BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L15

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU46744.1|  hypothetical protein MIMGU_mgv1a013710mg              64.7    7e-10   Erythranthe guttata [common monkey flower]
ref|XP_003632383.1|  PREDICTED: pectinesterase inhibitor              63.9    1e-09   Vitis vinifera
ref|XP_010088298.1|  Putative invertase inhibitor                     62.4    4e-09   Morus notabilis
ref|XP_010026122.1|  PREDICTED: uncharacterized protein LOC104416421  60.8    2e-08   Eucalyptus grandis [rose gum]
ref|XP_009335756.1|  PREDICTED: putative invertase inhibitor          60.1    3e-08   Pyrus x bretschneideri [bai li]
ref|XP_008363728.1|  PREDICTED: uncharacterized protein LOC103427453  59.7    4e-08   
ref|XP_008355510.1|  PREDICTED: uncharacterized protein LOC103419166  59.3    5e-08   
ref|XP_009335752.1|  PREDICTED: putative invertase inhibitor          58.9    8e-08   Pyrus x bretschneideri [bai li]
gb|EPS62398.1|  hypothetical protein M569_12395                       57.4    3e-07   Genlisea aurea
ref|XP_007200555.1|  hypothetical protein PRUPE_ppa011794mg           56.6    4e-07   Prunus persica
ref|XP_008386682.1|  PREDICTED: uncharacterized protein LOC103449171  55.1    2e-06   
ref|XP_008235119.1|  PREDICTED: pectinesterase inhibitor 2            54.3    3e-06   Prunus mume [ume]
ref|XP_010259728.1|  PREDICTED: pectinesterase inhibitor-like         53.5    5e-06   Nelumbo nucifera [Indian lotus]
ref|XP_008454497.1|  PREDICTED: uncharacterized protein LOC103494896  52.4    6e-06   Cucumis melo [Oriental melon]
ref|XP_003633605.1|  PREDICTED: pectinesterase inhibitor-like         53.5    6e-06   Vitis vinifera
ref|XP_004292666.1|  PREDICTED: putative invertase inhibitor          52.4    2e-05   Fragaria vesca subsp. vesca
ref|XP_004152360.1|  PREDICTED: cell wall / vacuolar inhibitor of...  50.8    3e-05   
ref|XP_007012508.1|  Plant invertase/pectin methylesterase inhibi...  51.2    3e-05   
ref|XP_004156885.1|  PREDICTED: cell wall / vacuolar inhibitor of...  50.4    5e-05   
gb|KGN52826.1|  hypothetical protein Csa_4G001930                     50.8    6e-05   Cucumis sativus [cucumbers]
gb|KHN08674.1|  Pectinesterase inhibitor                              50.1    8e-05   Glycine soja [wild soybean]
ref|XP_003519758.1|  PREDICTED: pectinesterase inhibitor 1-like       50.1    1e-04   Glycine max [soybeans]
ref|XP_004507480.1|  PREDICTED: pectinesterase inhibitor 1-like       49.7    2e-04   Cicer arietinum [garbanzo]
gb|KDP28188.1|  hypothetical protein JCGZ_13959                       49.3    2e-04   Jatropha curcas
gb|KJB22516.1|  hypothetical protein B456_004G052000                  49.3    2e-04   Gossypium raimondii
gb|EPS67066.1|  pectinesterase                                        50.4    3e-04   Genlisea aurea
ref|XP_003606993.1|  hypothetical protein MTR_4g071020                48.5    4e-04   Medicago truncatula
gb|AFK49569.1|  unknown                                               47.8    9e-04   Medicago truncatula



>gb|EYU46744.1| hypothetical protein MIMGU_mgv1a013710mg [Erythranthe guttata]
Length=212

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = +3

Query  294  LAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSV  473
            LAFFAL+ +E  AVN++  ++  L      L P  Q  LSDC + Y P  DLIE+A++++
Sbjct  85   LAFFALRFVEDHAVNITTDIKKFL--AVPDLAPLLQSALSDCMDQYNPLDDLIEDAINAI  142

Query  474  GNKAFPDAVKFLQDAILDLNACE  542
              KA+ DA +F+  AI D+N C+
Sbjct  143  LAKAYSDAEQFIDAAITDINQCD  165



>ref|XP_003632383.1| PREDICTED: pectinesterase inhibitor [Vitis vinifera]
Length=181

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 62/122 (51%), Gaps = 8/122 (7%)
 Frame = +3

Query  177  KLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVE  356
            +LI   C HS   + C+  L    N  +       DM  LA  ALK     A + S+ + 
Sbjct  33   ELIEKVCQHSPHSDICMASLRTDPNSGQA------DMEGLALIALKVAHANATDTSQHIA  86

Query  357  MKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNA  536
              LNN +  L P  +Q L+DC E Y+ AV+ IE+++ ++  K F D   +++ AI D++ 
Sbjct  87   KLLNNST--LDPFIEQCLTDCSEQYLDAVEQIEDSLVALTAKGFHDVDAWVKAAIADVDT  144

Query  537  CE  542
            CE
Sbjct  145  CE  146



>ref|XP_010088298.1| Putative invertase inhibitor [Morus notabilis]
 gb|EXB33523.1| Putative invertase inhibitor [Morus notabilis]
Length=182

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 85/165 (52%), Gaps = 20/165 (12%)
 Frame = +3

Query  48   KMASRFLLLALIFCYLSLNNNVYSIQPQQIIPNLKFPAKKVDPKLIATACDHSKGGEACV  227
            K  + FLLL  I  Y+S     YS  PQQ + +      +     +  AC H+   ++C+
Sbjct  2    KFINTFLLL-FITLYIS-----YS--PQQAVAH----GHQSHANNLEKACQHAGHKDSCI  49

Query  228  KWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQG  407
              L   ++DP       +D++ L   AL+     A ++SE +++ LN+ S  L P  Q G
Sbjct  50   SML---QSDPNS---HSSDVKGLTLIALRLASSNASDISEHIKVLLNDSS--LDPAVQDG  101

Query  408  LSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNACE  542
            LS+C E+Y+ A + ++++V ++   A+ D   ++  AI+D  +C+
Sbjct  102  LSECLEYYLDAAEQLDDSVAALLANAYKDVEAWVNVAIIDAASCD  146



>ref|XP_010026122.1| PREDICTED: uncharacterized protein LOC104416421 [Eucalyptus grandis]
Length=203

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 4/96 (4%)
 Frame = +3

Query  255  PEISLIEINDMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYV  434
            PE+      D+  LA  AL+     A + S  ++  L + +  L P+ QQGLSDC EHYV
Sbjct  76   PEVG--SATDIGVLAIAALRFATTNASDTSAHIQGLLKDIT--LAPDVQQGLSDCAEHYV  131

Query  435  PAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNACE  542
             AV+ +++++ ++  KA+ D   ++Q AI D +ACE
Sbjct  132  DAVEQLDDSLAALTVKAYGDVHTWVQTAIADADACE  167



>ref|XP_009335756.1| PREDICTED: putative invertase inhibitor [Pyrus x bretschneideri]
Length=197

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 63/134 (47%), Gaps = 6/134 (4%)
 Frame = +3

Query  141  PNLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKI  320
             N    A +V+ KL+  AC HS   + C++ L    N     LI       LA+ A++  
Sbjct  35   SNTAAAAGEVNMKLLEQACQHSPRKDLCIESLEKDSNSKGADLI------GLAYIAVRLA  88

Query  321  EKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAV  500
               A +V E +   L + S  L P  QQGL+DC EHY  A D +++   ++    F D  
Sbjct  89   AAMAADVDEHMRSLLMHNSTSLDPVIQQGLADCVEHYSDANDQLDDCTAAISASKFKDVE  148

Query  501  KFLQDAILDLNACE  542
             ++  AI D + C+
Sbjct  149  VWVNVAISDADFCD  162



>ref|XP_008363728.1| PREDICTED: uncharacterized protein LOC103427453 [Malus domestica]
Length=197

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 63/134 (47%), Gaps = 6/134 (4%)
 Frame = +3

Query  141  PNLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKI  320
             N    A +V+ KL+  AC HS   + C++ L    N     LI       LA+ A++  
Sbjct  35   SNTAAAAGEVNMKLLEQACQHSPRKDLCIESLEKDSNSKGADLI------GLAYIAVRLA  88

Query  321  EKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAV  500
               A +V E +   L + +  L P  QQGL+DC EHY  A D +++   ++    F D  
Sbjct  89   AAMAADVDEHMRSLLMHNATTLDPMIQQGLADCVEHYSDANDQLDDCTAAISASNFKDVE  148

Query  501  KFLQDAILDLNACE  542
             ++  AI D + C+
Sbjct  149  VWVNVAISDADFCD  162



>ref|XP_008355510.1| PREDICTED: uncharacterized protein LOC103419166 [Malus domestica]
Length=197

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 63/134 (47%), Gaps = 6/134 (4%)
 Frame = +3

Query  141  PNLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKI  320
             N    A +V+ KL+  AC HS   + C++ L    N     LI       LA+ A++  
Sbjct  35   SNTAAAAGEVNMKLLEQACQHSPRKDLCIESLEKDSNSKGADLI------GLAYIAVRLA  88

Query  321  EKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAV  500
               A +V E +   L + +  L P  QQGL+DC EHY  A D +++   ++    F D  
Sbjct  89   AAMAADVDEHMRSLLMHNATTLDPMIQQGLADCVEHYSDANDQLDDCTAAISASNFKDVE  148

Query  501  KFLQDAILDLNACE  542
             ++  AI D + C+
Sbjct  149  VWVNVAISDADFCD  162



>ref|XP_009335752.1| PREDICTED: putative invertase inhibitor [Pyrus x bretschneideri]
Length=197

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 63/134 (47%), Gaps = 6/134 (4%)
 Frame = +3

Query  141  PNLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKI  320
             N    A +V+ KL+  AC HS   + C++ L    N     LI       LA+ A++  
Sbjct  35   SNTAAAAGEVNMKLLEQACQHSPRKDLCIESLEKDSNSKGADLI------GLAYIAVRLA  88

Query  321  EKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAV  500
               A +V E +   L + +  L P  QQGL+DC EHY  A D +++   ++    F D  
Sbjct  89   AAMAADVDEHMRSLLMHNATSLDPVIQQGLADCVEHYSDANDQLDDCTAAISASKFKDVE  148

Query  501  KFLQDAILDLNACE  542
             ++  AI D + C+
Sbjct  149  VWVNVAISDADFCD  162



>gb|EPS62398.1| hypothetical protein M569_12395 [Genlisea aurea]
Length=207

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 64/131 (49%), Gaps = 14/131 (11%)
 Frame = +3

Query  159  AKKVDPKLIATACDHSKGGEA-CVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAV  335
            +K  +P L+ +AC      E+ C+  L       +       D   LAFFALK +E  A 
Sbjct  40   SKSAEP-LVLSACRGVGKFESECISTLQSASKSQK------TDANGLAFFALKYVEDHAA  92

Query  336  NVSEAVEMKLNNGSEV--LPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFL  509
            N++    M +     +  L P  Q  LS+C + Y P  DLIE+A+++V   A+ DA  F+
Sbjct  93   NLT----MDIAKAGTIPNLDPMFQAALSECMDQYTPLGDLIEDAINAVLANAYGDAKTFI  148

Query  510  QDAILDLNACE  542
               I +++ C+
Sbjct  149  DATISNIDVCD  159



>ref|XP_007200555.1| hypothetical protein PRUPE_ppa011794mg [Prunus persica]
 gb|EMJ01754.1| hypothetical protein PRUPE_ppa011794mg [Prunus persica]
Length=195

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 63/128 (49%), Gaps = 6/128 (5%)
 Frame = +3

Query  159  AKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVN  338
            A  V+  LI  AC H+   + C+  L   +NDP     +  D+  LA+ A++     A  
Sbjct  37   AGVVNMNLIQQACQHAPHKDLCIDIL---KNDPNS---KGADLTGLAYIAIRLAGAYASE  90

Query  339  VSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDA  518
            V   +   L N +  L P  QQG++DC EHY  A + +++ + ++  K F D   ++  A
Sbjct  91   VDAHLRSLLINNATTLSPVVQQGVADCIEHYSDANEQLDDCIAAMSTKNFKDVEVWVNVA  150

Query  519  ILDLNACE  542
            I D + C+
Sbjct  151  ISDADYCD  158



>ref|XP_008386682.1| PREDICTED: uncharacterized protein LOC103449171 [Malus domestica]
Length=197

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (50%), Gaps = 6/133 (5%)
 Frame = +3

Query  144  NLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIE  323
            N    A +V+ KL+  AC  S   + C++ L   E DP     +  D+  LAF A++   
Sbjct  36   NTAAAAGEVNMKLLEQACQXSPRKDLCIETL---EKDPNS---KGADLTGLAFVAIRLAA  89

Query  324  KEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVK  503
              A +V E +   L + +  L P  QQGL+DC EHY  A + +++ V+++      +   
Sbjct  90   AMASDVDEHMRSLLIHNATTLDPTIQQGLADCIEHYSDANEQLDDCVEAISTHNLEEVEL  149

Query  504  FLQDAILDLNACE  542
            ++  AI D + C+
Sbjct  150  WVNVAISDADLCD  162



>ref|XP_008235119.1| PREDICTED: pectinesterase inhibitor 2 [Prunus mume]
Length=195

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 63/128 (49%), Gaps = 6/128 (5%)
 Frame = +3

Query  159  AKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVN  338
            A  V+  LI  AC H+   + C+  L   +NDP     +  D+  LA+ +++     A  
Sbjct  37   AGVVNMNLIQQACQHAPHKDLCINAL---KNDPNS---KGADLIGLAYISIRLAGAYASE  90

Query  339  VSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDA  518
            V   +   L N +  L P  QQG++DC EHY  A + +++ V ++  K + D   ++  A
Sbjct  91   VDAHLRSLLINNATTLSPVVQQGVADCIEHYSDANEQLDDCVAAMSTKNYKDVEVWVNVA  150

Query  519  ILDLNACE  542
            I D + C+
Sbjct  151  ISDADYCD  158



>ref|XP_010259728.1| PREDICTED: pectinesterase inhibitor-like [Nelumbo nucifera]
Length=182

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 69/133 (52%), Gaps = 9/133 (7%)
 Frame = +3

Query  144  NLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIE  323
            ++  P     P LI   C H+   + C++ +   E +P+ +    +D++ LA  ALK   
Sbjct  20   SVDHPGGGGIPDLIKETCQHAVYTDLCIQTM---ELEPDSAK---SDIKSLASIALKIAA  73

Query  324  KEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVK  503
                 +S+ +   +   ++   P  QQ L+DC E+Y+ A+D +E+++ ++ ++ + D   
Sbjct  74   SNGTYISDYIRRLIQTTAD---PYLQQCLTDCSENYIDAIDQLEDSISALESRGYSDINH  130

Query  504  FLQDAILDLNACE  542
            ++  A+ ++ +CE
Sbjct  131  WVTGAMNEIESCE  143



>ref|XP_008454497.1| PREDICTED: uncharacterized protein LOC103494896 [Cucumis melo]
Length=118

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +3

Query  294  LAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSV  473
            LA  AL+     A ++SE++++ LN  S+   P  QQGL DC + Y+ A   +++++ ++
Sbjct  3    LALVALRLASSNASDISESIKVMLNETSQN-EPAVQQGLFDCLDEYLDASQQLDDSIAAI  61

Query  474  GNKAFPDAVKFLQDAILDLNACE  542
              KA+ D  K++  A+ D+  CE
Sbjct  62   IAKAYGDVEKWVHAAVADVRTCE  84



>ref|XP_003633605.1| PREDICTED: pectinesterase inhibitor-like [Vitis vinifera]
Length=193

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 64/136 (47%), Gaps = 11/136 (8%)
 Frame = +3

Query  135  IIPNLKFPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALK  314
            IIPN K     +  +LIA  CDH+   + C+  L       +  L E+  +      ALK
Sbjct  31   IIPNQK---SSLGEELIAQVCDHAIYKDLCISSLQSVPESKDADLFELTTI------ALK  81

Query  315  KIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPD  494
                 A  + + V+  LN         T Q L+DC E+Y  A+D IE+++ ++ +K + D
Sbjct  82   LAATNATEIKKYVQKLLNKSHS--DRYTHQCLADCSENYEDALDRIEDSLKALESKGYND  139

Query  495  AVKFLQDAILDLNACE  542
               ++  A+ D  +CE
Sbjct  140  VNTWVTAAMADAESCE  155



>ref|XP_004292666.1| PREDICTED: putative invertase inhibitor [Fragaria vesca subsp. 
vesca]
Length=198

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/160 (26%), Positives = 72/160 (45%), Gaps = 6/160 (4%)
 Frame = +3

Query  63   FLLLALIFCYLSLNNNVYSIQPQQIIPNLKFPAKKVDPKLIATACDHSKGGEACVKWLND  242
            FL    +  +++L  N   +  Q   P    P+  V   L+  AC  +   + C+  L  
Sbjct  9    FLSTLCVLQHVALAANSKPVGGQPGKPARGQPSGPVSGNLLEEACKQATNKDLCINSLKK  68

Query  243  KENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCR  422
              N       +  D+  LAF AL+     A +V   +   +   +  L P+ QQG+ DC 
Sbjct  69   DPNS------QGADLTGLAFIALRLAAANAADVESHLRTLMLKNATGLDPDVQQGVQDCI  122

Query  423  EHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNACE  542
            + Y  A + ++++V ++ +K   D V +++ AI D N CE
Sbjct  123  DSYTDANEQLDDSVAALSDKKCKDVVVWVKVAIADSNYCE  162



>ref|XP_004152360.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Cucumis sativus]
Length=145

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = +3

Query  282  DMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEA  461
            D   LA  AL+     A ++SE++++ LN  S+   P  QQ L DC + Y+ A   ++++
Sbjct  25   DKMGLALVALRLASSNASDISESIKVMLNETSQNNEPTVQQALFDCLDEYLEASQQLDDS  84

Query  462  VDSVGNKAFPDAVKFLQDAILDLNACE  542
            + ++  KA+ D  ++++ A+ ++  CE
Sbjct  85   IAAIIAKAYGDVQEWVRVAVTNVRTCE  111



>ref|XP_007012508.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
 gb|EOY30127.1| Plant invertase/pectin methylesterase inhibitor superfamily protein, 
putative [Theobroma cacao]
Length=169

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 9/122 (7%)
 Frame = +3

Query  180  LIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALK-KIEKEAVNVSEAVE  356
            L++ AC H++  E CV  L   ++DP+    E +D+R LA  AL   I      +S    
Sbjct  21   LVSNACSHTQFYEVCVSTL---KSDPQS---EKSDIRGLADIALNVSIAYGMETLSHINS  74

Query  357  MKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNA  536
            +K + G+    P   + LSDC E Y  AVD ++E+  ++  K++      +  A+ D + 
Sbjct  75   LKFSPGNYT--PFASRCLSDCMEEYSDAVDNLQESAQALRTKSYTTVNTLVAAAMTDSDT  132

Query  537  CE  542
            CE
Sbjct  133  CE  134



>ref|XP_004156885.1| PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like 
[Cucumis sativus]
Length=167

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = +3

Query  282  DMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEA  461
            D   LA  AL+     A ++SE++++ LN  S+   P  QQ L DC + Y+ A   ++++
Sbjct  47   DKMGLALVALRLASSNASDISESIKVMLNETSQNNEPTVQQALFDCLDEYLEASQQLDDS  106

Query  462  VDSVGNKAFPDAVKFLQDAILDLNACE  542
            + ++  KA+ D  ++++ A+ ++  CE
Sbjct  107  IAAIIAKAYGDVQEWVRVAVTNVRTCE  133



>gb|KGN52826.1| hypothetical protein Csa_4G001930 [Cucumis sativus]
Length=181

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 60/122 (49%), Gaps = 8/122 (7%)
 Frame = +3

Query  180  LIATACDHSKGGEACVKWLNDKEND-PEISLIEINDMRDLAFFALKKIEKEAVNVSEAVE  356
            +I   C  +   + C+  L    N  P        D   LA  AL+     A ++SE+++
Sbjct  33   MIQKMCAQTNYKDLCITSLTSDPNSFPA-------DKMGLALVALRLASSNASDISESIK  85

Query  357  MKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNA  536
            + LN  S+   P  QQ L DC + Y+ A   +++++ ++  KA+ D  ++++ A+ ++  
Sbjct  86   VMLNETSQNNEPTVQQALFDCLDEYLEASQQLDDSIAAIIAKAYGDVQEWVRVAVTNVRT  145

Query  537  CE  542
            CE
Sbjct  146  CE  147



>gb|KHN08674.1| Pectinesterase inhibitor [Glycine soja]
Length=166

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 70/127 (55%), Gaps = 8/127 (6%)
 Frame = +3

Query  162  KKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNV  341
            +K+  +LI + C +    E C++ L+   +DP+    +  D+++LA  +LK     A  +
Sbjct  12   EKIGKELIKSICKNRGNDELCMQVLS---SDPDS---DHADLQELALISLKAAASNASGI  65

Query  342  SEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAI  521
                +  ++N  + L P+ QQGL+DC+E+ + A   I++AV S+ N    DA  +L+ A+
Sbjct  66   LNDCKRMIDN--QDLEPKIQQGLADCKENLLDAEGQIQDAVASILNNDKLDAQVWLKAAL  123

Query  522  LDLNACE  542
              ++ C+
Sbjct  124  AAIDTCD  130



>ref|XP_003519758.1| PREDICTED: pectinesterase inhibitor 1-like [Glycine max]
Length=180

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 70/127 (55%), Gaps = 8/127 (6%)
 Frame = +3

Query  162  KKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNV  341
            +K+  +LI + C +    E C++ L+   +DP+    +  D+++LA  +LK     A  +
Sbjct  26   EKIGKELIKSICKNRGNDELCMQVLS---SDPDS---DHADLQELALISLKAAASNASGI  79

Query  342  SEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAI  521
                +  ++N  + L P+ QQGL+DC+E+ + A   I++AV S+ N    DA  +L+ A+
Sbjct  80   LNDCKRMIDN--QDLEPKIQQGLADCKENLLDAEGQIQDAVASILNNDKLDAQVWLKAAL  137

Query  522  LDLNACE  542
              ++ C+
Sbjct  138  AAIDTCD  144



>ref|XP_004507480.1| PREDICTED: pectinesterase inhibitor 1-like [Cicer arietinum]
Length=197

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 78/170 (46%), Gaps = 14/170 (8%)
 Frame = +3

Query  45   EKMASRFLLLALIFCYLSLNNNVYSIQPQQ----IIPNLKFPAKKVDPKLIATACDHSKG  212
            E + +++L L  I  Y+ L N+  +I  +     + P   F  K     LI   CD +  
Sbjct  2    EVVTTKYLYLLAI--YIILLNHQIAIATENKDNVLFPENLFSHKGKTSDLIKKVCDQTPN  59

Query  213  GEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVEMKLNNGSEVLPP  392
             + C++ L  +      +L      +DLA  +LK     A  +   V+M +++    L P
Sbjct  60   KDLCLEVLLSEPTSEHATL------QDLAMISLKVAASNATGILTDVKMMIDDPD--LDP  111

Query  393  ETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNACE  542
              QQGL+DC+E  + A   +E+ V ++   +  D   +LQ A+  ++ C+
Sbjct  112  GIQQGLADCKETLLDAEGQLEDTVAAILGNSKRDVQLWLQAALAAIDTCD  161



>gb|KDP28188.1| hypothetical protein JCGZ_13959 [Jatropha curcas]
Length=182

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 55/130 (42%), Gaps = 8/130 (6%)
 Frame = +3

Query  153  FPAKKVDPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEA  332
            FP +     L+   C+HS     C++  N        SL        L   A+K   + A
Sbjct  23   FPHQIAGSGLVEQVCEHSHNKTKCIESFNSNPTSEGASL------EQLGVLAIKLAVQNA  76

Query  333  VNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQ  512
               S  ++  L  G++ L P  QQ +S C E Y  A   +E+++D++          ++ 
Sbjct  77   TYTSLYMQQFL--GNQTLDPAVQQAVSHCAEQYSNASQELEDSIDALSTDDRHTVFTWVS  134

Query  513  DAILDLNACE  542
             AI ++ +CE
Sbjct  135  AAITNIESCE  144



>gb|KJB22516.1| hypothetical protein B456_004G052000 [Gossypium raimondii]
Length=183

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 8/121 (7%)
 Frame = +3

Query  180  LIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVEM  359
            L+A AC+  K  + C+  L  +            D+  LA  ++K       N S  ++ 
Sbjct  34   LVAQACEKVKAKDLCISSLMAEHASKSA------DLAMLALISIKVASNNGTNTSFYIKK  87

Query  360  KLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNAC  539
             L+  ++ L P  +Q   DC ++Y+ A   ++ AV S+ +K + D   FL+ AI D   C
Sbjct  88   TLD--TKKLEPAVEQNFQDCEDNYISATQQLDGAVSSLVSKNYKDTKMFLESAIDDAITC  145

Query  540  E  542
            +
Sbjct  146  D  146



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/77 (34%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = +3

Query  312  KKIEKEAVNVSEAVEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFP  491
            + +E  AVNV+   +++       L P  Q  L+DC + Y P  DLIE+A++SV   A+ 
Sbjct  323  RYVEDHAVNVT--TDIQKAAAIPNLTPMFQAALTDCLDQYTPLGDLIEDAINSVLANAYT  380

Query  492  DAVKFLQDAILDLNACE  542
            DA  F+   I +++ C+
Sbjct  381  DAKTFIDGVISNIDVCD  397



>ref|XP_003606993.1| hypothetical protein MTR_4g071020 [Medicago truncatula]
 gb|AES89190.1| plant invertase/pectin methylesterase inhibitor [Medicago truncatula]
Length=178

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 63/124 (51%), Gaps = 8/124 (6%)
 Frame = +3

Query  171  DPKLIATACDHSKGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEA  350
            D  LI+  C +    E CV  L+  +   + +L      +DLA  +L+     A  +   
Sbjct  26   DNPLISKVCANLPNKEQCVSILSSDKLSQQATL------KDLAMISLRVAASNATGILSD  79

Query  351  VEMKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDL  530
            V+M +++ +  L P  QQGL+DC+E  + A   +E+ V ++ + A  DA  +LQ A+  +
Sbjct  80   VKMMIDDPN--LDPGIQQGLADCKETLLDAESQLEDTVAALLSNAKHDAQLWLQAALAAI  137

Query  531  NACE  542
            + C+
Sbjct  138  DTCD  141



>gb|AFK49569.1| unknown [Medicago truncatula]
Length=186

 Score = 47.8 bits (112),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 69/122 (57%), Gaps = 8/122 (7%)
 Frame = +3

Query  180  LIATACDHS-KGGEACVKWLNDKENDPEISLIEINDMRDLAFFALKKIEKEAVNVSEAVE  356
            LI   C  + K  + CV+ L+   +DP+ +    +D+ DLA  AL+ + + A  +   V+
Sbjct  29   LITRVCQLAQKNSDLCVEVLS---SDPKSA--NADDINDLAIIALRVVARNASAMLNDVK  83

Query  357  MKLNNGSEVLPPETQQGLSDCREHYVPAVDLIEEAVDSVGNKAFPDAVKFLQDAILDLNA  536
              +++ +  L PE QQGL+DC+E+ + A   +E+ + ++  ++  D+ K+L+ A+  +  
Sbjct  84   SMIDDAN--LDPEVQQGLADCKENILDAESQLEDTIAALLVESDVDSQKWLKAALAAITT  141

Query  537  CE  542
            C+
Sbjct  142  CD  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490