSITDDTRIRAAVPTIQDLTKKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG++V   V  + +G VLLLENVR
Sbjct  62   SHFGRPKGVDDKLRLTPVAKRLSELLGQEVVKTDDCIGDDVAAKVGALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHAST  159



>ref|XP_002972143.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
 gb|EFJ27060.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
Length=402

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            TKKSVG L EAD+KGKRVF+R DLNVPLD +  ITDDTR+RAAVPTI+YL + GA++IL+
Sbjct  4    TKKSVGDLTEADVKGKRVFLRADLNVPLDAEFNITDDTRLRAAVPTIQYLRRLGAKIILA  63

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SHLGRPKG T    L PLV RLSELLG +V  A+D +G EV   +A + DGGVLLLEN+R
Sbjct  64   SHLGRPKGYTKSCCLAPLVGRLSELLGVKVDRADDSVGTEVEAKIAALDDGGVLLLENLR  123

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            F+ EEEKND E A+KL +LADLYVNDAFGTAHRAHAST
Sbjct  124  FHPEEEKNDEEHARKLGALADLYVNDAFGTAHRAHAST  161



>ref|WP_026719925.1| phosphoglycerate kinase [Fischerella sp. PCC 9431]
Length=400

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ +L   DL GKR FVRVD NVP+DD  KITDDTRIRAA+PTI+ L Q GA+VIL+
Sbjct  2    SKKTLANLSATDLSGKRAFVRVDFNVPVDDTGKITDDTRIRAALPTIQDLVQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG++V   +  + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDCIGDDVAAKIGALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHAST  159



>ref|XP_001699523.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
 gb|EDO98586.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
Length=462

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 131/161 (81%), Gaps = 2/161 (1%)
 Frame = +1

Query  85   ATKKSVGSLKEADLKGKRVFVRVDLNVPLDD-DLKITDDTRIRAAVPTIKYLTQNGARVI  261
            A KKSVG L +ADL+GKRVFVR DLNVPLD   L ITDDTRIRAAVPT+KYL  NGA+V+
Sbjct  61   AVKKSVGDLHKADLEGKRVFVRADLNVPLDKATLAITDDTRIRAAVPTLKYLLDNGAKVL  120

Query  262  LSSHLGRPKGVTP-KYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            L+SHLGRPKG    KY L P+V RLSELLG  V   +DCIG EV K V  + +G +LLLE
Sbjct  121  LTSHLGRPKGGPEDKYRLTPVVARLSELLGKPVTKVDDCIGPEVEKAVGAMKNGELLLLE  180

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            NVRFYKEEEKN+PEFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  181  NVRFYKEEEKNEPEFAKKLAANADLYVNDAFGTAHRAHAST  221



>ref|WP_009454679.1| MULTISPECIES: phosphoglycerate kinase [Fischerella]
 gb|EHC18638.1| Phosphoglycerate kinase [Fischerella sp. JSC-11]
Length=400

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ +L   DL GKR FVRVD NVP+DD   ITDDTRIRAA+PTI+ L Q GA+VIL+
Sbjct  2    SKKTLANLSATDLSGKRAFVRVDFNVPVDDAGNITDDTRIRAALPTIQDLVQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG+EV   V  + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDCIGDEVAAKVEALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHAST  159



>ref|WP_016865730.1| phosphoglycerate kinase [Fischerella muscicola]
Length=400

 Score =   224 bits (570),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ +L   DL GKR FVRVD NVP DD   ITDDTRIRAA+PTI+ L Q GA+VIL+
Sbjct  2    SKKTLANLSATDLSGKRAFVRVDFNVPTDDAGNITDDTRIRAALPTIQDLVQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG+EV   V  + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDCIGDEVAAKVGALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHAST  159



>sp|P41758.1|PGKH_CHLRE RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Chlamydomonas reinhardtii]
 gb|AAA70082.1| phosphoglycerate kinase precursor [Chlamydomonas reinhardtii]
 gb|AAQ14241.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
Length=461

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 130/161 (81%), Gaps = 2/161 (1%)
 Frame = +1

Query  85   ATKKSVGSLKEADLKGKRVFVRVDLNVPLDD-DLKITDDTRIRAAVPTIKYLTQNGARVI  261
            A KKSVG L +ADL+GKRVFVR DLNVPLD   L ITDDTRIRAAVPT+KYL  NGA+V+
Sbjct  60   AVKKSVGDLHKADLEGKRVFVRADLNVPLDKATLAITDDTRIRAAVPTLKYLLDNGAKVL  119

Query  262  LSSHLGRPKGVTP-KYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLE  438
            L+SHLGRPKG    KY L P+V RLSELLG  V   +DCIG EV K V  + +G +LLLE
Sbjct  120  LTSHLGRPKGGPEDKYRLTPVVARLSELLGKPVTKVDDCIGPEVEKAVGAMKNGELLLLE  179

Query  439  NVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            N RFYKEEEKN+PEFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  180  NCRFYKEEEKNEPEFAKKLAANADLYVNDAFGTAHRAHAST  220



>ref|XP_005791258.1| phosphoglycerate kinase, partial [Emiliania huxleyi CCMP1516]
 gb|EOD38829.1| phosphoglycerate kinase, partial [Emiliania huxleyi CCMP1516]
Length=269

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 129/158 (82%), Gaps = 2/158 (1%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KKSVG L EADLKGK+V VR DLNVPLD    ITDDTRIRA+VPT+KYL + GA+V+LSS
Sbjct  39   KKSVGDLSEADLKGKKVLVRCDLNVPLDGK-TITDDTRIRASVPTVKYLVEKGAKVLLSS  97

Query  271  HLGRPK-GVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            HLGRPK G   K+SL P+ PRLSELLG +V MA DCIG+ V + V ++ DG VLLLEN R
Sbjct  98   HLGRPKSGPEDKFSLGPVAPRLSELLGKDVVMAPDCIGDGVKECVDKMGDGDVLLLENTR  157

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKN PEFA+KLA+ ADL+VNDAFGTAHRAH ST
Sbjct  158  FYKEEEKNVPEFAEKLAANADLFVNDAFGTAHRAHGST  195



>ref|WP_026098466.1| phosphoglycerate kinase [Oscillatoria sp. PCC 10802]
Length=400

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KK+V +L  +DL GKRV VR D NVPLD+   ITDDTRIRAA+PTI+ LT  GA+VIL S
Sbjct  3    KKTVANLSASDLAGKRVLVRADFNVPLDEAGNITDDTRIRAALPTIQDLTGKGAKVILCS  62

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            H GRPKGV  K  L P+  RLSELLG EV   +DCIGEEV   V  + DG V LLENVRF
Sbjct  63   HFGRPKGVDDKLRLTPVAKRLSELLGQEVIKCDDCIGEEVASKVGAMQDGQVALLENVRF  122

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            YKEEEKNDPEFA+KLAS+ADLYVNDAFGTAHRAHAST
Sbjct  123  YKEEEKNDPEFAQKLASVADLYVNDAFGTAHRAHAST  159



>ref|WP_007352879.1| MULTISPECIES: phosphoglycerate kinase [Kamptonema]
 emb|CBN53648.1| Phosphoglycerate kinase [ [[Oscillatoria] sp. PCC 6506]
Length=399

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 126/158 (80%), Gaps = 1/158 (1%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            TKK++ +L  +DL GKRV VR D NVPLD+   ITDDTRIRAA+PTI+ LT  GA+VIL 
Sbjct  2    TKKTLANLSASDLSGKRVLVRADFNVPLDNG-NITDDTRIRAALPTIEDLTSKGAKVILC  60

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV+ K  L P+  RLSELLG EVK  +DCIGEEV  +VA + DG V+LLENVR
Sbjct  61   SHFGRPKGVSDKLRLTPVAARLSELLGKEVKKPSDCIGEEVAGVVAAMQDGDVILLENVR  120

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FY EEE NDPEFAK LAS+ADLYVNDAFGTAHRAHAST
Sbjct  121  FYPEEEANDPEFAKNLASVADLYVNDAFGTAHRAHAST  158



>ref|WP_028089947.1| phosphoglycerate kinase [Dolichospermum circinale]
Length=400

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ SL  AD+ GKR  VRVD NVP+DD   ITDDTRIRAA+PTI+ LTQ GA+VIL+
Sbjct  2    SKKSLASLSAADISGKRALVRVDFNVPVDDQGNITDDTRIRAALPTIQDLTQKGAKVILT  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLS LLG EV   +DCIG++V   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSALLGQEVIKTDDCIGDDVAAKVAALDNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFA+KLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAQKLAANADFYVNDAFGTAHRAHAST  159



>ref|WP_019495207.1| phosphoglycerate kinase [Calothrix sp. PCC 7103]
Length=400

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ +L  +DL GKR FVRVD NVPLDD   ITDDTRIRAA+PTI+ L   GA+VIL+
Sbjct  2    SKKSLANLSASDLSGKRAFVRVDFNVPLDDAGNITDDTRIRAALPTIQDLASKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG+EV   V  + +G VLLLENVR
Sbjct  62   SHFGRPKGVDDKLRLTPVAARLSELLGQEVVKCDDCIGDEVAAKVGSLQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKND EFA+KLAS ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDSEFAQKLASNADLYVNDAFGTAHRAHAST  159



>ref|WP_009628155.1| phosphoglycerate kinase [Pseudanabaena biceps]
 gb|ELS31754.1| phosphoglycerate kinase [Pseudanabaena biceps PCC 7429]
Length=400

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +1

Query  91   KKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSS  270
            KK++ SL  ADL GK+V VRVD NVP D+  KITDDTRIRAA+PTIKYLT+ GARVIL+S
Sbjct  3    KKNLASLTSADLAGKKVLVRVDFNVPQDEAGKITDDTRIRAALPTIKYLTEAGARVILTS  62

Query  271  HLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRF  450
            H GRPKGVT    L P+  RLSELLG  V   +DCIG+ V   V  + +G V LLENVRF
Sbjct  63   HFGRPKGVTESLRLNPVAVRLSELLGKPVVKTDDCIGDAVAAQVNALNNGDVALLENVRF  122

Query  451  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            Y EEEKNDPEFAKKLASLAD+YVNDAFGTAHRAHAST
Sbjct  123  YPEEEKNDPEFAKKLASLADIYVNDAFGTAHRAHAST  159



>gb|KIE11439.1| phosphoglycerate kinase [Tolypothrix bouteillei VB521301]
Length=400

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ +L  ADL GKR  VRVD NVPLDD   ITDDTRIRAA+PTI+ LTQ GA+VIL+
Sbjct  2    SKKSLANLSAADLSGKRALVRVDFNVPLDDAGNITDDTRIRAALPTIQDLTQKGAKVILT  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +D IG++V   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVDDKLRLTPVAKRLSELLGQEVVKTDDSIGDDVTAKVAALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEE+NDPEFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEQNDPEFAKKLAANADLYVNDAFGTAHRAHAST  159



>ref|WP_015217208.1| phosphoglycerate kinase [Anabaena cylindrica]
 gb|AFZ60594.1| phosphoglycerate kinase [Anabaena cylindrica PCC 7122]
Length=400

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 126/158 (80%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ SL  AD+ GKR  VRVD NVP+DD   ITDDTRIRAA+PTI+ LT+ GA+VIL+
Sbjct  2    SKKSLASLSAADVSGKRALVRVDFNVPVDDQGSITDDTRIRAALPTIQDLTKKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG++V   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVDDKLRLTPVAKRLSELLGQEVVKTDDCIGDDVAAKVAALQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKN+PEFAKKLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNEPEFAKKLAANADFYVNDAFGTAHRAHAST  159



>ref|XP_005855869.1| phosphoglycerate kinase, partial [Nannochloropsis gaditana CCMP526]
 gb|EKU20494.1| phosphoglycerate kinase, partial [Nannochloropsis gaditana CCMP526]
Length=197

 Score =   215 bits (548),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 124/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
             KKSVGSL +ADLKGKRVFVR DLNVPLD    ITDDTRIRA+VPTI+YL   GA+V+L+
Sbjct  2    AKKSVGSLADADLKGKRVFVRCDLNVPLDGK-TITDDTRIRASVPTIEYLASKGAKVLLT  60

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SHLGRPKG   K+SL P+  RL+ELLG +V    DCIGE V   VA + +G V LLENVR
Sbjct  61   SHLGRPKGKEDKFSLSPVADRLTELLGKKVAFVEDCIGEAVSTAVAGLKEGDVALLENVR  120

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FY EEEKN  EFA+KLA+ ADLYVNDAFGTAHRAH ST
Sbjct  121  FYPEEEKNVAEFAEKLAANADLYVNDAFGTAHRAHGST  158



>ref|WP_009631644.1| phosphoglycerate kinase [Synechocystis sp. PCC 7509]
Length=400

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ +L  +DL GKR  VRVD NVPLDD   ITDDTRIRAA+PTI+ L Q GA+ IL+
Sbjct  2    SKKTLANLSSSDLSGKRALVRVDFNVPLDDQGNITDDTRIRAALPTIQDLMQKGAKTILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGVT K  L P+  RLSELLG EV   +DCIGEEV   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVTDKLRLTPVAKRLSELLGTEVIKCDDCIGEEVTTKVAAMQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            F+ EEEKNDPEFAK+LA+ AD+YVNDAFGTAHRAHAST
Sbjct  122  FHPEEEKNDPEFAKQLAANADMYVNDAFGTAHRAHAST  159



>ref|WP_017655761.1| phosphoglycerate kinase [Microchaete sp. PCC 7126]
Length=400

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ SL  AD+ GKR  VRVD NVP+DD  KITDDTRIRAA+PTI+ LTQ GA+VIL 
Sbjct  2    SKKTLFSLSAADVSGKRALVRVDFNVPVDDQGKITDDTRIRAALPTIQDLTQKGAKVILV  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +D IG+EV   V E+ +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAQRLSELLGQEVIKTDDSIGDEVAAKVGELANGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFA+KLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAQKLAANADFYVNDAFGTAHRAHAST  159



>ref|WP_016861411.1| phosphoglycerate kinase [Fischerella muscicola]
Length=400

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KK++ +L   DL GKR FVRVD NVP+DD   ITDDTRIRAA+PTI+ L Q GA+VIL+
Sbjct  2    SKKTLANLSATDLSGKRAFVRVDFNVPVDDAGNITDDTRIRAALPTIQDLVQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG++V   V  + +G V+LLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDCIGDDVAAKVGALQNGQVILLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDPEFAKKLA+ ADLYVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHAST  159



>ref|WP_027404640.1| phosphoglycerate kinase [Aphanizomenon flos-aquae]
Length=400

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ SL  AD+ GKR  VRVD NVP+DD   ITDDTRIRAA+PTI+ LTQ GA+VIL+
Sbjct  2    SKKSLASLSAADISGKRALVRVDFNVPVDDQGNITDDTRIRAALPTIQDLTQKGAKVILA  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG++V   V  + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDCIGDDVAAKVGALANGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKNDP FA+KLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDPAFAEKLAANADFYVNDAFGTAHRAHAST  159



>ref|WP_015080710.1| phosphoglycerate kinase [Anabaena sp. 90]
 gb|AFW95556.1| phosphoglycerate kinase [Anabaena sp. 90]
Length=400

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ SL  AD+ GKR  VRVD NVP+DD   ITDDTRIRAA+PTI+ LTQ GA+VIL+
Sbjct  2    SKKSLASLSAADISGKRALVRVDFNVPVDDQGNITDDTRIRAALPTIQDLTQKGAKVILT  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLSELLG EV   +DCIG++V   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSELLGQEVIKTDDCIGDDVAAKVAALDNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FYKEEEKND EFA+KLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYKEEEKNDREFAQKLAANADFYVNDAFGTAHRAHAST  159



>ref|WP_028085373.1| phosphoglycerate kinase [Dolichospermum circinale]
Length=400

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ SL  AD+ GKR  VRVD NVP+DD   ITDDTRIRAA+PTI+ LTQ GA+VIL+
Sbjct  2    SKKSLASLSAADISGKRALVRVDFNVPVDDQGNITDDTRIRAALPTIQDLTQKGAKVILT  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV  K  L P+  RLS LLG EV   +DCIG++V   VA + +G VLLLENVR
Sbjct  62   SHFGRPKGVDEKLRLTPVAKRLSALLGQEVIKTDDCIGDDVAAKVAALDNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FY EEEKNDPEFA+KLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYAEEEKNDPEFAQKLAANADFYVNDAFGTAHRAHAST  159



>ref|WP_015205969.1| phosphoglycerate kinase [Cylindrospermum stagnale]
 gb|AFZ22711.1| 3-phosphoglycerate kinase [Cylindrospermum stagnale PCC 7417]
Length=400

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = +1

Query  88   TKKSVGSLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILS  267
            +KKS+ SL  AD+ GKR  VRVD NVP+DD   ITDDTRIRAA+PTIK LTQ GA+VIL 
Sbjct  2    SKKSLASLSAADISGKRALVRVDFNVPVDDQGNITDDTRIRAALPTIKDLTQKGAKVILV  61

Query  268  SHLGRPKGVTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVR  447
            SH GRPKGV+ K  L P+  RLSELLG +V  A+D IG+EV   V  + +G VLLLENVR
Sbjct  62   SHFGRPKGVSDKLRLTPVAKRLSELLGQDVVKADDSIGDEVAAKVGTLQNGQVLLLENVR  121

Query  448  FYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            FY EEEKNDPEFAKKLA+ AD YVNDAFGTAHRAHAST
Sbjct  122  FYPEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHAST  159



>ref|WP_026156411.1| phosphoglycerate kinase [Dehalobacter sp. FTH1]
Length=400

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 124/153 (81%), Gaps = 1/153 (1%)
 Frame = +1

Query  106  SLKEADLKGKRVFVRVDLNVPLDDDLKITDDTRIRAAVPTIKYLTQNGARVILSSHLGRP  285
             + E D+KGK VFVRVD NVP+DD   ITDDTRIRAA+PTI+YL +NGA+VIL+SHLGRP
Sbjct  5    GIDEIDVKGKCVFVRVDFNVPMDDQQNITDDTRIRAALPTIRYLKENGAKVILASHLGRP  64

Query  286  KG-VTPKYSLKPLVPRLSELLGNEVKMANDCIGEEVVKMVAEIPDGGVLLLENVRFYKEE  462
            KG V PKYSL P    LS LLG EVK+A DCIG +V  +V  + DG VLLLENVRF++EE
Sbjct  65   KGKVNPKYSLAPAAAHLSILLGTEVKLAPDCIGPKVAALVEHMEDGQVLLLENVRFHEEE  124

Query  463  EKNDPEFAKKLASLADLYVNDAFGTAHRAHAST  561
            EKNDP+FA+ LA LAD+YVNDAFG AHRAHAST
Sbjct  125  EKNDPDFARSLAGLADIYVNDAFGAAHRAHAST  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880