BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L18

Length=259
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009607506.1|  PREDICTED: sucrose-phosphatase 1                 78.2    1e-14   Nicotiana tomentosiformis
ref|XP_009774320.1|  PREDICTED: sucrose-phosphatase 1 isoform X1      77.8    1e-14   Nicotiana sylvestris
ref|XP_004228616.1|  PREDICTED: sucrose-phosphatase 1 isoform X2      77.0    3e-14   Solanum lycopersicum
ref|XP_010315846.1|  PREDICTED: sucrose-phosphatase 1 isoform X1      77.0    3e-14   Solanum lycopersicum
ref|XP_009774321.1|  PREDICTED: sucrose-phosphatase 1 isoform X2      75.9    5e-14   Nicotiana sylvestris
ref|XP_006348425.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose-phos...  74.3    2e-13   
ref|XP_011094210.1|  PREDICTED: sucrose-phosphatase 2-like            64.7    5e-10   Sesamum indicum [beniseed]
ref|XP_011047136.1|  PREDICTED: sucrose-phosphatase 1-like isofor...  62.8    2e-09   Populus euphratica
ref|XP_011047137.1|  PREDICTED: sucrose-phosphatase 1-like isofor...  62.8    2e-09   Populus euphratica
gb|AAO33161.1|AF493564_1  sucrose-phosphatase                         60.5    3e-09   Solanum lycopersicum
gb|KJB61977.1|  hypothetical protein B456_009G395300                  62.4    3e-09   Gossypium raimondii
sp|Q5IH14.1|SPP1_TOBAC  RecName: Full=Sucrose-phosphatase 1; Shor...  62.4    3e-09   Nicotiana tabacum [American tobacco]
gb|KJB61975.1|  hypothetical protein B456_009G395300                  62.4    3e-09   Gossypium raimondii
gb|KJB61974.1|  hypothetical protein B456_009G395300                  62.4    3e-09   Gossypium raimondii
gb|KHF98463.1|  Sucrose-phosphatase 2                                 62.4    3e-09   Gossypium arboreum [tree cotton]
ref|XP_011077781.1|  PREDICTED: sucrose-phosphatase 2-like isofor...  61.6    6e-09   Sesamum indicum [beniseed]
gb|KJB61986.1|  hypothetical protein B456_009G395300                  61.2    7e-09   Gossypium raimondii
ref|XP_009141524.1|  PREDICTED: probable sucrose-phosphatase 2        61.2    9e-09   Brassica rapa
emb|CDX84596.1|  BnaA03g16340D                                        60.8    1e-08   
emb|CDY40432.1|  BnaA04g20850D                                        60.8    1e-08   Brassica napus [oilseed rape]
gb|KJB61979.1|  hypothetical protein B456_009G395300                  60.1    1e-08   Gossypium raimondii
ref|XP_009631728.1|  PREDICTED: sucrose-phosphatase 2                 60.8    1e-08   Nicotiana tomentosiformis
ref|XP_006481641.1|  PREDICTED: sucrose-phosphatase 2-like isofor...  60.5    1e-08   Citrus sinensis [apfelsine]
emb|CDX79629.1|  BnaC03g19650D                                        60.5    1e-08   
ref|XP_009770901.1|  PREDICTED: sucrose-phosphatase 2 isoform X2      60.5    1e-08   Nicotiana sylvestris
ref|XP_009770900.1|  PREDICTED: sucrose-phosphatase 2 isoform X1      60.5    1e-08   Nicotiana sylvestris
emb|CDY32084.1|  BnaC04g44820D                                        60.1    2e-08   Brassica napus [oilseed rape]
gb|EYU18148.1|  hypothetical protein MIMGU_mgv1a005333mg              60.5    2e-08   Erythranthe guttata [common monkey flower]
ref|NP_001275110.1|  sucrose-phosphatase                              60.1    2e-08   Solanum tuberosum [potatoes]
ref|XP_006339186.1|  PREDICTED: sucrose-phosphatase 2                 60.1    2e-08   
emb|CDP10562.1|  unnamed protein product                              60.1    2e-08   Coffea canephora [robusta coffee]
gb|KJB61980.1|  hypothetical protein B456_009G395300                  59.7    2e-08   Gossypium raimondii
gb|ABS52707.1|  sucrose-phosphatase                                   59.3    3e-08   Solanum tuberosum [potatoes]
ref|XP_009133047.1|  PREDICTED: probable sucrose-phosphatase 2        59.7    3e-08   Brassica rapa
gb|KDO70699.1|  hypothetical protein CISIN_1g014638mg                 59.7    3e-08   Citrus sinensis [apfelsine]
ref|NP_001234683.1|  sucrose-phosphatase                              59.7    3e-08   Solanum lycopersicum
ref|XP_010677590.1|  PREDICTED: probable sucrose-phosphatase 2        59.7    3e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO70696.1|  hypothetical protein CISIN_1g014638mg                 59.3    4e-08   Citrus sinensis [apfelsine]
ref|XP_006430008.1|  hypothetical protein CICLE_v10011822mg           58.9    5e-08   
sp|Q5IH13.1|SPP2_TOBAC  RecName: Full=Sucrose-phosphatase 2; Shor...  58.9    5e-08   Nicotiana tabacum [American tobacco]
ref|XP_010505109.1|  PREDICTED: probable sucrose-phosphatase 2        58.5    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006410754.1|  hypothetical protein EUTSA_v10016712mg           58.5    6e-08   Eutrema salsugineum [saltwater cress]
ref|XP_002309266.1|  sucrose-phosphatase family protein               58.5    6e-08   Populus trichocarpa [western balsam poplar]
gb|AAS79794.1|  sucrose phosphate phosphatase                         58.5    7e-08   Actinidia chinensis
ref|XP_010516791.1|  PREDICTED: probable sucrose-phosphatase 2        58.5    7e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002879579.1|  sucrose-phosphatase 1                            58.5    7e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_011047138.1|  PREDICTED: sucrose-phosphatase 1-like isofor...  58.5    8e-08   Populus euphratica
ref|NP_565828.1|  putative sucrose-phosphatase 2                      58.2    8e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516654.1|  PREDICTED: probable sucrose-phosphatase 2        58.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_011077782.1|  PREDICTED: sucrose-phosphatase 2-like isofor...  58.2    1e-07   Sesamum indicum [beniseed]
gb|ABI17892.1|  sucrose phosphatase                                   57.8    1e-07   Coffea canephora [robusta coffee]
gb|KDP36073.1|  hypothetical protein JCGZ_08717                       57.8    1e-07   Jatropha curcas
ref|XP_002524098.1|  sucrose phosphate phosphatase, putative          57.4    2e-07   
gb|EEE56283.1|  hypothetical protein OsJ_05345                        57.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|AAZ03742.1|  sucrose phosphate phosphatase                         57.4    2e-07   Ricinus communis
ref|XP_010110450.1|  putative sucrose-phosphatase 2                   57.4    2e-07   
gb|EEC72465.1|  hypothetical protein OsI_05817                        57.0    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_011042543.1|  PREDICTED: sucrose-phosphatase 1 isoform X1      56.6    3e-07   Populus euphratica
ref|XP_010941762.1|  PREDICTED: sucrose-phosphatase 2-like            56.6    4e-07   Elaeis guineensis
ref|XP_011042544.1|  PREDICTED: sucrose-phosphatase 2 isoform X2      56.2    4e-07   Populus euphratica
ref|XP_002322765.2|  sucrose-phosphatase family protein               56.2    4e-07   Populus trichocarpa [western balsam poplar]
ref|XP_002452127.1|  hypothetical protein SORBIDRAFT_04g020180        56.2    5e-07   
gb|AAS79792.1|  sucrose phosphate phosphatase                         55.8    5e-07   Malus domestica [apple tree]
ref|XP_004303391.1|  PREDICTED: sucrose-phosphatase 1                 55.8    6e-07   Fragaria vesca subsp. vesca
ref|XP_008655415.1|  PREDICTED: sucrose-phosphatase 1 isoform X1      55.8    6e-07   
ref|NP_001105006.1|  sucrose-phosphatase 1                            55.8    6e-07   
gb|EEC70676.1|  hypothetical protein OsI_01999                        55.8    6e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_008366607.1|  PREDICTED: sucrose-phosphatase 2-like            55.8    6e-07   
gb|AAS79795.1|  sucrose phosphate phosphatase                         55.8    6e-07   Actinidia chinensis
ref|XP_009362647.1|  PREDICTED: sucrose-phosphatase 2-like            55.8    6e-07   Pyrus x bretschneideri [bai li]
ref|XP_006826412.1|  hypothetical protein AMTR_s00004p00156880        55.8    6e-07   
ref|XP_007145761.1|  hypothetical protein PHAVU_007G265500g           55.8    6e-07   Phaseolus vulgaris [French bean]
ref|XP_007203884.1|  hypothetical protein PRUPE_ppa006143mg           55.8    7e-07   Prunus persica
gb|ACJ85046.1|  unknown                                               55.1    7e-07   Medicago truncatula
ref|XP_008807286.1|  PREDICTED: sucrose-phosphatase 2-like            55.8    7e-07   Phoenix dactylifera
gb|AAG31075.1|AF283565_1  sucrose-phosphatase                         55.5    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008392008.1|  PREDICTED: probable sucrose-phosphatase 2 is...  55.5    7e-07   
ref|XP_003557469.1|  PREDICTED: sucrose-phosphatase 2                 55.5    7e-07   Brachypodium distachyon [annual false brome]
gb|AAO33156.1|AF493559_1  sucrose-phosphatase                         55.5    8e-07   Aegilops speltoides
ref|XP_008241119.1|  PREDICTED: probable sucrose-phosphatase 2        55.5    8e-07   Prunus mume [ume]
gb|EMS66525.1|  Sucrose-phosphatase 2                                 55.5    8e-07   Triticum urartu
gb|AAK09372.1|AF321557_1  sucrose-6F-phosphate phosphohydrolase SPP2  55.5    8e-07   Triticum aestivum [Canadian hard winter wheat]
gb|EPS73451.1|  sucrose phosphatase                                   55.1    8e-07   Genlisea aurea
ref|NP_001045866.1|  Os02g0143100                                     55.5    8e-07   
gb|AAG31076.1|AF283566_1  sucrose-phosphatase                         55.5    8e-07   Medicago truncatula
ref|XP_008392007.1|  PREDICTED: probable sucrose-phosphatase 2 is...  55.5    9e-07   
gb|AAK31789.1|  sucrose-6F-phosphate phosphohydrolase SPP3            55.5    9e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010532383.1|  PREDICTED: probable sucrose-phosphatase 2        55.5    9e-07   Tarenaya hassleriana [spider flower]
ref|XP_010509550.1|  PREDICTED: probable sucrose-phosphatase 2        55.1    1e-06   Camelina sativa [gold-of-pleasure]
gb|AAK09371.1|AF321556_1  sucrose-6F-phosphate phosphohydrolase SPP1  55.1    1e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004968780.1|  PREDICTED: sucrose-phosphatase 1-like            55.1    1e-06   Setaria italica
ref|XP_004958283.1|  PREDICTED: sucrose-phosphatase 1-like isofor...  55.1    1e-06   Setaria italica
ref|XP_002269810.1|  PREDICTED: sucrose-phosphatase 1                 55.1    1e-06   Vitis vinifera
ref|XP_006646874.1|  PREDICTED: sucrose-phosphatase 2-like            54.7    1e-06   Oryza brachyantha
gb|AFK37304.1|  unknown                                               54.3    2e-06   Lotus japonicus
gb|AAZ03743.1|  sucrose phosphate phosphatase                         54.3    2e-06   Saccharum officinarum [noble cane]
ref|NP_001043081.1|  Os01g0376700                                     54.3    2e-06   
gb|AAO33157.1|AF493560_1  sucrose-phosphatase                         54.3    2e-06   Secale cereale
gb|KCW90408.1|  hypothetical protein EUGRSUZ_A02547                   54.3    2e-06   Eucalyptus grandis [rose gum]
sp|Q94E75.1|SPP1_ORYSJ  RecName: Full=Probable sucrose-phosphatas...  54.3    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008790096.1|  PREDICTED: sucrose-phosphatase 2-like isofor...  53.9    3e-06   Phoenix dactylifera
ref|XP_009348572.1|  PREDICTED: probable sucrose-phosphatase 2 is...  54.3    3e-06   Pyrus x bretschneideri [bai li]
gb|AAO33159.1|AF493562_1  sucrose-phosphatase                         53.9    3e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009383754.1|  PREDICTED: sucrose-phosphatase 2-like            53.9    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006294622.1|  hypothetical protein CARUB_v10023659mg           53.5    3e-06   
gb|KCW65165.1|  hypothetical protein EUGRSUZ_G02659                   53.5    3e-06   Eucalyptus grandis [rose gum]
ref|XP_008442968.1|  PREDICTED: sucrose-phosphatase 1                 53.5    4e-06   Cucumis melo [Oriental melon]
ref|XP_006644185.1|  PREDICTED: probable sucrose-phosphatase 1-like   53.5    4e-06   Oryza brachyantha
ref|XP_009348580.1|  PREDICTED: probable sucrose-phosphatase 2 is...  53.5    4e-06   Pyrus x bretschneideri [bai li]
ref|XP_010058779.1|  PREDICTED: sucrose-phosphatase 2                 53.5    4e-06   Eucalyptus grandis [rose gum]
ref|XP_007010546.1|  Sucrose-6F-phosphate phosphohydrolase family...  52.8    7e-06   
ref|XP_010067097.1|  PREDICTED: sucrose-phosphatase 2-like isofor...  52.8    9e-06   Eucalyptus grandis [rose gum]
ref|XP_010917912.1|  PREDICTED: sucrose-phosphatase 2-like isofor...  52.4    9e-06   Elaeis guineensis
ref|XP_010067096.1|  PREDICTED: sucrose-phosphatase 2-like isofor...  52.8    9e-06   Eucalyptus grandis [rose gum]
ref|XP_010067098.1|  PREDICTED: sucrose-phosphatase 2-like isofor...  52.4    1e-05   Eucalyptus grandis [rose gum]
ref|XP_003535832.1|  PREDICTED: sucrose-phosphatase 1-like isofor...  52.4    1e-05   Glycine max [soybeans]
gb|ACU23242.1|  unknown                                               52.4    1e-05   Glycine max [soybeans]
ref|XP_007028058.1|  Sucrose-phosphatase 1 isoform 1                  52.0    1e-05   
ref|XP_002894316.1|  predicted protein                                52.0    1e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_007028060.1|  Sucrose-6F-phosphate phosphohydrolase family...  51.2    2e-05   
ref|XP_004161283.1|  PREDICTED: sucrose-phosphatase 1-like            51.6    2e-05   
ref|XP_004136534.1|  PREDICTED: sucrose-phosphatase 1-like            51.6    2e-05   Cucumis sativus [cucumbers]
ref|XP_010268155.1|  PREDICTED: sucrose-phosphatase 2-like            51.2    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_006605356.1|  PREDICTED: uncharacterized protein LOC100796...  51.2    3e-05   Glycine max [soybeans]
ref|XP_010461973.1|  PREDICTED: probable sucrose-phosphatase 1        50.8    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010479625.1|  PREDICTED: probable sucrose-phosphatase 1        50.8    3e-05   Camelina sativa [gold-of-pleasure]
emb|CDY03617.1|  BnaC03g68760D                                        50.8    3e-05   
ref|XP_009107208.1|  PREDICTED: probable sucrose-phosphatase 1        50.8    3e-05   Brassica rapa
ref|XP_004497625.1|  PREDICTED: sucrose-phosphatase 1-like            50.8    3e-05   Cicer arietinum [garbanzo]
ref|XP_010500718.1|  PREDICTED: probable sucrose-phosphatase 1        50.4    4e-05   Camelina sativa [gold-of-pleasure]
gb|AFK47160.1|  unknown                                               48.9    4e-05   Medicago truncatula
ref|XP_003589863.1|  Sucrose-phosphatase                              50.1    4e-05   
ref|NP_175553.1|  sucrose-phosphatase 1                               50.4    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307613.1|  hypothetical protein CARUB_v10009241mg           50.4    4e-05   Capsella rubella
ref|XP_003589862.1|  Sucrose-phosphatase                              50.4    5e-05   
ref|XP_002986252.1|  hypothetical protein SELMODRAFT_182236           50.1    6e-05   Selaginella moellendorffii
gb|AES60113.2|  sucrose phosphate phosphatase                         50.1    6e-05   Medicago truncatula
ref|XP_010103975.1|  Sucrose-phosphatase 2                            50.1    6e-05   Morus notabilis
gb|ACJ84344.1|  unknown                                               49.3    7e-05   Medicago truncatula
gb|KJB60363.1|  hypothetical protein B456_009G301900                  49.7    8e-05   Gossypium raimondii
gb|KJB60362.1|  hypothetical protein B456_009G301900                  49.7    8e-05   Gossypium raimondii
sp|A3AZW5.1|SPP3_ORYSJ  RecName: Full=Probable sucrose-phosphatas...  49.7    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEE62305.1|  hypothetical protein OsJ_17094                        49.7    8e-05   Oryza sativa Japonica Group [Japonica rice]
gb|KDO48682.1|  hypothetical protein CISIN_1g040434mg                 47.4    9e-05   Citrus sinensis [apfelsine]
ref|XP_006393055.1|  hypothetical protein EUTSA_v10011514mg           49.7    9e-05   Eutrema salsugineum [saltwater cress]
gb|KHG10002.1|  Sucrose-phosphatase 1                                 49.3    9e-05   Gossypium arboreum [tree cotton]
ref|XP_006654037.1|  PREDICTED: probable sucrose-phosphatase 3-like   49.3    9e-05   
gb|EEC78505.1|  hypothetical protein OsI_18433                        49.3    1e-04   Oryza sativa Indica Group [Indian rice]
gb|AAT93996.1|  putative sucrose phosphatase                          49.3    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|KDP27528.1|  hypothetical protein JCGZ_20166                       48.9    1e-04   Jatropha curcas
gb|KJB60365.1|  hypothetical protein B456_009G301900                  48.5    1e-04   Gossypium raimondii
gb|KJB60367.1|  hypothetical protein B456_009G301900                  47.8    2e-04   Gossypium raimondii
ref|XP_010515695.1|  PREDICTED: probable sucrose-phosphatase 3b i...  48.9    2e-04   Camelina sativa [gold-of-pleasure]
gb|KHN05360.1|  Sucrose-phosphatase 1                                 48.5    2e-04   Glycine soja [wild soybean]
gb|EMS54577.1|  putative sucrose-phosphatase 3                        48.1    2e-04   Triticum urartu
ref|NP_001241573.1|  uncharacterized protein LOC100796915             48.1    2e-04   Glycine max [soybeans]
gb|EMT18778.1|  Putative sucrose-phosphatase 3                        48.1    3e-04   
ref|XP_006445667.1|  hypothetical protein CICLE_v10015425mg           48.1    3e-04   
ref|XP_003568956.1|  PREDICTED: probable sucrose-phosphatase 3        47.8    3e-04   Brachypodium distachyon [annual false brome]
gb|AHA61683.1|  putative sucrose phosphatase                          47.8    4e-04   Sorghum bicolor [broomcorn]
ref|XP_002439265.1|  hypothetical protein SORBIDRAFT_09g003460        47.8    4e-04   
ref|XP_007145373.1|  hypothetical protein PHAVU_007G233700g           47.4    4e-04   Phaseolus vulgaris [French bean]
gb|ACR38611.1|  unknown                                               47.4    4e-04   Zea mays [maize]
ref|XP_009139466.1|  PREDICTED: probable sucrose-phosphatase 3b i...  47.4    5e-04   Brassica rapa
ref|XP_002985069.1|  hypothetical protein SELMODRAFT_121516           47.0    5e-04   
gb|ABK25441.1|  unknown                                               47.0    6e-04   Picea sitchensis
ref|XP_006403814.1|  hypothetical protein EUTSA_v10010361mg           47.0    6e-04   
ref|XP_002439266.1|  hypothetical protein SORBIDRAFT_09g003463        47.0    7e-04   
gb|ACN28398.1|  unknown                                               47.0    7e-04   Zea mays [maize]
ref|XP_008662328.1|  PREDICTED: sucrose-phosphatase 2 isoform X1      46.6    8e-04   Zea mays [maize]
emb|CAC07925.1|  putative protein                                     46.6    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105652.1|  sucrose-phosphatase 2                            46.6    9e-04   Zea mays [maize]



>ref|XP_009607506.1| PREDICTED: sucrose-phosphatase 1 [Nicotiana tomentosiformis]
Length=466

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  92   CSAHAPHRHSISLSFQSENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            CS   P   S + SFQ+E N R  MDRLTSAARLMI SDLDHTM DHHDPENLSL
Sbjct  19   CSTPTPKLSSFT-SFQTEVNFRSIMDRLTSAARLMIVSDLDHTMVDHHDPENLSL  72



>ref|XP_009774320.1| PREDICTED: sucrose-phosphatase 1 isoform X1 [Nicotiana sylvestris]
Length=466

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  92   CSAHAPHRHSISLSFQSENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            CS   P   S + SFQ+E N R  MDRLTSAARLMI SDLDHTM DHHDPENLSL
Sbjct  19   CSTPTPKLSSFT-SFQTEVNFRSIMDRLTSAARLMIVSDLDHTMVDHHDPENLSL  72



>ref|XP_004228616.1| PREDICTED: sucrose-phosphatase 1 isoform X2 [Solanum lycopersicum]
Length=466

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  131  SFQSENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            SFQSE NI+ TMDRLTSAARLMI SDLD+TM DHHDPENLSL
Sbjct  30   SFQSEANIKSTMDRLTSAARLMIVSDLDYTMIDHHDPENLSL  71



>ref|XP_010315846.1| PREDICTED: sucrose-phosphatase 1 isoform X1 [Solanum lycopersicum]
Length=475

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  131  SFQSENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            SFQSE NI+ TMDRLTSAARLMI SDLD+TM DHHDPENLSL
Sbjct  30   SFQSEANIKSTMDRLTSAARLMIVSDLDYTMIDHHDPENLSL  71



>ref|XP_009774321.1| PREDICTED: sucrose-phosphatase 1 isoform X2 [Nicotiana sylvestris]
Length=401

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  92   CSAHAPHRHSISLSFQSENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            CS   P   S + SFQ+E N R  MDRLTSAARLMI SDLDHTM DHHDPENLSL
Sbjct  19   CSTPTPKLSSFT-SFQTEVNFRSIMDRLTSAARLMIVSDLDHTMVDHHDPENLSL  72



>ref|XP_006348425.1| PREDICTED: LOW QUALITY PROTEIN: sucrose-phosphatase 1-like [Solanum 
tuberosum]
Length=466

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  131  SFQSENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            SFQSE NI+ TMDRLTSAARLMI SDLD+TM DHHD ENLSL
Sbjct  30   SFQSEANIKSTMDRLTSAARLMIVSDLDYTMVDHHDSENLSL  71



>ref|XP_011094210.1| PREDICTED: sucrose-phosphatase 2-like [Sesamum indicum]
Length=469

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 7/62 (11%)
 Frame = +2

Query  77   PFFF-RCSAHAPHRHSISLSF-QSENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENL  250
            PF   RCS  A     ++ +F QSE+++R+TMDRL   A LMI SDLDHTM DHHD ENL
Sbjct  19   PFLLTRCSTTA-----VATAFSQSESSLRKTMDRLAGNANLMIVSDLDHTMVDHHDSENL  73

Query  251  SL  256
            SL
Sbjct  74   SL  75



>ref|XP_011047136.1| PREDICTED: sucrose-phosphatase 1-like isoform X1 [Populus euphratica]
Length=433

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  155  RETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            RE MDRL + ARLMI SDLDHTM DHHDPEN+SL
Sbjct  7    REAMDRLKAPARLMIVSDLDHTMVDHHDPENMSL  40



>ref|XP_011047137.1| PREDICTED: sucrose-phosphatase 1-like isoform X2 [Populus euphratica]
Length=432

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  155  RETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            RE MDRL + ARLMI SDLDHTM DHHDPEN+SL
Sbjct  7    REAMDRLKAPARLMIVSDLDHTMVDHHDPENMSL  40



>gb|AAO33161.1|AF493564_1 sucrose-phosphatase [Solanum lycopersicum]
Length=205

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRLTSAARLMI SDLD+TM DHHDPENLSL
Sbjct  1    MDRLTSAARLMIVSDLDYTMIDHHDPENLSL  31



>gb|KJB61977.1| hypothetical protein B456_009G395300 [Gossypium raimondii]
Length=379

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDR+T AARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRITKAARLMIVSDLDHTMVDHHDPENMSL  31



>sp|Q5IH14.1|SPP1_TOBAC RecName: Full=Sucrose-phosphatase 1; Short=NtSPP1 [Nicotiana 
tabacum]
 gb|AAW32902.1| sucrose-6-phosphate phosphatase [Nicotiana tabacum]
Length=425

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+LTSAARLMI SDLDHTM DHHDPENLSL
Sbjct  1    MDQLTSAARLMIVSDLDHTMVDHHDPENLSL  31



>gb|KJB61975.1| hypothetical protein B456_009G395300 [Gossypium raimondii]
 gb|KJB61976.1| hypothetical protein B456_009G395300 [Gossypium raimondii]
 gb|KJB61983.1| hypothetical protein B456_009G395300 [Gossypium raimondii]
 gb|KJB61984.1| hypothetical protein B456_009G395300 [Gossypium raimondii]
 gb|KJB61985.1| hypothetical protein B456_009G395300 [Gossypium raimondii]
Length=426

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDR+T AARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRITKAARLMIVSDLDHTMVDHHDPENMSL  31



>gb|KJB61974.1| hypothetical protein B456_009G395300 [Gossypium raimondii]
 gb|KJB61978.1| hypothetical protein B456_009G395300 [Gossypium raimondii]
Length=437

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDR+T AARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRITKAARLMIVSDLDHTMVDHHDPENMSL  31



>gb|KHF98463.1| Sucrose-phosphatase 2 [Gossypium arboreum]
Length=437

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDR+T AARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRITKAARLMIVSDLDHTMVDHHDPENMSL  31



>ref|XP_011077781.1| PREDICTED: sucrose-phosphatase 2-like isoform X1 [Sesamum indicum]
Length=438

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  137  QSENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            + E ++ +TMDRL   ARLMI SDLDHTM DHHDPENLSL
Sbjct  5    RREASLLKTMDRLAGNARLMIVSDLDHTMVDHHDPENLSL  44



>gb|KJB61986.1| hypothetical protein B456_009G395300 [Gossypium raimondii]
Length=392

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDR+T AARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRITKAARLMIVSDLDHTMVDHHDPENMSL  31



>ref|XP_009141524.1| PREDICTED: probable sucrose-phosphatase 2 [Brassica rapa]
Length=422

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS ARLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLTSPARLMIVSDLDHTMVDHHDPENLSL  31



>emb|CDX84596.1| BnaA03g16340D [Brassica napus]
Length=424

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS ARLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLTSPARLMIVSDLDHTMVDHHDPENLSL  31



>emb|CDY40432.1| BnaA04g20850D [Brassica napus]
Length=422

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS ARLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLTSPARLMIVSDLDHTMVDHHDPENLSL  31



>gb|KJB61979.1| hypothetical protein B456_009G395300 [Gossypium raimondii]
Length=317

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDR+T AARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRITKAARLMIVSDLDHTMVDHHDPENMSL  31



>ref|XP_009631728.1| PREDICTED: sucrose-phosphatase 2 [Nicotiana tomentosiformis]
Length=425

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/31 (90%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRLTSAARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLTSAARLMIVSDLDHTMVDHHDAENLSL  31



>ref|XP_006481641.1| PREDICTED: sucrose-phosphatase 2-like isoform X1 [Citrus sinensis]
 ref|XP_006481642.1| PREDICTED: sucrose-phosphatase 2-like isoform X2 [Citrus sinensis]
 ref|XP_006481643.1| PREDICTED: sucrose-phosphatase 2-like isoform X3 [Citrus sinensis]
Length=421

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRLT+AARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLTAAARLMIVSDLDHTMVDHHDAENLSL  31



>emb|CDX79629.1| BnaC03g19650D [Brassica napus]
Length=446

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS+ARLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLTSSARLMIVSDLDHTMVDHHDPENLSL  31



>ref|XP_009770901.1| PREDICTED: sucrose-phosphatase 2 isoform X2 [Nicotiana sylvestris]
Length=394

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/31 (90%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRLTSAARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLTSAARLMIVSDLDHTMVDHHDAENLSL  31



>ref|XP_009770900.1| PREDICTED: sucrose-phosphatase 2 isoform X1 [Nicotiana sylvestris]
Length=425

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/31 (90%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRLTSAARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLTSAARLMIVSDLDHTMVDHHDAENLSL  31



>emb|CDY32084.1| BnaC04g44820D [Brassica napus]
Length=422

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS ARLMI SDLDHTM DHHDPENL+L
Sbjct  1    MERLTSPARLMIVSDLDHTMVDHHDPENLAL  31



>gb|EYU18148.1| hypothetical protein MIMGU_mgv1a005333mg [Erythranthe guttata]
Length=488

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  143  ENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            E+ +R+TMDRL   ARLMI SDLDHTM DHHD ENLS+
Sbjct  57   ESTLRKTMDRLAENARLMIVSDLDHTMVDHHDAENLSI  94



>ref|NP_001275110.1| sucrose-phosphatase [Solanum tuberosum]
 gb|ABS52706.1| sucrose-phosphatase [Solanum tuberosum]
Length=425

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/31 (90%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRLTSAARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLTSAARLMIVSDLDHTMVDHHDSENLSL  31



>ref|XP_006339186.1| PREDICTED: sucrose-phosphatase 2 [Solanum tuberosum]
Length=425

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/31 (90%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRLTSAARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLTSAARLMIVSDLDHTMVDHHDSENLSL  31



>emb|CDP10562.1| unnamed protein product [Coffea canephora]
Length=507

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  140  SENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            +E +I+ TMDRL  AA LMI SDLDHTM DHHDPEN+SL
Sbjct  75   NEVHIKVTMDRLADAAHLMIVSDLDHTMVDHHDPENMSL  113



>gb|KJB61980.1| hypothetical protein B456_009G395300 [Gossypium raimondii]
Length=395

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDR+T AARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRITKAARLMIVSDLDHTMVDHHDPENMSL  31



>gb|ABS52707.1| sucrose-phosphatase, partial [Solanum tuberosum]
Length=331

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+LTSAARLMI SDLD+TM DHHDPENLSL
Sbjct  1    MDQLTSAARLMIVSDLDYTMVDHHDPENLSL  31



>ref|XP_009133047.1| PREDICTED: probable sucrose-phosphatase 2 [Brassica rapa]
 ref|XP_009133048.1| PREDICTED: probable sucrose-phosphatase 2 [Brassica rapa]
Length=424

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL+S ARLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLSSPARLMIVSDLDHTMVDHHDPENLSL  31



>gb|KDO70699.1| hypothetical protein CISIN_1g014638mg [Citrus sinensis]
Length=396

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL++AARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLSAAARLMIVSDLDHTMVDHHDAENLSL  31



>ref|NP_001234683.1| sucrose-phosphatase [Solanum lycopersicum]
 gb|AAO33160.1|AF493563_1 sucrose-phosphatase [Solanum lycopersicum]
Length=425

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/31 (90%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRLTSAARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLTSAARLMIVSDLDHTMVDHHDSENLSL  31



>ref|XP_010677590.1| PREDICTED: probable sucrose-phosphatase 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010677591.1| PREDICTED: probable sucrose-phosphatase 2 [Beta vulgaris subsp. 
vulgaris]
Length=425

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL+S ARLMI SDLDHTM DHHDPENLS+
Sbjct  1    MDRLSSPARLMIVSDLDHTMVDHHDPENLSI  31



>gb|KDO70696.1| hypothetical protein CISIN_1g014638mg [Citrus sinensis]
 gb|KDO70697.1| hypothetical protein CISIN_1g014638mg [Citrus sinensis]
 gb|KDO70698.1| hypothetical protein CISIN_1g014638mg [Citrus sinensis]
Length=421

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL++AARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLSAAARLMIVSDLDHTMVDHHDAENLSL  31



>ref|XP_006430008.1| hypothetical protein CICLE_v10011822mg [Citrus clementina]
 ref|XP_006430009.1| hypothetical protein CICLE_v10011822mg [Citrus clementina]
 ref|XP_006430010.1| hypothetical protein CICLE_v10011822mg [Citrus clementina]
 gb|ESR43248.1| hypothetical protein CICLE_v10011822mg [Citrus clementina]
 gb|ESR43249.1| hypothetical protein CICLE_v10011822mg [Citrus clementina]
 gb|ESR43250.1| hypothetical protein CICLE_v10011822mg [Citrus clementina]
Length=421

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL++AARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLSAAARLMIVSDLDHTMVDHHDAENLSL  31



>sp|Q5IH13.1|SPP2_TOBAC RecName: Full=Sucrose-phosphatase 2; Short=NtSPP2 [Nicotiana 
tabacum]
 gb|AAW32903.1| sucrose-6-phosphate phosphatase [Nicotiana tabacum]
Length=425

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+LTSAARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDQLTSAARLMIVSDLDHTMVDHHDAENLSL  31



>ref|XP_010505109.1| PREDICTED: probable sucrose-phosphatase 2 [Camelina sativa]
Length=422

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS  RLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDHTMVDHHDPENLSL  31



>ref|XP_006410754.1| hypothetical protein EUTSA_v10016712mg [Eutrema salsugineum]
 gb|ESQ52207.1| hypothetical protein EUTSA_v10016712mg [Eutrema salsugineum]
Length=422

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS  RLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDHTMVDHHDPENLSL  31



>ref|XP_002309266.1| sucrose-phosphatase family protein [Populus trichocarpa]
 gb|EEE92789.1| sucrose-phosphatase family protein [Populus trichocarpa]
Length=424

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRLKAPARLMIVSDLDHTMVDHHDPENMSL  31



>gb|AAS79794.1| sucrose phosphate phosphatase [Actinidia chinensis]
Length=425

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARLMI SDLDHTM DHHDPENLSL
Sbjct  1    MDRLNKSARLMIVSDLDHTMVDHHDPENLSL  31



>ref|XP_010516791.1| PREDICTED: probable sucrose-phosphatase 2 [Camelina sativa]
Length=422

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS  RLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDHTMVDHHDPENLSL  31



>ref|XP_002879579.1| sucrose-phosphatase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55838.1| sucrose-phosphatase 1 [Arabidopsis lyrata subsp. lyrata]
Length=422

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS  RLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDHTMVDHHDPENLSL  31



>ref|XP_011047138.1| PREDICTED: sucrose-phosphatase 1-like isoform X3 [Populus euphratica]
Length=424

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRLKAPARLMIVSDLDHTMVDHHDPENMSL  31



>ref|NP_565828.1| putative sucrose-phosphatase 2 [Arabidopsis thaliana]
 ref|NP_973609.1| putative sucrose-phosphatase 2 [Arabidopsis thaliana]
 ref|NP_001189687.1| putative sucrose-phosphatase 2 [Arabidopsis thaliana]
 sp|Q9SJ66.2|SPP2_ARATH RecName: Full=Probable sucrose-phosphatase 2; Short=AtSPP2 [Arabidopsis 
thaliana]
 gb|AAK96665.1| Unknown protein [Arabidopsis thaliana]
 gb|AAD21473.2| expressed protein [Arabidopsis thaliana]
 gb|AAM47953.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09168.1| putative sucrose-phosphatase 2 [Arabidopsis thaliana]
 gb|AEC09169.1| putative sucrose-phosphatase 2 [Arabidopsis thaliana]
 gb|AEC09170.1| putative sucrose-phosphatase 2 [Arabidopsis thaliana]
Length=422

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS  RLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDHTMVDHHDPENLSL  31



>ref|XP_010516654.1| PREDICTED: probable sucrose-phosphatase 2 [Camelina sativa]
Length=422

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS  RLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDHTMVDHHDPENLSL  31



>ref|XP_011077782.1| PREDICTED: sucrose-phosphatase 2-like isoform X2 [Sesamum indicum]
 ref|XP_011077783.1| PREDICTED: sucrose-phosphatase 2-like isoform X2 [Sesamum indicum]
Length=425

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/31 (84%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL   ARLMI SDLDHTM DHHDPENLSL
Sbjct  1    MDRLAGNARLMIVSDLDHTMVDHHDPENLSL  31



>gb|ABI17892.1| sucrose phosphatase [Coffea canephora]
Length=425

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  AA LMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRLADAAHLMIVSDLDHTMVDHHDPENMSL  31



>gb|KDP36073.1| hypothetical protein JCGZ_08717 [Jatropha curcas]
Length=463

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRLKAPARLMIVSDLDHTMVDHHDPENMSL  31



>ref|XP_002524098.1| sucrose phosphate phosphatase, putative [Ricinus communis]
 gb|EEF38308.1| sucrose phosphate phosphatase, putative [Ricinus communis]
Length=421

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRLKAPARLMIVSDLDHTMVDHHDPENMSL  31



>gb|EEE56283.1| hypothetical protein OsJ_05345 [Oryza sativa Japonica Group]
Length=487

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  104  APHRHSISLSFQSENNIRE-TMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            AP R S SL  ++    +   MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  44   APSRASCSLRRRARGASQAGKMDKLNGSARLMIVSDLDHTMVDHHDEENLSL  95



>gb|AAZ03742.1| sucrose phosphate phosphatase [Ricinus communis]
Length=421

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHDPEN+SL
Sbjct  1    MDRLKAPARLMIVSDLDHTMVDHHDPENMSL  31



>ref|XP_010110450.1| putative sucrose-phosphatase 2 [Morus notabilis]
 gb|EXC26392.1| putative sucrose-phosphatase 2 [Morus notabilis]
Length=519

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  155  RETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            R  M RL++ ARLMI SDLDHTM DHHDPENLSL
Sbjct  113  RTIMARLSAPARLMIVSDLDHTMVDHHDPENLSL  146



>gb|EEC72465.1| hypothetical protein OsI_05817 [Oryza sativa Indica Group]
Length=479

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +2

Query  104  APHRHSISLSFQSENNIRE-TMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            AP R S SL   +    +   MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  44   APSRASCSLRRSARGASQAGKMDKLNGSARLMIVSDLDHTMVDHHDEENLSL  95



>ref|XP_011042543.1| PREDICTED: sucrose-phosphatase 1 isoform X1 [Populus euphratica]
Length=425

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL + ARLMI SDLDHTM DHHDPEN+SL
Sbjct  2    MNRLNAPARLMIVSDLDHTMVDHHDPENMSL  32



>ref|XP_010941762.1| PREDICTED: sucrose-phosphatase 2-like [Elaeis guineensis]
Length=424

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL   ARLMI SDLDHTM DHHDPENLSL
Sbjct  1    MNRLNGPARLMIVSDLDHTMVDHHDPENLSL  31



>ref|XP_011042544.1| PREDICTED: sucrose-phosphatase 2 isoform X2 [Populus euphratica]
Length=398

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL + ARLMI SDLDHTM DHHDPEN+SL
Sbjct  2    MNRLNAPARLMIVSDLDHTMVDHHDPENMSL  32



>ref|XP_002322765.2| sucrose-phosphatase family protein [Populus trichocarpa]
 gb|EEF04526.2| sucrose-phosphatase family protein [Populus trichocarpa]
Length=425

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M RL + ARLMI SDLDHTM DHHDPEN+SL
Sbjct  2    MKRLNAPARLMIVSDLDHTMVDHHDPENMSL  32



>ref|XP_002452127.1| hypothetical protein SORBIDRAFT_04g020180 [Sorghum bicolor]
 gb|EES05103.1| hypothetical protein SORBIDRAFT_04g020180 [Sorghum bicolor]
Length=423

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L+ +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLSGSARLMIVSDLDHTMVDHHDEENLSL  31



>gb|AAS79792.1| sucrose phosphate phosphatase [Malus domestica]
Length=425

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLEAPARLMIVSDLDHTMVDHHDTENLSL  31



>ref|XP_004303391.1| PREDICTED: sucrose-phosphatase 1 [Fragaria vesca subsp. vesca]
Length=425

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLKAPARLMIVSDLDHTMVDHHDKENLSL  31



>ref|XP_008655415.1| PREDICTED: sucrose-phosphatase 1 isoform X1 [Zea mays]
 gb|ACF83834.1| unknown [Zea mays]
 gb|AFW82211.1| sucrose-phosphatase1 [Zea mays]
Length=423

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L+ +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLSGSARLMIVSDLDHTMVDHHDEENLSL  31



>ref|NP_001105006.1| sucrose-phosphatase 1 [Zea mays]
 sp|Q9FQ11.1|SPP1_MAIZE RecName: Full=Sucrose-phosphatase 1; Short=ZmSPP1 [Zea mays]
 gb|AAG31074.1|AF283564_1 sucrose-phosphatase [Zea mays]
 gb|ACG39958.1| sucrose phosphate synthase [Zea mays]
Length=423

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L+ +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLSGSARLMIVSDLDHTMVDHHDEENLSL  31



>gb|EEC70676.1| hypothetical protein OsI_01999 [Oryza sativa Indica Group]
Length=423

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L+ +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLSGSARLMIVSDLDHTMVDHHDEENLSL  31



>ref|XP_008366607.1| PREDICTED: sucrose-phosphatase 2-like [Malus domestica]
 ref|XP_008366608.1| PREDICTED: sucrose-phosphatase 2-like [Malus domestica]
Length=425

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLEAPARLMIVSDLDHTMVDHHDTENLSL  31



>gb|AAS79795.1| sucrose phosphate phosphatase [Actinidia chinensis]
Length=425

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL+S+AR+MI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLSSSARVMIVSDLDHTMVDHHDSENLSL  31



>ref|XP_009362647.1| PREDICTED: sucrose-phosphatase 2-like [Pyrus x bretschneideri]
Length=425

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLEAPARLMIVSDLDHTMVDHHDTENLSL  31



>ref|XP_006826412.1| hypothetical protein AMTR_s00004p00156880 [Amborella trichopoda]
 gb|ERM93649.1| hypothetical protein AMTR_s00004p00156880 [Amborella trichopoda]
Length=493

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL   ARLMI SDLDHTM DHHDPENLS+
Sbjct  8    MDRLNGPARLMIVSDLDHTMVDHHDPENLSI  38



>ref|XP_007145761.1| hypothetical protein PHAVU_007G265500g [Phaseolus vulgaris]
 ref|XP_007145762.1| hypothetical protein PHAVU_007G265500g [Phaseolus vulgaris]
 gb|ESW17755.1| hypothetical protein PHAVU_007G265500g [Phaseolus vulgaris]
 gb|ESW17756.1| hypothetical protein PHAVU_007G265500g [Phaseolus vulgaris]
Length=416

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL S+ RLM+ SDLDHTM DHHDPEN SL
Sbjct  1    MDRLNSSPRLMLVSDLDHTMVDHHDPENSSL  31



>ref|XP_007203884.1| hypothetical protein PRUPE_ppa006143mg [Prunus persica]
 gb|EMJ05083.1| hypothetical protein PRUPE_ppa006143mg [Prunus persica]
Length=425

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLKAPARLMIVSDLDHTMVDHHDTENLSL  31



>gb|ACJ85046.1| unknown [Medicago truncatula]
Length=298

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL S+ARLMI SDLDHTM DHHD EN SL
Sbjct  1    MDRLKSSARLMIVSDLDHTMVDHHDAENSSL  31



>ref|XP_008807286.1| PREDICTED: sucrose-phosphatase 2-like [Phoenix dactylifera]
Length=424

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL   ARLMI SDLDHTM DHHDPENLSL
Sbjct  1    MNRLNGPARLMIVSDLDHTMVDHHDPENLSL  31



>gb|AAG31075.1|AF283565_1 sucrose-phosphatase [Arabidopsis thaliana]
Length=420

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  170  RLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            RLTS  RLMI SDLDHTM DHHDPENLSL
Sbjct  1    RLTSPPRLMIVSDLDHTMVDHHDPENLSL  29



>ref|XP_008392008.1| PREDICTED: probable sucrose-phosphatase 2 isoform X2 [Malus domestica]
Length=425

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLEAPARLMIVSDLDHTMVDHHDTENLSL  31



>ref|XP_003557469.1| PREDICTED: sucrose-phosphatase 2 [Brachypodium distachyon]
 ref|XP_010228269.1| PREDICTED: sucrose-phosphatase 2 [Brachypodium distachyon]
Length=422

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLKGSARLMIVSDLDHTMVDHHDEENLSL  31



>gb|AAO33156.1|AF493559_1 sucrose-phosphatase [Aegilops speltoides]
Length=422

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLKGSARLMIVSDLDHTMVDHHDEENLSL  31



>ref|XP_008241119.1| PREDICTED: probable sucrose-phosphatase 2 [Prunus mume]
Length=425

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLKAPARLMIVSDLDHTMVDHHDTENLSL  31



>gb|EMS66525.1| Sucrose-phosphatase 2 [Triticum urartu]
Length=390

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLKGSARLMIVSDLDHTMVDHHDEENLSL  31



>gb|AAK09372.1|AF321557_1 sucrose-6F-phosphate phosphohydrolase SPP2 [Triticum aestivum]
Length=422

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLKGSARLMIVSDLDHTMVDHHDEENLSL  31



>gb|EPS73451.1| sucrose phosphatase, partial [Genlisea aurea]
Length=314

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL   ARLMI SDLDHTM DHHDPENLSL
Sbjct  1    MERLAGNARLMIVSDLDHTMVDHHDPENLSL  31



>ref|NP_001045866.1| Os02g0143100 [Oryza sativa Japonica Group]
 sp|Q6YXW6.1|SPP2_ORYSJ RecName: Full=Sucrose-phosphatase 2; Short=OsSPP2 [Oryza sativa 
Japonica Group]
 dbj|BAD13232.1| putative sucrose-phosphatase [Oryza sativa Japonica Group]
 dbj|BAF07780.1| Os02g0143100 [Oryza sativa Japonica Group]
 dbj|BAG88651.1| unnamed protein product [Oryza sativa Japonica Group]
Length=423

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLNGSARLMIVSDLDHTMVDHHDEENLSL  31



>gb|AAG31076.1|AF283566_1 sucrose-phosphatase [Medicago truncatula]
 gb|KEH41814.1| sucrose-6F-phosphate phosphohydrolase [Medicago truncatula]
Length=419

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL S+ARLMI SDLDHTM DHHD EN SL
Sbjct  1    MDRLKSSARLMIVSDLDHTMVDHHDAENSSL  31



>ref|XP_008392007.1| PREDICTED: probable sucrose-phosphatase 2 isoform X1 [Malus domestica]
Length=477

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  155  RETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            R  MDRL + ARLMI SDLDHTM DHHD ENLSL
Sbjct  50   RIVMDRLEAPARLMIVSDLDHTMVDHHDTENLSL  83



>gb|AAK31789.1| sucrose-6F-phosphate phosphohydrolase SPP3 [Triticum aestivum]
Length=422

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLKGSARLMIVSDLDHTMVDHHDEENLSL  31



>ref|XP_010532383.1| PREDICTED: probable sucrose-phosphatase 2 [Tarenaya hassleriana]
 ref|XP_010532384.1| PREDICTED: probable sucrose-phosphatase 2 [Tarenaya hassleriana]
 ref|XP_010532385.1| PREDICTED: probable sucrose-phosphatase 2 [Tarenaya hassleriana]
Length=425

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS  RLMI SDLDHTM DHHD ENLSL
Sbjct  1    MERLTSPPRLMIVSDLDHTMVDHHDAENLSL  31



>ref|XP_010509550.1| PREDICTED: probable sucrose-phosphatase 2 [Camelina sativa]
Length=422

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS  RLMI SDLDHTM DHHD ENLSL
Sbjct  1    MERLTSPPRLMIVSDLDHTMVDHHDSENLSL  31



>gb|AAK09371.1|AF321556_1 sucrose-6F-phosphate phosphohydrolase SPP1 [Triticum aestivum]
Length=422

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLKGSARLMIVSDLDHTMVDHHDEENLSL  31



>ref|XP_004968780.1| PREDICTED: sucrose-phosphatase 1-like [Setaria italica]
Length=423

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLNGSARLMIVSDLDHTMVDHHDEENLSL  31



>ref|XP_004958283.1| PREDICTED: sucrose-phosphatase 1-like isoform X1 [Setaria italica]
 ref|XP_004958284.1| PREDICTED: sucrose-phosphatase 1-like isoform X2 [Setaria italica]
Length=423

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLNGSARLMIVSDLDHTMVDHHDEENLSL  31



>ref|XP_002269810.1| PREDICTED: sucrose-phosphatase 1 [Vitis vinifera]
 ref|XP_010653242.1| PREDICTED: sucrose-phosphatase 1 [Vitis vinifera]
 emb|CAN77297.1| hypothetical protein VITISV_022385 [Vitis vinifera]
 emb|CBI39109.3| unnamed protein product [Vitis vinifera]
Length=424

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLNNPARLMIVSDLDHTMVDHHDSENLSL  31



>ref|XP_006646874.1| PREDICTED: sucrose-phosphatase 2-like [Oryza brachyantha]
Length=422

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLGGSARLMIVSDLDHTMVDHHDDENLSL  31



>gb|AFK37304.1| unknown [Lotus japonicus]
Length=419

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL S+ARLMI SDLDHTM DHHD EN SL
Sbjct  1    MDRLQSSARLMIVSDLDHTMVDHHDEENSSL  31



>gb|AAZ03743.1| sucrose phosphate phosphatase [Saccharum officinarum]
Length=420

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L+ + RLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKLSGSVRLMIVSDLDHTMVDHHDEENLSL  31



>ref|NP_001043081.1| Os01g0376700 [Oryza sativa Japonica Group]
 dbj|BAF04995.1| Os01g0376700 [Oryza sativa Japonica Group]
Length=423

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L+ +ARL+I SDLDHTM DHHD ENLSL
Sbjct  1    MDKLSGSARLIIVSDLDHTMVDHHDEENLSL  31



>gb|AAO33157.1|AF493560_1 sucrose-phosphatase [Secale cereale]
Length=422

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD++  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKVKGSARLMIVSDLDHTMVDHHDEENLSL  31



>gb|KCW90408.1| hypothetical protein EUGRSUZ_A02547 [Eucalyptus grandis]
Length=528

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 3/44 (7%)
 Frame = +2

Query  125  SLSFQSENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            S S Q E N   TM+RL+S+A+LM+ SDLDHTM DHHD EN+SL
Sbjct  94   SHSPQVEPN---TMERLSSSAKLMVVSDLDHTMVDHHDHENMSL  134



>sp|Q94E75.1|SPP1_ORYSJ RecName: Full=Probable sucrose-phosphatase 1; Short=OsSPP1 [Oryza 
sativa Japonica Group]
 dbj|BAB61165.1| sucrose-phosphatase-like protein [Oryza sativa Japonica Group]
 dbj|BAG92541.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54607.1| hypothetical protein OsJ_01840 [Oryza sativa Japonica Group]
Length=423

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L+ +ARL+I SDLDHTM DHHD ENLSL
Sbjct  1    MDKLSGSARLIIVSDLDHTMVDHHDEENLSL  31



>ref|XP_008790096.1| PREDICTED: sucrose-phosphatase 2-like isoform X1 [Phoenix dactylifera]
 ref|XP_008790104.1| PREDICTED: sucrose-phosphatase 2-like isoform X1 [Phoenix dactylifera]
Length=424

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL   ARLMI SDLD TM DHHDPENLSL
Sbjct  1    MDRLDGRARLMIVSDLDQTMVDHHDPENLSL  31



>ref|XP_009348572.1| PREDICTED: probable sucrose-phosphatase 2 isoform X1 [Pyrus x 
bretschneideri]
Length=520

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHD ENLSL
Sbjct  96   MDRLEAPARLMIVSDLDHTMVDHHDTENLSL  126



>gb|AAO33159.1|AF493562_1 sucrose-phosphatase [Hordeum vulgare subsp. vulgare]
Length=422

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD++  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MDKVKGSARLMIVSDLDHTMVDHHDEENLSL  31



>ref|XP_009383754.1| PREDICTED: sucrose-phosphatase 2-like [Musa acuminata subsp. 
malaccensis]
Length=424

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL   ARLMI SDLDHTM DHHDPEN SL
Sbjct  1    MDRLDGPARLMIVSDLDHTMVDHHDPENTSL  31



>ref|XP_006294622.1| hypothetical protein CARUB_v10023659mg [Capsella rubella]
 gb|EOA27520.1| hypothetical protein CARUB_v10023659mg [Capsella rubella]
Length=319

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RLTS  RLMI SDLDHTM DHHD ENLSL
Sbjct  1    MERLTSPPRLMIVSDLDHTMVDHHDHENLSL  31



>gb|KCW65165.1| hypothetical protein EUGRSUZ_G02659 [Eucalyptus grandis]
Length=318

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  158  ETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            + MDRL  AARLMI SDLD TM DH DPENLSL
Sbjct  2    KVMDRLDGAARLMIVSDLDSTMVDHLDPENLSL  34



>ref|XP_008442968.1| PREDICTED: sucrose-phosphatase 1 [Cucumis melo]
Length=423

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL+++ARLMI SDLDHTM DHHD EN SL
Sbjct  1    MERLSASARLMIVSDLDHTMVDHHDSENFSL  31



>ref|XP_006644185.1| PREDICTED: probable sucrose-phosphatase 1-like [Oryza brachyantha]
Length=423

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M++L  +ARLMI SDLDHTM DHHD ENLSL
Sbjct  1    MEKLNGSARLMIVSDLDHTMVDHHDEENLSL  31



>ref|XP_009348580.1| PREDICTED: probable sucrose-phosphatase 2 isoform X2 [Pyrus x 
bretschneideri]
Length=511

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL + ARLMI SDLDHTM DHHD ENLSL
Sbjct  87   MDRLEAPARLMIVSDLDHTMVDHHDTENLSL  117



>ref|XP_010058779.1| PREDICTED: sucrose-phosphatase 2 [Eucalyptus grandis]
 ref|XP_010058785.1| PREDICTED: sucrose-phosphatase 2 [Eucalyptus grandis]
Length=425

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL+S+A+LM+ SDLDHTM DHHD EN+SL
Sbjct  1    MERLSSSAKLMVVSDLDHTMVDHHDHENMSL  31



>ref|XP_007010546.1| Sucrose-6F-phosphate phosphohydrolase family protein isoform 
1 [Theobroma cacao]
 gb|EOY19356.1| Sucrose-6F-phosphate phosphohydrolase family protein isoform 
1 [Theobroma cacao]
Length=451

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL   ARLMI SDLD TM DH DPENLSL
Sbjct  1    MDRLNGPARLMIVSDLDQTMVDHDDPENLSL  31



>ref|XP_010067097.1| PREDICTED: sucrose-phosphatase 2-like isoform X2 [Eucalyptus 
grandis]
Length=497

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  158  ETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            + MDRL  AARLMI SDLD TM DH DPENLSL
Sbjct  69   KVMDRLDGAARLMIVSDLDSTMVDHLDPENLSL  101



>ref|XP_010917912.1| PREDICTED: sucrose-phosphatase 2-like isoform X1 [Elaeis guineensis]
Length=424

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD L   ARLMI SDLD+TM DHHDPENLSL
Sbjct  1    MDHLDGCARLMIVSDLDNTMVDHHDPENLSL  31



>ref|XP_010067096.1| PREDICTED: sucrose-phosphatase 2-like isoform X1 [Eucalyptus 
grandis]
Length=507

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  158  ETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            + MDRL  AARLMI SDLD TM DH DPENLSL
Sbjct  69   KVMDRLDGAARLMIVSDLDSTMVDHLDPENLSL  101



>ref|XP_010067098.1| PREDICTED: sucrose-phosphatase 2-like isoform X3 [Eucalyptus 
grandis]
Length=440

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  158  ETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            + MDRL  AARLMI SDLD TM DH DPENLSL
Sbjct  2    KVMDRLDGAARLMIVSDLDSTMVDHLDPENLSL  34



>ref|XP_003535832.1| PREDICTED: sucrose-phosphatase 1-like isoform X1 [Glycine max]
 ref|XP_006588892.1| PREDICTED: sucrose-phosphatase 1-like isoform X2 [Glycine max]
 ref|XP_006588893.1| PREDICTED: sucrose-phosphatase 1-like isoform X3 [Glycine max]
 gb|KHN05754.1| Sucrose-phosphatase 1 [Glycine soja]
Length=418

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL S+ +LMI SDLDHTM DHHD EN SL
Sbjct  1    MDRLKSSPQLMIVSDLDHTMVDHHDSENWSL  31



>gb|ACU23242.1| unknown [Glycine max]
Length=418

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL S+ +LMI SDLDHTM DHHD EN SL
Sbjct  1    MDRLKSSPQLMIVSDLDHTMVDHHDSENWSL  31



>ref|XP_007028058.1| Sucrose-phosphatase 1 isoform 1 [Theobroma cacao]
 ref|XP_007028059.1| Sucrose-phosphatase 1 isoform 1 [Theobroma cacao]
 gb|EOY08560.1| Sucrose-phosphatase 1 isoform 1 [Theobroma cacao]
 gb|EOY08561.1| Sucrose-phosphatase 1 isoform 1 [Theobroma cacao]
Length=425

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+R+   ARLMI SDLDHTM DHHD EN+SL
Sbjct  1    MNRIAMGARLMIVSDLDHTMVDHHDAENMSL  31



>ref|XP_002894316.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70575.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHH-DPENLSL  256
            M+RLTS  RLMI SDLD TM DHH DPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDETMVDHHKDPENLSL  32



>ref|XP_007028060.1| Sucrose-6F-phosphate phosphohydrolase family protein isoform 
3 [Theobroma cacao]
 ref|XP_007028061.1| Sucrose-6F-phosphate phosphohydrolase family protein isoform 
3 [Theobroma cacao]
 gb|EOY08562.1| Sucrose-6F-phosphate phosphohydrolase family protein isoform 
3 [Theobroma cacao]
 gb|EOY08563.1| Sucrose-6F-phosphate phosphohydrolase family protein isoform 
3 [Theobroma cacao]
Length=325

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+R+   ARLMI SDLDHTM DHHD EN+SL
Sbjct  1    MNRIAMGARLMIVSDLDHTMVDHHDAENMSL  31



>ref|XP_004161283.1| PREDICTED: sucrose-phosphatase 1-like [Cucumis sativus]
Length=423

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL+++A LMI SDLDHTM DHHD EN SL
Sbjct  1    MERLSASAHLMIVSDLDHTMVDHHDSENFSL  31



>ref|XP_004136534.1| PREDICTED: sucrose-phosphatase 1-like [Cucumis sativus]
 gb|KGN59242.1| hypothetical protein Csa_3G784370 [Cucumis sativus]
Length=423

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL+++A LMI SDLDHTM DHHD EN SL
Sbjct  1    MERLSASAHLMIVSDLDHTMVDHHDSENFSL  31



>ref|XP_010268155.1| PREDICTED: sucrose-phosphatase 2-like [Nelumbo nucifera]
Length=423

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +  LMI SDLDHTM DHHD ENLSL
Sbjct  1    MDRLNGSPHLMIVSDLDHTMVDHHDQENLSL  31



>ref|XP_006605356.1| PREDICTED: uncharacterized protein LOC100796915 isoform X1 [Glycine 
max]
Length=451

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  155  RETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            +E MDRL  +A LMI SDLD TM DH DPENL+L
Sbjct  26   KELMDRLNGSANLMIVSDLDFTMVDHDDPENLAL  59



>ref|XP_010461973.1| PREDICTED: probable sucrose-phosphatase 1 [Camelina sativa]
Length=423

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHH-DPENLSL  256
            M+RLTS  RLMI SDLD TM DHH DPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDETMVDHHNDPENLSL  32



>ref|XP_010479625.1| PREDICTED: probable sucrose-phosphatase 1 [Camelina sativa]
Length=423

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHH-DPENLSL  256
            M+RLTS  RLMI SDLD TM DHH DPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDETMVDHHNDPENLSL  32



>emb|CDY03617.1| BnaC03g68760D [Brassica napus]
Length=425

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHH-DPENLSL  256
            M+RLTS  RLMI SDLD TM DHH DPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDDTMVDHHNDPENLSL  32



>ref|XP_009107208.1| PREDICTED: probable sucrose-phosphatase 1 [Brassica rapa]
Length=423

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHH-DPENLSL  256
            M+RLTS  RLMI SDLD TM DHH DPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDDTMVDHHNDPENLSL  32



>ref|XP_004497625.1| PREDICTED: sucrose-phosphatase 1-like [Cicer arietinum]
Length=419

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL S+ RLMI SDLDHTM DHHD +N SL
Sbjct  1    MDRLKSSPRLMIVSDLDHTMVDHHDTDNSSL  31



>ref|XP_010500718.1| PREDICTED: probable sucrose-phosphatase 1 [Camelina sativa]
Length=423

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHH-DPENLSL  256
            M+RLTS  RLMI SDLD TM DHH DPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDETMVDHHNDPENLSL  32



>gb|AFK47160.1| unknown [Medicago truncatula]
Length=186

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +A LM+ SDLD+TM DH DPENL+L
Sbjct  1    MDRLIGSANLMVVSDLDYTMVDHDDPENLAL  31



>ref|XP_003589863.1| Sucrose-phosphatase [Medicago truncatula]
Length=321

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +A LMI SDLD+TM DH DPENL+L
Sbjct  1    MDRLIGSANLMIVSDLDYTMVDHDDPENLAL  31



>ref|NP_175553.1| sucrose-phosphatase 1 [Arabidopsis thaliana]
 sp|Q9C8J4.1|SPP1_ARATH RecName: Full=Probable sucrose-phosphatase 1; Short=AtSPP1 [Arabidopsis 
thaliana]
 gb|AAG52615.1|AC024261_2 unknown protein; 74043-75895 [Arabidopsis thaliana]
 gb|AEE32666.1| sucrose-phosphatase 1 [Arabidopsis thaliana]
Length=423

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHH-DPENLSL  256
            M+RLTS  RLMI SDLD TM DHH DPENL+L
Sbjct  1    MERLTSPPRLMIVSDLDETMVDHHKDPENLAL  32



>ref|XP_006307613.1| hypothetical protein CARUB_v10009241mg [Capsella rubella]
 gb|EOA40511.1| hypothetical protein CARUB_v10009241mg [Capsella rubella]
Length=423

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHH-DPENLSL  256
            M+RLTS  RLMI SDLD TM DHH DPENLSL
Sbjct  1    MERLTSPPRLMIVSDLDETMVDHHSDPENLSL  32



>ref|XP_003589862.1| Sucrose-phosphatase [Medicago truncatula]
Length=471

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +A LMI SDLD+TM DH DPENL+L
Sbjct  1    MDRLIGSANLMIVSDLDYTMVDHDDPENLAL  31



>ref|XP_002986252.1| hypothetical protein SELMODRAFT_182236 [Selaginella moellendorffii]
 gb|EFJ12783.1| hypothetical protein SELMODRAFT_182236 [Selaginella moellendorffii]
Length=424

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  173  LTSAARLMIXSDLDHTMXDHHDPENLSL  256
            L+S+ RLMI SDLDHTM DHHDPEN SL
Sbjct  3    LSSSPRLMIVSDLDHTMVDHHDPENKSL  30



>gb|AES60113.2| sucrose phosphate phosphatase [Medicago truncatula]
Length=423

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +A LMI SDLD+TM DH DPENL+L
Sbjct  1    MDRLIGSANLMIVSDLDYTMVDHDDPENLAL  31



>ref|XP_010103975.1| Sucrose-phosphatase 2 [Morus notabilis]
 gb|EXB97678.1| Sucrose-phosphatase 2 [Morus notabilis]
Length=424

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARLMI SDLD TM DH DPE++SL
Sbjct  1    MDRLNGSARLMIVSDLDSTMVDHEDPEDVSL  31



>gb|ACJ84344.1| unknown [Medicago truncatula]
 gb|AFK36861.1| unknown [Medicago truncatula]
Length=321

 Score = 49.3 bits (116),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +A LM+ SDLD+TM DH DPENL+L
Sbjct  1    MDRLIGSANLMVVSDLDYTMVDHDDPENLAL  31



>gb|KJB60363.1| hypothetical protein B456_009G301900 [Gossypium raimondii]
 gb|KJB60366.1| hypothetical protein B456_009G301900 [Gossypium raimondii]
Length=423

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL    RLMI SDLD TM DH DPENLSL
Sbjct  1    MDRLNGPPRLMIVSDLDFTMVDHEDPENLSL  31



>gb|KJB60362.1| hypothetical protein B456_009G301900 [Gossypium raimondii]
Length=423

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL    RLMI SDLD TM DH DPENLSL
Sbjct  1    MDRLNGPPRLMIVSDLDFTMVDHEDPENLSL  31



>sp|A3AZW5.1|SPP3_ORYSJ RecName: Full=Probable sucrose-phosphatase 3; Short=OsSPP3 [Oryza 
sativa Japonica Group]
Length=409

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLD TM DH+DP+NLSL
Sbjct  1    MDKLDGSARLMIVSDLDQTMIDHNDPKNLSL  31



>gb|EEE62305.1| hypothetical protein OsJ_17094 [Oryza sativa Japonica Group]
Length=423

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLD TM DH+DP+NLSL
Sbjct  1    MDKLDGSARLMIVSDLDQTMIDHNDPKNLSL  31



>gb|KDO48682.1| hypothetical protein CISIN_1g040434mg [Citrus sinensis]
Length=141

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARLMI SDLD TM DH D ENLSL
Sbjct  1    MDRLDGSARLMIVSDLDLTMVDHDDGENLSL  31



>ref|XP_006393055.1| hypothetical protein EUTSA_v10011514mg [Eutrema salsugineum]
 gb|ESQ30341.1| hypothetical protein EUTSA_v10011514mg [Eutrema salsugineum]
Length=423

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHH-DPENLSL  256
            M+RLTS  RLMI SDLD TM DHH DPENL+L
Sbjct  1    MERLTSPPRLMIVSDLDDTMVDHHNDPENLAL  32



>gb|KHG10002.1| Sucrose-phosphatase 1 [Gossypium arboreum]
Length=391

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL    RLMI SDLD TM DH DPENLSL
Sbjct  1    MDRLNGPPRLMIVSDLDFTMVDHEDPENLSL  31



>ref|XP_006654037.1| PREDICTED: probable sucrose-phosphatase 3-like [Oryza brachyantha]
Length=423

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L   ARLM+ SDLD TM DH+DPENLSL
Sbjct  1    MDKLDGPARLMVVSDLDQTMIDHNDPENLSL  31



>gb|EEC78505.1| hypothetical protein OsI_18433 [Oryza sativa Indica Group]
Length=423

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLD TM DH+DP+NLSL
Sbjct  1    MDKLDGSARLMIVSDLDQTMIDHNDPKNLSL  31



>gb|AAT93996.1| putative sucrose phosphatase [Oryza sativa Japonica Group]
 dbj|BAG89115.1| unnamed protein product [Oryza sativa Japonica Group]
Length=349

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MD+L  +ARLMI SDLD TM DH+DP+NLSL
Sbjct  1    MDKLDGSARLMIVSDLDQTMIDHNDPKNLSL  31



>gb|KDP27528.1| hypothetical protein JCGZ_20166 [Jatropha curcas]
Length=326

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL   A LMI SDLD TM DH DPENLSL
Sbjct  1    MDRLDGPASLMIVSDLDFTMVDHRDPENLSL  31



>gb|KJB60365.1| hypothetical protein B456_009G301900 [Gossypium raimondii]
Length=328

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL    RLMI SDLD TM DH DPENLSL
Sbjct  1    MDRLNGPPRLMIVSDLDFTMVDHEDPENLSL  31



>gb|KJB60367.1| hypothetical protein B456_009G301900 [Gossypium raimondii]
Length=242

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL    RLMI SDLD TM DH DPENLSL
Sbjct  1    MDRLNGPPRLMIVSDLDFTMVDHEDPENLSL  31



>ref|XP_010515695.1| PREDICTED: probable sucrose-phosphatase 3b isoform X1 [Camelina 
sativa]
Length=487

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +2

Query  137  QSENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            Q ++NI  TM+RL S   LMI SDLDHTM DH D +NLSL
Sbjct  55   QGQSNI-VTMERLISHPPLMIVSDLDHTMVDHQDQQNLSL  93



>gb|KHN05360.1| Sucrose-phosphatase 1 [Glycine soja]
Length=423

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +A LMI SDLD TM DH DPENL+L
Sbjct  1    MDRLNGSANLMIVSDLDFTMVDHDDPENLAL  31



>gb|EMS54577.1| putative sucrose-phosphatase 3 [Triticum urartu]
Length=372

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARLMI SDLD TM DH DPEN +L
Sbjct  1    MDRLDGSARLMIVSDLDQTMVDHCDPENSAL  31



>ref|NP_001241573.1| uncharacterized protein LOC100796915 [Glycine max]
 ref|XP_006605357.1| PREDICTED: uncharacterized protein LOC100796915 isoform X2 [Glycine 
max]
 ref|XP_006605358.1| PREDICTED: uncharacterized protein LOC100796915 isoform X3 [Glycine 
max]
 ref|XP_006605359.1| PREDICTED: uncharacterized protein LOC100796915 isoform X4 [Glycine 
max]
 ref|XP_006605360.1| PREDICTED: uncharacterized protein LOC100796915 isoform X5 [Glycine 
max]
 ref|XP_006605361.1| PREDICTED: uncharacterized protein LOC100796915 isoform X6 [Glycine 
max]
 ref|XP_006605362.1| PREDICTED: uncharacterized protein LOC100796915 isoform X7 [Glycine 
max]
 ref|XP_006605363.1| PREDICTED: uncharacterized protein LOC100796915 isoform X8 [Glycine 
max]
 gb|ACU18141.1| unknown [Glycine max]
Length=423

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +A LMI SDLD TM DH DPENL+L
Sbjct  1    MDRLNGSANLMIVSDLDFTMVDHDDPENLAL  31



>gb|EMT18778.1| Putative sucrose-phosphatase 3 [Aegilops tauschii]
Length=435

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARLMI SDLD TM DH DPEN +L
Sbjct  1    MDRLDGSARLMIVSDLDQTMVDHCDPENSAL  31



>ref|XP_006445667.1| hypothetical protein CICLE_v10015425mg [Citrus clementina]
 ref|XP_006445668.1| hypothetical protein CICLE_v10015425mg [Citrus clementina]
 gb|ESR58907.1| hypothetical protein CICLE_v10015425mg [Citrus clementina]
 gb|ESR58908.1| hypothetical protein CICLE_v10015425mg [Citrus clementina]
Length=410

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARLMI SDLD TM DH D ENLSL
Sbjct  1    MDRLDGSARLMIVSDLDLTMVDHDDGENLSL  31



>ref|XP_003568956.1| PREDICTED: probable sucrose-phosphatase 3 [Brachypodium distachyon]
Length=423

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARLMI SDLD TM DH DPEN +L
Sbjct  1    MDRLDGSARLMIVSDLDQTMVDHCDPENSAL  31



>gb|AHA61683.1| putative sucrose phosphatase [Sorghum bicolor]
Length=423

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARLM+ SDLD TM DH D ENLSL
Sbjct  1    MDRLDGSARLMLVSDLDQTMIDHQDRENLSL  31



>ref|XP_002439265.1| hypothetical protein SORBIDRAFT_09g003460 [Sorghum bicolor]
 gb|EES17695.1| hypothetical protein SORBIDRAFT_09g003460 [Sorghum bicolor]
Length=436

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARLM+ SDLD TM DH D ENLSL
Sbjct  1    MDRLDGSARLMLVSDLDQTMIDHQDRENLSL  31



>ref|XP_007145373.1| hypothetical protein PHAVU_007G233700g [Phaseolus vulgaris]
 gb|ESW17367.1| hypothetical protein PHAVU_007G233700g [Phaseolus vulgaris]
Length=423

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL+ +A +MI SDLD TM DH DPENL+L
Sbjct  1    MDRLSGSANVMIVSDLDFTMVDHDDPENLAL  31



>gb|ACR38611.1| unknown [Zea mays]
Length=365

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARL++ SDLD TM DH D ENLSL
Sbjct  1    MDRLDGSARLLLVSDLDQTMIDHDDRENLSL  31



>ref|XP_009139466.1| PREDICTED: probable sucrose-phosphatase 3b isoform X1 [Brassica 
rapa]
Length=475

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/63 (43%), Positives = 34/63 (54%), Gaps = 2/63 (3%)
 Frame = +2

Query  68   PPPPFFFRCSAHAPHRHSISLSFQSENNIRETMDRLTSAARLMIXSDLDHTMXDHHDPEN  247
            PP PF  +      +     +   +EN +   M+RL S   LMI SDLDHTM DH D +N
Sbjct  22   PPFPFNLQKRKRKKNNSRSDIHKDTENML--IMERLKSPPPLMIVSDLDHTMVDHQDHDN  79

Query  248  LSL  256
            LSL
Sbjct  80   LSL  82



>ref|XP_002985069.1| hypothetical protein SELMODRAFT_121516 [Selaginella moellendorffii]
 gb|EFJ13944.1| hypothetical protein SELMODRAFT_121516 [Selaginella moellendorffii]
Length=421

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  173  LTSAARLMIXSDLDHTMXDHHDPENLSL  256
            L+S+ RLMI SDLDHTM DHHDPEN SL
Sbjct  3    LSSSPRLMIVSDLDHTMVDHHDPENKSL  30



>gb|ABK25441.1| unknown [Picea sitchensis]
Length=425

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +2

Query  179  SAARLMIXSDLDHTMXDHHDPENLSL  256
            S+ RLMI SDLD+TM DHHDPEN+SL
Sbjct  7    SSPRLMIVSDLDNTMVDHHDPENISL  32



>ref|XP_006403814.1| hypothetical protein EUTSA_v10010361mg [Eutrema salsugineum]
 gb|ESQ45267.1| hypothetical protein EUTSA_v10010361mg [Eutrema salsugineum]
Length=457

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL S+  LMI SDLDHTM DH D ENLSL
Sbjct  5    MERLKSSPPLMIVSDLDHTMVDHQDSENLSL  35



>ref|XP_002439266.1| hypothetical protein SORBIDRAFT_09g003463 [Sorghum bicolor]
 gb|EES17696.1| hypothetical protein SORBIDRAFT_09g003463 [Sorghum bicolor]
Length=411

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M++L ++ARLMI SDLD TM DH DPE+LSL
Sbjct  1    MEKLDASARLMIVSDLDQTMVDHDDPEDLSL  31



>gb|ACN28398.1| unknown [Zea mays]
Length=435

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARL++ SDLD TM DH D ENLSL
Sbjct  1    MDRLDGSARLLLVSDLDQTMIDHDDRENLSL  31



>ref|XP_008662328.1| PREDICTED: sucrose-phosphatase 2 isoform X1 [Zea mays]
 gb|AFW57602.1| hypothetical protein ZEAMMB73_471714 [Zea mays]
Length=469

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARL++ SDLD TM DH D ENLSL
Sbjct  1    MDRLDGSARLLLVSDLDQTMIDHDDRENLSL  31



>emb|CAC07925.1| putative protein [Arabidopsis thaliana]
Length=412

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            M+RL S   LMI SDLDHTM DH D ENLSL
Sbjct  1    MERLISHPPLMIVSDLDHTMVDHQDHENLSL  31



>ref|NP_001105652.1| sucrose-phosphatase 2 [Zea mays]
 sp|Q84ZX8.1|SPP2_MAIZE RecName: Full=Sucrose-phosphatase 2; Short=ZmSPP2 [Zea mays]
 gb|AAO33158.1|AF493561_1 sucrose-phosphatase [Zea mays]
 gb|ACN27593.1| unknown [Zea mays]
 gb|AFW57601.1| sucrose-phosphatase 2 [Zea mays]
Length=437

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  164  MDRLTSAARLMIXSDLDHTMXDHHDPENLSL  256
            MDRL  +ARL++ SDLD TM DH D ENLSL
Sbjct  1    MDRLDGSARLLLVSDLDQTMIDHDDRENLSL  31



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 571209109800