BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L17

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            122   4e-31   Ipomoea nil [qian niu]
gb|KJB38279.1|  hypothetical protein B456_006G246000                    121   1e-30   Gossypium raimondii
gb|AEE25653.1|  auxin-responsive protein                                122   1e-30   Gossypium hirsutum [American cotton]
gb|KJB38280.1|  hypothetical protein B456_006G246000                    121   1e-30   Gossypium raimondii
gb|KJB38278.1|  hypothetical protein B456_006G246000                    122   2e-30   Gossypium raimondii
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    120   4e-30   Gossypium arboreum [tree cotton]
emb|CBI26357.3|  unnamed protein product                                119   6e-30   Vitis vinifera
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          119   7e-30   Vitis vinifera
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      119   9e-30   Nicotiana tabacum [American tobacco]
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          119   1e-29   Nicotiana sylvestris
ref|XP_008341049.1|  PREDICTED: auxin-responsive protein IAA7-like      117   2e-29   
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     117   9e-29   Nelumbo nucifera [Indian lotus]
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        117   1e-28   Fragaria vesca subsp. vesca
gb|ABH01143.1|  auxin-regulated protein                                 117   1e-28   Populus tomentosa [Chinese white poplar]
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             116   1e-28   
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like     116   2e-28   
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          115   2e-28   Nicotiana tomentosiformis
gb|AFK42031.1|  unknown                                                 114   4e-28   Medicago truncatula
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          115   5e-28   Prunus mume [ume]
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         114   6e-28   Jatropha curcas
gb|AFK37379.1|  unknown                                                 114   7e-28   Medicago truncatula
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2        113   7e-28   
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...    114   7e-28   Cicer arietinum [garbanzo]
gb|KEH42779.1|  auxin-responsive AUX/IAA family protein                 113   8e-28   Medicago truncatula
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   114   8e-28   
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...    114   9e-28   
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     114   9e-28   Populus euphratica
ref|NP_001280875.1|  auxin-responsive protein IAA14-like                114   9e-28   Malus domestica [apple tree]
emb|CAH59413.1|  auxin resistance protein                               114   9e-28   Plantago major [cart-track plant]
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        114   1e-27   Sesamum indicum [beniseed]
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like     114   1e-27   
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein             114   1e-27   Medicago truncatula
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             114   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     114   2e-27   Nelumbo nucifera [Indian lotus]
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein                 113   2e-27   Medicago truncatula
ref|XP_002302075.1|  auxin-induced protein aux28                        113   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        113   2e-27   Populus euphratica
emb|CDO99148.1|  unnamed protein product                                113   2e-27   Coffea canephora [robusta coffee]
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                    113   2e-27   Arabis alpina [alpine rockcress]
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g             112   2e-27   
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      112   2e-27   Nicotiana tomentosiformis
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       113   2e-27   Populus tremula x Populus tremuloides
ref|XP_006383686.1|  auxin-induced protein aux28                        112   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     113   3e-27   Populus euphratica
gb|KJB11141.1|  hypothetical protein B456_001G242900                    113   3e-27   Gossypium raimondii
gb|KJB11145.1|  hypothetical protein B456_001G242900                    113   3e-27   Gossypium raimondii
gb|KJB11146.1|  hypothetical protein B456_001G242900                    113   3e-27   Gossypium raimondii
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          112   4e-27   Sesamum indicum [beniseed]
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like     112   4e-27   
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     112   4e-27   Cucumis melo [Oriental melon]
gb|KJB11142.1|  hypothetical protein B456_001G242900                    112   5e-27   Gossypium raimondii
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              112   6e-27   Ricinus communis
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    112   6e-27   Gossypium arboreum [tree cotton]
gb|AAM96891.1|  auxin-responsive protein IAA1                           110   6e-27   Mirabilis jalapa
gb|AFZ78617.1|  hypothetical protein                                    112   7e-27   Populus tomentosa [Chinese white poplar]
gb|KDO48908.1|  hypothetical protein CISIN_1g026005mg                   110   7e-27   Citrus sinensis [apfelsine]
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14          112   7e-27   Nicotiana tomentosiformis
gb|KJB82526.1|  hypothetical protein B456_013G200700                    110   7e-27   Gossypium raimondii
gb|AFS44507.1|  auxin repressor                                         111   8e-27   Fragaria x ananassa
gb|AEE25650.1|  auxin-responsive protein                                112   9e-27   Gossypium hirsutum [American cotton]
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like      111   9e-27   Malus prunifolia
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             111   9e-27   Populus trichocarpa [western balsam poplar]
emb|CAC84711.1|  aux/IAA protein                                        111   1e-26   Populus tremula x Populus tremuloides
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     110   1e-26   Nicotiana sylvestris
ref|XP_007050422.1|  Indole-3-acetic acid inducible 14 isoform 2        111   1e-26   
gb|ACL81167.1|  auxin-responsive protein IAA1                           111   1e-26   Mirabilis jalapa
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     110   1e-26   Sesamum indicum [beniseed]
ref|NP_001266049.1|  IAA9 protein                                       111   2e-26   Solanum lycopersicum
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg                110   2e-26   Erythranthe guttata [common monkey flower]
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like     110   2e-26   Fragaria vesca subsp. vesca
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        112   2e-26   
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     110   2e-26   Solanum tuberosum [potatoes]
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        110   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like      110   2e-26   Brassica rapa
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like     110   2e-26   Brassica rapa
emb|CDX89832.1|  BnaA10g02500D                                          110   2e-26   
gb|EPS60474.1|  hypothetical protein M569_14329                         109   3e-26   Genlisea aurea
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             110   3e-26   Phaseolus vulgaris [French bean]
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg             110   4e-26   
gb|AEE25654.1|  auxin-responsive protein                                110   4e-26   Gossypium hirsutum [American cotton]
ref|XP_006432921.1|  hypothetical protein CICLE_v10002290mg             108   4e-26   
ref|XP_006471686.1|  PREDICTED: auxin-responsive protein IAA16-li...    109   4e-26   
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg             109   5e-26   Citrus clementina [clementine]
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        109   5e-26   Glycine max [soybeans]
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             109   5e-26   Citrus clementina [clementine]
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g             109   6e-26   Phaseolus vulgaris [French bean]
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        109   6e-26   Populus euphratica
gb|KDO48906.1|  hypothetical protein CISIN_1g026005mg                   108   6e-26   Citrus sinensis [apfelsine]
ref|NP_001266070.1|  IAA14                                              109   6e-26   Solanum lycopersicum
gb|KDO48907.1|  hypothetical protein CISIN_1g026005mg                   108   6e-26   Citrus sinensis [apfelsine]
gb|KDO48904.1|  hypothetical protein CISIN_1g026005mg                   108   7e-26   Citrus sinensis [apfelsine]
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                    109   8e-26   Gossypium arboreum [tree cotton]
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like     109   8e-26   
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   108   8e-26   Citrus sinensis [apfelsine]
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...    109   9e-26   Populus euphratica
ref|XP_006575865.1|  PREDICTED: auxin-induced protein AUX28-like        107   9e-26   
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    108   9e-26   Populus euphratica
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     108   1e-25   Vitis vinifera
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        108   1e-25   Malus domestica [apple tree]
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   108   1e-25   Citrus sinensis [apfelsine]
gb|AFK36684.1|  unknown                                                 107   1e-25   Lotus japonicus
gb|KJB28413.1|  hypothetical protein B456_005G046500                    108   1e-25   Gossypium raimondii
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          108   1e-25   Sesamum indicum [beniseed]
gb|KJB82525.1|  hypothetical protein B456_013G200700                    108   1e-25   Gossypium raimondii
emb|CAN63268.1|  hypothetical protein VITISV_013635                     108   1e-25   Vitis vinifera
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    108   1e-25   Populus euphratica
ref|XP_002311658.1|  aux/IAA family protein                             108   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...    108   1e-25   Populus euphratica
gb|ADJ68049.1|  auxin responsive protein                                108   1e-25   Catharanthus roseus [chatas]
ref|NP_001240213.1|  auxin-induced protein ali50                        108   1e-25   Glycine max [soybeans]
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     108   1e-25   Eucalyptus grandis [rose gum]
gb|KHN05057.1|  Auxin-responsive protein IAA14                          108   1e-25   Glycine soja [wild soybean]
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       108   1e-25   Solanum tuberosum [potatoes]
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                108   2e-25   Erythranthe guttata [common monkey flower]
gb|AFK36086.1|  unknown                                                 108   2e-25   Lotus japonicus
ref|NP_001288939.1|  auxin-responsive protein IAA16                     107   2e-25   Brassica rapa
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760          108   2e-25   Amborella trichopoda
gb|KHG04941.1|  Auxin-induced AUX28                                     107   2e-25   Gossypium arboreum [tree cotton]
gb|KHN30563.1|  Auxin-responsive protein IAA14                          107   2e-25   Glycine soja [wild soybean]
gb|KJB44872.1|  hypothetical protein B456_007G276900                    107   2e-25   Gossypium raimondii
dbj|BAJ34138.1|  unnamed protein product                                107   2e-25   Eutrema halophilum
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg             107   3e-25   Capsella rubella
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg             107   3e-25   
gb|ADL70685.1|  indole-3-acetic acid inducible 17                       105   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001241599.1|  uncharacterized protein LOC100803065               107   3e-25   Glycine max [soybeans]
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             107   3e-25   Citrus clementina [clementine]
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     107   3e-25   Tarenaya hassleriana [spider flower]
gb|ADB93635.1|  indole-3-acetic acid inducible 17                       105   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70684.1|  indole-3-acetic acid inducible 17                       105   3e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDY50750.1|  BnaAnng10570D                                          108   3e-25   Brassica napus [oilseed rape]
gb|KJB44873.1|  hypothetical protein B456_007G276900                    107   4e-25   Gossypium raimondii
gb|ADL70687.1|  indole-3-acetic acid inducible 17                       104   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70689.1|  indole-3-acetic acid inducible 17                       104   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     108   4e-25   
ref|NP_001236693.1|  auxin-induced protein AUX28                        107   4e-25   
gb|ABR08758.1|  auxin-resistance protein 3                              104   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KHN02537.1|  Auxin-induced protein AUX28                             107   4e-25   Glycine soja [wild soybean]
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          107   5e-25   Pyrus x bretschneideri [bai li]
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg             106   5e-25   
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             106   5e-25   Eutrema salsugineum [saltwater cress]
gb|ADL70640.1|  indole-3-acetic acid inducible 14                       105   5e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70642.1|  indole-3-acetic acid inducible 14                       105   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     107   5e-25   Cicer arietinum [garbanzo]
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          106   6e-25   Tarenaya hassleriana [spider flower]
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     106   6e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADL70639.1|  indole-3-acetic acid inducible 14                       105   6e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    106   6e-25   Arabis alpina [alpine rockcress]
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            105   7e-25   
ref|NP_001268036.1|  uncharacterized protein LOC100250231               106   7e-25   Vitis vinifera
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like        106   7e-25   Cucumis melo [Oriental melon]
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     106   7e-25   Brassica rapa
emb|CDY18214.1|  BnaC05g02370D                                          106   8e-25   Brassica napus [oilseed rape]
gb|AFK44192.1|  unknown                                                 106   8e-25   Medicago truncatula
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100               105   1e-24   Arabis alpina [alpine rockcress]
gb|KHN18836.1|  Auxin-induced protein AUX28                             105   1e-24   Glycine soja [wild soybean]
dbj|BAH56942.1|  AT4G14550                                              104   1e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CAN72026.1|  hypothetical protein VITISV_014421                     106   1e-24   Vitis vinifera
gb|ACU21378.1|  unknown                                                 105   1e-24   Glycine max [soybeans]
gb|ABR08763.1|  auxin-resistance protein 3                              103   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70641.1|  indole-3-acetic acid inducible 14                       104   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb|ACU18407.1|  unknown                                                 105   2e-24   Glycine max [soybeans]
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          105   2e-24   Tarenaya hassleriana [spider flower]
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17          105   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like     105   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like     105   2e-24   Camelina sativa [gold-of-pleasure]
gb|ADB93628.1|  indole-3-acetic acid inducible 14                       104   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like     105   2e-24   Camelina sativa [gold-of-pleasure]
gb|ADB93629.2|  indole-3-acetic acid inducible 14                       104   2e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDY15493.1|  BnaA08g27770D                                          105   2e-24   Brassica napus [oilseed rape]
gb|ADB93627.2|  indole-3-acetic acid inducible 14                       104   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             105   2e-24   Phaseolus vulgaris [French bean]
gb|ADB93625.2|  indole-3-acetic acid inducible 14                       104   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54609.1|  auxin-induced protein                                   105   2e-24   Phaseolus vulgaris [French bean]
ref|NP_001280973.1|  auxin-responsive protein IAA16                     105   2e-24   Malus domestica [apple tree]
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg             105   2e-24   
gb|KDP23667.1|  hypothetical protein JCGZ_23500                         105   2e-24   Jatropha curcas
gb|AFK44393.1|  unknown                                                 105   2e-24   Lotus japonicus
gb|KJB42200.1|  hypothetical protein B456_007G141900                    105   2e-24   Gossypium raimondii
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             105   2e-24   Phaseolus vulgaris [French bean]
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17          104   3e-24   Brassica rapa
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        105   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     105   3e-24   Morus notabilis
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like      105   3e-24   Camelina sativa [gold-of-pleasure]
emb|CDY10068.1|  BnaC08g43830D                                          104   3e-24   Brassica napus [oilseed rape]
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7           104   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like      104   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               105   3e-24   
ref|NP_193191.2|  auxin-responsive protein IAA14                        104   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451             104   3e-24   
emb|CAB46059.1|  IAA7 like protein                                      104   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg             104   3e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    104   4e-24   Elaeis guineensis
gb|AAC36584.1|  putative IAA-related protein                            102   5e-24   Pisum sativum [garden pea]
ref|XP_002884465.1|  indoleacetic acid-induced protein 16               104   5e-24   
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1            103   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     104   5e-24   Nicotiana sylvestris
ref|NP_171921.1|  auxin-responsive protein IAA17                        103   5e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    104   5e-24   
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        104   5e-24   
emb|CDY63910.1|  BnaC01g43640D                                          104   5e-24   Brassica napus [oilseed rape]
emb|CDY32537.1|  BnaA09g50590D                                          103   6e-24   Brassica napus [oilseed rape]
gb|ADL36587.1|  ARF domain class transcription factor                   102   6e-24   Malus domestica [apple tree]
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like     103   7e-24   Brassica rapa
gb|AFZ78616.1|  hypothetical protein                                    103   7e-24   Populus tomentosa [Chinese white poplar]
emb|CDY10349.1|  BnaC05g29300D                                          103   7e-24   Brassica napus [oilseed rape]
gb|AFK43673.1|  unknown                                                 104   7e-24   Lotus japonicus
ref|XP_004172702.1|  PREDICTED: auxin-induced protein AUX28-like        102   7e-24   
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        104   8e-24   Eucalyptus grandis [rose gum]
gb|AGV54230.1|  auxin-induced protein AUX28                             103   9e-24   Phaseolus vulgaris [French bean]
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...    103   9e-24   
gb|ABD98055.1|  auxin-regulated protein                                 103   9e-24   Striga asiatica [witchweed]
ref|NP_001267662.1|  auxin-induced protein AUX28-like                   103   9e-24   Cucumis sativus [cucumbers]
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401             103   9e-24   
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17          103   1e-23   Tarenaya hassleriana [spider flower]
ref|NP_974355.1|  auxin-responsive protein IAA7                         102   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ABY65124.1|  At1g04250                                             99.8    1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188945.1|  auxin-responsive protein IAA7                         103   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like     102   1e-23   Camelina sativa [gold-of-pleasure]
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein                 103   1e-23   Medicago truncatula
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 103   1e-23   Medicago truncatula
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)           103   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14          102   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...    102   2e-23   Cucumis sativus [cucumbers]
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     102   2e-23   Cucumis melo [Oriental melon]
ref|XP_002315736.1|  aux/IAA family protein                             103   2e-23   Populus trichocarpa [western balsam poplar]
ref|NP_001237212.1|  uncharacterized protein LOC100499872               102   2e-23   
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...    102   2e-23   
ref|NP_187124.1|  auxin-responsive protein IAA16                        102   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb|ABY65168.1|  At1g04250-like protein                                99.0    2e-23   Arabidopsis lyrata [lyrate rockcress]
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    102   2e-23   Setaria italica
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    102   3e-23   Setaria italica
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             102   3e-23   Capsella rubella
emb|CDY41894.1|  BnaC05g47100D                                          102   3e-23   Brassica napus [oilseed rape]
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like     101   3e-23   Solanum tuberosum [potatoes]
ref|XP_004982378.1|  PREDICTED: auxin-responsive protein IAA30-li...    102   3e-23   
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg             101   3e-23   Eutrema salsugineum [saltwater cress]
gb|ACJ83896.1|  unknown                                                 102   3e-23   Medicago truncatula
ref|XP_010087762.1|  Auxin-responsive protein IAA7                      102   4e-23   
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           102   4e-23   Ricinus communis
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024             101   5e-23   Arabidopsis lyrata subsp. lyrata
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg             101   5e-23   Capsella rubella
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        101   5e-23   Cicer arietinum [garbanzo]
emb|CDY63072.1|  BnaCnng41350D                                          103   5e-23   Brassica napus [oilseed rape]
ref|NP_001266055.1|  IAA10 protein                                      100   5e-23   Solanum lycopersicum
emb|CAC84710.1|  aux/IAA protein                                        102   5e-23   Populus tremula x Populus tremuloides
emb|CDY30017.1|  BnaC01g39910D                                          101   6e-23   Brassica napus [oilseed rape]
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                    100   9e-23   Arabis alpina [alpine rockcress]
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     100   9e-23   Eucalyptus grandis [rose gum]
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             100   1e-22   Citrus clementina [clementine]
gb|KDO53919.1|  hypothetical protein CISIN_1g026811mg                 99.8    1e-22   Citrus sinensis [apfelsine]
ref|NP_001288823.1|  auxin-responsive protein IAA7                      100   1e-22   Brassica rapa
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg                100   1e-22   Erythranthe guttata [common monkey flower]
gb|AAC39440.1|  IAA17/AXR3-1 protein                                  99.8    2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             100   2e-22   
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          100   2e-22   Prunus mume [ume]
gb|AAC49055.1|  IAA14                                                 97.8    3e-22   Arabidopsis thaliana [mouse-ear cress]
dbj|BAI94494.1|  Aux/IAA protein                                      99.4    3e-22   Dianthus caryophyllus [carnation]
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like   99.0    4e-22   Camelina sativa [gold-of-pleasure]
ref|NP_001239753.1|  uncharacterized protein LOC100781847             99.0    4e-22   Glycine max [soybeans]
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16        99.0    4e-22   Camelina sativa [gold-of-pleasure]
ref|NP_001275031.1|  auxin-responsive protein IAA14-like              98.6    4e-22   Solanum tuberosum [potatoes]
gb|EPS64756.1|  hypothetical protein M569_10024                       98.6    4e-22   Genlisea aurea
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like   99.0    5e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                   98.6    5e-22   Nicotiana tabacum [American tobacco]
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like   99.0    5e-22   Phoenix dactylifera
gb|KHN22078.1|  Auxin-responsive protein IAA16                        98.6    5e-22   Glycine soja [wild soybean]
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like   98.6    5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like   99.0    6e-22   Elaeis guineensis
gb|AFK42876.1|  unknown                                               98.6    7e-22   Medicago truncatula
gb|ACJ84642.1|  unknown                                               98.6    8e-22   Medicago truncatula
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14        97.8    1e-21   Brassica rapa
emb|CBI35213.3|  unnamed protein product                              96.3    1e-21   Vitis vinifera
ref|NP_001266039.1|  IAA7 protein                                     97.1    1e-21   Solanum lycopersicum
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like   97.4    2e-21   Cucumis sativus [cucumbers]
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16        97.4    2e-21   Fragaria vesca subsp. vesca
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like   97.1    2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg           96.3    3e-21   Eutrema salsugineum [saltwater cress]
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...  96.7    4e-21   Elaeis guineensis
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg              96.7    4e-21   Erythranthe guttata [common monkey flower]
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...  96.3    4e-21   
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like   95.5    4e-21   
emb|CDY47148.1|  BnaA08g05350D                                        96.3    5e-21   
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...  96.3    5e-21   
emb|CDY62130.1|  BnaC08g47390D                                        95.9    5e-21   
ref|XP_010923479.1|  PREDICTED: auxin-responsive protein IAA30-li...  95.9    5e-21   
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like   96.3    5e-21   
gb|ABK24636.1|  unknown                                               96.3    1e-20   
ref|XP_008391048.1|  PREDICTED: auxin-induced protein 22D             94.0    1e-20   
dbj|BAJ84870.1|  predicted protein                                    94.7    2e-20   
dbj|BAK01326.1|  predicted protein                                    94.7    2e-20   
ref|XP_008351274.1|  PREDICTED: auxin-induced protein 22D-like        93.6    2e-20   
ref|XP_004150437.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  94.7    2e-20   
emb|CDP06818.1|  unnamed protein product                              94.4    3e-20   
gb|KDP21369.1|  hypothetical protein JCGZ_21840                       94.4    3e-20   
ref|XP_002438435.1|  hypothetical protein SORBIDRAFT_10g019590        94.4    3e-20   
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like   94.0    3e-20   
gb|ABR16302.1|  unknown                                               94.7    4e-20   
ref|XP_007201398.1|  hypothetical protein PRUPE_ppa010342mg           92.4    5e-20   
emb|CBW30571.1|  auxin-responsive protein iaa27                       93.2    5e-20   
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like   93.2    6e-20   
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like    94.4    6e-20   
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...  93.2    6e-20   
gb|ABY65138.1|  At1g04250                                             89.4    6e-20   
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like   93.2    6e-20   
ref|XP_008462707.1|  PREDICTED: auxin-induced protein AUX28-like ...  92.8    7e-20   
ref|XP_009337290.1|  PREDICTED: auxin-induced protein 22D             92.0    8e-20   
gb|ABR17764.1|  unknown                                               93.6    9e-20   
ref|NP_001234694.1|  AUX/IAA 2                                        91.7    1e-19   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like      92.8    1e-19   
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28           93.2    1e-19   
ref|XP_004960656.1|  PREDICTED: auxin-responsive protein IAA17-like   92.4    1e-19   
ref|XP_006356050.1|  PREDICTED: auxin-responsive protein IAA3-like    91.3    1e-19   
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like   92.4    1e-19   
ref|XP_008655142.1|  PREDICTED: IAA19 - auxin-responsive Aux/IAA ...  92.8    2e-19   
gb|AEX00362.1|  IAA21                                                 91.7    2e-19   
gb|KHN18839.1|  Auxin-induced protein 22D                             91.3    2e-19   
ref|XP_004288426.1|  PREDICTED: auxin-responsive protein IAA4         91.3    2e-19   
ref|XP_007201399.1|  hypothetical protein PRUPE_ppa010342mg           92.0    2e-19   
ref|XP_002531289.1|  Auxin-induced protein 22D, putative              90.9    2e-19   
gb|ABR16139.1|  unknown                                               93.6    2e-19   
ref|NP_001242729.1|  uncharacterized protein LOC100780752             90.9    2e-19   
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg           91.7    2e-19   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like    92.4    2e-19   
gb|KFK31702.1|  hypothetical protein AALP_AA6G148000                  90.5    3e-19   
gb|AAP44405.1|  auxin-induced protein 2                               92.0    3e-19   
gb|AAM12952.1|  auxin-regulated protein                               92.0    3e-19   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA  91.7    3e-19   
ref|XP_004146959.1|  PREDICTED: auxin-induced protein 22D-like        90.5    3e-19   
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580        91.3    4e-19   
ref|XP_004302884.1|  PREDICTED: auxin-responsive protein IAA27-like   91.7    5e-19   
gb|AFW81082.1|  hypothetical protein ZEAMMB73_869175                  91.3    5e-19   
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like    91.7    6e-19   
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...  91.7    6e-19   
gb|ADC29389.2|  indole-3-acetic acid inducible 8                      90.1    6e-19   
ref|XP_010526458.1|  PREDICTED: auxin-responsive protein IAA27        90.9    6e-19   
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg           91.7    6e-19   
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...  92.0    6e-19   
gb|KDP21371.1|  hypothetical protein JCGZ_21842                       89.7    6e-19   
gb|ADL70563.1|  indole-3-acetic acid inducible 8                      90.5    6e-19   
ref|XP_010548702.1|  PREDICTED: auxin-responsive protein IAA27-like   90.9    6e-19   
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...  92.0    6e-19   
gb|ADC29390.2|  indole-3-acetic acid inducible 8                      90.5    6e-19   
gb|EEC81620.1|  hypothetical protein OsI_25139                        90.1    6e-19   
gb|ADC29391.2|  indole-3-acetic acid inducible 8                      90.1    7e-19   
sp|O24542.1|AX22D_VIGRR  RecName: Full=Auxin-induced protein 22D;...  89.7    7e-19   
ref|XP_002463898.1|  hypothetical protein SORBIDRAFT_01g008480        90.1    7e-19   
gb|EMS60184.1|  Auxin-responsive protein IAA19                        90.1    7e-19   
gb|ADC29393.2|  indole-3-acetic acid inducible 8                      90.5    7e-19   
gb|ADL70573.1|  indole-3-acetic acid inducible 8                      90.5    7e-19   
gb|ADL70565.1|  indole-3-acetic acid inducible 8                      90.5    7e-19   
gb|ADC29392.2|  indole-3-acetic acid inducible 8                      90.1    7e-19   
gb|ADL70568.1|  indole-3-acetic acid inducible 8                      90.1    7e-19   
gb|ADL70756.1|  indole-3-acetic acid inducible 27                     90.5    7e-19   
gb|ACF87432.1|  unknown                                               90.5    7e-19   
gb|ADL70562.1|  indole-3-acetic acid inducible 8                      90.1    7e-19   
gb|ADL70572.1|  indole-3-acetic acid inducible 8                      90.5    7e-19   
gb|ADL70564.1|  indole-3-acetic acid inducible 8                      90.5    8e-19   
gb|ADL70567.1|  indole-3-acetic acid inducible 8                      90.5    8e-19   
gb|ADL70561.1|  indole-3-acetic acid inducible 8                      90.1    8e-19   
gb|ADL70569.1|  indole-3-acetic acid inducible 8                      90.5    8e-19   
gb|ADL70566.1|  indole-3-acetic acid inducible 8                      90.1    8e-19   
gb|EMS50778.1|  Auxin-responsive protein IAA30                        90.5    8e-19   
gb|ACU19616.1|  unknown                                               90.1    8e-19   
gb|ADL70749.1|  indole-3-acetic acid inducible 27                     89.7    8e-19   
ref|XP_006294565.1|  hypothetical protein CARUB_v10023602mg           90.9    8e-19   
gb|ADL70571.1|  indole-3-acetic acid inducible 8                      90.5    8e-19   
gb|ACG40460.1|  IAA19 - auxin-responsive Aux/IAA family member        90.5    9e-19   
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...  89.7    9e-19   
ref|XP_007225723.1|  hypothetical protein PRUPE_ppa006744mg           90.5    9e-19   
gb|KDP23666.1|  hypothetical protein JCGZ_23499                       89.4    9e-19   
gb|AFW81083.1|  IAA19-auxin-responsive Aux/IAA family member          90.5    1e-18   
ref|XP_002867425.1|  phytochrome-associated protein 2                 90.5    1e-18   
gb|EMT20161.1|  Auxin-responsive protein IAA30                        90.5    1e-18   
ref|XP_006284170.1|  hypothetical protein CARUB_v10005309mg           90.5    1e-18   
gb|KHN46011.1|  Auxin-responsive protein IAA9                         90.5    1e-18   
gb|ADL70570.1|  indole-3-acetic acid inducible 8                      90.1    1e-18   
gb|ADL70755.1|  indole-3-acetic acid inducible 27                     89.7    1e-18   
ref|XP_006294567.1|  hypothetical protein CARUB_v10023602mg           90.5    1e-18   
gb|ADL70750.1|  indole-3-acetic acid inducible 27                     89.7    1e-18   
gb|ADL70757.1|  indole-3-acetic acid inducible 27                     89.7    1e-18   
ref|NP_850028.1|  auxin-responsive protein IAA8                       90.1    1e-18   
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like   89.7    1e-18   
ref|NP_001189579.1|  auxin-responsive protein IAA8                    90.1    1e-18   
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540        90.9    1e-18   
ref|XP_004150434.1|  PREDICTED: auxin-induced protein 22B-like        88.6    1e-18   
gb|ADL70753.1|  indole-3-acetic acid inducible 27                     89.7    1e-18   
ref|NP_194637.1|  phytochrome-associated protein 2                    90.1    1e-18   
ref|NP_179852.1|  auxin-responsive protein IAA8                       90.1    1e-18   
ref|XP_002281696.1|  PREDICTED: auxin-induced protein 22D             88.6    1e-18   
gb|ADL70760.1|  indole-3-acetic acid inducible 27                     89.4    1e-18   
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)               90.1    1e-18   
ref|XP_006465643.1|  PREDICTED: auxin-responsive protein IAA8-lik...  90.1    1e-18   
tpg|DAA55064.1|  TPA: hypothetical protein ZEAMMB73_489535            89.0    1e-18   
ref|XP_006426926.1|  hypothetical protein CICLE_v10025988mg           90.1    1e-18   
emb|CBI28036.3|  unnamed protein product                              88.2    1e-18   
ref|XP_008449289.1|  PREDICTED: auxin-induced protein 22B             88.6    1e-18   
gb|KDO56957.1|  hypothetical protein CISIN_1g019236mg                 90.1    1e-18   
ref|XP_003568720.1|  PREDICTED: auxin-responsive protein IAA17-like   89.4    1e-18   
gb|ABB55368.1|  Aux/IAA protein-like                                  90.1    2e-18   
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like    90.1    2e-18   
ref|XP_002878628.1|  indoleacetic acid-induced protein 8              89.7    2e-18   
gb|ADB93663.1|  indole-3-acetic acid inducible 27                     89.4    2e-18   
ref|XP_006465642.1|  PREDICTED: auxin-responsive protein IAA8-lik...  90.1    2e-18   
gb|ADL70759.1|  indole-3-acetic acid inducible 27                     89.4    2e-18   
ref|XP_002464208.1|  hypothetical protein SORBIDRAFT_01g014130        89.4    2e-18   
gb|KGN60808.1|  hypothetical protein Csa_2G010920                     89.0    2e-18   
gb|ADB93662.1|  indole-3-acetic acid inducible 27                     89.4    2e-18   
gb|ADB93660.2|  indole-3-acetic acid inducible 27                     89.4    2e-18   
gb|ADB93661.1|  indole-3-acetic acid inducible 27                     89.4    2e-18   
gb|ADL70754.1|  indole-3-acetic acid inducible 27                     89.4    2e-18   
gb|ADL70752.1|  indole-3-acetic acid inducible 27                     89.4    2e-18   
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g           90.1    2e-18   
ref|NP_001275473.1|  Aux/IAA protein                                  89.7    2e-18   
gb|ADL70748.1|  indole-3-acetic acid inducible 27                     89.4    2e-18   
ref|XP_006426927.1|  hypothetical protein CICLE_v10025988mg           89.7    2e-18   
gb|ADL70751.1|  indole-3-acetic acid inducible 27                     89.4    2e-18   
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  88.6    2e-18   
gb|AAD50278.1|  auxin-induced protein ali50                           88.6    2e-18   
emb|CAC84712.1|  aux/IAA protein                                      88.2    3e-18   
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like    89.4    3e-18   
ref|XP_010417025.1|  PREDICTED: auxin-responsive protein IAA8-like    89.4    3e-18   
ref|XP_010521483.1|  PREDICTED: auxin-responsive protein IAA27-li...  88.6    3e-18   
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg           90.1    3e-18   
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg           89.7    3e-18   
ref|XP_010429195.1|  PREDICTED: auxin-responsive protein IAA8         89.4    3e-18   
ref|XP_010472259.1|  PREDICTED: auxin-responsive protein IAA8-like    89.0    3e-18   
ref|XP_008663887.1|  PREDICTED: auxin-responsive protein IAA5-like    87.8    3e-18   
emb|CDP02673.1|  unnamed protein product                              89.4    3e-18   
ref|XP_006412880.1|  hypothetical protein EUTSA_v10025542mg           89.4    3e-18   
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg           89.4    3e-18   
ref|XP_006433736.1|  hypothetical protein CICLE_v10001479mg           89.4    4e-18   
ref|XP_010551701.1|  PREDICTED: auxin-responsive protein IAA1-like    87.4    4e-18   
ref|XP_007226262.1|  hypothetical protein PRUPE_ppa018535mg           87.4    4e-18   
gb|EEE53551.1|  hypothetical protein OsJ_36765                        87.4    4e-18   
dbj|BAJ90698.1|  predicted protein                                    88.2    4e-18   
ref|XP_004981819.1|  PREDICTED: auxin-responsive protein IAA13-li...  88.2    4e-18   
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like   88.6    4e-18   
gb|ABY48132.1|  GH1 protein                                           89.0    4e-18   
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like    89.0    4e-18   
ref|XP_008665238.1|  PREDICTED: auxin-responsive protein IAA5-lik...  88.2    4e-18   
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...  89.0    4e-18   
gb|ACU19136.1|  unknown                                               88.2    4e-18   
ref|XP_008665239.1|  PREDICTED: auxin-responsive protein IAA5-lik...  88.2    4e-18   
gb|KJB58782.1|  hypothetical protein B456_009G226000                  89.0    4e-18   
ref|XP_010521482.1|  PREDICTED: auxin-responsive protein IAA8-lik...  89.0    4e-18   
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like   88.2    4e-18   
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9         89.0    4e-18   
ref|XP_008224186.1|  PREDICTED: auxin-induced protein IAA4-like       87.4    4e-18   
ref|XP_009382657.1|  PREDICTED: auxin-induced protein 22D-like        87.4    4e-18   
gb|EPS59988.1|  auxin-regulated protein                               88.6    5e-18   
gb|ACN27887.1|  unknown                                               87.4    5e-18   
ref|NP_001280937.1|  auxin-responsive protein IAA27                   88.6    5e-18   
emb|CDO98008.1|  unnamed protein product                              88.6    5e-18   
ref|XP_004981820.1|  PREDICTED: auxin-responsive protein IAA13-li...  87.8    5e-18   
gb|KHN31465.1|  Auxin-responsive protein IAA16                        87.8    5e-18   
dbj|BAJ33683.1|  unnamed protein product                              88.6    5e-18   
gb|KFK29453.1|  hypothetical protein AALP_AA7G136400                  88.2    5e-18   
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like   88.6    5e-18   
ref|NP_001059051.1|  Os07g0182400                                     87.4    5e-18   
gb|ACF88333.1|  unknown                                               88.2    5e-18   
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like    88.2    5e-18   
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...  88.2    6e-18   
ref|XP_004302056.1|  PREDICTED: auxin-responsive protein IAA4-like    86.7    6e-18   
gb|KJB58781.1|  hypothetical protein B456_009G226000                  88.6    6e-18   
ref|NP_001280795.1|  auxin-responsive protein IAA8-like               88.6    6e-18   
ref|XP_009112194.1|  PREDICTED: auxin-responsive protein IAA9-lik...  88.2    6e-18   
dbj|BAJ89956.1|  predicted protein                                    87.8    6e-18   
gb|KJB58777.1|  hypothetical protein B456_009G226000                  88.6    6e-18   
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like    88.6    6e-18   
ref|NP_001159048.1|  IAA19 - auxin-responsive Aux/IAA family member   88.2    6e-18   
gb|AIN39810.1|  hypothetical protein                                  87.8    6e-18   
emb|CDY68170.1|  BnaCnng57860D                                        88.2    6e-18   
gb|AFZ78612.1|  hypothetical protein                                  87.0    6e-18   
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg              88.2    7e-18   
emb|CAD10639.1|  IAA9 protein                                         88.2    7e-18   
dbj|BAJ85543.1|  predicted protein                                    87.4    7e-18   
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...  88.2    7e-18   
ref|XP_009406220.1|  PREDICTED: auxin-responsive protein IAA21-like   87.8    7e-18   
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like   87.4    7e-18   
gb|ABI36493.1|  AUX/IAA16 A                                           85.9    7e-18   
ref|XP_007034953.1|  AUX/IAA transcriptional regulator family pro...  86.7    7e-18   
ref|XP_002892202.1|  hypothetical protein ARALYDRAFT_887587           86.7    7e-18   
ref|XP_010087759.1|  Auxin-responsive protein IAA4                    87.0    7e-18   
ref|XP_009118660.1|  PREDICTED: auxin-responsive protein IAA3         86.7    7e-18   
ref|XP_010547580.1|  PREDICTED: auxin-responsive protein IAA9-lik...  88.2    7e-18   
tpg|DAA55065.1|  TPA: hypothetical protein ZEAMMB73_489535            87.4    7e-18   
ref|XP_010936161.1|  PREDICTED: auxin-induced protein 22D             87.0    7e-18   
ref|XP_010447892.1|  PREDICTED: auxin-responsive protein IAA27        87.8    7e-18   
ref|NP_001050713.2|  Os03g0633500                                     87.4    7e-18   
gb|ADL36578.1|  ARF domain class transcription factor                 88.6    7e-18   
gb|AFW56689.1|  hypothetical protein ZEAMMB73_089866                  88.2    8e-18   
ref|XP_003569553.1|  PREDICTED: auxin-responsive protein IAA5-like    87.8    8e-18   
emb|CDY10069.1|  BnaC08g43820D                                        86.7    8e-18   
ref|NP_001241389.1|  uncharacterized protein LOC100783314             88.2    8e-18   
ref|XP_007030568.1|  AUX/IAA transcriptional regulator family pro...  86.7    8e-18   
emb|CDY10694.1|  BnaA05g16680D                                        86.3    8e-18   
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9         88.2    8e-18   
gb|ACJ84551.1|  unknown                                               88.2    8e-18   
gb|KHN08222.1|  Auxin-responsive protein IAA8                         88.2    8e-18   
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27        87.8    8e-18   



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 79/105 (75%), Gaps = 9/105 (9%)
 Frame = +2

Query  176  VDLKLKLSSKDSQIHASDHNKANNKD-----ADVTKPPAKAQVVGWPPVRSYRRNILAAN  340
            VDLKLKLSSK+S +   ++ K NN +     +D TKPPAKAQVVGWPPVRSYR+NIL+  
Sbjct  37   VDLKLKLSSKESNVDQVENLKDNNNNVVTSPSDSTKPPAKAQVVGWPPVRSYRKNILSG-  95

Query  341  NHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
              QK+ GE  S   A LVKVS+DGAPYLRKVDL MYKSY +LS+A
Sbjct  96   --QKAAGES-SGGGAALVKVSVDGAPYLRKVDLKMYKSYHELSEA  137



>gb|KJB38279.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=217

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 79/113 (70%), Gaps = 12/113 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHAS---DHNKANNKDA---DVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL L SK+S +  +   D N +  K     D  KPPAKAQVVGWPPVRSY
Sbjct  55   FSET---VDLKLNLQSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSY  111

Query  317  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI+A   +QK+  E+  +  A LVKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  112  RKNIMA---NQKNSSEESGNSGAALVKVSMDGAPYLRKVDLKMYKSYQELSDA  161



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 79/113 (70%), Gaps = 12/113 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHAS---DHNKANNKDA---DVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL L SK+S +  +   D N +  K     D  KPPAKAQVVGWPPVRSY
Sbjct  55   FSET---VDLKLNLQSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSY  111

Query  317  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI+A   +QK+  E+  +  A LVKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  112  RKNIMA---NQKNSSEESGNSGAALVKVSMDGAPYLRKVDLKMYKSYQELSDA  161



>gb|KJB38280.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=249

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 79/113 (70%), Gaps = 12/113 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHAS---DHNKANNKDA---DVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL L SK+S +  +   D N +  K     D  KPPAKAQVVGWPPVRSY
Sbjct  55   FSET---VDLKLNLQSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSY  111

Query  317  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI+A   +QK+  E+  +  A LVKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  112  RKNIMA---NQKNSSEESGNSGAALVKVSMDGAPYLRKVDLKMYKSYQELSDA  161



>gb|KJB38278.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=294

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 79/113 (70%), Gaps = 12/113 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHAS---DHNKANNKDA---DVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL L SK+S +  +   D N +  K     D  KPPAKAQVVGWPPVRSY
Sbjct  100  FSET---VDLKLNLQSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQVVGWPPVRSY  156

Query  317  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI+A   +QK+  E+  +  A LVKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  157  RKNIMA---NQKNSSEESGNSGAALVKVSMDGAPYLRKVDLKMYKSYQELSDA  206



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 79/113 (70%), Gaps = 12/113 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHAS---DHNKANNKDA---DVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL L SK+S +  +   D N +  K     D  KPPAKAQ+VGWPPVRSY
Sbjct  55   FSET---VDLKLNLQSKESTMDLNKNLDDNGSKEKSGSAKDPAKPPAKAQMVGWPPVRSY  111

Query  317  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI+A   +QK+  E+  +  A LVKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  112  RKNIMA---NQKNSSEESGNSGAALVKVSMDGAPYLRKVDLKMYKSYQELSDA  161



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 78/114 (68%), Gaps = 12/114 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVRS  313
            F ET   VDLKL L SK+S +  +++ K   K+        D  KPPAKAQVVGWPPVRS
Sbjct  41   FSET---VDLKLNLQSKESVVDLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRS  97

Query  314  YRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+NI+A  N  +  GE GS  AA  VKV MDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  98   FRKNIMAQKNSSEE-GEKGSSGAA-FVKVCMDGAPYLRKVDLKMYKSYQELSDA  149



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 78/114 (68%), Gaps = 12/114 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVRS  313
            F ET   VDLKL L SK+S +  +++ K   K+        D  KPPAKAQVVGWPPVRS
Sbjct  47   FSET---VDLKLNLQSKESVVDLNENVKCPPKEKNLLPCTKDPAKPPAKAQVVGWPPVRS  103

Query  314  YRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+NI+A  N  +  GE GS  AA  VKV MDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  104  FRKNIMAQKNSSEE-GEKGSSGAA-FVKVCMDGAPYLRKVDLKMYKSYQELSDA  155



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score =   119 bits (298),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 72/110 (65%), Gaps = 7/110 (6%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHN---KANNKDADVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDLKL LSSKDS +     N   K N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  47   FSET---VDLKLNLSSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQVVGWPPVRSFRKN  103

Query  326  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +L    +    GE  S   A  VKVS+DGAPYLRKVDL MYKSYQ LSDA
Sbjct  104  VLTVQKNSTGNGES-SGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDA  152



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 72/110 (65%), Gaps = 7/110 (6%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHN---KANNKDADVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDLKL LSSKDS +     N   K N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  47   FSET---VDLKLNLSSKDSTVDNQVDNIKEKKNIAPTDPAKPPAKAQVVGWPPVRSFRKN  103

Query  326  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +L    +    GE  S   A  VKVS+DGAPYLRKVDL MYKSYQ LSDA
Sbjct  104  VLTVQKNSTGNGES-SGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDA  152



>ref|XP_008341049.1| PREDICTED: auxin-responsive protein IAA7-like [Malus domestica]
Length=173

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 74/117 (63%), Gaps = 13/117 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKLKL SKD        I + + N   +   D  KPPAKAQVVGWPPVRSY
Sbjct  43   FSET---VDLKLKLQSKDDLNDNVKNIASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSY  99

Query  317  RRNILAANNHQKSGGE----DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI+A  N  +   E     G   +A  VKV MDGAPYLRKVDL MYKSYQ+LS+A
Sbjct  100  RKNIMAQKNTSEENTEKATVGGGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNA  156



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score =   117 bits (292),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 79/115 (69%), Gaps = 14/115 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDH-NKANNKDA-----DVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL L SK+S +  S+  N    K+      D+ KPPAKAQVVGWPPVRS+
Sbjct  55   FCET---VDLKLNLPSKESVMDPSEKKNSPKEKNLLPCTNDLAKPPAKAQVVGWPPVRSF  111

Query  317  RRNILAANNHQKSGGEDGS--DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NIL+    QKS  E+G     +A  VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  112  RKNILSV---QKSSTEEGEKVSSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  163



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 78/117 (67%), Gaps = 14/117 (12%)
 Frame = +2

Query  158  EETHQHVDLKLKLSSKDSQIHAS-------DHNKANNKD--ADVTKPPAKAQVVGWPPVR  310
            +E+   VDLKL LSSKD    A        + NK  N D  AD  KPPAKAQVVGWPPVR
Sbjct  49   DESSACVDLKLNLSSKDGSSTAEKSKSLMMNKNKEKNVDLPADPAKPPAKAQVVGWPPVR  108

Query  311  SYRRNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            S+R+N+L+A   QKS   D S     A LVKVSMDGAPYLRKVDL+MYK+Y  LSDA
Sbjct  109  SFRKNMLSA---QKSSTTDESKAGGNAALVKVSMDGAPYLRKVDLNMYKTYPQLSDA  162



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 76/117 (65%), Gaps = 13/117 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVRS  313
            F ET   VDLKL LS+KD+    SD  KA  K+        D  KPP+KAQVVGWPP+RS
Sbjct  50   FSET---VDLKLNLSTKDTGKDGSDQEKAAMKEKAVAPRPNDPAKPPSKAQVVGWPPIRS  106

Query  314  YRRNILAANNHQKSGGEDGSDKAAV---LVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+N++A   +    GE  S   A     VKVSMDGAPYLRKVDL +YKSY++LSDA
Sbjct  107  FRKNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDA  163



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 73/113 (65%), Gaps = 9/113 (8%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET   +DLKL L SK+        I + + N       D  KPPAKAQVVGWPPVRSY
Sbjct  42   FSET---IDLKLNLQSKEDLNDNVKNIASKEKNNLLTCTKDPAKPPAKAQVVGWPPVRSY  98

Query  317  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI+A  +  +   E GS  +A  VKV MDGAPYLRKVDL MYKSYQ+LS++
Sbjct  99   RKNIMAQKSSSEESTEKGSGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNS  151



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 74/117 (63%), Gaps = 13/117 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKLKL SKD        I + + N   +   D  KPPAKAQVVGWPPVRSY
Sbjct  43   FSET---VDLKLKLQSKDDLNDNVKNIASREKNDLLSCTKDPAKPPAKAQVVGWPPVRSY  99

Query  317  RRNILAANNHQKSGGE----DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI+A  N  +   E     G   +A  VKV MDGAPYLRKVDL MYKSYQ+LS+A
Sbjct  100  RKNIMAQKNTSEENTEKATVGGGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNA  156



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 71/110 (65%), Gaps = 7/110 (6%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASD---HNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDLKL LSSKDS +         K N    D +KPPAKAQVVGWPPVRS+R+N
Sbjct  47   FSET---VDLKLNLSSKDSTVDNQVDKMKEKKNIAPTDPSKPPAKAQVVGWPPVRSFRKN  103

Query  326  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +L         GE  S   A  VKVS+DGAPYLRKVDL MYKSYQ LSDA
Sbjct  104  VLNVQKKSTGNGES-SGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDA  152



>gb|AFK42031.1| unknown [Medicago truncatula]
Length=214

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 75/109 (69%), Gaps = 6/109 (6%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL L +K+  ++    +K      D  KPPAKAQVVGWPPVRSYR+N++A
Sbjct  44   FSET---VDLKLNLQTKE-DLNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  99

Query  335  --ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
               NN + +     +  AA  VKVSMDGAPYLRKVDL+MYK+Y+DLSDA
Sbjct  100  QKVNNTEDTEKTTSNTTAAAFVKVSMDGAPYLRKVDLTMYKTYKDLSDA  148



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 75/113 (66%), Gaps = 9/113 (8%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVT------KPPAKAQVVGWPPVRSY  316
            F ET   +DLKL L SK+       +N +  K+  +T      KPPAKAQVVGWPPVRSY
Sbjct  51   FSET---IDLKLNLQSKEDLNDKVKNNASKEKNNLLTCTKYPAKPPAKAQVVGWPPVRSY  107

Query  317  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI+A  +  +   E GS  +A  VKV MDGAPYLRKVDL MYKSYQ+LS++
Sbjct  108  RKNIMAQKSSSEESTEKGSGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNS  160



>gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 79/117 (68%), Gaps = 16/117 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA---------DVTKPPAKAQVVGWPPV  307
            F ET   VDLKL L +KD  +  +++ K  +KD          D  KPPAKAQVVGWPPV
Sbjct  43   FAET---VDLKLNLQAKDGVMDLNENIKNASKDKNHLPTSTIKDPAKPPAKAQVVGWPPV  99

Query  308  RSYRRNILAANNHQKSGGEDGSDK-AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            RSYR+NI+A   +QK+  ++G    +A  VKV MDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  100  RSYRKNIMA---NQKNNSDEGEKSLSAAFVKVCMDGAPYLRKVDLKMYKSYQELSDA  153



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score =   114 bits (285),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 76/109 (70%), Gaps = 6/109 (6%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL L +K+  ++    +K      D  KPPAKAQVVGWPPVRSY++N++A
Sbjct  44   FSET---VDLKLNLQTKE-DLNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYKKNMMA  99

Query  335  --ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
               NN + +     +  AAV VKVSMDGAPYLRKVDL+MYK+Y+DLSDA
Sbjct  100  QKVNNTEDTEKTTSNTTAAVFVKVSMDGAPYLRKVDLTMYKTYKDLSDA  148



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score =   113 bits (283),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 80/119 (67%), Gaps = 18/119 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L SK++ +  + + +  +K+         D  KPPAKAQVVGWPPVR
Sbjct  17   FSET---VDLKLNLQSKETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGWPPVR  73

Query  311  SYRRNILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+NI+A   +QK+  E+   KA    A  VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  74   SYRKNIMA---NQKNSCEESDKKASSGGAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  129



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score =   114 bits (285),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 75/113 (66%), Gaps = 9/113 (8%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--DVTKPPAKAQVVGWPPVRSYRRNI  328
            F ET   VDLKL L S    ++ +  N + +K    D  KPPAKAQVVGWPPVRSYR+N+
Sbjct  43   FSET---VDLKLNLQSNKEDLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNM  99

Query  329  LA--ANNHQKSGGE--DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +A   NN  + G E    S  A   VKVSMDGAPYLRKVDL+MY +Y+DLSDA
Sbjct  100  MAQKVNNSDQDGNEKTTSSTTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDA  152



>gb|KEH42779.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=204

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 75/109 (69%), Gaps = 6/109 (6%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL L +K+  ++    +K      D  KPPAKAQVVGWPPVRSYR+N++A
Sbjct  44   FSET---VDLKLNLQTKE-DLNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  99

Query  335  --ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
               NN + +     +  AA  VKVSMDGAPYLRKVDL+MYK+Y+DLSDA
Sbjct  100  QKVNNTEDTEKTTSNTTAAAFVKVSMDGAPYLRKVDLTMYKTYKDLSDA  148



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 80/119 (67%), Gaps = 18/119 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L SK++ +  + + +  +K+         D  KPPAKAQVVGWPPVR
Sbjct  54   FSET---VDLKLNLQSKETGMDLNKNIENGSKEKTLLPACTKDPAKPPAKAQVVGWPPVR  110

Query  311  SYRRNILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+NI+A   +QK+  E+   KA    A  VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  111  SYRKNIMA---NQKNSCEESDKKASSGGAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  166



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 75/113 (66%), Gaps = 9/113 (8%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--DVTKPPAKAQVVGWPPVRSYRRNI  328
            F ET   VDLKL L S    ++ +  N + +K    D  KPPAKAQVVGWPPVRSYR+N+
Sbjct  43   FSET---VDLKLNLQSNKEDLNDNSKNVSKDKTLLKDPAKPPAKAQVVGWPPVRSYRKNM  99

Query  329  LA--ANNHQKSGGE--DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +A   NN  + G E    S  A   VKVSMDGAPYLRKVDL+MY +Y+DLSDA
Sbjct  100  MAQKVNNSDQDGNEKTTSSTTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDA  152



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 13/117 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVT-------KPPAKAQVVGWPPVRS  313
            F ET   VDLKL LS+K++    SD  K   K+  V        KPP+KAQVVGWPP+RS
Sbjct  48   FSET---VDLKLNLSTKETGKDGSDQEKVATKEKTVAPRPNDPAKPPSKAQVVGWPPIRS  104

Query  314  YRRNILAANNHQKSGGEDGSD---KAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+N++A   +    GE  S      A  VKVSMDGAPYLRKVDL +YKSY++LSDA
Sbjct  105  FRKNVMAVQKNNNDEGEKASSSGTTGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDA  161



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 75/118 (64%), Gaps = 16/118 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET   +DLKL L SK+        I + D N   +   D +KPPAKAQVVGWPPVRSY
Sbjct  44   FSET---IDLKLNLQSKEDLNDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSY  100

Query  317  RRNILAANN-----HQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI+A  N      +K+ G  G    A  VKV MDGAPYLRKVDL MYKSYQ+LS+A
Sbjct  101  RKNIMAQKNTSEEKTKKASGGGGC--TAAFVKVCMDGAPYLRKVDLKMYKSYQELSNA  156



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score =   114 bits (284),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 74/105 (70%), Gaps = 9/105 (9%)
 Frame = +2

Query  167  HQHVDLKLKLSSKD--SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAAN  340
             Q VDLKL LSSKD  +Q   ++    N K+    KPPAKAQVVGWPPVR++R+N++A  
Sbjct  42   EQTVDLKLNLSSKDLPNQTDLAE----NKKNDQPVKPPAKAQVVGWPPVRNFRKNVMAVQ  97

Query  341  NHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
              +K+    GS   A  VKVSMDGAPYLRKVDL MYK+Y++LSDA
Sbjct  98   KTEKAEESGGS---AAFVKVSMDGAPYLRKVDLKMYKTYEELSDA  139



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 78/117 (67%), Gaps = 13/117 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD-SQIHASD-HNKANNKDA-------DVTKPPAKAQVVGWPPV  307
            +EET   VDLKL LS+KD   +  SD   K  +K+        D  KPPAKAQVVGWPPV
Sbjct  43   YEET---VDLKLNLSTKDVGNLDQSDLKEKTLSKEKNLLPCPNDSVKPPAKAQVVGWPPV  99

Query  308  RSYRRNILAANNHQKSG-GEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            RS+R+N++A      S   E GS  AA  VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  100  RSFRKNVMAVQKVSDSEETEKGSGGAAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  156



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 74/116 (64%), Gaps = 12/116 (10%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL L SK+        I + D N   +   D +KPPAKAQVVGWPPVRSY
Sbjct  44   FSET---VDLKLNLQSKEDLNDNVKNIASKDKNNLLSCTKDPSKPPAKAQVVGWPPVRSY  100

Query  317  RRNILAANNHQKSGGE---DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI++  N  +   E    G   +A  VKV MDGAPYLRKVDL MYKSYQ+LS+A
Sbjct  101  RKNIMSQKNTSEEKTEKASGGGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNA  156



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 75/109 (69%), Gaps = 6/109 (6%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL L +K+  ++    +K      D  KPPAKAQVVGWPPVRSYR+N++A
Sbjct  44   FSET---VDLKLNLQTKE-DLNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  99

Query  335  --ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
               NN + +     +  AA  VKVSMDGAPYLRKVDL+MYK+Y+DLSDA
Sbjct  100  QKVNNTEDTEKTTSNTTAAAFVKVSMDGAPYLRKVDLTMYKTYKDLSDA  148



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 76/118 (64%), Gaps = 14/118 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVT-------KPPAKAQVVGWPPVRS  313
            F ET   VDLKL LS+K++    SD  K   K+  V        KPP+KAQVVGWPP+RS
Sbjct  48   FSET---VDLKLNLSTKETGKDGSDQEKVVMKEKTVAPRPNDPAKPPSKAQVVGWPPIRS  104

Query  314  YRRNILAANNHQKSGGE----DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+N++A   +    GE     G+   A  VKVSMDGAPYLRKVDL +YKSY++LSDA
Sbjct  105  FRKNVMAVQKNSNDEGEKASSSGTTGTAAFVKVSMDGAPYLRKVDLKLYKSYRELSDA  162



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 75/113 (66%), Gaps = 10/113 (9%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIH-ASDHNKANNKDA-----DVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL L +K+S +  A   N    K+      D  KPPAKAQVVGWPPVRS+
Sbjct  56   FAET---VDLKLNLPTKESVLDPAEKKNSPKEKNLLPCSNDPAKPPAKAQVVGWPPVRSF  112

Query  317  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NIL+ +      GE  S  AA  VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  113  RKNILSVHKSSTEEGEKVSSSAA-FVKVSMDGAPYLRKVDLKMYKSYQELSDA  164



>gb|KEH42778.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=239

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 75/109 (69%), Gaps = 6/109 (6%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL L +K+  ++    +K      D  KPPAKAQVVGWPPVRSYR+N++A
Sbjct  44   FSET---VDLKLNLQTKE-DLNEKSASKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMMA  99

Query  335  --ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
               NN + +     +  AA  VKVSMDGAPYLRKVDL+MYK+Y+DLSDA
Sbjct  100  QKVNNTEDTEKTTSNTTAAAFVKVSMDGAPYLRKVDLTMYKTYKDLSDA  148



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 78/117 (67%), Gaps = 16/117 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS------QIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKLKLSSK+S      +  +S   + N    D  KPPAKAQVVGWPPVRS+
Sbjct  37   FSET---VDLKLKLSSKESGADPNHEKTSSLQREKNLLATDPAKPPAKAQVVGWPPVRSF  93

Query  317  RRNILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+N+LA    QKS  +   +K     A  VKVSMDGAPYLRKVDL MYK+YQ+LSDA
Sbjct  94   RKNMLAV---QKSSTDQECEKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYQELSDA  147



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 75/114 (66%), Gaps = 12/114 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDLKL LSSK+  I   H     + N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  39   FSET---VDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  326  ILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +LA    + S  ++ +DK     A  VKVSMDGAPYLRKVDL MYK+Y +LSDA
Sbjct  96   MLAV--QKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDA  147



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 6/110 (5%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--DVTKPPA-KAQVVGWPPVRSYRRN  325
            F ET   VDLKL L   +  +   +  KA  K+A  D  KPPA KAQVVGWPPVRS+R+N
Sbjct  45   FSET---VDLKLNLQPNEPVVDLKEKMKAPAKEATKDPVKPPAAKAQVVGWPPVRSFRKN  101

Query  326  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            I+A  ++ +    + +  +A  VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  102  IMAQKSNTEEAAAEKAGSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  151



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 79/115 (69%), Gaps = 14/115 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA---DVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDL L L S   +    ++  A  K++   D TKPPAKAQVVGWPPVR+YR+N
Sbjct  38   FSET---VDLMLNLQSNKEEAVDLNNIAAAPKESLLKDPTKPPAKAQVVGWPPVRNYRKN  94

Query  326  ILAANNHQKSGG--EDGSDKA---AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            ++     QK+ G  E  SDKA   A LVKVSMDGAPYLRKVDL+MYKSYQDLSDA
Sbjct  95   MM---TQQKTTGSEEASSDKAGTGAALVKVSMDGAPYLRKVDLNMYKSYQDLSDA  146



>ref|XP_002306817.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
 gb|EEE93813.1| hypothetical protein POPTR_0005s23980g [Populus trichocarpa]
Length=229

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 75/114 (66%), Gaps = 12/114 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDLKL LSSK+  I   H     + N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  39   FSET---VDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  326  ILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +LA    + S  ++ +DK     A  VKVSMDGAPYLRKVDL MYK+Y +LSDA
Sbjct  96   MLAV--QKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDA  147



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 71/115 (62%), Gaps = 12/115 (10%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS--------QIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL   + DS        +I      +  N + D  KPPAKAQVVGWPPVR
Sbjct  27   FSET---VDLKLNFQTNDSSSAMDLKEKIKTPTTKEIANCNKDSVKPPAKAQVVGWPPVR  83

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            S+R+N++A  N+ +   E  S  A   VKV MDGAPYLRKVDL MYKSYQ LSDA
Sbjct  84   SFRKNVMAQKNNTEET-EKSSATAVAFVKVCMDGAPYLRKVDLKMYKSYQQLSDA  137



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 13/117 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVT-------KPPAKAQVVGWPPVRS  313
            F ET   VDLKL LS+K++    SD  K   K+  V        KPP+KAQVVGWPP+RS
Sbjct  48   FSET---VDLKLNLSTKETGKDGSDQEKVVMKEKTVAPRPNDPAKPPSKAQVVGWPPIRS  104

Query  314  YRRNILAANNHQKSGGEDGSDKAAV---LVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+N++A   +    GE  S   A     VKVSMDGAPYLRKVDL +YKSY++LSDA
Sbjct  105  FRKNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDA  161



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 75/114 (66%), Gaps = 12/114 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDLKL LSSK+  I   H     + N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  39   FSET---VDLKLNLSSKEGGIDPNHEKTQREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  326  ILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +LA    + S  ++ +DK     A  VKVSMDGAPYLRKVDL MYK+Y +LSDA
Sbjct  96   MLAV--QKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDA  147



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 74/115 (64%), Gaps = 11/115 (10%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNK------DADVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL LS+K+S     +      K        D  KPPAKAQVVGWPP+RS+
Sbjct  47   FSET---VDLKLNLSTKESGKGVVEEKVMKEKTVAPPASTDPAKPPAKAQVVGWPPIRSF  103

Query  317  RRNILAANNHQKSGGE-DGSDKAAV-LVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+N++A   +    GE  GS  A V  VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  104  RKNVMAVQKNSNDNGEKSGSGGAGVAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  158



>gb|KJB11141.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11144.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=253

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 78/117 (67%), Gaps = 15/117 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD--SQIHASD------HNKANN--KDADVTKPPAKAQVVGWPP  304
            F ET   VDLKL LSSK   S I  +D      H + N      D  KPPAKAQVVGWPP
Sbjct  54   FSET---VDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+N+LAA   QKS  E+  +KAA LVKVSMDGAPYLRKVDL MY SY  LSDA
Sbjct  111  VRSFRKNMLAATT-QKSSSEESGEKAA-LVKVSMDGAPYLRKVDLRMYTSYHQLSDA  165



>gb|KJB11145.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=261

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 78/117 (67%), Gaps = 15/117 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD--SQIHASD------HNKANN--KDADVTKPPAKAQVVGWPP  304
            F ET   VDLKL LSSK   S I  +D      H + N      D  KPPAKAQVVGWPP
Sbjct  54   FSET---VDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+N+LAA   QKS  E+  +KAA LVKVSMDGAPYLRKVDL MY SY  LSDA
Sbjct  111  VRSFRKNMLAATT-QKSSSEESGEKAA-LVKVSMDGAPYLRKVDLRMYTSYHQLSDA  165



>gb|KJB11146.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=285

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 78/117 (67%), Gaps = 15/117 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD--SQIHASD------HNKANN--KDADVTKPPAKAQVVGWPP  304
            F ET   VDLKL LSSK   S I  +D      H + N      D  KPPAKAQVVGWPP
Sbjct  54   FSET---VDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+N+LAA   QKS  E+  +KAA LVKVSMDGAPYLRKVDL MY SY  LSDA
Sbjct  111  VRSFRKNMLAATT-QKSSSEESGEKAA-LVKVSMDGAPYLRKVDLRMYTSYHQLSDA  165



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 73/116 (63%), Gaps = 15/116 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L   +S         A +K      D  KPPAKAQVVGWPPVRS+R+
Sbjct  44   FSET---VDLKLNLQPNESAALDLKETSAMDKPVLPPKDPVKPPAKAQVVGWPPVRSFRK  100

Query  323  NILAANNHQKSGGEDG-----SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            NI+A   HQKS  E+      S   A  VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  101  NIMA---HQKSSDEEAEKAACSSPTAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  153



>ref|XP_004172452.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 80/129 (62%), Gaps = 28/129 (22%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQ----------IHASDHNKANNKDA-------DVTKPPAKA  283
            F ET   VDLKL L SKD            ++ +  N + N D        D  KPPAKA
Sbjct  46   FSET---VDLKLNLQSKDGGGGVGVGVGVDLNENIKNVSTNVDGEKSLCSKDPAKPPAKA  102

Query  284  QVVGWPPVRSYRRNILAANNHQKSGGEDGSDK-----AAVLVKVSMDGAPYLRKVDLSMY  448
            QVVGWPPVRSYR+N++A  N   SGGE G++K     +A  VKV MDGAPYLRKVDL MY
Sbjct  103  QVVGWPPVRSYRKNVMAQKNT--SGGE-GTEKGNGGSSAAFVKVCMDGAPYLRKVDLKMY  159

Query  449  KSYQDLSDA  475
            +SYQ+LSDA
Sbjct  160  QSYQELSDA  168



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 77/128 (60%), Gaps = 26/128 (20%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQ----------IHASDHNKANNKDA-------DVTKPPAKA  283
            F ET   VDLKL L SKD            ++ +  N + N D        D  KPPAKA
Sbjct  46   FSET---VDLKLNLQSKDGGGGGGVGVGVDLNENVKNVSTNVDGEKSLCSKDPAKPPAKA  102

Query  284  QVVGWPPVRSYRRNILAANNHQKSGGEDG----SDKAAVLVKVSMDGAPYLRKVDLSMYK  451
            QVVGWPPVRSYR+N++A  N   SGGE      S  +A  VKV MDGAPYLRKVDL MY+
Sbjct  103  QVVGWPPVRSYRKNVMAQKNT--SGGEGAEKGSSGSSAAFVKVCMDGAPYLRKVDLKMYQ  160

Query  452  SYQDLSDA  475
            SYQ+LSDA
Sbjct  161  SYQELSDA  168



>gb|KJB11142.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11143.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=227

 Score =   112 bits (279),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 78/117 (67%), Gaps = 15/117 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD--SQIHASD------HNKANN--KDADVTKPPAKAQVVGWPP  304
            F ET   VDLKL LSSK   S I  +D      H + N      D  KPPAKAQVVGWPP
Sbjct  54   FSET---VDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+N+LAA   QKS  E+  +KAA LVKVSMDGAPYLRKVDL MY SY  LSDA
Sbjct  111  VRSFRKNMLAATT-QKSSSEESGEKAA-LVKVSMDGAPYLRKVDLRMYTSYHQLSDA  165



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 80/116 (69%), Gaps = 16/116 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA------DVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL LSSK+  I  +D+ K  +++       D  KPPAKAQVVGWPPVRS+
Sbjct  48   FSET---VDLKLNLSSKEPGIDPNDNTKTISRENNLLSADDPAKPPAKAQVVGWPPVRSF  104

Query  317  RRNILAANNHQKSGGEDGSDKAAV---LVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+++L     QKS  E+ ++K  +    VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  105  RKHMLTV---QKSSNEE-TEKLGLNPTFVKVSMDGAPYLRKVDLKMYKSYQELSDA  156



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 77/121 (64%), Gaps = 21/121 (17%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   V+LKL LSSK++    SD  K  +   D  KPPAKAQVVGWPPVRS+R+NI+A
Sbjct  45   FSET---VNLKLNLSSKETVAEDSDEMKEKS-STDTAKPPAKAQVVGWPPVRSFRKNIMA  100

Query  335  ANNHQKSGGED--GSDKAA------------VLVKVSMDGAPYLRKVDLSMYKSYQDLSD  472
                QK+  E+  GS KA               VKVSMDGAPYLRKVDL +YKSYQ LSD
Sbjct  101  V---QKASSEEEGGSKKAGNSAAATTTTTAAAFVKVSMDGAPYLRKVDLKLYKSYQQLSD  157

Query  473  A  475
            A
Sbjct  158  A  158



>gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa]
Length=194

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 70/91 (77%), Gaps = 10/91 (11%)
 Frame = +2

Query  224  SDHNKAN--NKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGG--EDGSDKAAV-  388
            +D+ K N  N +AD+ KPPAKAQVVGWPPVRSYR+N+LA    QKS G  E  S+K A  
Sbjct  19   NDNTKVNGANNNADLAKPPAKAQVVGWPPVRSYRKNMLAV---QKSTGAPESESEKPAAN  75

Query  389  --LVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
              LVKVSMDGAPYLRKVDL +YKSYQDLSDA
Sbjct  76   GGLVKVSMDGAPYLRKVDLKLYKSYQDLSDA  106



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 77/118 (65%), Gaps = 14/118 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNK-ANNKDA---------DVTKPPAKAQVVGWPP  304
            F ET   VDLKL L +KD  +  +D+ K   +KD          D  KPPAKAQVVGWPP
Sbjct  46   FAET---VDLKLNLQAKDGVMDLNDNIKNITSKDKNHLPAAAIKDPAKPPAKAQVVGWPP  102

Query  305  VRSYRRNILAANNHQKSGGEDGS-DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRSYR+N++A  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDA
Sbjct  103  VRSYRKNVMAQKNASEEGEKTSTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDA  160



>gb|KDO48908.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=171

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 16/112 (14%)
 Frame = +2

Query  176  VDLKLKLSSKDSQ-IHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRRNILAAN  340
            VDLKL LS+K+S  I   +  K  +  A    D++KPPAK+QVVGWPPVRS+R+NI+A  
Sbjct  50   VDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAVQ  109

Query  341  NHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                   E+G +KA          VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  110  KDN----EEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  157



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 72/115 (63%), Gaps = 11/115 (10%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNK-----DADVTKPPAKAQVVGWPPVRSYR  319
            F ET   VDLKL L S DS       +K  N      + D  KPPAKAQVVGWPPVRS+R
Sbjct  44   FSET---VDLKLNLQSNDSSGLDLKKDKMKNPSKETCNKDSAKPPAKAQVVGWPPVRSFR  100

Query  320  RNILAANNH---QKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +NI+A       ++S    G   +A  VKVSMDGAPYLRKVDL MYKSYQ LSDA
Sbjct  101  KNIMAQKGSSICEESENSKGGSSSAAFVKVSMDGAPYLRKVDLKMYKSYQQLSDA  155



>gb|KJB82526.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=194

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 78/122 (64%), Gaps = 23/122 (19%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-DVTKPPAKAQVVGWPPVRSYRRNIL  331
            F ET   V+LKL LSSK++   A D  K   K + D  KPPAKAQVVGWPPVRS+R+NI+
Sbjct  45   FSET---VNLKLNLSSKET--VAEDSEKMKEKSSTDPAKPPAKAQVVGWPPVRSFRKNIM  99

Query  332  AANNHQKSGGED--GSDKAA------------VLVKVSMDGAPYLRKVDLSMYKSYQDLS  469
            A    QK+  E+  GS KA               VKVSMDGAPYLRKVDL +YKSYQ LS
Sbjct  100  AV---QKASSEEEGGSKKAGNSAAATTTTTAAAFVKVSMDGAPYLRKVDLKLYKSYQQLS  156

Query  470  DA  475
            DA
Sbjct  157  DA  158



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 14/114 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKD-----ADVTKPPAKAQVVGWPPVRSYR  319
            F ET   VDLKL L + +  ++ S  N ++ +       D  KPPAKAQVVGWPPVRSYR
Sbjct  37   FSET---VDLKLNLHANEGLMNESVKNVSSREKNLPCIKDPAKPPAKAQVVGWPPVRSYR  93

Query  320  RNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +N++A    QKS GE+ S     A  VKV MDGAPYLRKVDL MYKSY++LSDA
Sbjct  94   KNVMA----QKSTGEESSTTTEKAAFVKVCMDGAPYLRKVDLKMYKSYKELSDA  143



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 77/117 (66%), Gaps = 15/117 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD--SQIHASD------HNKANN--KDADVTKPPAKAQVVGWPP  304
            F ET   VDLKL LSSK   S I  +D      H + N      D  KPPAKAQVVGWPP
Sbjct  54   FSET---VDLKLNLSSKQDTSGIDPNDEKVKGLHQEKNLLLSAIDPAKPPAKAQVVGWPP  110

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+N+LA    QKS  E+  +KAA LVKVSMDGAPYLRKVDL MY SY  LSDA
Sbjct  111  VRSFRKNMLATTT-QKSSSEESGEKAA-LVKVSMDGAPYLRKVDLRMYTSYHQLSDA  165



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 73/115 (63%), Gaps = 11/115 (10%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET   +DLKL L SK+        I + D N   +   D +KPPAKAQVVGWPPVRSY
Sbjct  44   FSET---IDLKLNLQSKEDLNDNVKNIASKDKNNFLSCTKDPSKPPAKAQVVGWPPVRSY  100

Query  317  RRNILAANN--HQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+N++A  N   +K+         A  VKV MDGAPYLRKVDL MY+SYQ+LS+A
Sbjct  101  RKNVMAQKNTSEEKTKKASAGGCTAAFVKVCMDGAPYLRKVDLKMYRSYQELSNA  155



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 73/115 (63%), Gaps = 11/115 (10%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNK------DADVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL LS+K+S     +      K        D  KPPAKAQVVGWPP+RS+
Sbjct  47   FSET---VDLKLNLSTKESGKGGDEEKVMKEKTVAPPASTDPAKPPAKAQVVGWPPIRSF  103

Query  317  RRNILAANNHQKSGGE-DGSDKAAV-LVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+N++A   +    GE  GS    V  VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  104  RKNVMAVQKNSNDNGEKSGSSGTGVAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  158



>emb|CAC84711.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=229

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 12/114 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDLKL LSSK+  I   H     + N    D  KPPAKAQVVGWPPVRS+R+N
Sbjct  39   FSET---VDLKLNLSSKEGGIDPNHEKTRREKNLLATDPAKPPAKAQVVGWPPVRSFRKN  95

Query  326  ILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +LA    + S  ++ ++K     A  VKVSMDGAPYLRKVDL+MYK+Y +LSDA
Sbjct  96   MLAV--QKSSTDQESTNKVPGGNATFVKVSMDGAPYLRKVDLNMYKTYHELSDA  147



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 74/116 (64%), Gaps = 16/116 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNK---------ANNKDADVTKPPAKAQVVGWPPV  307
            F ET   VDLKL   + DS        K         A+NKD+   KPPAKAQVVGWPPV
Sbjct  27   FSET---VDLKLNFQTNDSSSAMDLKEKIKTPTTKEIASNKDS--VKPPAKAQVVGWPPV  81

Query  308  RSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            RS+R+N++A  N+ ++  E  +  AA  VKV MDGAPYLRKVDL MYKSYQ LSDA
Sbjct  82   RSFRKNVMAQKNNTEA--EKSNATAAAFVKVCMDGAPYLRKVDLKMYKSYQQLSDA  135



>ref|XP_007050422.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOX94579.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=260

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 69/109 (63%), Gaps = 5/109 (5%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKAN--NKDADVTKPPAKAQVVGWPPVRSYRRNI  328
            F ET   VDLKL LSSK+S     +  + N      D  KPPAKAQVVGWPPVRS+R+N+
Sbjct  99   FSET---VDLKLNLSSKESSGVDPNEKEKNLLPCATDPAKPPAKAQVVGWPPVRSFRKNM  155

Query  329  LAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
             A         E G    A  VKVSMDGAPYLRKVDL MYK+Y +LSDA
Sbjct  156  FATQKSSSEESEKGGAGNAAFVKVSMDGAPYLRKVDLRMYKTYLELSDA  204



>gb|ACL81167.1| auxin-responsive protein IAA1, partial [Mirabilis jalapa]
Length=263

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 70/91 (77%), Gaps = 10/91 (11%)
 Frame = +2

Query  224  SDHNKAN--NKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGG--EDGSDKAAV-  388
            +D+ K N  N +AD+ KPPAKAQVVGWPPVRSYR+N+LA    QKS G  E  S+K A  
Sbjct  88   NDNTKVNGANNNADLAKPPAKAQVVGWPPVRSYRKNMLAV---QKSTGAPESESEKPAAN  144

Query  389  --LVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
              LVKVSMDGAPYLRKVDL +YKSYQDLSDA
Sbjct  145  GGLVKVSMDGAPYLRKVDLKLYKSYQDLSDA  175



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 70/111 (63%), Gaps = 22/111 (20%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            FEET   +D KL  +S    I+            D  KPPAKAQVVGWPPVRS+R+NI+A
Sbjct  35   FEET---LDFKLNFASNGENIN------------DSVKPPAKAQVVGWPPVRSFRKNIMA  79

Query  335  ANNHQKSG----GEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                +KSG     E GS      VKVSMDGAPYLRK+DL MYK+YQ+LSDA
Sbjct  80   V---KKSGDSEDNEKGSGGGGAFVKVSMDGAPYLRKIDLKMYKTYQELSDA  127



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 76/121 (63%), Gaps = 17/121 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS-SKDS------QIHASDH--NKANN----KDADVTKPPAKAQVVG  295
            F ET   VDLKL LS SKDS       I+  D+   K NN       D  KPPAKAQVVG
Sbjct  46   FSET---VDLKLNLSNSKDSTLMDNININQVDNMKEKKNNIVVPSSNDPAKPPAKAQVVG  102

Query  296  WPPVRSYRRNILAANNHQKSGGE-DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  472
            WPPVRS+R+N++    +    GE  G+   A  VKVS+DGAPYLRKVDL MYKSYQ LSD
Sbjct  103  WPPVRSFRKNVMTVQKNTTGAGEISGTGTGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSD  162

Query  473  A  475
            A
Sbjct  163  A  163



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 73/118 (62%), Gaps = 14/118 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK----DSQIHASDHNKANNKD-------ADVTKPPAKAQVVGWP  301
            F ET   VDLKL LSS     DS I   ++N    K+        D  KPPAKAQVVGWP
Sbjct  29   FSET---VDLKLNLSSAEIGLDSAIDLKENNFNKEKNLLPSSSPTDSVKPPAKAQVVGWP  85

Query  302  PVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            PVRS+R+N++A      S   +     A  VKVSMDGAPYLRKVDL MYK+Y++LSDA
Sbjct  86   PVRSFRKNVMAVQKRTDSDEAEKGTGGAAFVKVSMDGAPYLRKVDLKMYKTYKELSDA  143



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 76/114 (67%), Gaps = 14/114 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKD-----ADVTKPPAKAQVVGWPPVRSYR  319
            F ET   VDLKL L + +  ++ S  N ++ +       D  KPPAKAQVVGWPPVRS+R
Sbjct  44   FSET---VDLKLNLHANEGLMNESVKNVSSREKNLPCIKDPAKPPAKAQVVGWPPVRSFR  100

Query  320  RNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +N++A    QKS GE+ S     A  VKV MDGAPYLRKVDL MYKSY++LSDA
Sbjct  101  KNVMA----QKSTGEESSTTTEKAAFVKVCMDGAPYLRKVDLKMYKSYKELSDA  150



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 69/109 (63%), Gaps = 5/109 (5%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKAN--NKDADVTKPPAKAQVVGWPPVRSYRRNI  328
            F ET   VDLKL LSSK+S     +  + N      D  KPPAKAQVVGWPPVRS+R+N+
Sbjct  112  FSET---VDLKLNLSSKESSGVDPNEKEKNLLPCATDPAKPPAKAQVVGWPPVRSFRKNM  168

Query  329  LAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
             A         E G    A  VKVSMDGAPYLRKVDL MYK+Y +LSDA
Sbjct  169  FATQKSSSEESEKGGAGNAAFVKVSMDGAPYLRKVDLRMYKTYLELSDA  217



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 72/117 (62%), Gaps = 17/117 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIH-ASDHNKANNK---------DADVTKPPAKAQVVGWPP  304
            F ET   VDLKL     +  I  A ++NK  N          + D  KPPAKAQVVGWPP
Sbjct  41   FSET---VDLKLNFHQANDDISCAMENNKMKNSVTTTKEVVCNKDPIKPPAKAQVVGWPP  97

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+N++A    QKS  E+        VKV MDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  98   VRSFRKNVMA----QKSNTEESEKTTVAFVKVCMDGAPYLRKVDLKMYKSYQELSDA  150



>ref|XP_009367750.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=259

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 75/126 (60%), Gaps = 21/126 (17%)
 Frame = +2

Query  161  ETHQHVDLKLKLSS----------KDSQIHASDHNKANNKDADV-----TKPPA-KAQVV  292
            +T   VDLKL LSS          KD     S  NK  N + D       KPPA KAQVV
Sbjct  46   DTSTCVDLKLNLSSNSKEANSTGGKDGSAEKSKTNKEKNNNLDFPASDPAKPPAAKAQVV  105

Query  293  GWPPVRSYRRNILAANNHQKSGGED-----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSY  457
            GWPPVRS+R+N+  A  +  + GE      G +  AVLVKVSMDGAPYLRKVDL MYKSY
Sbjct  106  GWPPVRSFRKNMFTAVQNSTNDGESEQMNKGGNNNAVLVKVSMDGAPYLRKVDLKMYKSY  165

Query  458  QDLSDA  475
             +LSDA
Sbjct  166  PELSDA  171



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 16/117 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKL-SSKDSQIHASDHNKANNKDA--DVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   +DL L L  +K+  +  ++   +  K    D  KPPAKAQVVGWPPVR+YR+N
Sbjct  38   FSET---MDLMLNLQCNKEETVDLNNATASKEKTLLKDPAKPPAKAQVVGWPPVRNYRKN  94

Query  326  ILAANNHQKSGGED-------GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            ++     QK+ GE+       G+   A LVKVSMDGAPYLRKVDL+MYKSYQDLSDA
Sbjct  95   MMT---QQKTSGEEEASSEKAGNGGGAALVKVSMDGAPYLRKVDLTMYKSYQDLSDA  148



>ref|XP_009119323.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=224

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 75/115 (65%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+        SK   +  S   + N    D TKPPAKAQVVGWPPVR
Sbjct  29   FSET---VDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS   +G  + AV VKVSMDGAPYLRKVDL MYKSY +LS+A
Sbjct  86   SYRKNVMGS--CQKS---NGVTETAVFVKVSMDGAPYLRKVDLKMYKSYDELSNA  135



>emb|CDX89832.1| BnaA10g02500D [Brassica napus]
Length=224

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 75/115 (65%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+        SK   +  S   + N    D TKPPAKAQVVGWPPVR
Sbjct  29   FSET---VDLKLNLNNEPESKEVSKTHDVVISVSKEKNTCPKDPTKPPAKAQVVGWPPVR  85

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS   +G  + AV VKVSMDGAPYLRKVDL MYKSY +LS+A
Sbjct  86   SYRKNVMGS--CQKS---NGVTETAVFVKVSMDGAPYLRKVDLKMYKSYDELSNA  135



>gb|EPS60474.1| hypothetical protein M569_14329, partial [Genlisea aurea]
Length=212

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 75/111 (68%), Gaps = 8/111 (7%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNK-DADVTKPPAKAQVVGWPPVRSYRRNIL  331
            F ET   VDLKL L++K+  +      K N +  AD +KPP KAQVVGWPPVR++RRN +
Sbjct  33   FAET---VDLKLNLAAKEMNLDKEKEKKKNLQISADSSKPPMKAQVVGWPPVRAFRRNAI  89

Query  332  AANNHQKSGGEDGSDKAA---VLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
             +        E+ ++KA+    LVKVSMDGAPYLRK+DL MYK+YQ LSDA
Sbjct  90   CSQKKSTEPAEE-TEKASPSPALVKVSMDGAPYLRKIDLKMYKTYQQLSDA  139



>ref|XP_007162490.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
 gb|ESW34484.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
Length=246

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 76/122 (62%), Gaps = 18/122 (15%)
 Frame = +2

Query  155  FEETHQH-----VDLKLKLSSKDSQIHASDHNKANNKD-------ADVTKPPAKAQVVGW  298
            F ET        VDL L LSSK+    A   +K N          AD  KPPAKAQVVGW
Sbjct  38   FSETETQDDTATVDLMLNLSSKEPTTGADPTHKHNTLPKEKTLLPADPAKPPAKAQVVGW  97

Query  299  PPVRSYRRNILAANNHQKSGGEDG---SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  469
            PPVRS+R+N+LA    QKS GE+    S   A  VKVSMDGAPYLRKVDL MY+SY++LS
Sbjct  98   PPVRSFRKNMLAV---QKSVGEESEKNSSPNASFVKVSMDGAPYLRKVDLKMYQSYRELS  154

Query  470  DA  475
            D+
Sbjct  155  DS  156



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 78/114 (68%), Gaps = 13/114 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKL-SSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDL L L S+K+  +   + +   K  N   D  KPPAKAQVVGWPPVR+YR+
Sbjct  89   FSET---VDLMLNLQSNKEGSVDLNNVAASPKEKNLIKDPAKPPAKAQVVGWPPVRNYRK  145

Query  323  NILAANNHQKSGG--EDGSDKA-AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            NI+     QK+ G  E  S+KA A LVKVSMDGAPYLRKVDL MYKSYQDLSDA
Sbjct  146  NIM---TQQKTSGTEEASSEKAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDA  196



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 77/121 (64%), Gaps = 21/121 (17%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   V+LKL LSSK++    SD  K  +   D  KPPAKAQVVGWPPVRS+R+NI+A
Sbjct  45   FSET---VNLKLNLSSKETVAEDSDKMKEKS-STDPAKPPAKAQVVGWPPVRSFRKNIMA  100

Query  335  ANNHQKSGGED--GSDKAA------------VLVKVSMDGAPYLRKVDLSMYKSYQDLSD  472
                QK+  E+  GS KA               VKVSMDGAPYLRKVDL +YKSYQ LSD
Sbjct  101  V---QKASSEEEGGSKKAGNSAAAITTTTAAAFVKVSMDGAPYLRKVDLKLYKSYQQLSD  157

Query  473  A  475
            A
Sbjct  158  A  158



>ref|XP_006432921.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 gb|ESR46161.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=213

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 74/112 (66%), Gaps = 16/112 (14%)
 Frame = +2

Query  176  VDLKLKLSSKDSQ-IHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRRNILAAN  340
            VDLKL LS+K+S  I      K  +  A    D++KPPAKAQVVGWPPVRS+R+NI+A  
Sbjct  50   VDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSFRKNIMAVQ  109

Query  341  NHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                   E+G +KA          VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  110  KDN----EEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  157



>ref|XP_006471686.1| PREDICTED: auxin-responsive protein IAA16-like isoform X3 [Citrus 
sinensis]
Length=217

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 74/112 (66%), Gaps = 16/112 (14%)
 Frame = +2

Query  176  VDLKLKLSSKDSQ-IHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRRNILAAN  340
            VDLKL LS+K+S  I      K  +  A    D++KPPAKAQVVGWPPVRS+R+NI+A  
Sbjct  50   VDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSFRKNIMAVQ  109

Query  341  NHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                   E+G +KA          VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  110  KDN----EEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  157



>ref|XP_006432922.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471685.1| PREDICTED: auxin-responsive protein IAA16-like isoform X2 [Citrus 
sinensis]
 gb|ESR46162.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=221

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 74/112 (66%), Gaps = 16/112 (14%)
 Frame = +2

Query  176  VDLKLKLSSKDSQ-IHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRRNILAAN  340
            VDLKL LS+K+S  I      K  +  A    D++KPPAKAQVVGWPPVRS+R+NI+A  
Sbjct  50   VDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSFRKNIMAVQ  109

Query  341  NHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                   E+G +KA          VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  110  KDN----EEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  157



>ref|XP_003521268.1| PREDICTED: auxin-induced protein AUX28-like [Glycine max]
 gb|KHN10705.1| Auxin-induced protein AUX28 [Glycine soja]
Length=254

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 77/111 (69%), Gaps = 14/111 (13%)
 Frame = +2

Query  176  VDLKLKLSSKDSQIHA--SDHNKANNKD-----ADVTKPPAKAQVVGWPPVRSYRRNILA  334
            VDL L LSSK++   A  +D +K   K+     AD  KPPAKAQVVGWPPVRS+R+N+LA
Sbjct  57   VDLMLNLSSKEAAAAADPTDKHKTLPKEKTLLPADPAKPPAKAQVVGWPPVRSFRKNMLA  116

Query  335  ANNHQKSGGEDG----SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                QKS GE+     S   A  VKVSMDGAPYLRKVDL MYKSY++LSD+
Sbjct  117  V---QKSVGEENEKNSSSPNASFVKVSMDGAPYLRKVDLKMYKSYRELSDS  164



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 74/112 (66%), Gaps = 16/112 (14%)
 Frame = +2

Query  176  VDLKLKLSSKDSQ-IHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRRNILAAN  340
            VDLKL LS+K+S  I      K  +  A    D++KPPAKAQVVGWPPVRS+R+NI+A  
Sbjct  50   VDLKLNLSTKESGGIDVIQKTKGKSASATGATDLSKPPAKAQVVGWPPVRSFRKNIMAVQ  109

Query  341  NHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                   E+G +KA          VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  110  KDN----EEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  157



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 77/115 (67%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--DVTKPPAKAQVVGWPPVRSYRRNI  328
            F ET   VDLKL L +K+  ++ +  N    K    D TK PAKAQVVGWPPVRSYR+N+
Sbjct  50   FSET---VDLKLNLQAKE-DLNENLKNAPEEKTLLKDPTKQPAKAQVVGWPPVRSYRKNM  105

Query  329  LAANNHQKSGGEDGSDK------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +     QK   EDG++K      +   VKVSMDGAPYLRKVDL+MYKSY+DLSDA
Sbjct  106  MT----QKVSTEDGAEKTTSSTASGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDA  156



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 76/118 (64%), Gaps = 18/118 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKA-------NNKDADVTKPPAKAQVVGWPPVRS  313
            F ET   VDLKLKLSSK+ +    +H K        N    D  KPPAKAQVVGWPPVRS
Sbjct  37   FSET---VDLKLKLSSKE-RGAGPNHEKTRSLQREKNILATDPAKPPAKAQVVGWPPVRS  92

Query  314  YRRNILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+N+LA    QKS  +   +K     A  VKVSMDGAPYLRKVDL MYK+YQ+LS A
Sbjct  93   FRKNMLAV---QKSSTDQECEKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYQELSGA  147



>gb|KDO48906.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=217

 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 16/112 (14%)
 Frame = +2

Query  176  VDLKLKLSSKDSQ-IHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRRNILAAN  340
            VDLKL LS+K+S  I   +  K  +  A    D++KPPAK+QVVGWPPVRS+R+NI+A  
Sbjct  50   VDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAVQ  109

Query  341  NHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                   E+G +KA          VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  110  KDN----EEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  157



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 73/117 (62%), Gaps = 17/117 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKL-SSKDSQIHASDHNKANNK---------DADVTKPPAKAQVVGWPP  304
            F ET   VDLKL    + D    A ++NK  +          + D  KPPAKAQVVGWPP
Sbjct  39   FSET---VDLKLNFHQASDDISCAMENNKMKSSVTTTKEVVCNKDPIKPPAKAQVVGWPP  95

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+N++A    QKS  E+     A  VKV MDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  96   VRSFRKNVMA----QKSNTEESEKTTAAFVKVCMDGAPYLRKVDLKMYKSYQELSDA  148



>gb|KDO48907.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=213

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 16/112 (14%)
 Frame = +2

Query  176  VDLKLKLSSKDSQ-IHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRRNILAAN  340
            VDLKL LS+K+S  I   +  K  +  A    D++KPPAK+QVVGWPPVRS+R+NI+A  
Sbjct  50   VDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAVQ  109

Query  341  NHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                   E+G +KA          VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  110  KDN----EEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  157



>gb|KDO48904.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=221

 Score =   108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 16/112 (14%)
 Frame = +2

Query  176  VDLKLKLSSKDSQ-IHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRRNILAAN  340
            VDLKL LS+K+S  I   +  K  +  A    D++KPPAK+QVVGWPPVRS+R+NI+A  
Sbjct  50   VDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAVQ  109

Query  341  NHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                   E+G +KA          VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  110  KDN----EEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  157



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 75/110 (68%), Gaps = 11/110 (10%)
 Frame = +2

Query  170  QHVDLKLKLSSKDSQIHASDH--NKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANN  343
            + VDLKL L SK+  +  + +  N +  K+    KPPAKAQV+GWPPVRSYR+NI+A   
Sbjct  54   ETVDLKLNLQSKEGCMDLNQNLENGSKEKNHHPAKPPAKAQVLGWPPVRSYRKNIMA---  110

Query  344  HQKSGGEDGSDKA------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +QK+  ++ SD+A      A  VKV MDGAPYLRKVDL MY SYQ LSDA
Sbjct  111  NQKNNSDEISDRASSGSGGAAFVKVCMDGAPYLRKVDLKMYNSYQKLSDA  160



>ref|XP_010679165.1| PREDICTED: auxin-responsive protein IAA14-like [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 72/111 (65%), Gaps = 8/111 (7%)
 Frame = +2

Query  158  EETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAA  337
            E+T     L L  +   + + A D   ++  +AD  KPPAKAQVVGWPPVRSYR+N+LA 
Sbjct  83   EQTATSAPLDLMKNDNKADVSA-DKEISSKVNADSVKPPAKAQVVGWPPVRSYRKNMLAV  141

Query  338  NNHQKSGGEDGS-----DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
               + +GG D       +    LVKVSMDGAPYLRKVDL MYKSYQDLSDA
Sbjct  142  --QKTTGGPDSETEKPMNGGGALVKVSMDGAPYLRKVDLKMYKSYQDLSDA  190



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 16/112 (14%)
 Frame = +2

Query  176  VDLKLKLSSKDSQ-IHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRRNILAAN  340
            VDLKL LS+K+S  I   +  K  +  A    D++KPPAK+QVVGWPPVRS+R+NI+A  
Sbjct  50   VDLKLNLSTKESGGIDVIEKTKGKSASATGATDLSKPPAKSQVVGWPPVRSFRKNIMAVQ  109

Query  341  NHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                   E+G +KA          VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  110  KDN----EEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  157



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 76/120 (63%), Gaps = 18/120 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS---------QIHASDHNK---ANNKDADVTKPPAKAQVVGW  298
            F ET   VDLKL L +K+           I + D N+   A  KD    KPPAKAQVVGW
Sbjct  46   FAET---VDLKLNLQAKEGVMDLNENIKNIASKDKNQLPAATIKDP--AKPPAKAQVVGW  100

Query  299  PPVRSYRRNILAANNHQKSGGEDGS-DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            PPVRSYR+N+LA  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDA
Sbjct  101  PPVRSYRKNVLAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDA  160



>ref|XP_006575865.1| PREDICTED: auxin-induced protein AUX28-like [Glycine max]
Length=170

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 75/122 (61%), Gaps = 17/122 (14%)
 Frame = +2

Query  155  FEETHQ----HVDLKLKLSSKDSQIH----ASDHNKANNKD-----ADVTKPPAKAQVVG  295
            F ET       VDL L LS K++         +  K + K+      D  KPPAKAQVVG
Sbjct  39   FSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQVVG  98

Query  296  WPPVRSYRRNILAANNHQKSGGEDG--SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  469
            WPPVRS+R+N+ AA   + SGGE+   S   A  VKVSMDGAPYLRKVDL MYKSY +LS
Sbjct  99   WPPVRSFRKNMFAA--QKSSGGEESEKSSPNASFVKVSMDGAPYLRKVDLKMYKSYPELS  156

Query  470  DA  475
            DA
Sbjct  157  DA  158



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 76/120 (63%), Gaps = 18/120 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS---------QIHASDHNK---ANNKDADVTKPPAKAQVVGW  298
            F ET   VDLKL L +K+           I + D N+   A  KD    KPPAKAQVVGW
Sbjct  46   FAET---VDLKLNLQAKEGVMDLNENIKNIASKDKNQLPAATIKDP--AKPPAKAQVVGW  100

Query  299  PPVRSYRRNILAANNHQKSGGEDGS-DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            PPVRSYR+N+LA  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDA
Sbjct  101  PPVRSYRKNVLAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDA  160



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 76/120 (63%), Gaps = 22/120 (18%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-----------DVTKPPAKAQVVGWP  301
            F ET   VDLKL LS K++ +   D NK  +              D  +PPAKAQVVGWP
Sbjct  46   FSET---VDLKLNLSGKEAGV---DDNKVKSLQKEKSKSLLPCGNDPARPPAKAQVVGWP  99

Query  302  PVRSYRRNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            PVRS+R+N+LA    QK G E+G   +  A  VKVSMDGAPYLRKVDL MY SYQ+LS+A
Sbjct  100  PVRSFRKNMLAG---QKGGSEEGEKVSCNAAFVKVSMDGAPYLRKVDLKMYTSYQELSNA  156



>ref|XP_008382962.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 73/121 (60%), Gaps = 21/121 (17%)
 Frame = +2

Query  176  VDLKLKLSS----------KDSQIHASDHNKANNKDADV-----TKPPA-KAQVVGWPPV  307
            VDLKL LS+          KD     S  NK  N + D       KPPA KAQVVGWPPV
Sbjct  49   VDLKLNLSNNSKETNSTGGKDGSAEKSKTNKEKNNNLDFRASDPAKPPAAKAQVVGWPPV  108

Query  308  RSYRRNILAANNHQKSGGED-----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  472
            RS+R+N+  A     + GE      GS+  AVLVKVSMDGAPYLRKVDL MYKSY +LSD
Sbjct  109  RSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVKVSMDGAPYLRKVDLKMYKSYPELSD  168

Query  473  A  475
            A
Sbjct  169  A  169



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 72/115 (63%), Gaps = 14/115 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVT----KPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL LSSKD+        K  N     T    KPPAK QVVGWPPVRS+R+
Sbjct  36   FSET---VDLKLNLSSKDTSEKVKSFQKEKNPLPRATDPPAKPPAKTQVVGWPPVRSFRK  92

Query  323  NILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N+L     QKS GE+ SD A    A  VKVSMDGAPYLRKVDL MY +YQDL  A
Sbjct  93   NMLGV--VQKSSGEE-SDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYQDLYHA  144



>gb|AFK36684.1| unknown [Lotus japonicus]
Length=190

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 77/128 (60%), Gaps = 24/128 (19%)
 Frame = +2

Query  155  FEETHQH---VDLKLKLSSKDSQIHASDHNKANNKD---------ADVTKPPAKAQVVGW  298
            F ET      VDL L LSSK+     +D ++    +         AD  KPPAKA+VVGW
Sbjct  45   FSETESETDTVDLMLNLSSKEPTSAGADPSQKPKTNLQKEKTLLPADPAKPPAKARVVGW  104

Query  299  PPVRSYRRNILAANNHQKSGGEDGSDKA---------AVLVKVSMDGAPYLRKVDLSMYK  451
            PPVRS+R+N+LA    QKS GE+   +          A  VKVSMDGAPYLRKVDL MYK
Sbjct  105  PPVRSFRKNMLAV---QKSVGEESGGEKSNNGGGGGGASFVKVSMDGAPYLRKVDLKMYK  161

Query  452  SYQDLSDA  475
            SY+DLSD+
Sbjct  162  SYRDLSDS  169



>gb|KJB28413.1| hypothetical protein B456_005G046500 [Gossypium raimondii]
Length=248

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 75/110 (68%), Gaps = 11/110 (10%)
 Frame = +2

Query  170  QHVDLKLKLSSKDSQIHASDH--NKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANN  343
            + VDLKL L SK+  +  + +  N +  K+    KPPAKAQV+GWPPVRSYR+NI+A   
Sbjct  54   ETVDLKLNLQSKEGCMDLNQNLENGSKEKNHLPAKPPAKAQVLGWPPVRSYRKNIMA---  110

Query  344  HQKSGGEDGSDKA------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +QK+  ++ SD+A      A  VKV MDGAPYLRKVDL MY SYQ LSDA
Sbjct  111  NQKNNSDEISDRASSGSGGAAFVKVCMDGAPYLRKVDLKMYNSYQKLSDA  160



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 72/116 (62%), Gaps = 15/116 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS--------QIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKLKL   +          I  S H        D  KPPAKAQVVGWPPVR
Sbjct  53   FSET---VDLKLKLHQSNEPAALDLKENIKNSSHENPMLPPKDPIKPPAKAQVVGWPPVR  109

Query  311  SYRRNILAANNHQKSGGEDGS-DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            S+R+N   A +HQKS  E+ +    A  VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  110  SFRKN---AMSHQKSDKEEAACSGGAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  162



>gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=246

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 78/122 (64%), Gaps = 23/122 (19%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-DVTKPPAKAQVVGWPPVRSYRRNIL  331
            F ET   V+LKL LSSK++   A D  K   K + D  KPPAKAQVVGWPPVRS+R+NI+
Sbjct  45   FSET---VNLKLNLSSKETV--AEDSEKMKEKSSTDPAKPPAKAQVVGWPPVRSFRKNIM  99

Query  332  AANNHQKSGGED--GSDKAA------------VLVKVSMDGAPYLRKVDLSMYKSYQDLS  469
            A    QK+  E+  GS KA               VKVSMDGAPYLRKVDL +YKSYQ LS
Sbjct  100  AV---QKASSEEEGGSKKAGNSAAATTTTTAAAFVKVSMDGAPYLRKVDLKLYKSYQQLS  156

Query  470  DA  475
            DA
Sbjct  157  DA  158



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 76/120 (63%), Gaps = 22/120 (18%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANN-----------KDADVTKPPAKAQVVGWP  301
            F ET   VDLKL LS K++ +   D NK  +              D  +PPAKAQVVGWP
Sbjct  37   FSET---VDLKLNLSGKEAGV---DDNKVKSLQKEKSKSLLPCGNDPARPPAKAQVVGWP  90

Query  302  PVRSYRRNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            PVRS+R+N+LA    QK G E+G   +  A  VKVSMDGAPYLRKVDL MY SYQ+LS+A
Sbjct  91   PVRSFRKNMLAG---QKGGSEEGEKVSCNAAFVKVSMDGAPYLRKVDLKMYTSYQELSNA  147



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 77/118 (65%), Gaps = 14/118 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNK-ANNKDA---------DVTKPPAKAQVVGWPP  304
            F ET   VDLKL L +K+  +  +++ K   +KD          D  KPPAKAQVVGWPP
Sbjct  46   FAET---VDLKLNLQAKEGVMDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPP  102

Query  305  VRSYRRNILAANNHQKSGGEDGS-DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRSYR+N++A  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDA
Sbjct  103  VRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDA  160



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 77/118 (65%), Gaps = 14/118 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNK-ANNKDA---------DVTKPPAKAQVVGWPP  304
            F ET   VDLKL L +K+  +  +++ K   +KD          D  KPPAKAQVVGWPP
Sbjct  46   FAET---VDLKLNLQAKEGVMDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPP  102

Query  305  VRSYRRNILAANNHQKSGGEDGS-DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRSYR+N++A  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDA
Sbjct  103  VRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDA  160



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 77/118 (65%), Gaps = 14/118 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNK-ANNKDA---------DVTKPPAKAQVVGWPP  304
            F ET   VDLKL L +K+  +  +++ K   +KD          D  KPPAKAQVVGWPP
Sbjct  46   FAET---VDLKLNLQAKEGVMDLNENIKNITSKDKNHLPAVTIKDPAKPPAKAQVVGWPP  102

Query  305  VRSYRRNILAANNHQKSGGEDGS-DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRSYR+N++A  N  + G +  +   +A  VKV MDGAPYLRKVDL MY+SYQ+LSDA
Sbjct  103  VRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQELSDA  160



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 76/118 (64%), Gaps = 16/118 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS-------QIHASDHNKANNKDADVTKPPAKAQVVGWPPVRS  313
            F ET   VDLKL L S D        ++      + N+KD    KPPAKAQVVGWPPVR+
Sbjct  41   FSET---VDLKLNLQSNDQSSVDLNEKVKNPPSKETNSKDP--VKPPAKAQVVGWPPVRA  95

Query  314  YRRNILAA-NNHQKSGGEDGSDKA---AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+NI+A  NN +   GE GS  +      VKVSMDGAPYLRKVDL +YKSYQ+L+DA
Sbjct  96   FRKNIMAQKNNTEVEAGEKGSSSSSSSVAFVKVSMDGAPYLRKVDLKIYKSYQELADA  153



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 76/116 (66%), Gaps = 15/116 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  331
            F ET   VDLKL L +K D   +  + +K      D  KPPAKAQVVGWPPVRSYR+N++
Sbjct  42   FSET---VDLKLNLQTKEDLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMM  98

Query  332  AANNHQKSGGEDGSDK--------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            A    QK   E+ ++K        +   VKVSMDGAPYLRKVDL+MYKSY+DLSDA
Sbjct  99   AV---QKVSNEEVAEKTTSSTIANSGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDA  151



>ref|XP_010025014.1| PREDICTED: auxin-responsive protein IAA16-like [Eucalyptus grandis]
 gb|KCW61599.1| hypothetical protein EUGRSUZ_H04335 [Eucalyptus grandis]
Length=270

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 79/137 (58%), Gaps = 35/137 (26%)
 Frame = +2

Query  170  QHVDLKLKLSSKD-----SQIHASD--HNKANNKDA---------------------DVT  265
            + VDLKL  SSK+      +I AS     K N+ D                      +V 
Sbjct  46   ETVDLKLNFSSKEDGGSVEKIRASAPAEKKMNSSDGKEKSVAAAAAAAAPPPPSSSSEVA  105

Query  266  KPPAKAQVVGWPPVRSYRRNILA----ANNHQKSGGEDGSDKA---AVLVKVSMDGAPYL  424
            KPPAKAQVVGWPPVRS+R+NI+A     ++  + GG  G+  A   A  VKVSMDGAPYL
Sbjct  106  KPPAKAQVVGWPPVRSFRKNIMAVQKSGSDEAEKGGSSGNGAATSGAAFVKVSMDGAPYL  165

Query  425  RKVDLSMYKSYQDLSDA  475
            RKVDL +YKSYQDLSDA
Sbjct  166  RKVDLKLYKSYQDLSDA  182



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 76/115 (66%), Gaps = 14/115 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  331
            F ET   VDLKL L SK D   +  + +K      D  KPPAKAQVVGWPPVRSYR+N++
Sbjct  49   FSET---VDLKLNLHSKEDLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMM  105

Query  332  AANNHQKSGGEDGSDK-------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            A    QK   ED ++K       +   VKVSMDGAPYLRKVDL+MYKSY++LSDA
Sbjct  106  AV---QKVSTEDVAEKTTSSTANSGAFVKVSMDGAPYLRKVDLTMYKSYKELSDA  157



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 74/119 (62%), Gaps = 15/119 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS-SKDSQIHASDHNKANNKDA----------DVTKPPAKAQVVGWP  301
            F ET   VDLKL LS SKDS +  + +   N K+           D  K PAKAQVVGWP
Sbjct  46   FSET---VDLKLNLSNSKDSTLMDNINQVDNMKEKKNNIVVPSSNDPAKSPAKAQVVGWP  102

Query  302  PVRSYRRNILAANNHQKSGGED-GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            PVRS+R+N++    +    GE  G+   A  VKVS+DGAPYLRKVDL MYKSYQ LSDA
Sbjct  103  PVRSFRKNVMTVQKNTTGAGESSGTGTGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDA  161



>gb|EYU30526.1| hypothetical protein MIMGU_mgv1a012831mg [Erythranthe guttata]
Length=239

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 72/113 (64%), Gaps = 11/113 (10%)
 Frame = +2

Query  170  QHVDLKLKLSSKDSQ------IHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  331
            + +DLKL+L++  S       I  + H K    + +  KPP+K QVVGWPPVRS+R+NIL
Sbjct  39   ESIDLKLELNTLSSSGNNNNNIDENIHQKNLKAEENNAKPPSKTQVVGWPPVRSFRKNIL  98

Query  332  AANNHQKSGGEDGSDK-----AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            A   +  SG    +DK     AA  VKVS+DGAPYLRKVDL MY SYQ LSDA
Sbjct  99   AVQKNSSSGATTEADKSSGGAAAAFVKVSLDGAPYLRKVDLKMYTSYQQLSDA  151



>gb|AFK36086.1| unknown [Lotus japonicus]
Length=257

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 77/128 (60%), Gaps = 24/128 (19%)
 Frame = +2

Query  155  FEETHQH---VDLKLKLSSKDSQIHASDHNKANNKD---------ADVTKPPAKAQVVGW  298
            F ET      VDL L LSSK+     +D ++    +         AD  KPPAKAQVVGW
Sbjct  45   FSETESETDTVDLMLNLSSKEPTSAGADPSQKPKTNLQKEKTLLPADPAKPPAKAQVVGW  104

Query  299  PPVRSYRRNILAANNHQKSGGEDGSDKA---------AVLVKVSMDGAPYLRKVDLSMYK  451
            PPVRS+R+N+LA    QKS GE+   +          A  VKVSMDGAPYLRKVDL MYK
Sbjct  105  PPVRSFRKNMLAV---QKSVGEESGGEKSNNGGGGGGASFVKVSMDGAPYLRKVDLKMYK  161

Query  452  SYQDLSDA  475
            SY+DLSD+
Sbjct  162  SYRDLSDS  169



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 73/117 (62%), Gaps = 15/117 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL LSS  + + +       N    V KPPAKAQVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSS--TALDSVSGVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  335  ANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                      +G++K          AA  VKVSMDGAPYLRK+DL +YK+YQDLSDA
Sbjct  87   GQKPTAGDATEGTEKTSSSNGATSSAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDA  143



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 79/123 (64%), Gaps = 21/123 (17%)
 Frame = +2

Query  155  FEETHQHVDLKLKL-----------SSKDSQIHASDHNKANNKDADVTKPPA-KAQVVGW  298
            F ET   VDLKL L           + KD+ +  ++  + +N  AD  KPPA KAQVVGW
Sbjct  34   FSET---VDLKLNLMEPAPLDVPASTVKDTGVDLTEKLRGSNAVADPAKPPAHKAQVVGW  90

Query  299  PPVRSYRRNILAA----NNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDL  466
            PPVRS+RRN+LA      N++   GE   +  A  VKVSMDGAPYLRKVDL+MYKSYQDL
Sbjct  91   PPVRSFRRNMLATQSSKGNNRSEEGE--KNAGATYVKVSMDGAPYLRKVDLNMYKSYQDL  148

Query  467  SDA  475
            S++
Sbjct  149  SNS  151



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 68/100 (68%), Gaps = 4/100 (4%)
 Frame = +2

Query  176  VDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKS  355
            VDLKL L S  S     D N   +       PPAKAQVVGWPPVRS+R+N+LA    + S
Sbjct  51   VDLKLNLIST-SPTDDKDKNIVPSHLDPAKPPPAKAQVVGWPPVRSFRKNMLA--TQKSS  107

Query  356  GGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            G ED  +KAA  VKVSMDGAPYLRKVDL MYK+YQ LSDA
Sbjct  108  GSEDSGEKAA-FVKVSMDGAPYLRKVDLRMYKTYQQLSDA  146



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 76/116 (66%), Gaps = 15/116 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  331
            F ET   VDLKL L +K D   +  + +K      D  KPPAKAQVVGWPPVRSYR+N++
Sbjct  39   FSET---VDLKLNLQTKEDLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMM  95

Query  332  AANNHQKSGGEDGSDK--------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            A    QK   E+ ++K        +   VKVSMDGAPYLRKVDL+MYKSY+DLSDA
Sbjct  96   AV---QKVSTEEVAEKTTSSTTANSGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDA  148



>gb|KJB44872.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=210

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 13/109 (12%)
 Frame = +2

Query  176  VDLKLKLSS-KDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAA-----  337
            VDLKL LS+ K++ +  ++  K  N      KPPAKAQVVGWPPVRS+R+NI+       
Sbjct  49   VDLKLNLSTTKEASVDEAEKMKEKN----TAKPPAKAQVVGWPPVRSFRKNIMTVQKNSS  104

Query  338  -NNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
             N  +K+G  +  + A  A  VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  105  DNKGEKTGSGNTINTAVPAAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  153



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 74/120 (62%), Gaps = 18/120 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  331
            F ET   VDLKL LSS  + + +       N    V KPPAK QVVGWPPVRS+R+N++ 
Sbjct  32   FSET---VDLKLNLSS--TALDSVSEVDIQNLKGKVVKPPAKTQVVGWPPVRSFRKNVMS  86

Query  332  --------AANNHQKSGGEDGS----DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                    AA   +K+ G  G+    + A   VKVSMDGAPYLRK+DL +YK+YQDLSDA
Sbjct  87   GQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDA  146



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 71/110 (65%), Gaps = 11/110 (10%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHAS---DHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDLKL L+++      S   D  + ++   D  KPPAKAQVVGWPPVRSYR+N
Sbjct  34   FSET---VDLKLNLNNEPENKEGSTTLDSKEKSSCSKDPAKPPAKAQVVGWPPVRSYRKN  90

Query  326  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            ++ +     SG E     AA  VKVSMDGAPYLRKVDL MYKSY +LS A
Sbjct  91   VMVSCQKASSGPE-----AAAFVKVSMDGAPYLRKVDLRMYKSYDELSTA  135



>ref|XP_006443920.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 gb|ESR57160.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=226

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 73/115 (63%), Gaps = 14/115 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVT----KPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL LSSKD+        K  +     T    KPPAK QVVGWPPVRS+R+
Sbjct  36   FSET---VDLKLNLSSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPVRSFRK  92

Query  323  NILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N+L     QKS GE+ SD A    A  VKVSMDGAPYLRKVDL MY +Y+DL DA
Sbjct  93   NMLGV--VQKSSGEE-SDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYKDLYDA  144



>gb|ADL70685.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70695.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=149

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++ +    S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  33   FSET---VDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVR  89

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRK+DL MYKSY +LS+A
Sbjct  90   SYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNA  139



>ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max]
 gb|ACU20028.1| unknown [Glycine max]
 gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja]
Length=248

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 78/125 (62%), Gaps = 20/125 (16%)
 Frame = +2

Query  155  FEETHQ----HVDLKLKLSSKDSQIHAS-------DHNKANNKDA-----DVTKPPAKAQ  286
            F ET       VDL L LS K++   A+       ++ K + K+      D  KPPAKAQ
Sbjct  38   FSETETDETTSVDLMLNLSPKEASAAATTDGADPRENPKTSPKEKNLPLLDPAKPPAKAQ  97

Query  287  VVGWPPVRSYRRNILAANNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQ  460
            VVGWPPVRS+R+N+ AA   + SGGE+    +  A  VKVSMDGAPYLRKVDL MYKSY 
Sbjct  98   VVGWPPVRSFRKNMFAA--QKSSGGEESEKNSPNASFVKVSMDGAPYLRKVDLKMYKSYP  155

Query  461  DLSDA  475
            +LSDA
Sbjct  156  ELSDA  160



>ref|XP_006443921.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 ref|XP_006479598.1| PREDICTED: auxin-induced protein AUX28-like [Citrus sinensis]
 gb|ESR57161.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=232

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 73/115 (63%), Gaps = 14/115 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVT----KPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL LSSKD+        K  +     T    KPPAK QVVGWPPVRS+R+
Sbjct  36   FSET---VDLKLNLSSKDTSEKVKSFQKEKHPLPRATDPPAKPPAKTQVVGWPPVRSFRK  92

Query  323  NILAANNHQKSGGEDGSDKA----AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N+L     QKS GE+ SD A    A  VKVSMDGAPYLRKVDL MY +Y+DL DA
Sbjct  93   NMLGV--VQKSSGEE-SDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYKDLYDA  144



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 75/111 (68%), Gaps = 11/111 (10%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTK----PPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L +    +    +N A +K   V+K    PPAKAQVVGWPPVR+YR+
Sbjct  44   FSET---VDLKLNLQTNKEGV-VDLNNVAKDKSLLVSKDHAKPPAKAQVVGWPPVRNYRK  99

Query  323  NILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A   HQKS   +    AA  VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  100  NMMA---HQKSSAVEEEKAAAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  147



>gb|ADB93635.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93636.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93637.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93638.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADB93639.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70683.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70686.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70691.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70693.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70694.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=150

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++ +    S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVR  90

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRK+DL MYKSY +LS+A
Sbjct  91   SYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNA  140



>gb|ADL70684.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70688.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70692.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=144

 Score =   105 bits (261),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++ +    S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  28   FSET---VDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVR  84

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRK+DL MYKSY +LS+A
Sbjct  85   SYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNA  134



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 75/117 (64%), Gaps = 15/117 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  331
            F ET   VDLKL LSS  + + +       N    V KPPAKAQVVGWPPVRS+R+N++ 
Sbjct  92   FSET---VDLKLNLSS--TALDSVSGVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  146

Query  332  --------AANNHQKSGGEDG-SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                    AA   +K+   +G +  AA  VKVSMDGAPYLRK+DL +YK+YQDLSDA
Sbjct  147  GQKPTAGDAAEGTEKTSSSNGATSSAAAYVKVSMDGAPYLRKIDLKLYKTYQDLSDA  203



>gb|KJB44873.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=254

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 13/109 (12%)
 Frame = +2

Query  176  VDLKLKLSS-KDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAA-----  337
            VDLKL LS+ K++ +  ++  K  N      KPPAKAQVVGWPPVRS+R+NI+       
Sbjct  49   VDLKLNLSTTKEASVDEAEKMKEKN----TAKPPAKAQVVGWPPVRSFRKNIMTVQKNSS  104

Query  338  -NNHQKSGGEDGSDKA--AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
             N  +K+G  +  + A  A  VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  105  DNKGEKTGSGNTINTAVPAAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  153



>gb|ADL70687.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
 gb|ADL70690.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=132

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHAS--------DHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++ +    S        D  + +    D  KPPAKAQVVGWPPVR
Sbjct  16   FSET---VDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVR  72

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRK+DL MYKSY +LS+A
Sbjct  73   SYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNA  122



>gb|ADL70689.1| indole-3-acetic acid inducible 17 [Arabidopsis thaliana]
Length=138

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++ +    S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  22   FSET---VDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVR  78

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRK+DL MYKSY +LS+A
Sbjct  79   SYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNA  128



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 75/115 (65%), Gaps = 14/115 (12%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  331
            F ET   VDLKL L SK D   +  + +K      D  KPPAKAQVVGWPPVRSYR+N++
Sbjct  135  FSET---VDLKLNLHSKEDLNENLKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMM  191

Query  332  AANNHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            A    QK   ED ++K           VKVSMDGAPYLRKVDL+MYKSY++LSDA
Sbjct  192  AV---QKVSTEDVAEKTTSSTANPGAFVKVSMDGAPYLRKVDLTMYKSYKELSDA  243



>ref|NP_001236693.1| auxin-induced protein AUX28 [Glycine max]
 sp|P13089.1|AUX28_SOYBN RecName: Full=Auxin-induced protein AUX28 [Glycine max]
 gb|AAA33945.1| auxin-regulated protein (Aux28) [Glycine max]
Length=243

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 17/120 (14%)
 Frame = +2

Query  158  EETHQHVDLKLKLSSKDSQIHA------SDHNKANNKD-----ADVTKPPAKAQVVGWPP  304
            +E+   VDL L LSSK++   A      +D +K   K+     AD  KPPAK QVVGWPP
Sbjct  37   DESATTVDLMLNLSSKEAATTAAAAADPTDKHKTLPKEKTLLPADPAKPPAKTQVVGWPP  96

Query  305  VRSYRRNILAANNHQKSGGEDG---SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+N+LA    QKS GE+    S   A  VKVSMDGAPYLRKVDL MYKSY++LSD+
Sbjct  97   VRSFRKNMLAV---QKSVGEESEKNSSPNASFVKVSMDGAPYLRKVDLKMYKSYRELSDS  153



>gb|ABR08758.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08759.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08760.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08761.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08762.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08764.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08765.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08766.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08767.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08768.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08769.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08770.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08771.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08772.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08773.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08774.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08775.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08776.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08777.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08778.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
 gb|ABR08779.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
Length=134

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++ +    S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  20   FSET---VDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVR  76

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRK+DL MYKSY +LS+A
Sbjct  77   SYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNA  126



>gb|KHN02537.1| Auxin-induced protein AUX28 [Glycine soja]
Length=252

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 79/120 (66%), Gaps = 17/120 (14%)
 Frame = +2

Query  158  EETHQHVDLKLKLSSKDSQIHA------SDHNKANNKD-----ADVTKPPAKAQVVGWPP  304
            +E+   VDL L LSSK++   A      +D +K   K+     AD  KPPAK QVVGWPP
Sbjct  46   DESATTVDLMLNLSSKEAATTAAAAADPTDKHKTLPKEKTLLPADPAKPPAKTQVVGWPP  105

Query  305  VRSYRRNILAANNHQKSGGED---GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+N+LA    QKS GE+    S   A  VKVSMDGAPYLRKVDL MYKSY++LSD+
Sbjct  106  VRSFRKNMLAV---QKSVGEESEKNSSPNASFVKVSMDGAPYLRKVDLKMYKSYRELSDS  162



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 73/117 (62%), Gaps = 13/117 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADV---------TKPPA-KAQVVGWPP  304
            F ET   VDLKL +SS+D      D  +   K+ +V         TKPPA KAQ VGWPP
Sbjct  50   FAET---VDLKLNISSEDQSAGDEDQVEEMKKEKNVAPVPRSNNPTKPPAAKAQAVGWPP  106

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+NILA   +    GE  +   A  VKVS+DGAPYLRKVDL +YKSYQ+LS A
Sbjct  107  VRSFRKNILAVQKNGSEEGEKTNSITAAFVKVSVDGAPYLRKVDLKLYKSYQELSTA  163



>ref|XP_006408158.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49611.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=223

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 74/120 (62%), Gaps = 18/120 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  331
            F ET   VDLKL LSS  + + +       N    V KPPAK QVVGWPPVRS+R+N++ 
Sbjct  32   FSET---VDLKLNLSS--TALDSVSEVDIQNLKEKVVKPPAKTQVVGWPPVRSFRKNVMS  86

Query  332  --------AANNHQKSGGEDGS----DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                    AA   +K+ G  G+    + A   VKVSMDGAPYLRK+DL +YK+YQDLSDA
Sbjct  87   GQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDA  146



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 74/120 (62%), Gaps = 18/120 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  331
            F ET   VDLKL LSS  + + +       N    V KPPAK QVVGWPPVRS+R+N++ 
Sbjct  32   FSET---VDLKLNLSS--TALDSVSEVDIQNLKEKVVKPPAKTQVVGWPPVRSFRKNVMS  86

Query  332  --------AANNHQKSGGEDGS----DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                    AA   +K+ G  G+    + A   VKVSMDGAPYLRK+DL +YK+YQDLSDA
Sbjct  87   GQKQTTEVAAEGTEKTCGSSGATSSANAAVAYVKVSMDGAPYLRKIDLKLYKTYQDLSDA  146



>gb|ADL70640.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=172

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L S + Q H   +     K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRK  88

Query  323  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A   +QKSG  +            VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  89   NVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYNSYKDLSDA  140



>gb|ADL70642.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70650.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=172

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L S + Q H   +     K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRK  88

Query  323  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A   +QKSG  +            VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  89   NVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDA  140



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 76/120 (63%), Gaps = 16/120 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET  +VDLKL LS      S  S I     NK  +K +    P AKAQVVGWPPVRS+
Sbjct  48   FSET-SNVDLKLNLSPTNDSVSPSSTIPLVPANKVKDKTSTTAPPRAKAQVVGWPPVRSF  106

Query  317  RRNIL---AANNH----QKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+NI+    +NN     +K+ G  G + A   VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  107  RKNIVNVQKSNNEVEAEKKTSGSGGGNGA--FVKVSMDGAPYLRKVDLKLYKSYQELSDA  164



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 73/107 (68%), Gaps = 6/107 (6%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL L + + Q    D   A+    D  KPP+KAQVVGWPPVR+YR+N++A
Sbjct  41   FSET---VDLKLNLQT-NKQEGVMDLTNASKVSKDPAKPPSKAQVVGWPPVRNYRKNVMA  96

Query  335  ANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
              N + S  E+    AA  VKVSMDGAPYLRKVDL M+KSYQDLSDA
Sbjct  97   --NQKNSAMEEEEKAAAAFVKVSMDGAPYLRKVDLKMHKSYQDLSDA  141



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 76/118 (64%), Gaps = 16/118 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK---DSQI-------HASDHNKANNKDADVTKPPA-KAQVVGWP  301
            F ET   +DLKLKL +    + QI         S  N      +D  KPPA KAQVVGWP
Sbjct  37   FAET---IDLKLKLQTPVDAEEQIIEKARGSLPSQRNLGVFCGSDPEKPPAPKAQVVGWP  93

Query  302  PVRSYRRNILAANNHQ--KSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  469
            PVRS+R+NIL+A++ +  K GGE   +  A  VKVSMDGAPYLRKVDL MY+SYQ+LS
Sbjct  94   PVRSFRKNILSAHSEKGSKEGGEKPGNPVAAFVKVSMDGAPYLRKVDLKMYRSYQELS  151



>gb|ADL70639.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=171

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L S + Q H   +     K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRK  88

Query  323  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A   +QKSG  +            VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  89   NVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDA  140



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 71/122 (58%), Gaps = 24/122 (20%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL LSS  S++         N    V KPPAKAQVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSSTVSEVELE------NMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  82

Query  335  ANNHQKSGGEDGSDK---------------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  469
                      +G+DK                   VKVSMDGAPYLRK+DL +YK+YQDLS
Sbjct  83   GQKPTTGDAVEGTDKTSGSSGATSSASAGTTVAYVKVSMDGAPYLRKIDLKLYKTYQDLS  142

Query  470  DA  475
            DA
Sbjct  143  DA  144



>ref|XP_002517023.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
 gb|EEF45186.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
Length=181

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 56/73 (77%), Gaps = 3/73 (4%)
 Frame = +2

Query  257  DVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVD  436
            D  KPPAKAQVVGWPPVRSYR+NI+A  N  + G +  S   A  VKV MDGAPYLRKVD
Sbjct  24   DPAKPPAKAQVVGWPPVRSYRKNIMAQKNTSEEGEKASS---AAFVKVCMDGAPYLRKVD  80

Query  437  LSMYKSYQDLSDA  475
            L MYKSYQ+LSDA
Sbjct  81   LKMYKSYQELSDA  93



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS---QIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDLKL L SKDS   Q        A     D  KPPAKAQVVGWPPVRS+R+N
Sbjct  46   FSET---VDLKLNLLSKDSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVRSFRKN  102

Query  326  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            IL    +     E+ +  +A  VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  103  ILTVQKNSSE--EEKASSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  150



>ref|XP_008451270.1| PREDICTED: auxin-induced protein AUX28-like [Cucumis melo]
Length=230

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 69/114 (61%), Gaps = 26/114 (23%)
 Frame = +2

Query  161  ETHQHVDLKLKLSSKDSQIHASDHNKAN----NKD-----ADVTKPPAKAQVVGWPPVRS  313
            ET   VDLKL LSSK++     D   AN    NKD     AD  KPPAKAQVVGWPPVRS
Sbjct  45   ETISKVDLKLNLSSKETVGVGGDDVVANSNPSNKDKAVLTADPAKPPAKAQVVGWPPVRS  104

Query  314  YRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+N + A                  VKVSMDGAPYLRKVDL MYKSY+ LSDA
Sbjct  105  FRKNNMLA-----------------FVKVSMDGAPYLRKVDLKMYKSYKQLSDA  141



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 79/122 (65%), Gaps = 20/122 (16%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  331
            F ET   VDLKL LSS  +    S+ +  N K+  V KPPAKAQVVGWPPVRS+R+N++ 
Sbjct  32   FSET---VDLKLNLSST-AMGSVSEVDLVNMKE-KVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  332  --------AANNHQKSGGEDGSDKAAVL------VKVSMDGAPYLRKVDLSMYKSYQDLS  469
                    A    +K+ G +G+  +A +      VKVSMDGAPYLRK+DL +YK+YQDLS
Sbjct  87   GPKPTTGDAVQATEKTSGSNGATSSASIGATAAYVKVSMDGAPYLRKIDLKLYKTYQDLS  146

Query  470  DA  475
            DA
Sbjct  147  DA  148



>emb|CDY18214.1| BnaC05g02370D [Brassica napus]
Length=224

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+        SK   +  S   + N    D TKPPAKAQVVGWPPVR
Sbjct  29   FSET---VDLKLNLNNEPESKEVSKTHDVVISVSKQKNKCPKDPTKPPAKAQVVGWPPVR  85

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS   +   + AV VKVSMDGAPYLRKVDL MYKSY +LS+A
Sbjct  86   SYRKNVMGS--CQKS---NDVTETAVFVKVSMDGAPYLRKVDLKMYKSYDELSNA  135



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score =   106 bits (265),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 76/123 (62%), Gaps = 19/123 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS------SKDSQIHASDHNKA--NNKDADVTKPP-AKAQVVGWPPV  307
            F ET  +VDLKL LS      S    I +   NK       A V+ PP AKAQVVGWPPV
Sbjct  46   FSET-ANVDLKLNLSPINDSASSSPTIASVAENKGKDTTTSATVSPPPRAKAQVVGWPPV  104

Query  308  RSYRRNILAANNHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDL  466
            RS+R+NI+  N HQKS  E   DK+          VKVSMDGAPYLRKVDL +YKSYQ+L
Sbjct  105  RSFRKNIV--NVHQKSNSETEVDKSISGGGGNGAFVKVSMDGAPYLRKVDLKLYKSYQEL  162

Query  467  SDA  475
            SDA
Sbjct  163  SDA  165



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 72/118 (61%), Gaps = 19/118 (16%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-----DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYR  319
            F ET   VDLKL L S      D  +  +   K   KD   +KPPAKAQVVGWPPVR+YR
Sbjct  33   FSET---VDLKLNLQSNKQAPIDLNVAGTSREKTLLKDP--SKPPAKAQVVGWPPVRNYR  87

Query  320  RNILAANNHQKSGGE------DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +NI+A   +QKS  E       G       VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  88   KNIMA---NQKSSEEAEEAMSGGGGGTVAFVKVSMDGAPYLRKVDLKMYNSYKDLSDA  142



>gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja]
Length=246

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 77/123 (63%), Gaps = 19/123 (15%)
 Frame = +2

Query  155  FEETHQ----HVDLKLKLSSKDSQI----HASDHNKANNKD-----ADVTKPPAKAQVVG  295
            F ET       VDL L LS K++         +  K + K+      D  KPPAKAQVVG
Sbjct  39   FSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQVVG  98

Query  296  WPPVRSYRRNILAANNHQKSGGEDGSDKA---AVLVKVSMDGAPYLRKVDLSMYKSYQDL  466
            WPPVRS+R+N+ AA   QKS G + S+K+   A  VKVSMDGAPYLRKVDL MYKSY +L
Sbjct  99   WPPVRSFRKNMFAA---QKSSGGEESEKSSPNASFVKVSMDGAPYLRKVDLKMYKSYPEL  155

Query  467  SDA  475
            SDA
Sbjct  156  SDA  158



>dbj|BAH56942.1| AT4G14550 [Arabidopsis thaliana]
Length=183

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 72/115 (63%), Gaps = 15/115 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L S + Q H   +     K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRK  88

Query  323  NILAANNHQKSG----GEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A   +QKSG               VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  89   NVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDA  140



>emb|CAN72026.1| hypothetical protein VITISV_014421 [Vitis vinifera]
Length=285

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 71/110 (65%), Gaps = 8/110 (7%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS---QIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDLKL L SKDS   Q        A     D  KPPAKAQVVGWPPVRS+R+N
Sbjct  46   FSET---VDLKLNLLSKDSVADQAEKMKEKSALPPSNDPAKPPAKAQVVGWPPVRSFRKN  102

Query  326  ILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            IL    +     E+ +  +A  VKVSMDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  103  ILTVQKNSSE--EEKASSSAAFVKVSMDGAPYLRKVDLKMYKSYQELSDA  150



>gb|ACU21378.1| unknown [Glycine max]
Length=252

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 78/120 (65%), Gaps = 17/120 (14%)
 Frame = +2

Query  158  EETHQHVDLKLKLSSKDSQIHA------SDHNKANNKD-----ADVTKPPAKAQVVGWPP  304
            +E+   VDL L LSSK++   A      +D +K   K+     AD  KPPAK QVVGWPP
Sbjct  46   DESATTVDLMLNLSSKEAATAAAAAADPTDKHKTLPKEKTLLPADPAKPPAKTQVVGWPP  105

Query  305  VRSYRRNILAANNHQKSGGED---GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+N+LA    QKS GE+    S   A  VKVSMDG PYLRKVDL MYKSY++LSD+
Sbjct  106  VRSFRKNMLAV---QKSVGEESEKNSSPNASFVKVSMDGTPYLRKVDLKMYKSYRELSDS  162



>gb|ABR08763.1| auxin-resistance protein 3, partial [Arabidopsis thaliana]
Length=134

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 73/115 (63%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++ +    S  +     D+        D  KPP KAQVVGWPPVR
Sbjct  20   FSET---VDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPTKAQVVGWPPVR  76

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRK+DL MYKSY +LS+A
Sbjct  77   SYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNA  126



>gb|ADL70641.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=190

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 73/116 (63%), Gaps = 17/116 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-----DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYR  319
            F ET   VDLKL L S      D  ++ +   K   KD   +KPPAKAQVVGWPPVR+YR
Sbjct  33   FSET---VDLKLNLQSNKQGHVDLNVNGAPKEKTFLKDP--SKPPAKAQVVGWPPVRNYR  87

Query  320  RNILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +N++A   +QKSG  +            VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  88   KNVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDA  140



>gb|ACU18407.1| unknown [Glycine max]
Length=246

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 77/123 (63%), Gaps = 19/123 (15%)
 Frame = +2

Query  155  FEETHQ----HVDLKLKLSSKDSQI----HASDHNKANNKD-----ADVTKPPAKAQVVG  295
            F ET       VDL L LS K++         +  K + K+      D  KPPAKAQVVG
Sbjct  39   FSETETDETATVDLMLNLSPKEAAAADGADPREKPKTSPKEKTLLLPDPAKPPAKAQVVG  98

Query  296  WPPVRSYRRNILAANNHQKSGGEDGSDKA---AVLVKVSMDGAPYLRKVDLSMYKSYQDL  466
            WPPVRS+R+N+ AA   QKS G + S+K+   A  VKVSMDGAPYLRKVDL MYKSY +L
Sbjct  99   WPPVRSFRKNMFAA---QKSSGGEESEKSSPNASFVKVSMDGAPYLRKVDLKMYKSYPEL  155

Query  467  SDA  475
            SDA
Sbjct  156  SDA  158



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 71/111 (64%), Gaps = 12/111 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS----QIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L + +      ++A D         D  KPPAKAQVVGWPPVR+YR+
Sbjct  44   FSET---VDLKLNLQTNEEGRVVDLNAGDPKNFAGATKDKNKPPAKAQVVGWPPVRNYRK  100

Query  323  NILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A    QKS      +KA   VKVSMDGAPYLRKVDL +Y+ YQDLSDA
Sbjct  101  NMMA---QQKSSSAVEEEKA--FVKVSMDGAPYLRKVDLKIYQCYQDLSDA  146



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 71/115 (62%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++      S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCPKDPAKPPAKAQVVGWPPVR  90

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +     SG E     AA  VKVSMDGAPYLRKVDL MYKSY +LS+A
Sbjct  91   SYRKNVMVSCQKSSSGPE-----AAAFVKVSMDGAPYLRKVDLRMYKSYDELSNA  140



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 71/115 (62%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++      S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPENKEGSTTHGVVTFDSKDKSSCPKDPAKPPAKAQVVGWPPVR  90

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +     SG E     AA  VKVSMDGAPYLRKVDL MYKSY +LS+A
Sbjct  91   SYRKNVMVSCQKSSSGPE-----AAAFVKVSMDGAPYLRKVDLRMYKSYDELSNA  140



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 75/116 (65%), Gaps = 17/116 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-----DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYR  319
            F ET   VDLKL L S      D  +  S   K   KD   +KPPAKAQVVGWPPVR+YR
Sbjct  30   FSET---VDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDP--SKPPAKAQVVGWPPVRNYR  84

Query  320  RNILAANNHQKSGGEDGSDKAA----VLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +N++A   +QK+G  D +  +A      VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  85   KNVMA---NQKNGETDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYKDLSDA  137



>gb|ADB93628.1| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70647.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70648.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70649.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70651.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=189

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L S + Q H   +     K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRK  88

Query  323  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A   +QKSG  +            VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  89   NVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDA  140



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 71/116 (61%), Gaps = 17/116 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKL---------SSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPV  307
            F ET   VDLKL L         S+    +     +K ++   D  KPPAKAQVVGWPPV
Sbjct  34   FSET---VDLKLNLNNEPENKEGSTTHGVVTFDSKDKISSCPKDPAKPPAKAQVVGWPPV  90

Query  308  RSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            RSYR+N++ +     SG E     AA  VKVSMDGAPYLRKVDL MYKSY +LS+A
Sbjct  91   RSYRKNVMVSCQKPSSGPE-----AAAFVKVSMDGAPYLRKVDLRMYKSYDELSNA  141



>gb|ADB93629.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=190

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L S + Q H   +     K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRK  88

Query  323  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A   +QKSG  +            VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  89   NVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDA  140



>emb|CDY15493.1| BnaA08g27770D [Brassica napus]
Length=229

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 72/115 (63%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+        SK   + ++   + ++   D TKPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPESKEGSKSHDVVSAISKEKSSCTKDPTKPPAKAQVVGWPPVR  90

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +     S     S   A  VKVSMDGAPYLRK+DL MYKSY +LSDA
Sbjct  91   SYRKNVMGSCQKSSS-----SADTAAFVKVSMDGAPYLRKIDLKMYKSYDELSDA  140



>gb|ADB93627.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
Length=191

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L S + Q H   +     K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRK  88

Query  323  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A   +QKSG  +            VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  89   NVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDA  140



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 78/132 (59%), Gaps = 27/132 (20%)
 Frame = +2

Query  158  EETHQHVDLKLKLSSKDSQIHA---SDHNKANNKDA-------------DVTKPPAKAQV  289
            + T   VDLKL LSS  + + A   SD  K N   A             D  KPPAKAQV
Sbjct  54   DTTTASVDLKLNLSSTSNNVSATPSSDMAKDNTASAAANTTTPSSPPVKDPAKPPAKAQV  113

Query  290  VGWPPVRSYRRNILAANNHQKS-------GGEDG---SDKAAVLVKVSMDGAPYLRKVDL  439
            VGWPPVRS+R+NI+  NN QKS       GG  G    +  A  VKVSMDGAPYLRKVDL
Sbjct  114  VGWPPVRSFRKNIVN-NNVQKSNNKEEVQGGTSGRNHGNTGAAFVKVSMDGAPYLRKVDL  172

Query  440  SMYKSYQDLSDA  475
             +YKSYQ+LSD+
Sbjct  173  KVYKSYQELSDS  184



>gb|ADB93625.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADB93626.2| indole-3-acetic acid inducible 14 [Arabidopsis thaliana]
 gb|ADL70643.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70644.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70645.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
 gb|ADL70646.1| indole-3-acetic acid inducible 14, partial [Arabidopsis thaliana]
Length=190

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L S + Q H   +     K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRK  88

Query  323  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A   +QKSG  +            VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  89   NVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDA  140



>gb|AGV54609.1| auxin-induced protein [Phaseolus vulgaris]
Length=272

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 73/118 (62%), Gaps = 12/118 (10%)
 Frame = +2

Query  155  FEETHQH---VDLKLKLSSKDSQIHAS----DHNKANNKD----ADVTKPPAKAQVVGWP  301
            F ET      VDL L LS K++    S    +  K + KD     D  KPPAK QVVGWP
Sbjct  41   FSETQTETTTVDLMLNLSPKEAASAPSPDPRNMPKTSPKDNTLIPDPAKPPAKEQVVGWP  100

Query  302  PVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            PVRS+R+N+ AA        E+ S  A+  VKVSMDGAPYLRKVDL+MYKSY +LSDA
Sbjct  101  PVRSFRKNMFAAQKSMVEESENNSPNAS-FVKVSMDGAPYLRKVDLNMYKSYPELSDA  157



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 71/117 (61%), Gaps = 13/117 (11%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADV---------TKP-PAKAQVVGWPP  304
            F ET   VDLKL +SS+D      D      K+ DV         TKP  AKAQVVGWPP
Sbjct  50   FAET---VDLKLNISSEDQSAGDEDQVVDMKKEKDVAPVPRSNDPTKPHAAKAQVVGWPP  106

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R NILA        GE  +  +A  VKVSMDGAPYLRKVDL +YKSYQ+LS A
Sbjct  107  VRSFRXNILAVQKDVSDEGEKTNSXSAAFVKVSMDGAPYLRKVDLKLYKSYQELSTA  163



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 73/118 (62%), Gaps = 20/118 (17%)
 Frame = +2

Query  155  FEETHQHVDLKLKL-SSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  331
            F ET   VD KL L S+K   +  +       K  D  KPPAKAQVVGWPPVR+YR++++
Sbjct  61   FSET---VDFKLNLQSNKQGHVDLNVTVAHKEKTKDPAKPPAKAQVVGWPPVRNYRKSVM  117

Query  332  AANNHQKS----------GGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            A   HQKS          GG  G+      VKVSMDGAPYLRKVDL MYKSY+DLSDA
Sbjct  118  A---HQKSSEVEEASSCGGGRGGT---VAFVKVSMDGAPYLRKVDLKMYKSYKDLSDA  169



>gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 76/117 (65%), Gaps = 16/117 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA-DVTKPPAKAQVVGWPPVRSYRRNIL  331
            F ET   VDLKL LS+K+S        K +   + D  KPPAKAQVVGWPP+RS+R+N++
Sbjct  50   FSET---VDLKLNLSTKESGKEEKMKEKTDVPSSNDPAKPPAKAQVVGWPPIRSFRKNVM  106

Query  332  AANNHQKSGGEDG---------SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +    QKS G++             +A  VKVSMDGAPYLRKVDL +YKSYQ+LSDA
Sbjct  107  SV---QKSNGDEAEKAATATAAGSSSAAFVKVSMDGAPYLRKVDLKLYKSYQELSDA  160



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 72/111 (65%), Gaps = 7/111 (6%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  331
            F ET   VDLKL L SK D      + +K      D  KPPAKAQVVGWPPVRSYR+N++
Sbjct  47   FSET---VDLKLNLQSKEDLNDDVKNVSKEKTLLKDPAKPPAKAQVVGWPPVRSYRKNMM  103

Query  332  AAN-NHQKSGGEDGSDKAA--VLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                N++  G E  +   A     KVSMDGAPYLRKVDL+MYKSY++LSDA
Sbjct  104  VQKVNNEDQGTEKTTSSTAGGAFAKVSMDGAPYLRKVDLTMYKSYKELSDA  154



>gb|KJB42200.1| hypothetical protein B456_007G141900 [Gossypium raimondii]
Length=235

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
 Frame = +2

Query  176  VDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKS  355
            VDLKL L S  S     D N   +       PPAKAQVVGWPPVRS+R+N+LA    + S
Sbjct  51   VDLKLNLIST-SPTDDKDKNIVPSHLDPAKPPPAKAQVVGWPPVRSFRKNMLA--TQKSS  107

Query  356  GGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
              ED  +KAA  VKVSMDGAPYLRKVDL MYK+YQ LSDA
Sbjct  108  ASEDSGEKAA-FVKVSMDGAPYLRKVDLRMYKTYQQLSDA  146



>ref|XP_007144686.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
 gb|ESW16680.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
Length=245

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 71/118 (60%), Gaps = 12/118 (10%)
 Frame = +2

Query  155  FEETHQH---VDLKLKLSSKDSQIHAS----DHNKANNKD----ADVTKPPAKAQVVGWP  301
            F ET      VDL L LS K++    S    +  K + KD     D  KPPAK QVVGWP
Sbjct  41   FSETQTETTTVDLMLNLSPKEAASAPSPDPRNMPKTSPKDNTLIPDPAKPPAKEQVVGWP  100

Query  302  PVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            PVRS+R+N+ AA        E  S  A+  VKVSMDGAPYLRKVDL MYKSY +LSDA
Sbjct  101  PVRSFRKNMFAAQKSMVEESEKNSPNAS-FVKVSMDGAPYLRKVDLKMYKSYPELSDA  157



>ref|XP_009111119.1| PREDICTED: auxin-responsive protein IAA17 [Brassica rapa]
Length=229

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 72/115 (63%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+        SK   + ++   + ++   D TKPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPESKEGSKSHDVVSAISKEKSSCPKDPTKPPAKAQVVGWPPVR  90

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +     S     S   A  VKVSMDGAPYLRK+DL MYKSY +LSDA
Sbjct  91   SYRKNVMGSCQKSSS-----SADTAAFVKVSMDGAPYLRKIDLKMYKSYDELSDA  140



>ref|XP_009354870.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=257

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 74/126 (59%), Gaps = 21/126 (17%)
 Frame = +2

Query  161  ETHQHVDLKLKLSS----------KDSQIHASDHNKANNKDADV-----TKPPA-KAQVV  292
            +T   VDLKL LS+          KD     S  +K  N   D+      KPPA KAQVV
Sbjct  44   DTSTCVDLKLNLSNSSKAANSTGGKDGSADKSKTDKEKNNHLDLPASDPAKPPAAKAQVV  103

Query  293  GWPPVRSYRRNILAANNHQKSGGED-----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSY  457
            GWPPVRS+R+N+  A     + GE      G +  AVLVKVSMDGAPYLRKVDL MYKSY
Sbjct  104  GWPPVRSFRKNMFTAVQKSSNDGESEQMNKGGNNNAVLVKVSMDGAPYLRKVDLKMYKSY  163

Query  458  QDLSDA  475
             +LSDA
Sbjct  164  PELSDA  169



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 79/122 (65%), Gaps = 21/122 (17%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS----QIHASDHNKAN-NKDADVTKPPAKAQVVGWPPVRSYR  319
            F ET   VDLKL LSSKDS    Q+   +   +  +   D  KPPAKAQVVGWPPVRS+R
Sbjct  54   FPET---VDLKLNLSSKDSGSLDQVDKKEIKTSPVSPSTDSVKPPAKAQVVGWPPVRSFR  110

Query  320  RNILAANNHQKSGGEDGSDKAAV----------LVKVSMDGAPYLRKVDLSMYKSYQDLS  469
            +NI++A   QK+ G+  + KA             VKVSMDGAPYLRKVDL +YKSYQ+LS
Sbjct  111  KNIVSA---QKNSGDHEAVKAGGGGGGSSSSAAFVKVSMDGAPYLRKVDLKLYKSYQELS  167

Query  470  DA  475
            DA
Sbjct  168  DA  169



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 74/123 (60%), Gaps = 23/123 (19%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET   VDL L L S        + + AS   K   KD    KPPAKAQVVGWPPVR+Y
Sbjct  38   FSET---VDLMLNLQSNKEGSVDLNNVAASTKEKTLLKDP--AKPPAKAQVVGWPPVRNY  92

Query  317  RRNILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDL  466
            R+NI+     + SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDL
Sbjct  93   RKNIM--TQQKASGTEEASSEKAGSGSGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDL  150

Query  467  SDA  475
            SDA
Sbjct  151  SDA  153



>emb|CDY10068.1| BnaC08g43830D [Brassica napus]
Length=228

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+        SK   +  S   + ++   D  KPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPEINEGSKPHDVVTSVSKEKSSSPKDPAKPPAKAQVVGWPPVR  90

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +  +QK  G  G++ AA  VKVSMDGAPYLRKVDL MYKSY +LS+A
Sbjct  91   SYRKNVMGS--YQKPSG--GTETAA-FVKVSMDGAPYLRKVDLKMYKSYDELSNA  140



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 74/123 (60%), Gaps = 23/123 (19%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET   VDL L L S        + + AS   K   KD    KPPAKAQVVGWPPVR+Y
Sbjct  38   FSET---VDLMLNLQSNKEGSVDLNNVAASTKEKTLLKDP--AKPPAKAQVVGWPPVRNY  92

Query  317  RRNILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDL  466
            R+NI+     + SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDL
Sbjct  93   RKNIM--TQQKASGTEEASSEKAGSGSGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDL  150

Query  467  SDA  475
            SDA
Sbjct  151  SDA  153



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 74/123 (60%), Gaps = 23/123 (19%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET   VDL L L S        + + AS   K   KD    KPPAKAQVVGWPPVR+Y
Sbjct  38   FSET---VDLMLNLQSNKEGSVDLNNVAASTKEKTLLKDP--AKPPAKAQVVGWPPVRNY  92

Query  317  RRNILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDL  466
            R+NI+     + SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDL
Sbjct  93   RKNIM--TQQKASGTEEASSEKAGSGSGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDL  150

Query  467  SDA  475
            SDA
Sbjct  151  SDA  153



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 74/121 (61%), Gaps = 18/121 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKD------ADVTKPPAKAQVVGWPPVRSY  316
            F ET   VDLKL LS+    + A +  K   K       AD  KPPAKAQVVGWPPVRS+
Sbjct  45   FSET---VDLKLNLSTAKEAV-ADEAEKVKKKSTVAPRSADPAKPPAKAQVVGWPPVRSF  100

Query  317  RRNILAA--NNHQKSGGEDGSDKAAV------LVKVSMDGAPYLRKVDLSMYKSYQDLSD  472
            R+NI+A   N+    G + GS            VKVSMDGAPYLRKVDL +YKSYQ+LSD
Sbjct  101  RKNIMAVQKNSSDVEGEKAGSSNTTTATVAAAFVKVSMDGAPYLRKVDLKLYKSYQELSD  160

Query  473  A  475
            A
Sbjct  161  A  161



>ref|NP_193191.2| auxin-responsive protein IAA14 [Arabidopsis thaliana]
 sp|Q38832.2|IAA14_ARATH RecName: Full=Auxin-responsive protein IAA14; AltName: Full=Indoleacetic 
acid-induced protein 14; AltName: Full=Protein SOLITARY 
ROOT [Arabidopsis thaliana]
 gb|AAG50096.1|AF334718_1 IAA14 [Arabidopsis thaliana]
 dbj|BAF00338.1| IAA14 [Arabidopsis thaliana]
 dbj|BAH30518.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83459.1| auxin-responsive protein IAA14 [Arabidopsis thaliana]
Length=228

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 73/115 (63%), Gaps = 15/115 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L S + Q H   +     K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRK  88

Query  323  NILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A   +QKSG  +            VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  89   NVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDA  140



>ref|XP_002868277.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44536.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 73/116 (63%), Gaps = 17/116 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-----DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYR  319
            F ET   V LKL L S      D  ++ +   K   KD   +KPPAKAQVVGWPPVR+YR
Sbjct  33   FSET---VGLKLNLQSNKQGPVDLNVNGAPKEKTFLKDP--SKPPAKAQVVGWPPVRNYR  87

Query  320  RNILAANNHQKSGGED----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +N++A   +QKSG  +            VKVSMDGAPYLRKVDL MYKSY+DLSDA
Sbjct  88   KNVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYKSYKDLSDA  140



>emb|CAB46059.1| IAA7 like protein [Arabidopsis thaliana]
 emb|CAB78497.1| IAA7 like protein [Arabidopsis thaliana]
Length=234

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 72/115 (63%), Gaps = 15/115 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA----DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDLKL L S + Q H   +     K+     D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLKLNLQS-NKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRK  88

Query  323  NILAANNHQKSG----GEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            N++A   +QKSG               VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  89   NVMA---NQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDA  140



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 79/118 (67%), Gaps = 16/118 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKL-SSKDSQIHASDHNKANNKDA---DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDL L L S+K+  +  ++ + A  +     D +KPPAKAQVVGWPPVR+YR+
Sbjct  38   FSET---VDLMLNLQSNKEGTVDLNNVSAAPKEKTLLKDHSKPPAKAQVVGWPPVRNYRK  94

Query  323  NILAANNHQKSGGEDGSDK-------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            NI+     + SG E+ S +       AA LVKVSMDGAPYLRKVDL MYKSYQDLSDA
Sbjct  95   NIMT--QQKTSGVEEASSEKAGSGGGAAALVKVSMDGAPYLRKVDLKMYKSYQDLSDA  150



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%), Gaps = 15/117 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNK----ANNKDA-----DVTKPPA-KAQVVGWPP  304
            F ET   +DLKLKL + DS+   ++  K    A+ K+      D  KPPA KAQVVGWPP
Sbjct  37   FSET---IDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVVGWPP  93

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+NI++  + +  G ++  +K+A  VKVSMDGAPYLRK+DL MY+SYQ+LS A
Sbjct  94   VRSFRKNIMSVQSDK--GNKEEGEKSATFVKVSMDGAPYLRKIDLKMYRSYQELSVA  148



>gb|AAC36584.1| putative IAA-related protein [Pisum sativum]
Length=167

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 71/113 (63%), Gaps = 19/113 (17%)
 Frame = +2

Query  176  VDLKLKLSSKDSQIHASDHNKANNKDADV----TKPPAKAQVVGWPPVRSYRRNILAANN  343
            VDLKL LS K+    A    K   K   V    TKPPAKAQVVGWPPVRS+R+N+ A   
Sbjct  24   VDLKLNLSPKEG--AADPQLKPKEKSLLVSDSGTKPPAKAQVVGWPPVRSFRKNMFAG--  79

Query  344  HQKSGG---------EDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
             QKS G          DGS+ A   VKVSMDGAPYLRK+DL MYKSY +LSDA
Sbjct  80   -QKSIGGSEETTKKSSDGSN-AISFVKVSMDGAPYLRKIDLKMYKSYPELSDA  130



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 71/122 (58%), Gaps = 20/122 (16%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL LSS  + + +       N    V KPPAKAQVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSS--TAMDSVSKVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  335  ANNHQKSGGEDGSDK---------------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  469
                       G+DK               A   VKVSMDGAPYLRK+DL +YK+YQDLS
Sbjct  87   GQKPTTGDATVGNDKTSGSSGATSSASVCAAVAYVKVSMDGAPYLRKIDLKLYKTYQDLS  146

Query  470  DA  475
            DA
Sbjct  147  DA  148



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++ +    S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  33   FSET---VDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVR  89

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRK+DL MYKSY +LS+A
Sbjct  90   SYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNA  139



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 67/112 (60%), Gaps = 8/112 (7%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL  331
            F ET   VDLKL L S  D       +      + D  KPPAK QVVGWPPVRSYR+NI+
Sbjct  48   FSET---VDLKLNLQSNLDLSKEKIKNPSKETCNKDSAKPPAKTQVVGWPPVRSYRKNIM  104

Query  332  AANN----HQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            A        +    + G   +A  VKVSMDGAPYLRKVDL MYKSYQ LSDA
Sbjct  105  AQKGGSICEESENSKGGICSSAAFVKVSMDGAPYLRKVDLKMYKSYQQLSDA  156



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++ +    S  +     D+        D  KPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVR  90

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRK+DL MYKSY +LS+A
Sbjct  91   SYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNA  140



>ref|XP_010917600.1| PREDICTED: auxin-responsive protein IAA30 isoform X1 [Elaeis 
guineensis]
Length=246

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%), Gaps = 15/117 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNK----ANNKDA-----DVTKPPA-KAQVVGWPP  304
            F ET   +DLKLKL + DS+   ++  K    A+ K+      D  KPPA KAQVVGWPP
Sbjct  37   FSET---IDLKLKLQTVDSKDIEAEAEKMKRSASQKNLLACSNDPEKPPAPKAQVVGWPP  93

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRS+R+NI++  + +  G ++  +K+A  VKVSMDGAPYLRK+DL MY+SYQ+LS A
Sbjct  94   VRSFRKNIMSVQSDK--GNKEEGEKSATFVKVSMDGAPYLRKIDLKMYRSYQELSVA  148



>ref|XP_008372303.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 73/126 (58%), Gaps = 21/126 (17%)
 Frame = +2

Query  161  ETHQHVDLKLKLSS----------KDSQIHASDHNKANNKDADV-----TKPPA-KAQVV  292
            +T   VDLKL LS+          KD     S  NK  N   D+      KPPA KAQVV
Sbjct  44   DTSTCVDLKLNLSNSSKEANSTGGKDGIAVKSKTNKEKNNHLDLPASDPAKPPAAKAQVV  103

Query  293  GWPPVRSYRRNILAANNHQKSGGED-----GSDKAAVLVKVSMDGAPYLRKVDLSMYKSY  457
            GWPPVRS+R+N+        + GE      G +  AVLVKVSMDGAPYLRKVDL MYKSY
Sbjct  104  GWPPVRSFRKNMFTGVQKSSNDGESEQMNKGGNNNAVLVKVSMDGAPYLRKVDLKMYKSY  163

Query  458  QDLSDA  475
             +LSDA
Sbjct  164  PELSDA  169



>emb|CDY63910.1| BnaC01g43640D [Brassica napus]
 emb|CDY30781.1| BnaC07g16810D [Brassica napus]
Length=240

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 76/120 (63%), Gaps = 18/120 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKL-SSKDSQIHASDHNKANNKDA--DVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDL L L S+K+  I  ++   +  K    D  KPPAKAQVVGWPPVR+YR+N
Sbjct  38   FSET---VDLMLNLQSNKERAIDLNNATASKQKTLLKDPVKPPAKAQVVGWPPVRNYRKN  94

Query  326  ILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            I+   N + SG ++ S +           A LVKVSMDGAPYLRKV L MYKSYQDLSDA
Sbjct  95   IMT--NQKTSGADEASSEKAGNGGGGATGATLVKVSMDGAPYLRKVHLKMYKSYQDLSDA  152



>emb|CDY32537.1| BnaA09g50590D [Brassica napus]
Length=228

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 73/115 (63%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+        SK   +  S   + ++   D  KPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPESNEGSKTHDVVTSVSKEKSSSPKDPAKPPAKAQVVGWPPVR  90

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   + SGG +     A  VKVSMDGAPYLRKVDL MYKSY +LS+A
Sbjct  91   SYRKNVMGS-CQKPSGGTE----TASFVKVSMDGAPYLRKVDLKMYKSYDELSNA  140



>gb|ADL36587.1| ARF domain class transcription factor [Malus domestica]
Length=175

 Score =   102 bits (254),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +2

Query  257  DVTKPPA-KAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKV  433
            D TKPPA KAQVVGWPPVRS+R+NIL    +    GE+ +  +A  VKVSMDGAPYLRKV
Sbjct  14   DPTKPPAAKAQVVGWPPVRSFRKNILTVQKNSSEEGENTNSISAAFVKVSMDGAPYLRKV  73

Query  434  DLSMYKSYQDLSDA  475
            DL +YKSYQ+LS A
Sbjct  74   DLKLYKSYQELSTA  87



>ref|XP_009118658.1| PREDICTED: auxin-responsive protein IAA17-like [Brassica rapa]
Length=228

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 73/115 (63%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+        SK   +  S   + ++   D  KPPAKAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPESNEGSKTHDVVTSVSKEKSSSPKDPAKPPAKAQVVGWPPVR  90

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   + SGG +     A  VKVSMDGAPYLRKVDL MYKSY +LS+A
Sbjct  91   SYRKNVMGS-CQKPSGGTE----TASFVKVSMDGAPYLRKVDLKMYKSYDELSNA  140



>gb|AFZ78616.1| hypothetical protein [Populus tomentosa]
Length=211

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 77/146 (53%), Gaps = 42/146 (29%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD---------SQIHASDHNKANNKDA-DVTKPPAKAQVVGWPP  304
            F ET   VDLKL L +K+         + I + D N   +    D  KPPAKAQVVGWPP
Sbjct  47   FAET---VDLKLNLQAKEGVMDLNENINNIASEDKNHLPSATIKDPAKPPAKAQVVGWPP  103

Query  305  VRSYRRNILAANNH------------------------QKSGGEDG-----SDKAAVLVK  397
            VRSYR+N+LA  N                         QK+  E+G        +A  VK
Sbjct  104  VRSYRKNVLAQKNASEEGFGAQVEGWPPVRSYRKNVLVQKNASEEGEKASTGGCSAAFVK  163

Query  398  VSMDGAPYLRKVDLSMYKSYQDLSDA  475
            V MDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  164  VCMDGAPYLRKVDLKMYKSYQELSDA  189



>emb|CDY10349.1| BnaC05g29300D [Brassica napus]
Length=246

 Score =   103 bits (258),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 77/121 (64%), Gaps = 19/121 (16%)
 Frame = +2

Query  155  FEETHQHVDLKLKL-SSKDSQIHASDHNKANNKDA---DVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDL L L S+K+  +  ++   A+ +     D  KPPAKAQVVGWPPVR+YR+
Sbjct  42   FSET---VDLMLNLQSNKEGAVDLNNVASASKETTLLKDPAKPPAKAQVVGWPPVRNYRK  98

Query  323  NILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  472
            NI+     + SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDLSD
Sbjct  99   NIIT--QQKTSGKEEASSEKAGNSGGGASGAALVKVSMDGAPYLRKVDLKMYKSYQDLSD  156

Query  473  A  475
            A
Sbjct  157  A  157



>gb|AFK43673.1| unknown [Lotus japonicus]
Length=266

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 79/134 (59%), Gaps = 30/134 (22%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDH-----NKANNKDADVT------KPPAKAQVVGWP  301
            F ET  +VDLKL LSS      +S       NK   K A  T      KPPAKAQVVGWP
Sbjct  47   FLETDANVDLKLNLSSDLGSASSSVSSTLPPNKGKEKTAATTQANDPAKPPAKAQVVGWP  106

Query  302  PVRSYRRNILAANNHQKSGGEDGSDK----------------AAVLVKVSMDGAPYLRKV  433
            PVRS+R+NI+   N QKS   +G++K                AA  VKVSMDGAPYLRKV
Sbjct  107  PVRSFRKNIV---NVQKSNNNEGAEKKVTTTTATTTAGNSAAAAAFVKVSMDGAPYLRKV  163

Query  434  DLSMYKSYQDLSDA  475
            DL +YKSYQ+LSDA
Sbjct  164  DLKLYKSYQELSDA  177



>ref|XP_004172702.1| PREDICTED: auxin-induced protein AUX28-like [Cucumis sativus]
Length=198

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 69/114 (61%), Gaps = 26/114 (23%)
 Frame = +2

Query  161  ETHQHVDLKLKLSSKDSQIHASDHNKAN----NKD-----ADVTKPPAKAQVVGWPPVRS  313
            ET   VDLKL LSSK++     D   A+    NKD     AD  KPPAKAQVVGWPPVRS
Sbjct  45   ETISKVDLKLNLSSKETVGVGDDDLVADSNPSNKDKAVLTADPAKPPAKAQVVGWPPVRS  104

Query  314  YRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+N + A                  VKVSMDGAPYLRKVDL MYKSY+ LSDA
Sbjct  105  FRKNNMLA-----------------FVKVSMDGAPYLRKVDLKMYKSYKQLSDA  141



>ref|XP_010038039.1| PREDICTED: auxin-induced protein AUX28-like [Eucalyptus grandis]
 gb|KCW49838.1| hypothetical protein EUGRSUZ_K03313 [Eucalyptus grandis]
Length=280

 Score =   104 bits (259),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 59/72 (82%), Gaps = 4/72 (6%)
 Frame = +2

Query  263  TKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGED-GSDKAAVLVKVSMDGAPYLRKVDL  439
             KPPAKAQVVGWPPVRS+R+N++AA   QKS  ED  S  AA  VKVSMDGAPYLRKVDL
Sbjct  124  VKPPAKAQVVGWPPVRSFRKNMVAA---QKSSTEDMSSGGAASFVKVSMDGAPYLRKVDL  180

Query  440  SMYKSYQDLSDA  475
             MYKSYQ+LS+A
Sbjct  181  KMYKSYQELSEA  192



>gb|AGV54230.1| auxin-induced protein AUX28 [Phaseolus vulgaris]
Length=245

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 71/118 (60%), Gaps = 12/118 (10%)
 Frame = +2

Query  155  FEETHQH---VDLKLKLSSKDSQIHAS----DHNKANNKD----ADVTKPPAKAQVVGWP  301
            F ET      VDL L LS K++    S    +  K + KD     D  KPPAK QVVGWP
Sbjct  41   FSETQTETTTVDLMLNLSPKEAASAPSPDPRNMPKTSPKDNTLIPDPAKPPAKEQVVGWP  100

Query  302  PVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            PVRS+R+N+ AA        E  S  A+  VKVSMDGAPYLRKVDL MYK+Y +LSDA
Sbjct  101  PVRSFRKNMFAAQKSMVEESEKNSPNAS-FVKVSMDGAPYLRKVDLKMYKNYPELSDA  157



>ref|XP_004134097.1| PREDICTED: auxin-responsive protein IAA14-like isoform 2 [Cucumis 
sativus]
Length=220

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 71/115 (62%), Gaps = 11/115 (10%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS-QIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL + SK    +  +  N   + D        D  KPPAKAQVVGWPPVR
Sbjct  37   FSET---VDLKLNIQSKPGVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVR  93

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N ++  + +       S  +A+ VKV MDGAPYLRKVDL MYKSYQ+LS+A
Sbjct  94   SYRKNAMSQKSSEAGEKGGSSGGSAMFVKVCMDGAPYLRKVDLKMYKSYQELSNA  148



>gb|ABD98055.1| auxin-regulated protein [Striga asiatica]
Length=248

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 75/124 (60%), Gaps = 24/124 (19%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKD-----------ADVTKPPAKAQVVGWP  301
            F ET   VDLKLKLSSK  +I   D      KD            +  +PPAKAQVVGWP
Sbjct  44   FAET---VDLKLKLSSK--EIGDLDRGGLERKDLCKEKNLMPSPTESARPPAKAQVVGWP  98

Query  302  PVRSYRRNILAANNHQKSGGEDG------SDKAAVLVKVSMDGAPYLRKVDLSMYKSYQD  463
            PVRS+R+N++A    +KS  ED       S   A  VKVSMDGAPYLRKVDL MYK+YQ+
Sbjct  99   PVRSFRKNVMAV--QKKSEAEDAEKVAAASGGGAAFVKVSMDGAPYLRKVDLKMYKAYQE  156

Query  464  LSDA  475
            L DA
Sbjct  157  LYDA  160



>ref|NP_001267662.1| auxin-induced protein AUX28-like [Cucumis sativus]
 dbj|BAA81687.1| unnamed protein product [Cucumis sativus]
 gb|KGN44763.1| hypothetical protein Csa_7G378520 [Cucumis sativus]
Length=230

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 69/114 (61%), Gaps = 26/114 (23%)
 Frame = +2

Query  161  ETHQHVDLKLKLSSKDSQIHASDHNKAN----NKD-----ADVTKPPAKAQVVGWPPVRS  313
            ET   VDLKL LSSK++     D   A+    NKD     AD  KPPAKAQVVGWPPVRS
Sbjct  45   ETISKVDLKLNLSSKETVGVGDDDLVADSNPSNKDKAVLTADPAKPPAKAQVVGWPPVRS  104

Query  314  YRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+N + A                  VKVSMDGAPYLRKVDL MYKSY+ LSDA
Sbjct  105  FRKNNMLA-----------------FVKVSMDGAPYLRKVDLKMYKSYKQLSDA  141



>ref|XP_002889499.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65758.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score =   103 bits (256),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHAS--------DHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+++      S        D  + ++   D  KPP+KAQVVGWPPVR
Sbjct  34   FSET---VDLKLNLNNEPENKEGSTTHDVVTFDSKEKSSCPKDPAKPPSKAQVVGWPPVR  90

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRKVDL MYKSY +LS+A
Sbjct  91   SYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKVDLRMYKSYDELSNA  140



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 71/106 (67%), Gaps = 8/106 (8%)
 Frame = +2

Query  161  ETHQHVDLKLKLSSKD-SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAA  337
            E   H DL    + KD S + A   + +++   D +KPPAKAQVVGWPPVRSYR+N + A
Sbjct  50   EPRDHKDLGSVTTEKDPSSLAAVPADNSSSCPKDPSKPPAKAQVVGWPPVRSYRKN-MTA  108

Query  338  NNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
             + + SGG      +A  VKVSMDGAPYLRKVDL MY SY+DLS+A
Sbjct  109  MSQKASGG------SATFVKVSMDGAPYLRKVDLKMYNSYEDLSNA  148



>ref|NP_974355.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76709.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=210

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 75/121 (62%), Gaps = 18/121 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKL-SSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDL L L S+K+  +   + S   K      D +KPPAKAQVVGWPPVR+YR+
Sbjct  38   FSET---VDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRK  94

Query  323  NILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  472
            N++       SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDLSD
Sbjct  95   NMMT-QQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSD  153

Query  473  A  475
            A
Sbjct  154  A  154



>gb|ABY65124.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65125.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65126.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65127.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65128.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65129.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65130.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65131.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65132.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65133.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65134.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65135.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65136.1| At1g04250, partial [Arabidopsis thaliana]
 gb|ABY65137.1| At1g04250, partial [Arabidopsis thaliana]
Length=95

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 5/73 (7%)
 Frame = +2

Query  257  DVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVD  436
            D  KPPAKAQVVGWPPVRSYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRK+D
Sbjct  1    DPAKPPAKAQVVGWPPVRSYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKID  55

Query  437  LSMYKSYQDLSDA  475
            L MYKSY +LS+A
Sbjct  56   LRMYKSYDELSNA  68



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 75/121 (62%), Gaps = 18/121 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKL-SSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDL L L S+K+  +   + S   K      D +KPPAKAQVVGWPPVR+YR+
Sbjct  38   FSET---VDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRK  94

Query  323  NILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  472
            N++       SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDLSD
Sbjct  95   NMMT-QQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSD  153

Query  473  A  475
            A
Sbjct  154  A  154



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 74/116 (64%), Gaps = 17/116 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-----DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYR  319
            F ET   VDLKL L S      D  +  S   K   KD    KPPAKAQVVGWPPVR+YR
Sbjct  30   FSET---VDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDP--AKPPAKAQVVGWPPVRNYR  84

Query  320  RNILAANNHQKSGGEDGSDKAA----VLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +N++A   +QK+G  D +  +A      VKVSMDGAPYLRKVDL MY SY++LSDA
Sbjct  85   KNVMA---NQKNGETDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYKNLSDA  137



>gb|KEH43016.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=243

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 75/123 (61%), Gaps = 19/123 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPP-AKAQVVGWPPV  307
            F ET  +VDLKL LS        S      A +  K     A V+ PP AKAQVVGWPPV
Sbjct  46   FSET-ANVDLKLNLSPINDSASSSSTIASVAENKGKDTTTSATVSPPPRAKAQVVGWPPV  104

Query  308  RSYRRNILAANNHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDL  466
            RS+R+NI+  N HQKS  E   DK+          VKVSMDGAPYLRKVDL +YKSYQ+L
Sbjct  105  RSFRKNIV--NVHQKSNSETEVDKSISGGGGNGAFVKVSMDGAPYLRKVDLKLYKSYQEL  162

Query  467  SDA  475
            SDA
Sbjct  163  SDA  165



>gb|KEH43017.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=253

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 75/123 (61%), Gaps = 19/123 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKLS--------SKDSQIHASDHNKANNKDADVTKPP-AKAQVVGWPPV  307
            F ET  +VDLKL LS        S      A +  K     A V+ PP AKAQVVGWPPV
Sbjct  46   FSET-ANVDLKLNLSPINDSASSSSTIASVAENKGKDTTTSATVSPPPRAKAQVVGWPPV  104

Query  308  RSYRRNILAANNHQKSGGEDGSDKA-------AVLVKVSMDGAPYLRKVDLSMYKSYQDL  466
            RS+R+NI+  N HQKS  E   DK+          VKVSMDGAPYLRKVDL +YKSYQ+L
Sbjct  105  RSFRKNIV--NVHQKSNSETEVDKSISGGGGNGAFVKVSMDGAPYLRKVDLKLYKSYQEL  162

Query  467  SDA  475
            SDA
Sbjct  163  SDA  165



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 75/121 (62%), Gaps = 18/121 (15%)
 Frame = +2

Query  155  FEETHQHVDLKLKL-SSKDSQI---HASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRR  322
            F ET   VDL L L S+K+  +   + S   K      D +KPPAKAQVVGWPPVR+YR+
Sbjct  33   FSET---VDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRK  89

Query  323  NILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLSD  472
            N++       SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDLSD
Sbjct  90   NMMT-QQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSD  148

Query  473  A  475
            A
Sbjct  149  A  149



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 71/115 (62%), Gaps = 15/115 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-----DSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYR  319
            F ET   VDLKL L S      D  +  S   K   KD    KPPAKAQVVGWPPVR+YR
Sbjct  33   FSET---VDLKLNLQSNKQGHGDLNVAGSIKEKTLLKDP--AKPPAKAQVVGWPPVRNYR  87

Query  320  RNILAANNHQKSGGEDGSDKAA---VLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +N++A  NH+    ++    A      VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  88   KNVMA--NHKNGEPDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYKDLSDA  140



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 71/115 (62%), Gaps = 11/115 (10%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDS-QIHASDHNKANNKDA-------DVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL + SK    +  +  N   + D        D  KPPAKAQVVGWPPVR
Sbjct  37   FSET---VDLKLNIQSKPGVTVDLTPQNNDTSTDEESLIASKDPAKPPAKAQVVGWPPVR  93

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N ++  + +       S  +A+ VKV MDGAPYLRKVDL MYKSYQ+LS+A
Sbjct  94   SYRKNAMSQKSSEAGEKGGSSGGSAMFVKVCMDGAPYLRKVDLKMYKSYQELSNA  148



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 71/117 (61%), Gaps = 15/117 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLK----------LSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPP  304
            F ET   VDLKL           L+ K+S     + N   +KD    KPPAKAQVVGWPP
Sbjct  37   FSET---VDLKLNIQSKTGVTVDLTPKNSDTSTDEENLITSKDP--AKPPAKAQVVGWPP  91

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRSYR+N ++  +         S  +A+ VKV MDGAPYLRKVDL MYKSYQ+LS+A
Sbjct  92   VRSYRKNAMSQKSPDSGEKGGSSGGSAMFVKVCMDGAPYLRKVDLKMYKSYQELSNA  148



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 81/147 (55%), Gaps = 44/147 (30%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNK------ANNKDADVTK----PPAKAQVVGWPP  304
            F ET   VDLKL L +K+  +  +++ K       N+  AD  K    PPAKAQVVGWPP
Sbjct  47   FAET---VDLKLNLQAKEGVMDLNENIKNIASKDKNHLPADTIKDPAKPPAKAQVVGWPP  103

Query  305  VRSYRRNILAANN------------------------HQKSGGEDGSDKA------AVLV  394
            VRSYR+N+LA  N                         QK+  E+G DKA      A  V
Sbjct  104  VRSYRKNVLAQKNASEEGFRAQVVGWPPLRSYRKNVLTQKNASEEG-DKASTGGSSAAFV  162

Query  395  KVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            KV MDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  163  KVCMDGAPYLRKVDLKMYKSYQELSDA  189



>ref|NP_001237212.1| uncharacterized protein LOC100499872 [Glycine max]
 gb|ACU13989.1| unknown [Glycine max]
Length=228

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 78/125 (62%), Gaps = 26/125 (21%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSS------------------KDSQIHASDHNKANNKDADVTKPPAK  280
            F ET   VDLKL LSS                  K+++   ++   AN    D  KPPAK
Sbjct  29   FSETA-SVDLKLNLSSCINDSASDSPSSVSTEKPKENKTTTAEPPPAN----DPAKPPAK  83

Query  281  AQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQ  460
            AQVVGWPPVRS+R+NI+  N++++    + S K A  VKVSMDGAPYLRKVD+ +YKSYQ
Sbjct  84   AQVVGWPPVRSFRKNIVQRNSNEEEA--EKSTKNA-FVKVSMDGAPYLRKVDIKLYKSYQ  140

Query  461  DLSDA  475
            +LSDA
Sbjct  141  ELSDA  145



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 78/125 (62%), Gaps = 26/125 (21%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSS------------------KDSQIHASDHNKANNKDADVTKPPAK  280
            F ET   VDLKL LSS                  K+++   ++   AN    D  KPPAK
Sbjct  29   FSETA-SVDLKLNLSSCINDSASDSPSSVSTEKPKENKTTTAEPPPAN----DPAKPPAK  83

Query  281  AQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQ  460
            AQVVGWPPVRS+R+NI+  N++++    + S K A  VKVSMDGAPYLRKVD+ +YKSYQ
Sbjct  84   AQVVGWPPVRSFRKNIVQRNSNEEEA--EKSTKNA-FVKVSMDGAPYLRKVDIKLYKSYQ  140

Query  461  DLSDA  475
            +LSDA
Sbjct  141  ELSDA  145



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 71/122 (58%), Gaps = 20/122 (16%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL LSS  + + +       N    V KPPAKAQVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSS--TAMDSVSKVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  335  ANNHQKSGGEDGSDK---------------AAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  469
                      +G+DK                   VKVSMDGAPYLRK+DL +YK+YQDLS
Sbjct  87   GQKPTTGDATEGNDKTSGSSGATSSASACATVAYVKVSMDGAPYLRKIDLKLYKTYQDLS  146

Query  470  DA  475
            +A
Sbjct  147  NA  148



>gb|ABY65168.1| At1g04250-like protein, partial [Arabidopsis lyrata]
Length=95

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 57/73 (78%), Gaps = 5/73 (7%)
 Frame = +2

Query  257  DVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVD  436
            D  KPP+KAQVVGWPPVRSYR+N++ +   QKS    G  +AA  VKVSMDGAPYLRKVD
Sbjct  1    DPAKPPSKAQVVGWPPVRSYRKNVMVS--CQKS---SGGPEAAAFVKVSMDGAPYLRKVD  55

Query  437  LSMYKSYQDLSDA  475
            L MYKSY +LS+A
Sbjct  56   LRMYKSYVELSNA  68



>ref|XP_004982377.1| PREDICTED: auxin-responsive protein IAA30-like isoform X2 [Setaria 
italica]
Length=266

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 65/98 (66%), Gaps = 7/98 (7%)
 Frame = +2

Query  188  LKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGE-  364
            +K S   S +  +D       DAD  + P KAQ VGWPPVRS+R+NIL+  + QK GG+ 
Sbjct  86   MKRSPSQSSVVTTDAQP----DADKPRAP-KAQAVGWPPVRSFRKNILSVQSCQKGGGDM  140

Query  365  -DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
             DG   AA  VKVSMDGAPYLRKVDL MY SYQ+LS A
Sbjct  141  DDGKSGAAAFVKVSMDGAPYLRKVDLRMYGSYQELSKA  178



>ref|XP_004982376.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Setaria 
italica]
Length=267

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 65/98 (66%), Gaps = 7/98 (7%)
 Frame = +2

Query  188  LKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGE-  364
            +K S   S +  +D       DAD  + P KAQ VGWPPVRS+R+NIL+  + QK GG+ 
Sbjct  86   MKRSPSQSSVVTTDAQP----DADKPRAP-KAQAVGWPPVRSFRKNILSVQSCQKGGGDM  140

Query  365  -DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
             DG   AA  VKVSMDGAPYLRKVDL MY SYQ+LS A
Sbjct  141  DDGKSGAAAFVKVSMDGAPYLRKVDLRMYGSYQELSKA  178



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 73/125 (58%), Gaps = 22/125 (18%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL LSS  +    S     + K+ DV KPPAK QVVGWPPVRS+R+N+++
Sbjct  33   FSET---VDLKLNLSST-AMDSVSGAQLEDIKEKDVVKPPAKTQVVGWPPVRSFRKNVMS  88

Query  335  ANNHQKSGGEDGSDKAAV------------------LVKVSMDGAPYLRKVDLSMYKSYQ  460
                      +G+DK +                    VKVSMDGAPYLRK+DL +YK+YQ
Sbjct  89   GQKPITGDAVEGNDKTSGSSGATSSASACAAAAAAAYVKVSMDGAPYLRKIDLKLYKTYQ  148

Query  461  DLSDA  475
            DLSDA
Sbjct  149  DLSDA  153



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 72/117 (62%), Gaps = 15/117 (13%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILA  334
            F ET   VDLKL LSS  + + +       N    V KPPAKAQVVGWPPVRS+R+N+++
Sbjct  32   FSET---VDLKLNLSS--TAMDSVSGVDLENMKEKVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  335  ANNHQKSGGEDGSDKAAV----------LVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
                      +G++K +            VKVS+DGAPYLRK+DL +YK+YQDLSDA
Sbjct  87   GQKPTAGDAAEGTEKTSSSNAATSSAAAYVKVSLDGAPYLRKIDLKLYKTYQDLSDA  143



>ref|XP_006366663.1| PREDICTED: auxin-responsive protein IAA16-like [Solanum tuberosum]
Length=214

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 69/101 (68%), Gaps = 17/101 (17%)
 Frame = +2

Query  173  HVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQK  352
             VDLKL LSS  + I          K++ +  P  K Q+VGWPPVRS+R+NIL +   QK
Sbjct  46   FVDLKLNLSSDINNI----------KNSTLKAPAVKTQIVGWPPVRSFRKNILTS---QK  92

Query  353  SGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
             G E  SD   +LVKVSMDGAPYLRKVDL+MYKSYQ+LSDA
Sbjct  93   LGQE--SDN--ILVKVSMDGAPYLRKVDLNMYKSYQELSDA  129



>ref|XP_004982378.1| PREDICTED: auxin-responsive protein IAA30-like isoform X3 [Setaria 
italica]
Length=235

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 65/98 (66%), Gaps = 7/98 (7%)
 Frame = +2

Query  188  LKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQKSGGE-  364
            +K S   S +  +D       DAD  + P KAQ VGWPPVRS+R+NIL+  + QK GG+ 
Sbjct  86   MKRSPSQSSVVTTDAQP----DADKPRAP-KAQAVGWPPVRSFRKNILSVQSCQKGGGDM  140

Query  365  -DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
             DG   AA  VKVSMDGAPYLRKVDL MY SYQ+LS A
Sbjct  141  DDGKSGAAAFVKVSMDGAPYLRKVDLRMYGSYQELSKA  178



>ref|XP_006418149.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 dbj|BAJ33922.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36502.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=226

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 75/116 (65%), Gaps = 21/116 (18%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIH-ASDHNKANNKDA--------DVTKPPAKAQVVGWPPV  307
            F ET   VDLKL L+++ +     + H+   N  +        D  KPPAKAQVVGWPPV
Sbjct  34   FSET---VDLKLNLNNEPANKEGCTTHDVVTNSVSKEKSSSPKDPAKPPAKAQVVGWPPV  90

Query  308  RSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            RSYR+N+L ++  QKS       +AA  VKVSMDGAPYLRKVDL MYKSY +LS+A
Sbjct  91   RSYRKNVLVSS--QKS-------EAAAFVKVSMDGAPYLRKVDLKMYKSYDELSNA  137



>gb|ACJ83896.1| unknown [Medicago truncatula]
 gb|AFK48514.1| unknown [Medicago truncatula]
 gb|KEH42620.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=245

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 71/118 (60%), Gaps = 11/118 (9%)
 Frame = +2

Query  155  FEETHQH-----VDLKLKLSSKDSQI--HASDHNKANNKDADVTKPPAKAQVVGWPPVRS  313
            F ET        VDLKL LS+K+           KA        KPPAKAQVVGWPPVRS
Sbjct  39   FSETESESETNTVDLKLNLSTKEGATDPQFKPKEKALLLSDSGAKPPAKAQVVGWPPVRS  98

Query  314  YRRNILAAN----NHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +R+N+ AA       ++S  ++ ++     VKVSMDGAPYLRKVDL MYKSY +LSDA
Sbjct  99   FRKNMFAAQKSNEGSEESEKKNSNNNPISFVKVSMDGAPYLRKVDLKMYKSYPELSDA  156



>ref|XP_010087762.1| Auxin-responsive protein IAA7 [Morus notabilis]
 gb|EXB29843.1| Auxin-responsive protein IAA7 [Morus notabilis]
Length=304

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 72/122 (59%), Gaps = 23/122 (19%)
 Frame = +2

Query  170  QHVDLKLKLSSKDSQIHASDHNKANNKDA--------------DVTKPPAKAQVVGWPPV  307
            + VDLKL L  +  +    D N+ N K                D  KPPAKAQVVGWPPV
Sbjct  49   ETVDLKLNLHRQSVK---EDLNEINIKSTSAPPKEKNLLPCTKDPAKPPAKAQVVGWPPV  105

Query  308  RSYRRNILA---ANNHQKSGGE---DGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  469
            RSYR+NI+A   + N + S  E     S+ A   VKV MDGAPYLRKVDL MYKSYQ+LS
Sbjct  106  RSYRKNIMAQKMSTNEESSPHEKTSSSSNSAGAFVKVCMDGAPYLRKVDLKMYKSYQELS  165

Query  470  DA  475
            DA
Sbjct  166  DA  167



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 72/127 (57%), Gaps = 23/127 (18%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD--------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL LS+K+         +    +     +   D  KPPAKAQVVGWPP+R
Sbjct  46   FSET---VDLKLNLSTKEPSGKDVIVGEETMKEKATVPSSSNDPAKPPAKAQVVGWPPIR  102

Query  311  SYRRNILAANNHQKSGGE------------DGSDKAAVLVKVSMDGAPYLRKVDLSMYKS  454
            S+R+N++A   +    GE                 +A  VKVSMDGAPYLRKVDL +YKS
Sbjct  103  SFRKNVMAVQKNSTDEGEKGTATSAPAAAATSGSTSAAFVKVSMDGAPYLRKVDLKLYKS  162

Query  455  YQDLSDA  475
            YQ+LSDA
Sbjct  163  YQELSDA  169



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 74/123 (60%), Gaps = 23/123 (19%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD------SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSY  316
            F ET   VDL L L S        + + A+   K   KD   +KPP KAQVVGWPPVR+Y
Sbjct  38   FSET---VDLMLNLQSNKEGSVDLNNVAAAPKEKTTLKDP--SKPPTKAQVVGWPPVRNY  92

Query  317  RRNILAANNHQKSGGEDGSDK----------AAVLVKVSMDGAPYLRKVDLSMYKSYQDL  466
            R+N++     + SG E+ S +           A LVKVSMDGAPYLRKVDL MYKSYQDL
Sbjct  93   RKNMM--TQQKTSGVEEASSEKAGSGGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDL  150

Query  467  SDA  475
            SDA
Sbjct  151  SDA  153



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 68/111 (61%), Gaps = 7/111 (6%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD---SQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRN  325
            F ET   VDLKL L S       ++ S   K      D TKPP KAQVVGWPPVR+YR+ 
Sbjct  33   FSET---VDLKLNLQSNKQGHGDLNVSGSIKEKTLLQDPTKPPTKAQVVGWPPVRNYRKT  89

Query  326  ILAANNHQKSGGEDGSDKAAV-LVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            ++A   + ++     S    +  VKVSMDGAPYLRKVDL MY SY+DLSDA
Sbjct  90   VMATQKNGETEETMSSGGGTIAFVKVSMDGAPYLRKVDLRMYNSYKDLSDA  140



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 75/118 (64%), Gaps = 18/118 (15%)
 Frame = +2

Query  161  ETHQH-VDLKLKLSSK---DSQIHASDHNKANNKD-----ADVTKPPAKAQVVGWPPVRS  313
            ET  H +DL L LS+     S++   D+ K   K+     AD  KPPAKAQVVGWPPVRS
Sbjct  45   ETQDHTMDLMLNLSTNKEPTSEVDPIDNTKILQKENTLLPADPAKPPAKAQVVGWPPVRS  104

Query  314  YRRNILAANNHQKSG----GEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            YR+N+LA    QKS     GE+  + A   VKVSMDGAPYLRKVDL +Y SY  LSD+
Sbjct  105  YRKNMLA---MQKSSNDVVGEE--NNAISFVKVSMDGAPYLRKVDLKIYNSYSQLSDS  157



>emb|CDY63072.1| BnaCnng41350D [Brassica napus]
Length=398

 Score =   103 bits (256),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSK-DSQIHASDHN-------KANNKDADVTKPPAKAQVVGWPPVR  310
            F ET   VDLKL L+S+ +S+  +  H+       + ++   D TKP AKAQVVGWPPVR
Sbjct  198  FSET---VDLKLNLNSEPESKEGSKSHDVVSAVFKEKSSCPKDPTKPLAKAQVVGWPPVR  254

Query  311  SYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            SYR+N++ +     S  E      A  VKVSMDGAPYLRKVDL MYKSY +LSDA
Sbjct  255  SYRKNVMGSCQKSSSSAE-----TAAFVKVSMDGAPYLRKVDLKMYKSYDELSDA  304



>ref|NP_001266055.1| IAA10 protein [Solanum lycopersicum]
 gb|AEX00360.1| IAA17 [Solanum lycopersicum]
Length=208

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 67/101 (66%), Gaps = 17/101 (17%)
 Frame = +2

Query  173  HVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNILAANNHQK  352
             VDLKL LSS  + I  S H            P AKAQVVGWPPVRS+R+NIL +   QK
Sbjct  40   FVDLKLNLSSDINNIKNSTH----------KTPAAKAQVVGWPPVRSFRKNILTS---QK  86

Query  353  SGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
               E+ +    +LVKVSMDGAPYLRKVDL+MYKSYQ+L DA
Sbjct  87   LDRENDN----ILVKVSMDGAPYLRKVDLNMYKSYQELFDA  123



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 79/146 (54%), Gaps = 42/146 (29%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDH-NKANNKDA---------DVTKPPAKAQVVGWPP  304
            F ET   VDLKL L +K+  +  +++ N   ++D          D  KPPAKAQVVGWPP
Sbjct  47   FAET---VDLKLNLQAKEGVMDLNENINNIASEDKNHLPSATIKDPAKPPAKAQVVGWPP  103

Query  305  VRSYRRNILAANNH------------------------QKSGGEDG-----SDKAAVLVK  397
            VRSYR+N+LA  N                         QK+  E+G        +A  VK
Sbjct  104  VRSYRKNVLAQKNASEEGFGAQVEGWPPVRSYRKNVLVQKNASEEGEKASTGGCSAAFVK  163

Query  398  VSMDGAPYLRKVDLSMYKSYQDLSDA  475
            V MDGAPYLRKVDL MYKSYQ+LSDA
Sbjct  164  VCMDGAPYLRKVDLKMYKSYQELSDA  189



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 73/121 (60%), Gaps = 20/121 (17%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNKANNKDADVTKPPAKAQVVGWPPVRSYRRNIL-  331
            F ET   VDLKL LSS  +    S+ +  N K+  V KPPAKAQVVGWPPVRS+R+N++ 
Sbjct  32   FSET---VDLKLNLSST-AMDSVSELDLVNMKE-KVVKPPAKAQVVGWPPVRSFRKNVMS  86

Query  332  -----------AANNHQKSGGEDGS---DKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLS  469
                       A  N   S G   S      A  VK+SMDGAPYLRK+DL +YK+YQDLS
Sbjct  87   GPKPTTGDAFQATENTSSSNGATSSASIGATAAYVKISMDGAPYLRKIDLKLYKAYQDLS  146

Query  470  D  472
            D
Sbjct  147  D  147



>gb|KFK31703.1| hypothetical protein AALP_AA6G148100 [Arabis alpina]
Length=208

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 69/108 (64%), Gaps = 19/108 (18%)
 Frame = +2

Query  170  QHVDLKLKL-----SSKDSQIHASDHNKANNKDADVTKPP-AKAQVVGWPPVRSYRRNIL  331
            + VDLKL L     ++K+  +  S  N ++    D TKPP AKAQVVGWPPVRSYR+N++
Sbjct  28   ETVDLKLNLNNEPETNKEGSL-VSKENTSSICPKDSTKPPPAKAQVVGWPPVRSYRKNVM  86

Query  332  AANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            +A               A  VKVSMDGAPYLRK+DL MYKSY DLS+A
Sbjct  87   SATAE------------ATFVKVSMDGAPYLRKIDLKMYKSYNDLSNA  122



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 70/117 (60%), Gaps = 12/117 (10%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKD--SQIHASDHNKANNKDA--------DVTKPPAKAQVVGWPP  304
            F ET   VDLKL L +KD  S +   +  K+N K          D  KPPAKAQVVGWPP
Sbjct  41   FSETE--VDLKLNLQAKDASSVVDLKEAMKSNEKTLLAGASPAKDPAKPPAKAQVVGWPP  98

Query  305  VRSYRRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            VRSYR+N++ A        E     AA  VKVSMDGAPYLRKVDL  Y SY+ LSDA
Sbjct  99   VRSYRKNMMVAQKSTDPEEEKEKAAAAAFVKVSMDGAPYLRKVDLKNYSSYKQLSDA  155



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 72/113 (64%), Gaps = 21/113 (19%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNK---ANNK--DADVTKPPA-KAQVVGWPPVRSY  316
            F ET   +DLKL L SK+S +  +++ K   +NNK  D D  KP A KAQVVGWPPVRSY
Sbjct  47   FCETAV-IDLKLNLQSKESSVDLNENFKNPPSNNKNHDKDPAKPSANKAQVVGWPPVRSY  105

Query  317  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+N +A              + A  VKV MDGAPYLRKVDL  YKSYQ+LSDA
Sbjct  106  RKNAMA--------------ETAAFVKVCMDGAPYLRKVDLKTYKSYQELSDA  144



>gb|KDO53919.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=200

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 72/113 (64%), Gaps = 21/113 (19%)
 Frame = +2

Query  155  FEETHQHVDLKLKLSSKDSQIHASDHNK---ANNK--DADVTKPPA-KAQVVGWPPVRSY  316
            F ET   +DLKL L SK+S +  +++ K   +NNK  D D  KP A KAQVVGWPPVRSY
Sbjct  47   FCETAV-IDLKLNLQSKESSVDLNENFKNPPSNNKNHDKDPAKPSANKAQVVGWPPVRSY  105

Query  317  RRNILAANNHQKSGGEDGSDKAAVLVKVSMDGAPYLRKVDLSMYKSYQDLSDA  475
            R+N +A              + A  VKV MDGAPYLRKVDL  YKSYQ+LSDA
Sbjct  106  RKNAMA--------------ETAAFVKVCMDGAPYLRKVDLKTYKSYQELSDA  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567171140730