BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L13

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789164.1|  PREDICTED: 60S ribosomal protein L13a-1            316   9e-107   Nicotiana sylvestris
ref|XP_011073788.1|  PREDICTED: 60S ribosomal protein L13a-4            316   9e-107   Sesamum indicum [beniseed]
ref|XP_009625303.1|  PREDICTED: 60S ribosomal protein L13a-4-like       316   1e-106   Nicotiana tomentosiformis
gb|EYU31410.1|  hypothetical protein MIMGU_mgv1a013934mg                315   2e-106   Erythranthe guttata [common monkey flower]
ref|XP_009622553.1|  PREDICTED: 60S ribosomal protein L13a-4-like       315   2e-106   Nicotiana tomentosiformis
ref|XP_009795999.1|  PREDICTED: 60S ribosomal protein L13a-4-like       315   4e-106   Nicotiana sylvestris
gb|EYU32659.1|  hypothetical protein MIMGU_mgv1a013922mg                315   4e-106   Erythranthe guttata [common monkey flower]
ref|XP_006349931.1|  PREDICTED: 60S ribosomal protein L13a-4-like       314   5e-106   Solanum tuberosum [potatoes]
ref|XP_011091425.1|  PREDICTED: 60S ribosomal protein L13a-4-like       314   6e-106   Sesamum indicum [beniseed]
ref|NP_001275476.1|  60S ribosomal protein L13a-4-like                  314   6e-106   Solanum tuberosum [potatoes]
gb|AAR89618.1|  60S ribosomal protein L13a                              315   6e-106   Capsicum annuum
ref|XP_004252998.1|  PREDICTED: 60S ribosomal protein L13a-4            313   1e-105   Solanum lycopersicum
ref|XP_004239861.1|  PREDICTED: 60S ribosomal protein L13a-4-like       313   1e-105   Solanum lycopersicum
ref|XP_009596414.1|  PREDICTED: 60S ribosomal protein L13a-4            313   1e-105   Nicotiana tomentosiformis
ref|XP_009112682.1|  PREDICTED: 60S ribosomal protein L13a-2-like       313   2e-105   Brassica rapa
ref|XP_002268901.1|  PREDICTED: 60S ribosomal protein L13a-4            312   3e-105   Vitis vinifera
ref|XP_007223449.1|  hypothetical protein PRUPE_ppa011551mg             312   3e-105   Prunus persica
ref|XP_002267491.1|  PREDICTED: 60S ribosomal protein L13a-4            312   5e-105   Vitis vinifera
ref|XP_010920859.1|  PREDICTED: 60S ribosomal protein L13a-4-like       312   5e-105   Elaeis guineensis
ref|XP_008793237.1|  PREDICTED: 60S ribosomal protein L13a-4            312   5e-105   Phoenix dactylifera
ref|XP_009102457.1|  PREDICTED: 60S ribosomal protein L13a-2-like       311   5e-105   Brassica rapa
emb|CDY52083.1|  BnaCnng21840D                                          311   6e-105   Brassica napus [oilseed rape]
emb|CDP03876.1|  unnamed protein product                                311   6e-105   Coffea canephora [robusta coffee]
ref|XP_004288082.1|  PREDICTED: 60S ribosomal protein L13a-4            311   6e-105   Fragaria vesca subsp. vesca
ref|XP_010937848.1|  PREDICTED: 60S ribosomal protein L13a-4            311   6e-105   Elaeis guineensis
ref|XP_010023711.1|  PREDICTED: 60S ribosomal protein L13a-4-like       311   7e-105   Eucalyptus grandis [rose gum]
ref|XP_004297119.1|  PREDICTED: 60S ribosomal protein L13a-4-like       311   7e-105   Fragaria vesca subsp. vesca
ref|XP_004154636.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    313   7e-105   
ref|XP_009136093.1|  PREDICTED: 60S ribosomal protein L13a-2            311   7e-105   Brassica rapa
ref|XP_009765513.1|  PREDICTED: 60S ribosomal protein L13a-4            311   8e-105   Nicotiana sylvestris
gb|EPS58218.1|  hypothetical protein M569_16597                         311   9e-105   Genlisea aurea
ref|XP_010552053.1|  PREDICTED: 60S ribosomal protein L13a-2-like       311   9e-105   Tarenaya hassleriana [spider flower]
ref|XP_010524687.1|  PREDICTED: 60S ribosomal protein L13a-1            311   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_004247847.1|  PREDICTED: 60S ribosomal protein L13a-4            311   1e-104   Solanum lycopersicum
ref|XP_010532891.1|  PREDICTED: 60S ribosomal protein L13a-2-like       311   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_009111853.1|  PREDICTED: 60S ribosomal protein L13a-4            310   2e-104   Brassica rapa
emb|CDY33947.1|  BnaA02g30400D                                          310   2e-104   Brassica napus [oilseed rape]
gb|AHE13806.1|  ribosomal protein L13a                                  310   2e-104   Solanum torvum [berenjena cimarrona]
ref|XP_006418685.1|  hypothetical protein EUTSA_v10002667mg             310   2e-104   Eutrema salsugineum [saltwater cress]
ref|XP_009129745.1|  PREDICTED: 60S ribosomal protein L13a-4-like       310   2e-104   Brassica rapa
ref|XP_010527234.1|  PREDICTED: 60S ribosomal protein L13a-2-like       310   2e-104   Tarenaya hassleriana [spider flower]
gb|ACJ02350.1|  60S ribosomal protein L13A                              310   2e-104   Vernicia fordii [tung oil tree]
ref|XP_004133995.1|  PREDICTED: 60S ribosomal protein L13a-2-like       310   3e-104   Cucumis sativus [cucumbers]
ref|XP_002518107.1|  60S ribosomal protein L13a, putative               310   3e-104   Ricinus communis
ref|XP_010937601.1|  PREDICTED: 60S ribosomal protein L13a-2-like       310   3e-104   Elaeis guineensis
ref|XP_004138959.1|  PREDICTED: 60S ribosomal protein L13a-4-like       310   3e-104   
ref|XP_010547080.1|  PREDICTED: 60S ribosomal protein L13a-1            310   4e-104   Tarenaya hassleriana [spider flower]
ref|XP_004154637.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    310   4e-104   
ref|XP_010439646.1|  PREDICTED: 60S ribosomal protein L13a-4            309   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006840139.1|  hypothetical protein AMTR_s00089p00040540          309   4e-104   Amborella trichopoda
gb|AIC33046.1|  60S ribosomal protein L13a                              307   6e-104   Panax ginseng [Asiatic ginseng]
ref|XP_006298559.1|  hypothetical protein CARUB_v10014643mg             309   6e-104   Capsella rubella
gb|KFK39804.1|  hypothetical protein AALP_AA3G290300                    309   6e-104   Arabis alpina [alpine rockcress]
ref|XP_006281111.1|  hypothetical protein CARUB_v10027141mg             309   6e-104   Capsella rubella
ref|XP_010923627.1|  PREDICTED: 60S ribosomal protein L13a-2-like       310   7e-104   Elaeis guineensis
ref|NP_189127.1|  60S ribosomal protein L13a-2                          309   7e-104   Arabidopsis thaliana [mouse-ear cress]
gb|KHG26825.1|  60S ribosomal L13a-4 -like protein                      309   8e-104   Gossypium arboreum [tree cotton]
ref|XP_007223448.1|  hypothetical protein PRUPE_ppa011551mg             308   9e-104   
gb|ADR71263.1|  60S ribosomal protein L13aA                             308   9e-104   Hevea brasiliensis [jebe]
ref|XP_008789105.1|  PREDICTED: 60S ribosomal protein L13a-4-like       308   9e-104   Phoenix dactylifera
ref|XP_011045655.1|  PREDICTED: 60S ribosomal protein L13a-2            308   9e-104   Populus euphratica
ref|XP_010466918.1|  PREDICTED: 60S ribosomal protein L13a-2-like       308   1e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010488596.1|  PREDICTED: 60S ribosomal protein L13a-2            308   1e-103   Camelina sativa [gold-of-pleasure]
gb|AAL87341.1|  putative 60S ribosomal protein                          308   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395114.1|  hypothetical protein EUTSA_v10004924mg             308   1e-103   Eutrema salsugineum [saltwater cress]
ref|XP_010440660.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    308   1e-103   Camelina sativa [gold-of-pleasure]
ref|NP_199687.1|  60S ribosomal protein L13a-4                          308   1e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KHG08426.1|  60S ribosomal L13a-4 -like protein                      308   1e-103   Gossypium arboreum [tree cotton]
ref|XP_009374600.1|  PREDICTED: 60S ribosomal protein L13a-4            308   1e-103   Pyrus x bretschneideri [bai li]
gb|KDP39375.1|  hypothetical protein JCGZ_01132                         308   1e-103   Jatropha curcas
ref|XP_006407868.1|  hypothetical protein EUTSA_v10021532mg             308   1e-103   Eutrema salsugineum [saltwater cress]
gb|KHG07795.1|  60S ribosomal L13a-4 -like protein                      308   1e-103   Gossypium arboreum [tree cotton]
gb|KJB72096.1|  hypothetical protein B456_011G159000                    308   1e-103   Gossypium raimondii
ref|XP_009151676.1|  PREDICTED: 60S ribosomal protein L13a-4            308   1e-103   Brassica rapa
ref|XP_008786013.1|  PREDICTED: 60S ribosomal protein L13a-4-like       308   2e-103   Phoenix dactylifera
ref|XP_010277234.1|  PREDICTED: 60S ribosomal protein L13a-4            308   2e-103   Nelumbo nucifera [Indian lotus]
ref|XP_002883564.1|  60S ribosomal protein L13A                         308   2e-103   Arabidopsis lyrata subsp. lyrata
ref|XP_006369799.1|  60S ribosomal protein L13a-2                       308   2e-103   Populus trichocarpa [western balsam poplar]
ref|XP_008348430.1|  PREDICTED: 60S ribosomal protein L13a-4            308   2e-103   Malus domestica [apple tree]
ref|XP_002865669.1|  60S ribosomal protein L13A                         308   2e-103   
ref|XP_007034382.1|  Ribosomal protein L13 family protein isoform 1     308   2e-103   
ref|XP_010482144.1|  PREDICTED: 60S ribosomal protein L13a-4-like       308   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010069043.1|  PREDICTED: 60S ribosomal protein L13a-3            308   2e-103   Eucalyptus grandis [rose gum]
ref|XP_002323772.1|  ribosomal protein L13a                             307   2e-103   Populus trichocarpa [western balsam poplar]
ref|XP_010069656.1|  PREDICTED: 60S ribosomal protein L13a-2            307   3e-103   Eucalyptus grandis [rose gum]
ref|XP_010513787.1|  PREDICTED: 60S ribosomal protein L13a-2-like       307   3e-103   Camelina sativa [gold-of-pleasure]
ref|XP_009421391.1|  PREDICTED: 60S ribosomal protein L13a-4            307   3e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002521095.1|  60S ribosomal protein L13a, putative               307   3e-103   Ricinus communis
ref|XP_006855707.1|  hypothetical protein AMTR_s00044p00144180          306   4e-103   Amborella trichopoda
ref|XP_008805147.1|  PREDICTED: 60S ribosomal protein L13a-2-like       307   4e-103   Phoenix dactylifera
ref|XP_008356990.1|  PREDICTED: 60S ribosomal protein L13a-4            307   4e-103   Malus domestica [apple tree]
gb|AFK44939.1|  unknown                                                 307   4e-103   Lotus japonicus
ref|XP_002863167.1|  predicted protein                                  306   5e-103   Arabidopsis lyrata subsp. lyrata
ref|XP_002882511.1|  structural constituent of ribosome                 306   5e-103   
gb|KJB30129.1|  hypothetical protein B456_005G130900                    306   6e-103   Gossypium raimondii
gb|KFK39801.1|  hypothetical protein AALP_AA3G289800                    306   6e-103   Arabis alpina [alpine rockcress]
gb|KFK38165.1|  hypothetical protein AALP_AA3G077500                    306   6e-103   Arabis alpina [alpine rockcress]
ref|XP_009392721.1|  PREDICTED: 60S ribosomal protein L13a-4-like       306   7e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB72097.1|  hypothetical protein B456_011G159000                    305   7e-103   Gossypium raimondii
ref|XP_006284504.1|  hypothetical protein CARUB_v10005705mg             306   8e-103   
ref|XP_009404653.1|  PREDICTED: 60S ribosomal protein L13a-4-like       306   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006298567.1|  hypothetical protein CARUB_v10014649mg             306   1e-102   Capsella rubella
ref|XP_010279449.1|  PREDICTED: 60S ribosomal protein L13a-4-like       306   1e-102   Nelumbo nucifera [Indian lotus]
ref|XP_009403869.1|  PREDICTED: 60S ribosomal protein L13a-4-like       306   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010245584.1|  PREDICTED: 60S ribosomal protein L13a-4-like       305   1e-102   Nelumbo nucifera [Indian lotus]
ref|XP_010110069.1|  60S ribosomal protein L13a-3                       305   2e-102   Morus notabilis
ref|XP_010464292.1|  PREDICTED: 60S ribosomal protein L13a-1-like       305   2e-102   Camelina sativa [gold-of-pleasure]
ref|NP_193053.1|  60S ribosomal protein L13a-3                          305   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448678.1|  PREDICTED: 60S ribosomal protein L13a-1            305   2e-102   Camelina sativa [gold-of-pleasure]
gb|KDO61166.1|  hypothetical protein CISIN_1g028623mg                   305   4e-102   Citrus sinensis [apfelsine]
gb|KCW57253.1|  hypothetical protein EUGRSUZ_H00057                     303   4e-102   Eucalyptus grandis [rose gum]
ref|XP_006420899.1|  hypothetical protein CICLE_v10005900mg             305   4e-102   Citrus clementina [clementine]
ref|XP_009405822.1|  PREDICTED: 60S ribosomal protein L13a-4-like       304   5e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011041875.1|  PREDICTED: 60S ribosomal protein L13a-1-like       304   7e-102   Populus euphratica
ref|NP_187367.1|  60S ribosomal protein L13a-1                          304   7e-102   Arabidopsis thaliana [mouse-ear cress]
gb|KCW58067.1|  hypothetical protein EUGRSUZ_H00799                     303   7e-102   Eucalyptus grandis [rose gum]
ref|NP_001030654.1|  60S ribosomal protein L13a-1                       304   7e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004499225.1|  PREDICTED: 60S ribosomal protein L13a-4-like       304   8e-102   Cicer arietinum [garbanzo]
gb|KHG16481.1|  60S ribosomal L13a-4 -like protein                      303   1e-101   Gossypium arboreum [tree cotton]
gb|KJB10146.1|  hypothetical protein B456_001G186700                    302   3e-101   Gossypium raimondii
ref|XP_003559332.1|  PREDICTED: 60S ribosomal protein L13a-4            302   3e-101   Brachypodium distachyon [annual false brome]
ref|XP_006650608.1|  PREDICTED: 60S ribosomal protein L13a-4-like       302   4e-101   Oryza brachyantha
ref|XP_007049776.1|  Ribosomal protein L13 family protein               301   5e-101   Theobroma cacao [chocolate]
gb|KDP26388.1|  hypothetical protein JCGZ_17546                         301   6e-101   Jatropha curcas
ref|XP_006479280.1|  PREDICTED: 60S ribosomal protein L13a-4-like       301   7e-101   Citrus sinensis [apfelsine]
ref|NP_001235102.1|  uncharacterized protein LOC100499978               301   8e-101   Glycine max [soybeans]
ref|XP_007140600.1|  hypothetical protein PHAVU_008G125900g             301   1e-100   Phaseolus vulgaris [French bean]
gb|KJB22645.1|  hypothetical protein B456_004G058600                    300   1e-100   Gossypium raimondii
gb|KJB42469.1|  hypothetical protein B456_007G154600                    300   1e-100   Gossypium raimondii
gb|KHG00254.1|  60S ribosomal L13a-4 -like protein                      300   2e-100   Gossypium arboreum [tree cotton]
gb|KHF97469.1|  60S ribosomal L13a-4 -like protein                      300   2e-100   Gossypium arboreum [tree cotton]
ref|NP_001130808.1|  uncharacterized protein LOC100191912               299   6e-100   Zea mays [maize]
ref|NP_001276138.1|  60S ribosomal protein L13a-4-like                  299   6e-100   
gb|ACF79169.1|  unknown                                                 299   6e-100   Zea mays [maize]
ref|XP_003616742.1|  60S ribosomal protein L13A                         299   7e-100   Medicago truncatula
ref|XP_006586250.1|  PREDICTED: 60S ribosomal protein L13a-4-like       299   7e-100   Glycine max [soybeans]
gb|KDO65929.1|  hypothetical protein CISIN_1g028649mg                   298   8e-100   Citrus sinensis [apfelsine]
ref|XP_011024678.1|  PREDICTED: 60S ribosomal protein L13a-4-like       298   8e-100   Populus euphratica
ref|NP_001281205.1|  60S ribosomal protein L13a                         298   9e-100   Zea mays [maize]
gb|KHN07182.1|  60S ribosomal protein L13a-1                            298   1e-99    Glycine soja [wild soybean]
ref|NP_001051314.1|  Os03g0756000                                       298   1e-99    
ref|NP_001236202.1|  uncharacterized protein LOC100527190               298   1e-99    Glycine max [soybeans]
ref|XP_002466431.1|  hypothetical protein SORBIDRAFT_01g007690          298   1e-99    Sorghum bicolor [broomcorn]
ref|XP_010435310.1|  PREDICTED: 60S ribosomal protein L13a-3-like       298   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_004981725.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    297   2e-99    Setaria italica
ref|XP_007147486.1|  hypothetical protein PHAVU_006G128500g             297   3e-99    Phaseolus vulgaris [French bean]
gb|AFK34830.1|  unknown                                                 297   4e-99    Medicago truncatula
ref|XP_003546257.1|  PREDICTED: 60S ribosomal protein L13a-4-like       296   6e-99    Glycine max [soybeans]
gb|ACG36118.1|  60S ribosomal protein L13a                              296   7e-99    Zea mays [maize]
ref|XP_002301785.2|  ribosomal protein L13a                             296   7e-99    
pdb|3J61|O  Chain O, Localization Of The Large Subunit Ribosomal ...    295   1e-98    Triticum aestivum [Canadian hard winter wheat]
gb|ACG33474.1|  60S ribosomal protein L13a                              295   2e-98    Zea mays [maize]
gb|ACN36734.1|  unknown                                                 294   2e-98    Zea mays [maize]
ref|XP_002439183.1|  hypothetical protein SORBIDRAFT_09g001930          295   3e-98    Sorghum bicolor [broomcorn]
sp|O65055.1|RL13A_PICMA  RecName: Full=60S ribosomal protein L13a       294   6e-98    Picea mariana [black spruce]
gb|ACG37566.1|  60S ribosomal protein L13a                              294   7e-98    Zea mays [maize]
ref|XP_006443602.1|  hypothetical protein CICLE_v10023466mg             300   8e-98    
ref|XP_003589380.1|  60S ribosomal protein L13a                         293   1e-97    Medicago truncatula
gb|ACJ83838.1|  unknown                                                 293   2e-97    Medicago truncatula
ref|XP_010685006.1|  PREDICTED: 60S ribosomal protein L13a-2            292   3e-97    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN31417.1|  60S ribosomal protein L13a-4                            291   4e-97    Glycine soja [wild soybean]
dbj|BAK07924.1|  predicted protein                                      293   8e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG48503.1|  60S ribosomal protein L13a                              291   9e-97    Zea mays [maize]
ref|XP_001774253.1|  predicted protein                                  291   9e-97    
ref|XP_007200528.1|  hypothetical protein PRUPE_ppa011553mg             290   1e-96    Prunus persica
ref|XP_001763759.1|  predicted protein                                  290   2e-96    
ref|XP_010228462.1|  PREDICTED: 60S ribosomal protein L13a-4-like       289   3e-96    Brachypodium distachyon [annual false brome]
gb|ABQ57364.1|  ribosomal protein L13A                                  289   4e-96    Lupinus luteus
ref|XP_001765352.1|  predicted protein                                  288   7e-96    
ref|XP_001765905.1|  predicted protein                                  288   9e-96    
gb|KCW58066.1|  hypothetical protein EUGRSUZ_H00799                     288   3e-95    Eucalyptus grandis [rose gum]
ref|NP_001058724.1|  Os07g0109500                                       286   4e-95    
ref|XP_001773626.1|  predicted protein                                  286   4e-95    
gb|EMT05694.1|  60S ribosomal protein L13a-4                            286   1e-94    
ref|XP_008235481.1|  PREDICTED: 60S ribosomal protein L13a-1-like       285   1e-94    Prunus mume [ume]
gb|EMS52180.1|  60S ribosomal protein L13a-4                            285   2e-94    Triticum urartu
ref|XP_008365936.1|  PREDICTED: 60S ribosomal protein L13a-1            284   4e-94    
ref|XP_009334926.1|  PREDICTED: 60S ribosomal protein L13a-1-like       283   1e-93    Pyrus x bretschneideri [bai li]
gb|EAZ38446.1|  hypothetical protein OsJ_22825                          283   1e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008382629.1|  PREDICTED: 60S ribosomal protein L13a-1            280   4e-93    
sp|O49885.1|RL13A_LUPLU  RecName: Full=60S ribosomal protein L13a       281   4e-93    Lupinus luteus
gb|ABK22228.1|  unknown                                                 281   9e-93    Picea sitchensis
ref|XP_002964465.1|  hypothetical protein SELMODRAFT_166650             278   1e-91    Selaginella moellendorffii
ref|XP_004981724.1|  PREDICTED: 60S ribosomal protein L13a-4-like...    277   6e-91    
ref|XP_006657401.1|  PREDICTED: 60S ribosomal protein L13a-3-like       276   6e-91    Oryza brachyantha
gb|KGN66498.1|  hypothetical protein Csa_1G615170                       265   1e-86    Cucumis sativus [cucumbers]
gb|KDO65930.1|  hypothetical protein CISIN_1g028649mg                   245   8e-80    Citrus sinensis [apfelsine]
ref|XP_004955326.1|  PREDICTED: 60S ribosomal protein L13a-3-like       246   3e-79    Setaria italica
ref|XP_005643971.1|  ribosomal protein L13a component of cytosoli...    240   3e-77    Coccomyxa subellipsoidea C-169
ref|XP_002953387.1|  component of cytosolic 80S ribosome and 60S ...    233   3e-74    Volvox carteri f. nagariensis
ref|XP_001692909.1|  ribosomal protein L13a, component of cytosol...    233   3e-74    Chlamydomonas reinhardtii
ref|XP_010661466.1|  PREDICTED: 60S ribosomal protein L13a-2-like       233   1e-73    Vitis vinifera
ref|XP_005849945.1|  hypothetical protein CHLNCDRAFT_17540              229   5e-73    Chlorella variabilis
sp|P93099.1|RL13A_CYAPA  RecName: Full=60S ribosomal protein L13a       228   2e-72    Cyanophora paradoxa
ref|NP_001051312.2|  Os03g0755700                                       226   1e-71    
gb|AAR01666.1|  putative ribosomal protein L13a                         223   2e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001630812.1|  predicted protein                                  223   3e-70    Nematostella vectensis
gb|AAX92709.1|  60S ribosomal protein L13a                              219   3e-69    Picea abies
emb|CDS32619.1|  ribosomal protein rpl13a                               220   5e-69    Hymenolepis microstoma
gb|EUB62915.1|  60S ribosomal protein L13a                              218   3e-68    Echinococcus granulosus
ref|XP_002507247.1|  predicted protein                                  216   2e-67    Micromonas commoda
ref|XP_003054822.1|  predicted protein                                  216   2e-67    Micromonas pusilla CCMP1545
ref|XP_005833834.1|  large subunit ribosomal protein L13Ae_2, cyt...    212   3e-66    Guillardia theta CCMP2712
ref|XP_009035047.1|  hypothetical protein AURANDRAFT_58864              212   5e-66    Aureococcus anophagefferens
gb|EPZ33870.1|  60S ribosomal protein L13a                              212   8e-66    Rozella allomycis CSF55
gb|EWM30220.1|  60s ribosomal protein l13a                              212   8e-66    Nannochloropsis gaditana
ref|NP_001187674.1|  60S ribosomal protein l13a                         211   1e-65    Ictalurus punctatus
ref|XP_006292546.1|  hypothetical protein CARUB_v10018781mg             208   1e-65    
ref|XP_002436282.1|  ribosomal protein L13A, putative                   210   4e-65    Ixodes scapularis [blacklegged tick]
ref|XP_004349662.1|  ribosomal protein L13, putative                    210   4e-65    Acanthamoeba castellanii str. Neff
gb|ABW23219.1|  ribosomal protein rpl13a                                210   5e-65    Eurythoe complanata
ref|XP_011112396.1|  hypothetical protein H072_6613                     209   6e-65    
ref|XP_004226142.1|  PREDICTED: 60S ribosomal protein L13a-like         209   7e-65    Ciona intestinalis [sea vase]
emb|CCI10404.1|  unnamed protein product                                209   2e-64    Albugo candida
ref|XP_003384047.1|  PREDICTED: 60S ribosomal protein L13a-like         208   2e-64    Amphimedon queenslandica
ref|XP_002112893.1|  expressed hypothetical protein                     208   2e-64    Trichoplax adhaerens
ref|XP_009848042.1|  hypothetical protein NEUTE1DRAFT_115903            208   3e-64    Neurospora tetrasperma FGSC 2508
ref|XP_011394487.1|  60S ribosomal protein L16, variant                 208   3e-64    Neurospora crassa OR74A
ref|XP_011125712.1|  hypothetical protein AOL_s00169g53                 207   3e-64    Arthrobotrys oligospora ATCC 24927
ref|XP_003348078.1|  60S ribosomal protein L16                          208   3e-64    Sordaria macrospora k-hell
ref|XP_008861430.1|  ribosomal protein L13                              207   3e-64    Aphanomyces invadans
gb|KFM61542.1|  60S ribosomal protein L13a                              208   3e-64    Stegodyphus mimosarum
gb|AAX48846.1|  L13a                                                    207   4e-64    Suberites domuncula
ref|XP_011394488.1|  60S ribosomal protein L16                          209   4e-64    Neurospora crassa OR74A
emb|CCQ18645.1|  60S ribosomal protein L13a                             207   4e-64    Sycon ciliatum
ref|XP_008602497.1|  60S ribosomal protein L16                          207   4e-64    Beauveria bassiana ARSEF 2860
gb|EHK49489.1|  hypothetical protein TRIATDRAFT_297491                  207   5e-64    Trichoderma atroviride IMI 206040
gb|ESA01198.1|  hypothetical protein GLOINDRAFT_334214                  207   5e-64    
ref|XP_009822374.1|  ribosomal protein L13                              207   5e-64    Aphanomyces astaci
gb|EQL04215.1|  Ribosomal protein L13, eukaryotic/archaeal              207   5e-64    Ophiocordyceps sinensis CO18
gb|AFX72999.1|  60S ribosomal protein L13a                              207   5e-64    Spirometra erinaceieuropaei
ref|XP_007279305.1|  60s ribosomal protein l16                          207   6e-64    
gb|ABX75375.1|  60S ribosomal protein L13A                              207   6e-64    Lycosa singoriensis
ref|XP_004990512.1|  ribosomal protein L13Ae                            207   7e-64    Salpingoeca rosetta
ref|XP_003038672.1|  60S ribosomal protein L16                          207   8e-64    Schizophyllum commune H4-8
gb|EIE90993.1|  60S ribosomal protein L16                               207   9e-64    Rhizopus delemar RA 99-880
gb|ERT00595.1|  60S ribosomal protein L16                               206   9e-64    Sporothrix schenckii ATCC 58251
gb|EIE79164.1|  60S ribosomal protein L16                               206   9e-64    Rhizopus delemar RA 99-880
ref|XP_007873114.1|  hypothetical protein PNEG_01198                    206   1e-63    Pneumocystis murina B123
gb|AAW27674.1|  SJCHGC04249 protein                                     206   1e-63    Schistosoma japonicum
gb|KEZ46607.1|  hypothetical protein SAPIO_CDS0424                      206   1e-63    Scedosporium apiospermum
gb|EHK19473.1|  hypothetical protein TRIVIDRAFT_111666                  206   1e-63    Trichoderma virens Gv29-8
gb|EPE08609.1|  60s ribosomal protein l16                               207   1e-63    Ophiostoma piceae UAMH 11346
gb|EIE78513.1|  60S ribosomal protein L16                               206   1e-63    Rhizopus delemar RA 99-880
emb|CEG67074.1|  Putative 60S ribosomal protein L16                     206   1e-63    Rhizopus microsporus
ref|XP_001911222.1|  hypothetical protein                               206   1e-63    Podospora anserina S mat+
emb|CCD82603.1|  putative 60s ribosomal protein L13a                    206   2e-63    Schistosoma mansoni
emb|CEG78600.1|  Putative 60S ribosomal protein L16                     206   2e-63    Rhizopus microsporus
ref|XP_002590758.1|  hypothetical protein BRAFLDRAFT_280074             206   2e-63    Branchiostoma floridae
emb|CCE29838.1|  probable ribosomal protein l13a                        206   2e-63    Claviceps purpurea 20.1
ref|XP_002480444.1|  60S ribosomal protein L16                          205   3e-63    Talaromyces stipitatus ATCC 10500
ref|XP_007836334.1|  60S ribosomal protein L16                          205   3e-63    Pestalotiopsis fici W106-1
gb|KFH71578.1|  60S ribosomal protein L16-B                             205   3e-63    Mortierella verticillata NRRL 6337
ref|XP_002144062.1|  60S ribosomal protein L16                          205   3e-63    Talaromyces marneffei ATCC 18224
ref|XP_001555732.1|  60S ribosomal protein L16                          205   3e-63    Botrytis cinerea B05.10
gb|ESZ92305.1|  60S ribosomal protein L16                               205   3e-63    Sclerotinia borealis F-4128
emb|CEG62724.1|  Putative 60S ribosomal protein L16                     205   3e-63    Rhizopus microsporus
gb|AHA44488.1|  60S ribosomal-like protein                              205   4e-63    Pectinaria gouldii
ref|XP_001225089.1|  60S ribosomal protein L16                          205   4e-63    Chaetomium globosum CBS 148.51
emb|CCF47368.1|  60S ribosomal protein L16                              205   4e-63    Colletotrichum higginsianum
ref|NP_001016486.1|  ribosomal protein L13a                             206   4e-63    Xenopus tropicalis [western clawed frog]
gb|KGG52418.1|  60S ribosomal protein L16                               205   5e-63    Mitosporidium daphniae
ref|XP_008615115.1|  50S ribosomal protein L13                          205   5e-63    Saprolegnia diclina VS20
ref|XP_002741044.1|  PREDICTED: 60S ribosomal protein L13a-like i...    204   5e-63    Saccoglossus kowalevskii
gb|KDO33301.1|  50S ribosomal protein L13                               204   6e-63    Saprolegnia parasitica CBS 223.65
gb|EFX00180.1|  60S ribosomal protein l16                               204   6e-63    Grosmannia clavigera kw1407
ref|XP_004540518.1|  PREDICTED: 60S ribosomal protein L13a-like         204   6e-63    Maylandia zebra
ref|XP_007372042.1|  60S large subunit ribosomal protein                204   6e-63    Spathaspora passalidarum NRRL Y-27907
ref|XP_003453268.1|  PREDICTED: 60S ribosomal protein L13a-like         204   6e-63    Oreochromis niloticus
gb|ACO14619.1|  60S ribosomal protein L13A                              204   7e-63    Caligus clemensi
ref|XP_003649454.1|  60S ribosomal protein L16                          204   7e-63    Thielavia terrestris NRRL 8126
ref|XP_007916510.1|  putative 60s ribosomal protein l16 protein         204   7e-63    Phaeoacremonium minimum UCRPA7
ref|XP_003661900.1|  hypothetical protein MYCTH_2314728                 204   8e-63    Thermothelomyces thermophila ATCC 42464
ref|XP_006969355.1|  ribosomal protein L16, L13 family                  204   8e-63    Trichoderma reesei QM6a
ref|NP_001080130.1|  ribosomal protein L13a                             205   8e-63    Xenopus laevis [clawed frog]
emb|CEJ03799.1|  Putative 60S ribosomal protein L16                     204   9e-63    Rhizopus microsporus
ref|XP_006824379.1|  PREDICTED: 60S ribosomal protein L13a-like i...    204   9e-63    Saccoglossus kowalevskii
emb|CEJ00501.1|  Putative 60S ribosomal protein L16                     204   1e-62    Rhizopus microsporus
ref|XP_007594433.1|  ribosomal protein L13                              204   1e-62    
ref|XP_009222620.1|  60S ribosomal protein L16                          204   1e-62    
ref|XP_001507007.1|  PREDICTED: 60S ribosomal protein L13a              204   1e-62    
gb|ACO11694.1|  60S ribosomal protein L13A                              204   2e-62    
gb|ABY28364.1|  ribosomal protein L13A                                  203   2e-62    
gb|KID91699.1|  60S ribosomal protein L16                               203   2e-62    
gb|ETE70282.1|  60S ribosomal protein L13a                              203   2e-62    
ref|XP_006697168.1|  60S ribosomal protein L16-like protein             203   2e-62    
ref|XP_004011713.1|  PREDICTED: 60S ribosomal protein L13a-like         203   2e-62    
ref|XP_007820698.1|  hypothetical protein MAA_04996                     203   2e-62    
gb|ACN10380.1|  60S ribosomal protein L13a                              203   2e-62    
gb|KDN60858.1|  putative ribosomal protein L13                          202   2e-62    
ref|XP_002908436.1|  60S ribosomal protein L13, putative                203   2e-62    
ref|XP_007431701.1|  PREDICTED: 60S ribosomal protein L13a-like         203   2e-62    
gb|KGB33955.1|  60S ribosomal protein L13a                              203   2e-62    
gb|AFM88003.1|  60S ribosomal protein L13a                              203   2e-62    
gb|AAX81225.1|  ribosomal protein L13                                   203   2e-62    
ref|XP_001609803.1|  ribosomal protein L13                              203   2e-62    
gb|EFQ25839.1|  ribosomal protein L13                                   203   2e-62    
ref|XP_008890825.1|  ribosomal protein L13                              203   2e-62    
emb|CBJ25662.1|  60S ribosomal protein L13a                             202   3e-62    
gb|ACH85339.1|  ribosomal protein L13a                                  203   3e-62    
ref|XP_004694340.1|  PREDICTED: 60S ribosomal protein L13a isofor...    203   3e-62    
gb|ACH85355.1|  ribosomal protein L13a                                  203   3e-62    
gb|ACI67868.1|  60S ribosomal protein L13a                              203   3e-62    
ref|XP_003962761.1|  PREDICTED: 60S ribosomal protein L13a-like         204   3e-62    
ref|XP_007811898.1|  60S ribosomal protein L16                          203   3e-62    
ref|XP_003226237.1|  PREDICTED: 60S ribosomal protein L13a              202   3e-62    
ref|XP_002162037.1|  PREDICTED: 60S ribosomal protein L13a-like         202   3e-62    
ref|XP_008398128.1|  PREDICTED: 60S ribosomal protein L13a              203   3e-62    
ref|XP_007574193.1|  PREDICTED: 60S ribosomal protein L13a              202   3e-62    
gb|KID75750.1|  Ribosomal protein L13, eukaryotic/archaeal              202   3e-62    
ref|XP_002472416.1|  60S ribosomal protein L13a                         202   3e-62    
ref|XP_010733236.1|  PREDICTED: 60S ribosomal protein L13a              203   3e-62    
gb|ESW95899.1|  60S ribosomal protein L16-B                             202   3e-62    
gb|KIW01173.1|  60S ribosomal protein L16                               202   4e-62    
gb|KEY64902.1|  hypothetical protein S7711_03894                        202   4e-62    
ref|XP_008843288.1|  PREDICTED: 60S ribosomal protein L13a              202   4e-62    
gb|ADC97464.1|  putative 60S ribosomal protein L13a                     202   4e-62    
gb|KGQ02845.1|  60S ribosomal protein L16                               206   4e-62    
ref|XP_002558631.1|  Pc13g01870                                         202   4e-62    
gb|EMS25385.1|  60S ribosomal protein l16                               202   4e-62    
gb|AGH70161.1|  60S ribosomal protein L13a                              202   4e-62    
ref|XP_001749344.1|  hypothetical protein                               202   4e-62    
emb|CDQ71669.1|  unnamed protein product                                202   4e-62    
ref|XP_003000559.1|  60S ribosomal protein L16                          202   4e-62    
ref|XP_004597042.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   4e-62    
ref|XP_004830849.1|  60S ribosomal protein L13, putative                202   4e-62    
ref|XP_004672300.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   4e-62    
ref|XP_005801332.1|  PREDICTED: 60S ribosomal protein L13a-like         202   4e-62    
ref|XP_007289379.1|  60S ribosomal protein L13                          202   4e-62    
ref|XP_006631346.1|  PREDICTED: 60S ribosomal protein L13a-like         202   4e-62    
ref|XP_001591799.1|  60S ribosomal protein L16                          202   5e-62    
ref|XP_008152577.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   5e-62    
ref|NP_001230997.1|  ribosomal protein L13a isoform 1                   202   5e-62    
ref|XP_005412929.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   5e-62    
ref|XP_009174552.1|  hypothetical protein T265_10037                    205   5e-62    
gb|ACH48187.1|  60S ribosomal protein L13a                              202   5e-62    
ref|XP_011287982.1|  PREDICTED: 60S ribosomal protein L13a              202   5e-62    
emb|CAH57701.1|  60S ribosomal protein L13A                             202   5e-62    
gb|ELR49590.1|  60S ribosomal protein L13a                              202   5e-62    
ref|NP_001070466.1|  60S ribosomal protein L13a                         202   5e-62    
ref|XP_004472671.1|  PREDICTED: 60S ribosomal protein L13a isoform 2    202   5e-62    
gb|KHJ35006.1|  putative 60s ribosomal protein l16                      202   5e-62    
ref|XP_004409938.1|  PREDICTED: 60S ribosomal protein L13a              202   6e-62    
ref|XP_010877924.1|  PREDICTED: 60S ribosomal protein L13a              202   6e-62    
gb|KID97163.1|  60S ribosomal protein L16                               202   6e-62    
ref|XP_005336733.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   6e-62    
ref|XP_005879589.1|  PREDICTED: 60S ribosomal protein L13a              202   6e-62    
ref|XP_002762391.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   6e-62    
sp|Q4R8Z2.3|RL13A_MACFA  RecName: Full=60S ribosomal protein L13a       202   6e-62    
ref|XP_006905092.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   6e-62    
emb|CAK04157.1|  ribosomal protein L13a                                 202   6e-62    
ref|XP_005336734.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   6e-62    
ref|NP_001182348.1|  ribosomal protein L13a                             202   6e-62    
ref|XP_006014996.1|  PREDICTED: 60S ribosomal protein L13a-like         202   6e-62    
ref|NP_036555.1|  60S ribosomal protein L13a isoform 1                  202   6e-62    
ref|XP_008078073.1|  Ribosomal protein L13                              202   6e-62    
gb|EHB05652.1|  60S ribosomal protein L13a                              202   6e-62    
emb|CDM33337.1|  60S ribosomal protein L16                              202   6e-62    
gb|AFM86006.1|  60S ribosomal protein L13a                              202   7e-62    
ref|XP_006173860.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   7e-62    
gb|ABW90393.1|  putative ribosomal protein L13a                         202   7e-62    
gb|AFM90670.1|  60S ribosomal protein L13a                              202   7e-62    
ref|XP_005986102.1|  PREDICTED: 60S ribosomal protein L13a-like         202   7e-62    
ref|XP_005088148.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   7e-62    
ref|XP_004646507.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   7e-62    
gb|AAH04900.2|  RPL13A protein                                          202   7e-62    
ref|XP_007892973.1|  PREDICTED: 60S ribosomal protein L13a              202   7e-62    
gb|AGL33439.1|  60S ribosomal protein L13a                              202   7e-62    
ref|XP_008067417.1|  PREDICTED: 60S ribosomal protein L13a              202   7e-62    
ref|XP_006905093.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   7e-62    
ref|NP_001230998.1|  ribosomal protein L13a isoform 2                   202   7e-62    
ref|XP_004381707.1|  PREDICTED: 60S ribosomal protein L13a              202   7e-62    
ref|XP_004271087.1|  PREDICTED: 60S ribosomal protein L13a              202   7e-62    
ref|XP_001491926.1|  PREDICTED: 60S ribosomal protein L13a              202   7e-62    
gb|KHN97292.1|  60S ribosomal protein L16                               202   7e-62    
ref|XP_002723961.2|  PREDICTED: 60S ribosomal protein L13a              202   7e-62    
ref|XP_010584802.1|  PREDICTED: 60S ribosomal protein L13a              202   7e-62    
gb|ABX44816.1|  putative 60S ribosomal protein RPL13A                   201   8e-62    
ref|NP_001291802.1|  ribosomal protein L13a                             202   8e-62    
gb|ENH85897.1|  60s ribosomal protein l16                               202   8e-62    
ref|XP_006868260.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   8e-62    
ref|XP_004440337.1|  PREDICTED: 60S ribosomal protein L13a isoform 1    202   8e-62    
ref|NP_001125810.1|  60S ribosomal protein L13a                         202   8e-62    
ref|XP_005589974.1|  PREDICTED: 60S ribosomal protein L13a isofor...    201   8e-62    
ref|XP_007941028.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   8e-62    
ref|XP_006160205.1|  PREDICTED: 60S ribosomal protein L13a              202   8e-62    
ref|XP_004767370.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   8e-62    
ref|XP_001363221.1|  PREDICTED: 60S ribosomal protein L13a              202   8e-62    
ref|XP_004710493.1|  PREDICTED: 60S ribosomal protein L13a              202   8e-62    
gb|EHH59787.1|  hypothetical protein EGM_09978                          201   8e-62    
ref|XP_008152578.1|  PREDICTED: 60S ribosomal protein L13a isofor...    202   8e-62    
gb|ADC97465.1|  putative 60S ribosomal protein L13a                     202   8e-62    
gb|EFB23940.1|  hypothetical protein PANDA_006273                       201   8e-62    
ref|XP_007463424.1|  PREDICTED: 60S ribosomal protein L13a isofor...    201   8e-62    
ref|XP_006173859.1|  PREDICTED: 60S ribosomal protein L13a isofor...    201   8e-62    
ref|XP_005955448.1|  PREDICTED: 60S ribosomal protein L13a isofor...    201   8e-62    
gb|EKV08153.1|  Ribosomal protein L16a                                  201   8e-62    
gb|AFM87541.1|  60S ribosomal protein L13a                              202   9e-62    
ref|XP_007053692.1|  PREDICTED: 60S ribosomal protein L13a-like         202   9e-62    
gb|EYE99359.1|  ribosomal protein L13                                   201   9e-62    
gb|KIY47036.1|  60S ribosomal protein L13a                              201   9e-62    
emb|CCE40926.1|  hypothetical protein CPAR2_109630                      201   9e-62    
gb|EPT03925.1|  hypothetical protein FOMPIDRAFT_1022092                 201   9e-62    
gb|EPQ15989.1|  60S ribosomal protein L13a                              202   1e-61    
ref|XP_003868207.1|  Rpl16a protein                                     201   1e-61    
ref|XP_719047.1|  likely cytosolic ribosomal protein L16                201   1e-61    
gb|EGU79132.1|  hypothetical protein FOXB_10370                         201   1e-61    
gb|KFH42461.1|  60S ribosomal protein-like protein                      201   1e-61    
ref|XP_009156217.1|  60S ribosomal protein L16                          201   1e-61    
emb|CEF99938.1|  Ribosomal protein L13, eukaryotic/archaeal             201   1e-61    
ref|XP_007172851.1|  PREDICTED: 60S ribosomal protein L13a-like         201   1e-61    
ref|XP_010639023.1|  PREDICTED: 60S ribosomal protein L13a              201   1e-61    
gb|EPS27763.1|  hypothetical protein PDE_02707                          201   1e-61    
ref|XP_007727070.1|  60S ribosomal protein L16                          201   1e-61    
dbj|BAF98661.1|  ribosomal protein L13a                                 201   1e-61    
gb|ACN09948.1|  60S ribosomal protein L13a                              202   1e-61    
ref|XP_750349.2|  ribosomal protein L16a                                201   1e-61    
ref|XP_007298090.1|  60S ribosomal protein L13a                         201   1e-61    
ref|XP_011397206.1|  60S ribosomal protein L13a-1                       200   1e-61    
ref|XP_008031827.1|  60S ribosomal protein L13a                         201   1e-61    
emb|CEP16619.1|  hypothetical protein                                   201   1e-61    
ref|XP_003465562.1|  PREDICTED: 60S ribosomal protein L13a isofor...    201   1e-61    
gb|KHN23001.1|  60S ribosomal protein L13a-4                            199   2e-61    
gb|EDP55936.1|  ribosomal protein L16a                                  201   2e-61    
emb|CCM05160.1|  predicted protein                                      201   2e-61    
ref|XP_001265069.1|  60S ribosomal protein L16                          201   2e-61    
ref|XP_006898790.1|  PREDICTED: 60S ribosomal protein L13a              203   2e-61    
gb|ACQ57984.1|  60S ribosomal protein L13a                              201   2e-61    
ref|XP_003047678.1|  60S ribosomal protein L16                          201   2e-61    
ref|XP_007791101.1|  putative 60s ribosomal protein l16 protein         201   2e-61    
ref|XP_001816941.1|  60S ribosomal protein L16                          201   2e-61    
gb|KIW31658.1|  60S ribosomal protein L16                               201   2e-61    
ref|XP_002836976.1|  60S ribosomal protein L16                          201   2e-61    
ref|XP_007244661.1|  PREDICTED: 60S ribosomal protein L13a-like         201   2e-61    
gb|ELR10067.1|  60S ribosomal protein L16                               201   2e-61    
sp|P35427.2|RL13A_RAT  RecName: Full=60S ribosomal protein L13a         201   2e-61    
gb|EMD42236.1|  hypothetical protein CERSUDRAFT_79830                   201   2e-61    
gb|KFY17505.1|  hypothetical protein V491_04976                         201   2e-61    
gb|KFY13303.1|  hypothetical protein V492_03363                         201   2e-61    
dbj|GAN10069.1|  60S ribosomal protein L16                              201   2e-61    
gb|KFX88286.1|  hypothetical protein V490_07740                         201   2e-61    
ref|XP_003801534.1|  PREDICTED: 60S ribosomal protein L13a              201   2e-61    
gb|EPB90589.1|  60S ribosomal protein L16                               201   2e-61    
gb|KIW82386.1|  60S ribosomal protein L16                               201   2e-61    
ref|XP_007379121.1|  ribosomal protein L16a                             201   2e-61    
ref|XP_004364677.1|  ribosomal protein L16a                             200   2e-61    
ref|XP_006986315.1|  PREDICTED: 60S ribosomal protein L13a              201   2e-61    
gb|AIU94816.1|  40S ribosomal protein                                   201   2e-61    
gb|EER45034.1|  60S ribosomal protein L13a                              201   2e-61    
ref|XP_001398840.1|  60S ribosomal protein L16                          200   2e-61    
gb|KFH65594.1|  large subunit ribosomal protein L13Ae                   204   2e-61    
ref|XP_004619892.1|  PREDICTED: 60S ribosomal protein L13a isofor...    200   2e-61    
gb|ABZ04228.1|  ribosomal protein rpl13a                                200   2e-61    
gb|AAK95140.1|  ribosomal protein L13a                                  200   2e-61    
dbj|GAA83388.1|  serine palmitoyltransferase 2                          200   3e-61    
ref|XP_004625632.1|  PREDICTED: 60S ribosomal protein L13a-like         200   3e-61    
gb|EHH30267.1|  hypothetical protein EGK_10889                          200   3e-61    
ref|XP_007743982.1|  60S ribosomal protein L16                          200   3e-61    
gb|EPQ66359.1|  N-terminally acetylated protein component of the ...    200   3e-61    
ref|XP_009523807.1|  hypothetical protein PHYSODRAFT_285558             198   3e-61    
ref|XP_661806.1|  RL16_NEUCR 60S ribosomal protein L16                  200   3e-61    
ref|XP_002795946.1|  60S ribosomal protein L16                          200   3e-61    
gb|AFM86379.1|  60S ribosomal protein L13a                              200   3e-61    
ref|XP_004082291.2|  PREDICTED: 60S ribosomal protein L13a              201   3e-61    
gb|AJR44989.1|  Rpl16ap                                                 200   3e-61    
ref|XP_001269562.1|  60S ribosomal protein L16                          200   3e-61    
emb|CDW89718.1|  60s ribosomal protein l16                              200   3e-61    
emb|CAA35908.1|  tum- transplantation antigen P198                      200   3e-61    
ref|NP_033464.2|  60S ribosomal protein L13a                            200   4e-61    
ref|XP_007390595.1|  hypothetical protein PHACADRAFT_247592             200   4e-61    
ref|XP_008573628.1|  PREDICTED: 60S ribosomal protein L13a isofor...    201   4e-61    
ref|XP_001526631.1|  60S ribosomal protein L16-A                        200   4e-61    
emb|CEJ92902.1|  Putative Ribosomal protein L16, L13 family             200   4e-61    
ref|XP_002625192.1|  60S ribosomal protein L16                          200   4e-61    
ref|NP_775462.2|  60S ribosomal protein L13a                            200   4e-61    
ref|XP_005366879.1|  PREDICTED: 60S ribosomal protein L13a              200   4e-61    
ref|XP_002542528.1|  60S ribosomal protein L16                          200   4e-61    
gb|KIV78628.1|  60S ribosomal protein L16                               200   4e-61    
ref|XP_007778809.1|  60S ribosomal protein L16                          200   4e-61    
ref|XP_007758820.1|  60S ribosomal protein L16                          199   5e-61    
gb|KIW52209.1|  60S ribosomal protein L16                               199   5e-61    
ref|XP_007359836.1|  60S ribosomal protein L13a                         199   5e-61    
ref|XP_001420679.1|  Ribosomal protein L13a, component of cytosol...    199   5e-61    
ref|XP_007336962.1|  60S ribosomal protein L13a                         199   5e-61    
ref|XP_001244411.1|  60S ribosomal protein L16                          199   5e-61    
ref|XP_003940403.1|  PREDICTED: 60S ribosomal protein L13a isofor...    199   5e-61    
ref|XP_007861056.1|  60S ribosomal protein L13a                         199   6e-61    
gb|KIX94944.1|  60S ribosomal protein L16                               199   6e-61    
gb|KIX04818.1|  60S ribosomal protein L16                               199   6e-61    
gb|AAQ13495.1|AF109186_1  FWP004                                        199   6e-61    
ref|XP_001387342.1|  60S ribosomal protein L16                          199   7e-61    
gb|KIW67795.1|  60S ribosomal protein L16                               199   7e-61    
ref|XP_006454409.1|  ribosomal protein L13                              199   7e-61    
ref|XP_001828792.1|  60S ribosomal protein L16                          199   7e-61    
gb|KIL70745.1|  hypothetical protein M378DRAFT_183340                   199   8e-61    
ref|XP_007531370.1|  PREDICTED: 60S ribosomal protein L13a isofor...    199   8e-61    
gb|KIO08197.1|  hypothetical protein M404DRAFT_133675                   199   8e-61    
gb|KIM85315.1|  hypothetical protein PILCRDRAFT_817318                  199   8e-61    
ref|XP_005589973.1|  PREDICTED: 60S ribosomal protein L13a isofor...    201   8e-61    
dbj|BAD96467.1|  ribosomal protein L13a variant                         199   8e-61    



>ref|XP_009789164.1| PREDICTED: 60S ribosomal protein L13a-1 [Nicotiana sylvestris]
Length=206

 Score =   316 bits (810),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+R VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRTVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_011073788.1| PREDICTED: 60S ribosomal protein L13a-4 [Sesamum indicum]
Length=206

 Score =   316 bits (810),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_009625303.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana tomentosiformis]
Length=206

 Score =   316 bits (810),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+R VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRTVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>gb|EYU31410.1| hypothetical protein MIMGU_mgv1a013934mg [Erythranthe guttata]
Length=206

 Score =   315 bits (808),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_009622553.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana tomentosiformis]
Length=206

 Score =   315 bits (808),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I ARRVV+DARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVIDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_009795999.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nicotiana sylvestris]
Length=206

 Score =   315 bits (806),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/158 (97%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I ARRVVVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>gb|EYU32659.1| hypothetical protein MIMGU_mgv1a013922mg [Erythranthe guttata]
Length=206

 Score =   315 bits (806),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 156/158 (99%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPP+DK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPFDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_006349931.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum]
Length=206

 Score =   314 bits (805),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_011091425.1| PREDICTED: 60S ribosomal protein L13a-4-like [Sesamum indicum]
Length=206

 Score =   314 bits (805),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|NP_001275476.1| 60S ribosomal protein L13a-4-like [Solanum tuberosum]
 gb|ABA46790.1| 60S ribosomal protein L13a-like protein [Solanum tuberosum]
Length=206

 Score =   314 bits (805),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>gb|AAR89618.1| 60S ribosomal protein L13a [Capsicum annuum]
Length=220

 Score =   315 bits (806),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 152/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_004252998.1| PREDICTED: 60S ribosomal protein L13a-4 [Solanum lycopersicum]
Length=206

 Score =   313 bits (802),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ+GHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_004239861.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum lycopersicum]
Length=206

 Score =   313 bits (802),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I ARR+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ+GHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_009596414.1| PREDICTED: 60S ribosomal protein L13a-4 [Nicotiana tomentosiformis]
Length=206

 Score =   313 bits (802),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/158 (96%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I ARR+VVDARHHMLGRL+SILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_009112682.1| PREDICTED: 60S ribosomal protein L13a-2-like [Brassica rapa]
 emb|CDY39786.1| BnaA09g10380D [Brassica napus]
 emb|CDY03292.1| BnaC09g10560D [Brassica napus]
Length=206

 Score =   313 bits (802),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_002268901.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera]
 emb|CAN63603.1| hypothetical protein VITISV_006449 [Vitis vinifera]
Length=206

 Score =   312 bits (800),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICARRVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETI  158



>ref|XP_007223449.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
 ref|XP_008224495.1| PREDICTED: 60S ribosomal protein L13a-4 [Prunus mume]
 gb|EMJ24648.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
Length=206

 Score =   312 bits (800),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETI  158



>ref|XP_002267491.1| PREDICTED: 60S ribosomal protein L13a-4 [Vitis vinifera]
Length=206

 Score =   312 bits (799),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAGRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010920859.1| PREDICTED: 60S ribosomal protein L13a-4-like [Elaeis guineensis]
Length=206

 Score =   312 bits (799),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGW+HYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWSHYDTI  158



>ref|XP_008793237.1| PREDICTED: 60S ribosomal protein L13a-4 [Phoenix dactylifera]
Length=206

 Score =   312 bits (799),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYD++
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDRM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWN+YDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNYYDTI  158



>ref|XP_009102457.1| PREDICTED: 60S ribosomal protein L13a-2-like [Brassica rapa]
Length=206

 Score =   311 bits (798),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>emb|CDY52083.1| BnaCnng21840D [Brassica napus]
 emb|CDX77383.1| BnaA07g05210D [Brassica napus]
Length=206

 Score =   311 bits (798),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>emb|CDP03876.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   311 bits (798),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNH DTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHADTI  158



>ref|XP_004288082.1| PREDICTED: 60S ribosomal protein L13a-4 [Fragaria vesca subsp. 
vesca]
 ref|XP_004288083.1| PREDICTED: 60S ribosomal protein L13a-4 [Fragaria vesca subsp. 
vesca]
Length=206

 Score =   311 bits (798),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_010937848.1| PREDICTED: 60S ribosomal protein L13a-4 [Elaeis guineensis]
Length=206

 Score =   311 bits (798),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGW+HYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWSHYDTI  158



>ref|XP_010023711.1| PREDICTED: 60S ribosomal protein L13a-4-like [Eucalyptus grandis]
 gb|KCW60057.1| hypothetical protein EUGRSUZ_H02787 [Eucalyptus grandis]
Length=206

 Score =   311 bits (798),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLAS+LAKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQRVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_004297119.1| PREDICTED: 60S ribosomal protein L13a-4-like [Fragaria vesca 
subsp. vesca]
Length=206

 Score =   311 bits (798),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_004154636.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 1 [Cucumis 
sativus]
Length=241

 Score =   313 bits (801),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/159 (93%), Positives = 156/159 (98%), Gaps = 0/159 (0%)
 Frame = +3

Query  60   KMVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY  239
            KMVSGS ICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY
Sbjct  33   KMVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKY  92

Query  240  HRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK  419
             RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK
Sbjct  93   MRFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDK  152

Query  420  VKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            +KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  153  MKRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  191



>ref|XP_009136093.1| PREDICTED: 60S ribosomal protein L13a-2 [Brassica rapa]
 emb|CDY15113.1| BnaC03g44740D [Brassica napus]
 emb|CDX93039.1| BnaA03g37610D [Brassica napus]
Length=206

 Score =   311 bits (797),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +C++RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCSKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RF+RKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFMRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_009765513.1| PREDICTED: 60S ribosomal protein L13a-4 [Nicotiana sylvestris]
Length=206

 Score =   311 bits (797),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I ARR+VVDARHHMLGRL+SILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISARRIVVDARHHMLGRLSSILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWN+YDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNYYDTI  158



>gb|EPS58218.1| hypothetical protein M569_16597 [Genlisea aurea]
Length=206

 Score =   311 bits (797),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+R VVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRFVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_010552053.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   311 bits (797),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010524687.1| PREDICTED: 60S ribosomal protein L13a-1 [Tarenaya hassleriana]
Length=206

 Score =   311 bits (797),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGHLSSEVGWNHYDTI  158



>ref|XP_004247847.1| PREDICTED: 60S ribosomal protein L13a-4 [Solanum lycopersicum]
 ref|XP_006360354.1| PREDICTED: 60S ribosomal protein L13a-4-like [Solanum tuberosum]
Length=206

 Score =   311 bits (796),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I A+R+VVDARHHMLGRL+SILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISAKRIVVDARHHMLGRLSSILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRL+AGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLRAGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_010532891.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   311 bits (796),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_009111853.1| PREDICTED: 60S ribosomal protein L13a-4 [Brassica rapa]
 emb|CDY00046.1| BnaC09g02550D [Brassica napus]
 emb|CDX86281.1| BnaA06g29980D [Brassica napus]
Length=206

 Score =   310 bits (795),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>emb|CDY33947.1| BnaA02g30400D [Brassica napus]
 emb|CDY05663.1| BnaC02g38740D [Brassica napus]
 emb|CDX85362.1| BnaC07g26730D [Brassica napus]
Length=206

 Score =   310 bits (795),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>gb|AHE13806.1| ribosomal protein L13a [Solanum torvum]
Length=206

 Score =   310 bits (795),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I A+R+VVDARHHMLGRL+SI+AKELLNGQRVV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGISAKRIVVDARHHMLGRLSSIIAKELLNGQRVVIVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVFEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_006418685.1| hypothetical protein EUTSA_v10002667mg [Eutrema salsugineum]
 gb|ESQ37121.1| hypothetical protein EUTSA_v10002667mg [Eutrema salsugineum]
Length=206

 Score =   310 bits (795),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_009129745.1| PREDICTED: 60S ribosomal protein L13a-4-like [Brassica rapa]
Length=206

 Score =   310 bits (795),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010527234.1| PREDICTED: 60S ribosomal protein L13a-2-like [Tarenaya hassleriana]
Length=206

 Score =   310 bits (795),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTI  158



>gb|ACJ02350.1| 60S ribosomal protein L13A [Vernicia fordii]
Length=206

 Score =   310 bits (794),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLAS+LAKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKIVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETI  158



>ref|XP_004133995.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus]
 ref|XP_004169511.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis sativus]
 ref|XP_008438365.1| PREDICTED: 60S ribosomal protein L13a-2-like [Cucumis melo]
 gb|KGN56740.1| hypothetical protein Csa_3G131930 [Cucumis sativus]
Length=206

 Score =   310 bits (794),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_002518107.1| 60S ribosomal protein L13a, putative [Ricinus communis]
 gb|EEF44240.1| 60S ribosomal protein L13a, putative [Ricinus communis]
Length=206

 Score =   310 bits (794),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETI  158



>ref|XP_010937601.1| PREDICTED: 60S ribosomal protein L13a-2-like [Elaeis guineensis]
Length=206

 Score =   310 bits (793),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMK+ 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKFL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LS EVGW+HYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSKEVGWSHYDTI  158



>ref|XP_004138959.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus]
 ref|XP_004139040.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cucumis sativus]
 ref|XP_008450411.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 ref|XP_008457247.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 ref|XP_008458460.1| PREDICTED: 60S ribosomal protein L13a-4 [Cucumis melo]
 gb|KGN61467.1| hypothetical protein Csa_2G138710 [Cucumis sativus]
Length=206

 Score =   310 bits (793),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010547080.1| PREDICTED: 60S ribosomal protein L13a-1 [Tarenaya hassleriana]
Length=206

 Score =   310 bits (793),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKL  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGHLSSEVGWNHYDTI  158



>ref|XP_004154637.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 2 [Cucumis 
sativus]
 ref|XP_004154638.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform 3 [Cucumis 
sativus]
Length=208

 Score =   310 bits (793),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010439646.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa]
 ref|XP_010442327.1| PREDICTED: 60S ribosomal protein L13a-4 [Camelina sativa]
Length=206

 Score =   309 bits (792),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_006840139.1| hypothetical protein AMTR_s00089p00040540 [Amborella trichopoda]
 gb|ERN01814.1| hypothetical protein AMTR_s00089p00040540 [Amborella trichopoda]
Length=206

 Score =   309 bits (792),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+ VVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKVVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWNHYDTI  158



>gb|AIC33046.1| 60S ribosomal protein L13a, partial [Panax ginseng]
Length=157

 Score =   307 bits (787),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/157 (95%), Positives = 155/157 (99%), Gaps = 0/157 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICARRVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDT  533
            KRMVIPDALKVLRLQAGHKYCLLG+LS+EVGWN+YDT
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSAEVGWNYYDT  157



>ref|XP_006298559.1| hypothetical protein CARUB_v10014643mg [Capsella rubella]
 gb|EOA31457.1| hypothetical protein CARUB_v10014643mg [Capsella rubella]
Length=206

 Score =   309 bits (792),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KFK39804.1| hypothetical protein AALP_AA3G290300 [Arabis alpina]
Length=206

 Score =   309 bits (791),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+RVVVD RHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDGRHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLK++EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKMFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_006281111.1| hypothetical protein CARUB_v10027141mg [Capsella rubella]
 gb|EOA14009.1| hypothetical protein CARUB_v10027141mg [Capsella rubella]
Length=206

 Score =   309 bits (791),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010923627.1| PREDICTED: 60S ribosomal protein L13a-2-like [Elaeis guineensis]
Length=246

 Score =   310 bits (795),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/161 (93%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = +3

Query  54   AAKMVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM  233
            AA+MVSGS IC RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM
Sbjct  38   AAEMVSGSGICTRRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKM  97

Query  234  KYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPY  413
            K+ RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPY
Sbjct  98   KFLRFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPY  157

Query  414  DKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            DK KRMVIPDALKVLRLQAGHKYCLLG+LS EVGW+HYD I
Sbjct  158  DKTKRMVIPDALKVLRLQAGHKYCLLGRLSKEVGWSHYDII  198



>ref|NP_189127.1| 60S ribosomal protein L13a-2 [Arabidopsis thaliana]
 sp|Q9LRX8.1|R13A2_ARATH RecName: Full=60S ribosomal protein L13a-2 [Arabidopsis thaliana]
 dbj|BAB02893.1| 60S ribosomal protein L13A-like [Arabidopsis thaliana]
 gb|AAN12937.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AEE76951.1| 60S ribosomal protein L13a-2 [Arabidopsis thaliana]
Length=206

 Score =   309 bits (791),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KHG26825.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   309 bits (791),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTYEGIPAPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_007223448.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
 gb|EMJ24647.1| hypothetical protein PRUPE_ppa011551mg [Prunus persica]
Length=187

 Score =   308 bits (789),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETI  158



>gb|ADR71263.1| 60S ribosomal protein L13aA [Hevea brasiliensis]
Length=206

 Score =   308 bits (790),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKVYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETI  158



>ref|XP_008789105.1| PREDICTED: 60S ribosomal protein L13a-4-like [Phoenix dactylifera]
Length=206

 Score =   308 bits (790),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 155/158 (98%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RV+VDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVLVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK Y+GVPPPYD++
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYDGVPPPYDRM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_011045655.1| PREDICTED: 60S ribosomal protein L13a-2 [Populus euphratica]
Length=206

 Score =   308 bits (790),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTI  158



>ref|XP_010466918.1| PREDICTED: 60S ribosomal protein L13a-2-like [Camelina sativa]
Length=206

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010488596.1| PREDICTED: 60S ribosomal protein L13a-2 [Camelina sativa]
Length=206

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>gb|AAL87341.1| putative 60S ribosomal protein [Arabidopsis thaliana]
Length=206

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHM GRLASI+AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_006395114.1| hypothetical protein EUTSA_v10004924mg [Eutrema salsugineum]
 gb|ESQ32400.1| hypothetical protein EUTSA_v10004924mg [Eutrema salsugineum]
Length=206

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010440660.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L13a-3-like 
[Camelina sativa]
Length=206

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHM GRLAS LAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMSGRLASSLAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTI  158



>ref|NP_199687.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 ref|NP_001078737.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 sp|Q9FKC0.1|R13A4_ARATH RecName: Full=60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 dbj|BAB09429.1| 60S ribosomal protein L13a [Arabidopsis thaliana]
 gb|AAL91263.1| AT5g48760/K24G6_9 [Arabidopsis thaliana]
 gb|AAM65734.1| 60S ribosomal protein L13a [Arabidopsis thaliana]
 gb|AAM67435.1| At5g48760/K24G6_9 [Arabidopsis thaliana]
 gb|AED95720.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
 gb|AED95721.1| 60S ribosomal protein L13a-4 [Arabidopsis thaliana]
Length=206

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKVYEGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KHG08426.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
 gb|KJB37827.1| hypothetical protein B456_006G222200 [Gossypium raimondii]
 gb|KJB37828.1| hypothetical protein B456_006G222200 [Gossypium raimondii]
Length=206

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPAPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_009374600.1| PREDICTED: 60S ribosomal protein L13a-4 [Pyrus x bretschneideri]
Length=206

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETI  158



>gb|KDP39375.1| hypothetical protein JCGZ_01132 [Jatropha curcas]
Length=206

 Score =   308 bits (789),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLAS +AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASTIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETI  158



>ref|XP_006407868.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum]
 gb|ESQ49321.1| hypothetical protein EUTSA_v10021532mg [Eutrema salsugineum]
Length=206

 Score =   308 bits (789),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKV+EGVPPPY+K+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALDRLKVFEGVPPPYNKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KHG07795.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   308 bits (789),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAA+LARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAASLARLKAYEGIPAPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTI  158



>gb|KJB72096.1| hypothetical protein B456_011G159000 [Gossypium raimondii]
Length=206

 Score =   308 bits (789),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTYEGIPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_009151676.1| PREDICTED: 60S ribosomal protein L13a-4 [Brassica rapa]
Length=206

 Score =   308 bits (789),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHMLGRLASI+AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRGAAALAR+KV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPPKIFWRTVRGMIPHKTKRGAAALARMKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_008786013.1| PREDICTED: 60S ribosomal protein L13a-4-like [Phoenix dactylifera]
Length=206

 Score =   308 bits (789),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LS EVGW++YDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSKEVGWSYYDTI  158



>ref|XP_010277234.1| PREDICTED: 60S ribosomal protein L13a-4 [Nelumbo nucifera]
Length=206

 Score =   308 bits (788),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_002883564.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59823.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   308 bits (788),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_006369799.1| 60S ribosomal protein L13a-2 [Populus trichocarpa]
 gb|ABK93590.1| unknown [Populus trichocarpa]
 gb|ERP66368.1| 60S ribosomal protein L13a-2 [Populus trichocarpa]
Length=206

 Score =   308 bits (788),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+R+VVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRIVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTI  158



>ref|XP_008348430.1| PREDICTED: 60S ribosomal protein L13a-4 [Malus domestica]
Length=206

 Score =   308 bits (788),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETI  158



>ref|XP_002865669.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41928.1| 60S ribosomal protein L13A [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   308 bits (788),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_007034382.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 ref|XP_007034383.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 gb|EOY05308.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
 gb|EOY05309.1| Ribosomal protein L13 family protein isoform 1 [Theobroma cacao]
Length=206

 Score =   308 bits (788),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA++VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_010482144.1| PREDICTED: 60S ribosomal protein L13a-4-like [Camelina sativa]
Length=206

 Score =   308 bits (788),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPTPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGH YCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHNYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010069043.1| PREDICTED: 60S ribosomal protein L13a-3 [Eucalyptus grandis]
 gb|KCW57252.1| hypothetical protein EUGRSUZ_H00057 [Eucalyptus grandis]
Length=206

 Score =   308 bits (788),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +C +RVVVD RHHMLGRLAS+LAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCVKRVVVDGRHHMLGRLASVLAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK +EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETI  158



>ref|XP_002323772.1| ribosomal protein L13a [Populus trichocarpa]
 gb|ABK95932.1| unknown [Populus trichocarpa]
 gb|EEF03905.1| ribosomal protein L13a [Populus trichocarpa]
Length=206

 Score =   307 bits (787),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC +RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICVKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTI  158



>ref|XP_010069656.1| PREDICTED: 60S ribosomal protein L13a-2 [Eucalyptus grandis]
 gb|KCW58065.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=206

 Score =   307 bits (787),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGA ALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAGALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010513787.1| PREDICTED: 60S ribosomal protein L13a-2-like [Camelina sativa]
Length=206

 Score =   307 bits (787),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC++RVVVDARHHM GRLASI AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICSKRVVVDARHHMCGRLASITAKELLNGQSVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_009421391.1| PREDICTED: 60S ribosomal protein L13a-4 [Musa acuminata subsp. 
malaccensis]
Length=206

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTV  158



>ref|XP_002521095.1| 60S ribosomal protein L13a, putative [Ricinus communis]
 gb|EEF41246.1| 60S ribosomal protein L13a, putative [Ricinus communis]
Length=206

 Score =   307 bits (786),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_006855707.1| hypothetical protein AMTR_s00044p00144180 [Amborella trichopoda]
 gb|ERN17174.1| hypothetical protein AMTR_s00044p00144180 [Amborella trichopoda]
Length=171

 Score =   306 bits (783),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICAR VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAAL+RLKVYEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALSRLKVYEGVPPPYDKK  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_008805147.1| PREDICTED: 60S ribosomal protein L13a-2-like [Phoenix dactylifera]
Length=206

 Score =   307 bits (786),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR P+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRNPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+HYDTI
Sbjct  121  KRMVIPDALKVLRLQTGHKYCLLGRLSKEVGWSHYDTI  158



>ref|XP_008356990.1| PREDICTED: 60S ribosomal protein L13a-4 [Malus domestica]
 ref|XP_009348407.1| PREDICTED: 60S ribosomal protein L13a-4-like [Pyrus x bretschneideri]
Length=206

 Score =   307 bits (786),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRL+SILAKELLNGQ+VVVVR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSILAKELLNGQKVVVVRAEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYETI  158



>gb|AFK44939.1| unknown [Lotus japonicus]
Length=206

 Score =   307 bits (786),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAAL RLKVYEG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTLRGMIPHKTKRGAAALERLKVYEGIPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYCLLGKLSSEVGWN+YDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGKLSSEVGWNYYDTI  158



>ref|XP_002863167.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39426.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   306 bits (785),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVD RHHMLGRLAS  AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASTTAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_002882511.1| structural constituent of ribosome [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58770.1| structural constituent of ribosome [Arabidopsis lyrata subsp. 
lyrata]
Length=207

 Score =   306 bits (785),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KJB30129.1| hypothetical protein B456_005G130900 [Gossypium raimondii]
Length=206

 Score =   306 bits (785),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEISMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPAPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTI  158



>gb|KFK39801.1| hypothetical protein AALP_AA3G289800 [Arabis alpina]
Length=206

 Score =   306 bits (785),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+RVVVD RHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDGRHHMLGRLSSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKVYEGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ+GHKYCLL +LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLNRLSSEVGWNHYDTI  158



>gb|KFK38165.1| hypothetical protein AALP_AA3G077500 [Arabis alpina]
Length=206

 Score =   306 bits (785),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +C++RVVVD RHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCSKRVVVDGRHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_009392721.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   306 bits (784),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTV  158



>gb|KJB72097.1| hypothetical protein B456_011G159000 [Gossypium raimondii]
Length=169

 Score =   305 bits (781),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTYEGIPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTI  158



>ref|XP_006284504.1| hypothetical protein CARUB_v10005705mg, partial [Capsella rubella]
 gb|EOA17402.1| hypothetical protein CARUB_v10005705mg, partial [Capsella rubella]
Length=217

 Score =   306 bits (785),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHM GRLAS +AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  12   MVSGSGICAKRVVVDARHHMGGRLASSIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  71

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDK+
Sbjct  72   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKI  131

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTI
Sbjct  132  KRMVIPDALKVLRLQSGHKYCLLGQLSSEVGWNHYDTI  169



>ref|XP_009404653.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   306 bits (783),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTV  158



>ref|XP_006298567.1| hypothetical protein CARUB_v10014649mg [Capsella rubella]
 gb|EOA31465.1| hypothetical protein CARUB_v10014649mg [Capsella rubella]
Length=206

 Score =   306 bits (783),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASITAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            K+MVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KKMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010279449.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nelumbo nucifera]
Length=206

 Score =   306 bits (783),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAAL RLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALGRLKAYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGW+HYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWSHYDTI  158



>ref|XP_009403869.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   306 bits (783),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CARRVVVDARHHMLGRLASI+AKELLNGQRVV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARRVVVDARHHMLGRLASIVAKELLNGQRVVIVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTV  158



>ref|XP_010245584.1| PREDICTED: 60S ribosomal protein L13a-4-like [Nelumbo nucifera]
Length=206

 Score =   305 bits (782),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICARRVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICARRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGAAALARLKAYEGIPPPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGW+HYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSSEVGWSHYDTI  158



>ref|XP_010110069.1| 60S ribosomal protein L13a-3 [Morus notabilis]
 gb|EXC25125.1| 60S ribosomal protein L13a-3 [Morus notabilis]
Length=206

 Score =   305 bits (782),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEELCISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010464292.1| PREDICTED: 60S ribosomal protein L13a-1-like [Camelina sativa]
Length=206

 Score =   305 bits (782),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RV VDARHHMLGRLASI AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVAVDARHHMLGRLASITAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            K+MVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KKMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|NP_193053.1| 60S ribosomal protein L13a-3 [Arabidopsis thaliana]
 sp|Q9SVR0.1|R13A3_ARATH RecName: Full=60S ribosomal protein L13a-3 [Arabidopsis thaliana]
 emb|CAB41927.1| ribosomal protein L13a like protein [Arabidopsis thaliana]
 emb|CAB78359.1| ribosomal protein L13a like protein [Arabidopsis thaliana]
 gb|AAK97733.1| AT4g13170/F17N18_60 [Arabidopsis thaliana]
 gb|AAL31131.1| AT4g13170/F17N18_60 [Arabidopsis thaliana]
 gb|AEE83240.1| 60S ribosomal protein L13a-3 [Arabidopsis thaliana]
Length=206

 Score =   305 bits (781),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVD RHHMLGRLAS  AKELLNGQ VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASNTAKELLNGQEVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKV+EG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVFEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ+GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_010448678.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa]
 ref|XP_010486252.1| PREDICTED: 60S ribosomal protein L13a-1 [Camelina sativa]
Length=206

 Score =   305 bits (781),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRL SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLGSIVAKELLNGQKVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            K+MVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KKMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KDO61166.1| hypothetical protein CISIN_1g028623mg [Citrus sinensis]
Length=205

 Score =   305 bits (780),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLAS+LAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVP PYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPAPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNYYDTI  158



>gb|KCW57253.1| hypothetical protein EUGRSUZ_H00057 [Eucalyptus grandis]
Length=181

 Score =   303 bits (777),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +C +RVVVD RHHMLGRLAS+LAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCVKRVVVDGRHHMLGRLASVLAKELLNGQRVVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK +EGVPPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKTFEGVPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LSSEVGWNHY+TI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYETI  158



>ref|XP_006420899.1| hypothetical protein CICLE_v10005900mg [Citrus clementina]
 ref|XP_006493807.1| PREDICTED: 60S ribosomal protein L13a-4-like [Citrus sinensis]
 gb|ESR34139.1| hypothetical protein CICLE_v10005900mg [Citrus clementina]
 gb|KDO61167.1| hypothetical protein CISIN_1g028623mg [Citrus sinensis]
Length=206

 Score =   305 bits (780),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLAS+LAKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVLAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVP PYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPAPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNYYDTI  158



>ref|XP_009405822.1| PREDICTED: 60S ribosomal protein L13a-4-like [Musa acuminata 
subsp. malaccensis]
Length=206

 Score =   304 bits (779),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CAR VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCARCVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GH+YCLLG+LSSEVGWN+YDT+
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGRLSSEVGWNYYDTV  158



>ref|XP_011041875.1| PREDICTED: 60S ribosomal protein L13a-1-like [Populus euphratica]
Length=206

 Score =   304 bits (778),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC +RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICVKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKR NTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLKV+EGVPPPYD+ 
Sbjct  61   RFLRKRTNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKVFEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTI  158



>ref|NP_187367.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 sp|Q9SFU1.1|R13A1_ARATH RecName: Full=60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 gb|AAF20235.1|AC012395_22 putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AAG40393.1|AF325041_1 AT3g07110 [Arabidopsis thaliana]
 gb|AAL09790.1| AT3g07110/T1B9_24 [Arabidopsis thaliana]
 gb|AAL32871.1| putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AAM47908.1| putative 60S ribosomal protein L13A [Arabidopsis thaliana]
 gb|AEE74499.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
Length=206

 Score =   304 bits (778),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLAS++AK+LLNGQ +VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KCW58067.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=174

 Score =   303 bits (775),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGA ALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAGALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTI  158



>ref|NP_001030654.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
 gb|AEE74500.1| 60S ribosomal protein L13a-1 [Arabidopsis thaliana]
Length=207

 Score =   304 bits (778),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLAS++AK+LLNGQ +VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGA ALARLKV+EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_004499225.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cicer arietinum]
 ref|XP_004499231.1| PREDICTED: 60S ribosomal protein L13a-4-like [Cicer arietinum]
Length=206

 Score =   304 bits (778),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYYDTI  158



>gb|KHG16481.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
 gb|KJB22644.1| hypothetical protein B456_004G058600 [Gossypium raimondii]
Length=206

 Score =   303 bits (777),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KJB10146.1| hypothetical protein B456_001G186700 [Gossypium raimondii]
Length=206

 Score =   302 bits (774),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P P+DK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPAPFDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_003559332.1| PREDICTED: 60S ribosomal protein L13a-4 [Brachypodium distachyon]
Length=206

 Score =   302 bits (774),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKAYEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYCLLG+LS EVGWN+ DTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCLLGQLSKEVGWNYADTI  158



>ref|XP_006650608.1| PREDICTED: 60S ribosomal protein L13a-4-like [Oryza brachyantha]
Length=206

 Score =   302 bits (773),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CARRVVVDARHHMLGRL+S++AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCARRVVVDARHHMLGRLSSVIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRT+RGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTI  158



>ref|XP_007049776.1| Ribosomal protein L13 family protein [Theobroma cacao]
 gb|EOX93933.1| Ribosomal protein L13 family protein [Theobroma cacao]
Length=206

 Score =   301 bits (772),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MV GS +CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVCGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRT+RGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KDP26388.1| hypothetical protein JCGZ_17546 [Jatropha curcas]
Length=206

 Score =   301 bits (772),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA++VVVDARHHMLGRLAS++AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASVVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR P+KI WRT+RGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRNPAKIFWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_006479280.1| PREDICTED: 60S ribosomal protein L13a-4-like [Citrus sinensis]
 gb|KDO65928.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=206

 Score =   301 bits (771),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+L+SEVGWN+YDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLASEVGWNYYDTI  158



>ref|NP_001235102.1| uncharacterized protein LOC100499978 [Glycine max]
 gb|ACU14471.1| unknown [Glycine max]
Length=206

 Score =   301 bits (771),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCVLGRLSSEVGWSYYDTI  158



>ref|XP_007140600.1| hypothetical protein PHAVU_008G125900g [Phaseolus vulgaris]
 gb|AGV54439.1| 60S ribosomal protein L13a [Phaseolus vulgaris]
 gb|ESW12594.1| hypothetical protein PHAVU_008G125900g [Phaseolus vulgaris]
Length=206

 Score =   301 bits (770),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AAL RLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALDRLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYCLLGKLSSEVGWN+YDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGKLSSEVGWNYYDTI  158



>gb|KJB22645.1| hypothetical protein B456_004G058600 [Gossypium raimondii]
Length=173

 Score =   300 bits (767),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P PYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KJB42469.1| hypothetical protein B456_007G154600 [Gossypium raimondii]
Length=206

 Score =   300 bits (769),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+RVVVDARHHMLGRLASI+AKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKLVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPSPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRL  GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLLKGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KHG00254.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   300 bits (768),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+RVVVDARHHMLGRLASI+AKELLNGQ++VVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQKLVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKSYEGVPSPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRL  GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLLKGHKYCLLGRLSSEVGWNHYDTI  158



>gb|KHF97469.1| 60S ribosomal L13a-4 -like protein [Gossypium arboreum]
Length=206

 Score =   300 bits (768),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA++VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKKVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEG+P P+DK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGIPAPFDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHK+CLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKHCLLGRLSSEVGWNHYDTI  158



>ref|NP_001130808.1| uncharacterized protein LOC100191912 [Zea mays]
 gb|ACG24933.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   299 bits (765),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTI  158



>ref|NP_001276138.1| 60S ribosomal protein L13a-4-like [Glycine max]
 gb|ACU20583.1| unknown [Glycine max]
Length=206

 Score =   299 bits (765),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPY K+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYGKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCILGRLSSEVGWSYYDTI  158



>gb|ACF79169.1| unknown [Zea mays]
 tpg|DAA51453.1| TPA: ribosomal protein L13A-like protein [Zea mays]
Length=206

 Score =   299 bits (765),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTI  158



>ref|XP_003616742.1| 60S ribosomal protein L13A [Medicago truncatula]
 gb|AES99700.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
Length=206

 Score =   299 bits (765),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS  CA+RVV+DARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGACAKRVVIDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTLRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHK+CLLG+LS+EVGWN+YD I
Sbjct  121  KRMVVPDALKVLRLQKGHKFCLLGQLSAEVGWNYYDII  158



>ref|XP_006586250.1| PREDICTED: 60S ribosomal protein L13a-4-like [Glycine max]
 gb|KHN07181.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=206

 Score =   299 bits (765),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYC LG+LSSEVGWN+YDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCHLGQLSSEVGWNYYDTI  158



>gb|KDO65929.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=179

 Score =   298 bits (762),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+L+SEVGWN+YDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGRLASEVGWNYYDTI  158



>ref|XP_011024678.1| PREDICTED: 60S ribosomal protein L13a-4-like [Populus euphratica]
Length=206

 Score =   298 bits (764),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+ VVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKVVVVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTK+G AALARL+ YEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKKGEAALARLRAYEGIPPPYDKK  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYDTI
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDTI  158



>ref|NP_001281205.1| 60S ribosomal protein L13a [Zea mays]
 gb|ACN25827.1| unknown [Zea mays]
 gb|AFW67581.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   298 bits (764),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTI  158



>gb|KHN07182.1| 60S ribosomal protein L13a-1 [Glycine soja]
Length=206

 Score =   298 bits (764),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYC LG+LSSEVGWN+YDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCHLGQLSSEVGWNYYDTI  158



>ref|NP_001051314.1| Os03g0756000 [Oryza sativa Japonica Group]
 gb|AAR01683.1| putative ribosomal protein L13a [Oryza sativa Japonica Group]
 gb|ABF98951.1| 60S ribosomal protein L13a-2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13228.1| Os03g0756000 [Oryza sativa Japonica Group]
 gb|EAY91906.1| hypothetical protein OsI_13588 [Oryza sativa Indica Group]
 gb|EAZ28629.1| hypothetical protein OsJ_12636 [Oryza sativa Japonica Group]
 dbj|BAG96308.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97551.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01442.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   298 bits (764),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAPRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRT+RGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTI  158



>ref|NP_001236202.1| uncharacterized protein LOC100527190 [Glycine max]
 gb|ACU16241.1| unknown [Glycine max]
Length=206

 Score =   298 bits (763),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RV+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVIVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPGKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYC LG+LSSEVGWN+YDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCHLGQLSSEVGWNYYDTI  158



>ref|XP_002466431.1| hypothetical protein SORBIDRAFT_01g007690 [Sorghum bicolor]
 gb|AAM47582.1| putative 60S ribosomal protein [Sorghum bicolor]
 gb|EER93429.1| hypothetical protein SORBIDRAFT_01g007690 [Sorghum bicolor]
Length=206

 Score =   298 bits (763),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI
Sbjct  121  KRVVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTI  158



>ref|XP_010435310.1| PREDICTED: 60S ribosomal protein L13a-3-like [Camelina sativa]
Length=206

 Score =   298 bits (762),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHM G LAS LAKELLNGQ+VVVVRCEEICLSGGLVR +MKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMSGLLASSLAKELLNGQKVVVVRCEEICLSGGLVRLRMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+R MIPHKTKRGAAALARLKV+EG+PPPYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRSMIPHKTKRGAAALARLKVFEGIPPPYDKV  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDA KVLRLQ+GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVIPDAFKVLRLQSGHKYCLLGRLSSEVGWNHYDTI  158



>ref|XP_004981725.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform X2 [Setaria 
italica]
Length=206

 Score =   297 bits (761),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTI  158



>ref|XP_007147486.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris]
 gb|ESW19480.1| hypothetical protein PHAVU_006G128500g [Phaseolus vulgaris]
Length=206

 Score =   297 bits (761),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRG AAL RLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGEAALDRLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCVLGRLSSEVGWSYYDTI  158



>gb|AFK34830.1| unknown [Medicago truncatula]
Length=206

 Score =   297 bits (760),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS  CA+RVV+DARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGACAKRVVIDARHHMLGRLASIVAKELLNGQKVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKP+HGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPNHGPIHFRAPSKIFWRTLRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHK+CLLG+LS+EVGWN+YD I
Sbjct  121  KRMVVPDALKVLRLQKGHKFCLLGQLSAEVGWNYYDII  158



>ref|XP_003546257.1| PREDICTED: 60S ribosomal protein L13a-4-like [Glycine max]
Length=206

 Score =   296 bits (759),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+V VVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVAVVRCEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYC+LG+LS EVGW++YDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCVLGRLSPEVGWSYYDTI  158



>gb|ACG36118.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   296 bits (758),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KR+VIPDALKVLRLQ GHKYCLLG+L  EVGWN++DTI
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELXKEVGWNYHDTI  158



>ref|XP_002301785.2| ribosomal protein L13a [Populus trichocarpa]
 gb|ABK92693.1| unknown [Populus trichocarpa]
 gb|ABK94779.1| unknown [Populus trichocarpa]
 gb|EEE81058.2| ribosomal protein L13a [Populus trichocarpa]
Length=206

 Score =   296 bits (758),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+ V+VDARHHMLGRLASI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKVVLVDARHHMLGRLASIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTK+G AALARLK YEG+PPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKKGEAALARLKAYEGIPPPYDKK  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLGKLSSEVGWNHYD I
Sbjct  121  KRMVIPDALKVLRLQKGHKYCLLGKLSSEVGWNHYDII  158



>pdb|3J61|O Chain O, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50984.1| ribosomal protein L13a [Triticum aestivum]
 dbj|BAJ92402.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS50837.1| 60S ribosomal protein L13a-4 [Triticum urartu]
 gb|EMT20078.1| 60S ribosomal protein L13a-4 [Aegilops tauschii]
Length=206

 Score =   295 bits (756),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKT RG AALARLK YEGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTARGEAALARLKAYEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GH+YCLLG+LS EVGWN+ DTI
Sbjct  121  KRMVIPDALKVLRLQPGHRYCLLGQLSKEVGWNYADTI  158



>gb|ACG33474.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   295 bits (756),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSH PIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHRPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTI  158



>gb|ACN36734.1| unknown [Zea mays]
 gb|AFW67580.1| hypothetical protein ZEAMMB73_211853 [Zea mays]
Length=179

 Score =   294 bits (753),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTI  158



>ref|XP_002439183.1| hypothetical protein SORBIDRAFT_09g001930 [Sorghum bicolor]
 gb|EES17613.1| hypothetical protein SORBIDRAFT_09g001930 [Sorghum bicolor]
Length=206

 Score =   295 bits (754),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS + A+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGLSAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI
Sbjct  121  KRVVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTI  158



>sp|O65055.1|RL13A_PICMA RecName: Full=60S ribosomal protein L13a [Picea mariana]
 gb|AAC32117.1| probable 60s ribosomal protein L13a [Picea mariana]
Length=206

 Score =   294 bits (752),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+ VVVDARHHMLGRLASILAKELL+GQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKEVVVDARHHMLGRLASILAKELLHGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIPHKTKRGAAALA L+ +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHKTKRGAAALATLRAFEGVPPPYDRK  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTI  158



>gb|ACG37566.1| 60S ribosomal protein L13a [Zea mays]
Length=222

 Score =   294 bits (753),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+R  VDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRXXVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KR+VIPDALKVLRLQ GHKYCLLG+LS EVGWN++DTI
Sbjct  121  KRLVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHDTI  158



>ref|XP_006443602.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina]
 gb|ESR56842.1| hypothetical protein CICLE_v10023466mg, partial [Citrus clementina]
Length=382

 Score =   300 bits (767),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  177  MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  236

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  237  RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  296

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+L+SEVGWN+YDTI
Sbjct  297  KRMVIPDALKVLRLQKGHKYCLLGRLASEVGWNYYDTI  334



>ref|XP_003589380.1| 60S ribosomal protein L13a [Medicago truncatula]
 gb|ACJ85949.1| unknown [Medicago truncatula]
 gb|AES59631.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
 gb|AFK44083.1| unknown [Medicago truncatula]
Length=206

 Score =   293 bits (750),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICASGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWN+   I
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYGGII  158



>gb|ACJ83838.1| unknown [Medicago truncatula]
 gb|AFK37771.1| unknown [Medicago truncatula]
 gb|KEH22805.1| 60S ribosomal protein L13a-4 [Medicago truncatula]
Length=206

 Score =   293 bits (749),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVV+DARHHMLGRLASI+AKELLNGQ+VV+VRCEEIC SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVIDARHHMLGRLASIVAKELLNGQKVVLVRCEEICASGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALAR+KVYEG+PPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARMKVYEGIPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYC LG+LS+EVGWN+  TI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCSLGQLSAEVGWNYAGTI  158



>ref|XP_010685006.1| PREDICTED: 60S ribosomal protein L13a-2 [Beta vulgaris subsp. 
vulgaris]
Length=206

 Score =   292 bits (748),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS + A+RVVVDARHHM GRLASI+AKELL GQRVVV RCE I LSGGLVRQKMKY 
Sbjct  1    MVSGSGVMAKRVVVDARHHMCGRLASIVAKELLTGQRVVVTRCEAIALSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRGAAALARLKVYEGVPPPYDK+
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPPPYDKI  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KR+V+PDALKVLRLQ GHKYCLLG+LS EVGWNHYDTI
Sbjct  121  KRVVVPDALKVLRLQKGHKYCLLGRLSKEVGWNHYDTI  158



>gb|KHN31417.1| 60S ribosomal protein L13a-4 [Glycine soja]
Length=204

 Score =   291 bits (746),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 2/158 (1%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLAS   KELLNGQ+V VVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLAS--EKELLNGQKVAVVRCEEICISGGLVRQKMKYL  58

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG AALARLKVYEG+PPPYDK+
Sbjct  59   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEAALARLKVYEGIPPPYDKI  118

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYC+LG+LSSEVGW++YDTI
Sbjct  119  KRMVVPDALKVLRLQKGHKYCILGRLSSEVGWSYYDTI  156



>dbj|BAK07924.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=250

 Score =   293 bits (749),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 150/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  39   E*REDAAKMVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGL  218
            E R     MVSGS + ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGL
Sbjct  37   EGRSQQVTMVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGL  96

Query  219  VRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG  398
            VRQKMKY RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKT RG AALARLK +EG
Sbjct  97   VRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTPRGEAALARLKAFEG  156

Query  399  VPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+++TI
Sbjct  157  VPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGELSKEVGWNYHETI  202



>gb|ACG48503.1| 60S ribosomal protein L13a [Zea mays]
Length=206

 Score =   291 bits (744),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRG AALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGEAALARLKTYEGVPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            K MVIPDALKVLRLQ GHKYCLLG+L  EVGWN +D I
Sbjct  121  KXMVIPDALKVLRLQPGHKYCLLGELXKEVGWNXHDXI  158



>ref|XP_001774253.1| predicted protein [Physcomitrella patens]
 gb|EDQ60889.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   291 bits (744),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTI  158



>ref|XP_007200528.1| hypothetical protein PRUPE_ppa011553mg [Prunus persica]
 gb|EMJ01727.1| hypothetical protein PRUPE_ppa011553mg [Prunus persica]
Length=206

 Score =   290 bits (743),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVD RHHMLGRLAS++AK+LLNGQR+ VVRC+EI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLASVVAKDLLNGQRIAVVRCDEIAISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RF RKRMNT+PSHGPIHFR+P+KI WRT+RGMIPHKTKRGA ALARLK YEG+PPPYDK 
Sbjct  61   RFRRKRMNTQPSHGPIHFRSPAKIFWRTVRGMIPHKTKRGAEALARLKAYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNH+DTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHFDTI  158



>ref|XP_001763759.1| predicted protein [Physcomitrella patens]
 gb|EDQ71401.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   290 bits (742),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+ VVVDARHHMLGRLASILAKELLNGQ++VVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKIVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTI  158



>ref|XP_010228462.1| PREDICTED: 60S ribosomal protein L13a-4-like [Brachypodium distachyon]
Length=206

 Score =   289 bits (740),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEI +SGGLVRQKMKY 
Sbjct  1    MVSGSGISARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEISVSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALARLK YEGVPPP+D+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALARLKAYEGVPPPFDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQAGHKYC LG+LS EVGWN+ DTI
Sbjct  121  KRMVIPDALKVLRLQAGHKYCQLGELSKEVGWNYQDTI  158



>gb|ABQ57364.1| ribosomal protein L13A [Lupinus luteus]
Length=206

 Score =   289 bits (740),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I A+RVVVDARHHMLGRLASI+AKELLNGQ+VV+VR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGIAAKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRSEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPSKI WRT+RGMIPHKTKRG  ALARLKVYEG+PPP+DK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGEHALARLKVYEGIPPPFDKQ  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KR+V+PDALK LRLQ GHKYCLLG+LSSEVGWN+YDTI
Sbjct  121  KRLVVPDALKGLRLQKGHKYCLLGQLSSEVGWNYYDTI  158



>ref|XP_001765352.1| predicted protein [Physcomitrella patens]
 gb|EDQ69815.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   288 bits (738),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRL+ GHK+CLLG+LS EVGW+HYDTI
Sbjct  121  KRMVIPDALKVLRLKPGHKFCLLGRLSEEVGWHHYDTI  158



>ref|XP_001765905.1| predicted protein [Physcomitrella patens]
 gb|EDQ69226.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   288 bits (738),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+ VVVDARHHMLGRLASILAKELLNGQ+VVVVR EEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKVVVVDARHHMLGRLASILAKELLNGQKVVVVRSEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTI  158



>gb|KCW58066.1| hypothetical protein EUGRSUZ_H00799 [Eucalyptus grandis]
Length=240

 Score =   288 bits (737),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 151/192 (79%), Gaps = 34/192 (18%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGA ALARLK YEGVPPPYDK 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAGALARLKAYEGVPPPYDKT  120

Query  423  KRMVIPDALK----------------------------------VLRLQAGHKYCLLGKL  500
            KRMVIPDALK                                  VLRLQ GHKYCLLG+L
Sbjct  121  KRMVIPDALKYVSCFHLCCVHFGTVFSVVAYVNLMCNLHCDLYRVLRLQKGHKYCLLGRL  180

Query  501  SSEVGWNHYDTI  536
            SSEVGWNHYDTI
Sbjct  181  SSEVGWNHYDTI  192



>ref|NP_001058724.1| Os07g0109500 [Oryza sativa Japonica Group]
 dbj|BAC79560.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAD30642.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 dbj|BAF20638.1| Os07g0109500 [Oryza sativa Japonica Group]
 gb|EAZ02520.1| hypothetical protein OsI_24624 [Oryza sativa Indica Group]
 dbj|BAG88872.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95855.1| unnamed protein product [Oryza sativa Japonica Group]
Length=206

 Score =   286 bits (733),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +C RRVVVDARHHMLGRLAS++AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALA LK ++GVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALANLKAFDGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYCLLG+LS EVGWN++DTI
Sbjct  121  KRMVVPDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTI  158



>ref|XP_001773626.1| predicted protein [Physcomitrella patens]
 gb|EDQ61514.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   286 bits (733),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+ VVVDARHHMLGRLASIL+KELLNGQ+VVVVR EEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGLCAKVVVVDARHHMLGRLASILSKELLNGQKVVVVRSEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFR+P++ILWRTIRGMIPHKTKRGAAAL RLK +EGVP PYDK+
Sbjct  61   RFLRKRMNTKPSKGPIHFRSPARILWRTIRGMIPHKTKRGAAALERLKAFEGVPAPYDKM  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHK+CLLG+LS EVGW+HYDTI
Sbjct  121  KRMVIPDALKVLRLQPGHKFCLLGRLSEEVGWHHYDTI  158



>gb|EMT05694.1| 60S ribosomal protein L13a-4 [Aegilops tauschii]
Length=238

 Score =   286 bits (733),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS + ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALARLK +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALARLKAFEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GH++CLLG+LS EVGWN+++TI
Sbjct  121  KRMVIPDALKVLRLQPGHRFCLLGELSKEVGWNYHETI  158



>ref|XP_008235481.1| PREDICTED: 60S ribosomal protein L13a-1-like [Prunus mume]
Length=206

 Score =   285 bits (730),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS IC +RVVVD RHHMLGRLAS++AK+LLNGQR+ VVR +EI +SGGLVRQKMKY 
Sbjct  1    MVSGSGICLKRVVVDGRHHMLGRLASVVAKDLLNGQRIAVVRSDEIAISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RF RKRMNT+PSHGPIHFR+P+KI WRT+RGMIPHKTKRGA ALARLK YEG+PPPYDK 
Sbjct  61   RFRRKRMNTQPSHGPIHFRSPAKIFWRTVRGMIPHKTKRGAEALARLKAYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNH+DTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHFDTI  158



>gb|EMS52180.1| 60S ribosomal protein L13a-4 [Triticum urartu]
Length=206

 Score =   285 bits (729),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS + ARRVVVDARHHMLGRLASI+AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGVSARRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALARLK +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALARLKAFEGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GH++CLLG+LS EVGWN+++TI
Sbjct  121  KRMVIPDALKVLRLQPGHRFCLLGELSKEVGWNYHETI  158



>ref|XP_008365936.1| PREDICTED: 60S ribosomal protein L13a-1 [Malus domestica]
Length=206

 Score =   284 bits (727),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVD RHHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIPHKTKRGA ALARLKVYEG+P PYDK 
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIPHKTKRGAEALARLKVYEGIPXPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHYDTI  158



>ref|XP_009334926.1| PREDICTED: 60S ribosomal protein L13a-1-like [Pyrus x bretschneideri]
Length=206

 Score =   283 bits (724),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVD  HHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGHHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIPHKTKRGA ALARLKVYEG+PPPYDK 
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIPHKTKRGAEALARLKVYEGIPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRM +PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMAVPDALKVLRLQKGHKYCLLGQLSSEVGWNHYDTI  158



>gb|EAZ38446.1| hypothetical protein OsJ_22825 [Oryza sativa Japonica Group]
Length=206

 Score =   283 bits (723),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +C RRVVVDARHHMLGRLAS++AKELLNGQRVVVVRCEE+C+SGGLVRQKMKY 
Sbjct  1    MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALA LK ++GVP PYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALANLKAFDGVPLPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYCLLG+LS EVGWN++DTI
Sbjct  121  KRMVVPDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTI  158



>ref|XP_008382629.1| PREDICTED: 60S ribosomal protein L13a-1 [Malus domestica]
Length=161

 Score =   280 bits (716),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVD RHHMLGRLA+++AK+LLNGQ + VVR E+I +SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDGRHHMLGRLAAVVAKDLLNGQPIAVVRAEQIAISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNT+PSHGPIH+R+P+KI WRT+RGMIPHKTKRGA ALARLKVYEG+P PYDK 
Sbjct  61   RFLRKRMNTQPSHGPIHYRSPAKIFWRTVRGMIPHKTKRGAEALARLKVYEGIPXPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMV+PDALKVLRLQ GHKYCLLG+LSSEVGWNHYDTI
Sbjct  121  KRMVVPDALKVLRLQKGHKYCLLGQLSSEVGWNHYDTI  158



>sp|O49885.1|RL13A_LUPLU RecName: Full=60S ribosomal protein L13a [Lupinus luteus]
 emb|CAA11283.1| ribosomal protein L13a [Lupinus luteus]
Length=205

 Score =   281 bits (720),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 147/158 (93%), Gaps = 1/158 (1%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS I A+RVVVDARHHMLGRLASI+AKELLNGQ+VV+VR EEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGIAAKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRSEEICISGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIH  APSKI WRT+RGMIPHKTKRG  ALARLKVYEG+PPP+DK 
Sbjct  61   RFLRKRMNTKPSHGPIHC-APSKIFWRTVRGMIPHKTKRGEHALARLKVYEGIPPPFDKQ  119

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KR+V+PDALKVLRLQ GHKYCLLG+LSSEVGWN+YDTI
Sbjct  120  KRLVVPDALKVLRLQKGHKYCLLGQLSSEVGWNYYDTI  157



>gb|ABK22228.1| unknown [Picea sitchensis]
 gb|ABK22389.1| unknown [Picea sitchensis]
 gb|ABK22608.1| unknown [Picea sitchensis]
 gb|ABK23686.1| unknown [Picea sitchensis]
 gb|ABK23694.1| unknown [Picea sitchensis]
 gb|ABK26243.1| unknown [Picea sitchensis]
 gb|ABK26404.1| unknown [Picea sitchensis]
 gb|ABR17228.1| unknown [Picea sitchensis]
 gb|ACN40291.1| unknown [Picea sitchensis]
 gb|ACN40454.1| unknown [Picea sitchensis]
 gb|ACN40588.1| unknown [Picea sitchensis]
 gb|ACN40688.1| unknown [Picea sitchensis]
 gb|ADE77397.1| unknown [Picea sitchensis]
Length=206

 Score =   281 bits (718),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+ VVVDARHHMLGRLASILAKELL+GQRVVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKEVVVDARHHMLGRLASILAKELLHGQRVVVVRCEEICMSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIPHKTKRGAAALARL+ +EGVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHKTKRGAAALARLRAFEGVPPPYDRK  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+DTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFDTI  158



>ref|XP_002964465.1| hypothetical protein SELMODRAFT_166650 [Selaginella moellendorffii]
 ref|XP_002975331.1| hypothetical protein SELMODRAFT_271136 [Selaginella moellendorffii]
 gb|EFJ23532.1| hypothetical protein SELMODRAFT_271136 [Selaginella moellendorffii]
 gb|EFJ34798.1| hypothetical protein SELMODRAFT_166650 [Selaginella moellendorffii]
Length=206

 Score =   278 bits (711),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS  CAR VV+DARHHMLGRLASI AKELLNGQR+V+ RCEEI LSGGLVRQKMKY 
Sbjct  1    MVSGSGACARVVVIDARHHMLGRLASIAAKELLNGQRLVITRCEEIALSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPS GPIHFRAP++ILWRTIRGMIPHKTKRGAAAL RLKV+EG PPPYDK 
Sbjct  61   RFLRKRMNTKPSKGPIHFRAPARILWRTIRGMIPHKTKRGAAALERLKVFEGCPPPYDKT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            K+MV+PDALKVLRL+ GHK+CLLG+LS EVGW+H++TI
Sbjct  121  KKMVVPDALKVLRLKPGHKFCLLGQLSKEVGWHHHETI  158



>ref|XP_004981724.1| PREDICTED: 60S ribosomal protein L13a-4-like isoform X1 [Setaria 
italica]
Length=241

 Score =   277 bits (709),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 151/193 (78%), Gaps = 35/193 (18%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA+R+VVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGVCAKRIVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICLSGGLVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRG-----------------------------  335
            RFLRKRMNTKPSHGPIHFR+P+KILWRTIRG                             
Sbjct  61   RFLRKRMNTKPSHGPIHFRSPAKILWRTIRGYVSSFLDPSPVRRRCFDVPIFQFVGEIFC  120

Query  336  ------MIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGK  497
                  MIPHKTKRG AALARLK YEGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+
Sbjct  121  LLWFCRMIPHKTKRGEAALARLKTYEGVPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGE  180

Query  498  LSSEVGWNHYDTI  536
            LS EVGWN++DTI
Sbjct  181  LSKEVGWNYHDTI  193



>ref|XP_006657401.1| PREDICTED: 60S ribosomal protein L13a-3-like [Oryza brachyantha]
Length=206

 Score =   276 bits (705),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +C RRVVVDAR+HM+GRLAS +AKELLNGQRVVVVRCEE+C+SGG VRQKMKY 
Sbjct  1    MVSGSGVCRRRVVVDARNHMMGRLASAVAKELLNGQRVVVVRCEEMCVSGGPVRQKMKYL  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAPS+I WRT+RGMIPHKT RG AALA LK + GVPPPYD+ 
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPSRIFWRTVRGMIPHKTPRGEAALAALKAFGGVPPPYDRT  120

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG LS EVGWN++DTI
Sbjct  121  KRMVIPDALKVLRLQPGHKYCLLGHLSKEVGWNYHDTI  158



>gb|KGN66498.1| hypothetical protein Csa_1G615170 [Cucumis sativus]
Length=202

 Score =   265 bits (677),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 4/158 (3%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRL+SI+AKELLNGQ+VVVVRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICISGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KILWRTIRGMIPHKTKRGAAALARLK YEG+   Y+ V
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTKRGAAALARLKAYEGL-CIYELV  119

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
               ++    +VLRLQAGHKYCLLG+LSSEVGWNHYDTI
Sbjct  120  ---MLVWKFRVLRLQAGHKYCLLGRLSSEVGWNHYDTI  154



>gb|KDO65930.1| hypothetical protein CISIN_1g028649mg [Citrus sinensis]
Length=130

 Score =   245 bits (625),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHMLGRLASI+AKELLNGQ+VV VRCEEIC+SGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPIHFRAP+KI WRT+RGMIPHKTKRGAAALARLK YEGVP PYDKV
Sbjct  61   RFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALARLKAYEGVPAPYDKV  120

Query  423  KRMVIPDALK  452
            KRMVIPDALK
Sbjct  121  KRMVIPDALK  130



>ref|XP_004955326.1| PREDICTED: 60S ribosomal protein L13a-3-like [Setaria italica]
Length=200

 Score =   246 bits (628),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 133/158 (84%), Gaps = 6/158 (4%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSG       VVVDAR HM+GRLAS +AKELL GQRV V+RCEE+ LSGGLVRQK ++ 
Sbjct  1    MVSGC------VVVDARGHMMGRLASAVAKELLKGQRVAVLRCEEMTLSGGLVRQKSRFL  54

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGP+H R+P++I WR +RGM+PHKT RG AALARL+ ++GVPPPYD+ 
Sbjct  55   RFLRKRMNTKPSHGPVHHRSPARIFWRAVRGMVPHKTARGEAALARLQAFDGVPPPYDRT  114

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG LS EVGWN+ DTI
Sbjct  115  KRMVIPDALKVLRLQKGHKYCLLGDLSKEVGWNYQDTI  152



>ref|XP_005643971.1| ribosomal protein L13a component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19427.1| ribosomal protein L13a component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=185

 Score =   240 bits (613),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+DAR HMLGRLASI+AK+ LNGQ +VV R EEI +SGGLVRQKMKY RFLRKRMN+ P
Sbjct  5    VVIDARGHMLGRLASIVAKQALNGQHIVVTRAEEINVSGGLVRQKMKYERFLRKRMNSNP  64

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GPIHFRAPS+I WRT+RGM+PHKTKRGAAAL RLK +EGVPPPYDKVKRMV+PDALKV
Sbjct  65   KKGPIHFRAPSRIFWRTVRGMVPHKTKRGAAALERLKTFEGVPPPYDKVKRMVVPDALKV  124

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRLQ GHK+C LG L++ VGW H  ++
Sbjct  125  LRLQHGHKFCKLGDLAASVGWKHKASV  151



>ref|XP_002953387.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ45697.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=185

 Score =   233 bits (594),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D R HMLGRLAS++AK++L+GQ++VVVR E+I +SGGLVRQKMKY RFLRKRMNT P
Sbjct  5    VVIDGRAHMLGRLASVVAKQILSGQQIVVVRAEDITISGGLVRQKMKYDRFLRKRMNTNP  64

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPS+I WRT+RGMIPHKT RGAAAL RLK +EGVP PYDKVKRMV+PDALKV
Sbjct  65   TRGPFHFRAPSRIFWRTVRGMIPHKTARGAAALERLKAFEGVPHPYDKVKRMVVPDALKV  124

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRLQ GH+ C LG LS+ VGW H   +
Sbjct  125  LRLQHGHRCCKLGDLSAAVGWKHQAAV  151



>ref|XP_001692909.1| ribosomal protein L13a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP03478.1| ribosomal protein L13a [Chlamydomonas reinhardtii]
Length=185

 Score =   233 bits (593),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D R HMLGRLAS++AK++L GQ++VVVR EEI +SGGLVRQKMKY RFLRKRMNT P
Sbjct  5    VVIDGRAHMLGRLASVVAKQILAGQQIVVVRAEEITISGGLVRQKMKYDRFLRKRMNTNP  64

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPS+I WRT+RGMIPHKT RGAAAL RLK +EG+P PYDKVKR+V+PDALKV
Sbjct  65   TRGPFHFRAPSRIFWRTVRGMIPHKTARGAAALERLKAFEGIPHPYDKVKRLVVPDALKV  124

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRLQ GH+ C LG LS+ VGW H   +
Sbjct  125  LRLQHGHRNCKLGDLSASVGWKHQAAV  151



>ref|XP_010661466.1| PREDICTED: 60S ribosomal protein L13a-2-like [Vitis vinifera]
Length=249

 Score =   233 bits (595),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/116 (94%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +3

Query  189  CEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA  368
            CEEICLSGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA
Sbjct  121  CEEICLSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAA  180

Query  369  ALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
             LARLK YEG+PPPYDK+KRMVIPDALKVLRLQAGHKYCLLG+LS EVGWNHYDTI
Sbjct  181  TLARLKAYEGIPPPYDKMKRMVIPDALKVLRLQAGHKYCLLGRLSLEVGWNHYDTI  236



>ref|XP_005849945.1| hypothetical protein CHLNCDRAFT_17540, partial [Chlorella variabilis]
 gb|EFN57843.1| hypothetical protein CHLNCDRAFT_17540, partial [Chlorella variabilis]
Length=180

 Score =   229 bits (585),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  84   CARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRM  263
            C + VVVD R HMLGRLAS+LAK+LL+GQ VV VRCEEI +SGG+VRQK KY RFLRKR 
Sbjct  1    CVQTVVVDCRGHMLGRLASVLAKQLLSGQHVVCVRCEEINISGGMVRQKAKYERFLRKRS  60

Query  264  NTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPD  443
             T P  G + FRAPS+ILWRT+RGM PHKT RGAAAL RLK +EG+P PYDKVKRMVIPD
Sbjct  61   VTNPRRGAVKFRAPSRILWRTVRGMTPHKTARGAAALERLKAFEGIPAPYDKVKRMVIPD  120

Query  444  ALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            ALKVLRLQ GH+YC LG L+S VGW H + +
Sbjct  121  ALKVLRLQHGHRYCQLGNLASSVGWKHEEAV  151



>sp|P93099.1|RL13A_CYAPA RecName: Full=60S ribosomal protein L13a [Cyanophora paradoxa]
 emb|CAA71090.1| ribosomal protein L13a [Cyanophora paradoxa]
Length=200

 Score =   228 bits (582),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VVVD R H+LGRLA+ LAKELLNGQRVV VR EEI +SG L R K+K+H FL+KRMNT P
Sbjct  6    VVVDCRGHLLGRLAATLAKELLNGQRVVAVRTEEINISGSLFRNKLKFHAFLKKRMNTNP  65

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GP HFR+P++ILWRTIRGMIPHKT RGAAAL RLK +EGVPPPYDK+KRMVIP AL+V
Sbjct  66   RRGPFHFRSPARILWRTIRGMIPHKTPRGAAALERLKAFEGVPPPYDKMKRMVIPQALRV  125

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G K+C+LG+L++EVGW H D +
Sbjct  126  LRLKPGRKFCVLGRLATEVGWRHSDLV  152



>ref|NP_001051312.2| Os03g0755700 [Oryza sativa Japonica Group]
 dbj|BAF13226.2| Os03g0755700 [Oryza sativa Japonica Group]
Length=178

 Score =   226 bits (575),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 123/158 (78%), Gaps = 25/158 (16%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA RVVVDARHHML RLASI+AKELLNG+RVVV                    
Sbjct  1    MVSGSGVCAPRVVVDARHHMLSRLASIIAKELLNGKRVVV--------------------  40

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
                 RMNTKPSHGPIHFR+P+KILWRT+RGMIPHKTKRG AALARLK YE V PPYD+ 
Sbjct  41   -----RMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEVVTPPYDRT  95

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI
Sbjct  96   KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTI  133



>gb|AAR01666.1| putative ribosomal protein L13a [Oryza sativa Japonica Group]
Length=172

 Score =   223 bits (567),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 122/158 (77%), Gaps = 26/158 (16%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS +CA RVVVDARHHML RLASI+AKELLNG+RVV                     
Sbjct  1    MVSGSGVCAPRVVVDARHHMLSRLASIIAKELLNGKRVV---------------------  39

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
                 RMNTKPSHGPIHFR+P+KILWRT+RGMIPHKTKRG AALARLK YE V PPYD+ 
Sbjct  40   -----RMNTKPSHGPIHFRSPAKILWRTVRGMIPHKTKRGEAALARLKAYEVVTPPYDRT  94

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KRMVIPDALKVLRLQ GHKYCLLG+LS EVGWN+YDTI
Sbjct  95   KRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTI  132



>ref|XP_001630812.1| predicted protein [Nematostella vectensis]
 gb|EDO38749.1| predicted protein [Nematostella vectensis]
Length=201

 Score =   223 bits (569),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +3

Query  90   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  269
            +++V+D   H+LGRLAS +AK +L+GQRVVVVRCE+IC+SG   R K+KY  FLRKR NT
Sbjct  5    KQIVIDGAGHLLGRLASTVAKSILSGQRVVVVRCEKICISGNFYRNKLKYLDFLRKRTNT  64

Query  270  KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL  449
            KPSHGP HFRAPS+I WRT+RGMIPHKTK+G  A+ R+KV++GVPPPYDK KRMV+P AL
Sbjct  65   KPSHGPFHFRAPSRIFWRTVRGMIPHKTKKGTEAMNRMKVFDGVPPPYDKEKRMVVPSAL  124

Query  450  KVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            KV+RL+ G K+C+LG+LS EVGW + D +
Sbjct  125  KVIRLKPGRKFCVLGRLSHEVGWKYQDIL  153



>gb|AAX92709.1| 60S ribosomal protein L13a [Picea abies]
Length=170

 Score =   219 bits (558),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +3

Query  171  RVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHK  350
            RVVVVRCEEIC+SGGLVRQKMKY RFLRKRMNTKPSHGPIHFRAPS+ILWRTIRGMIPHK
Sbjct  1    RVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHK  60

Query  351  TKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYD  530
            TKRGAAALARL+ +EGVPPPYD+ KRMVIPDALKVLRLQ GHKYCLLG+LS EVGW+H+D
Sbjct  61   TKRGAAALARLRAFEGVPPPYDRKKRMVIPDALKVLRLQPGHKYCLLGRLSKEVGWHHFD  120

Query  531  TI  536
            TI
Sbjct  121  TI  122



>emb|CDS32619.1| ribosomal protein rpl13a [Hymenolepis microstoma]
Length=202

 Score =   220 bits (560),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+DAR H+LGRLASI+AK LLNGQ++VVVRCEEI +SG L R K+KYH FLRKRMNT P
Sbjct  8    IVIDARDHLLGRLASIVAKTLLNGQKIVVVRCEEINISGSLYRNKLKYHEFLRKRMNTNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAP+KI WRT+RGM+PHK  RG  ALA+LK +EGVPPPYDK KR+V+P AL+V
Sbjct  68   SRGPYHFRAPAKIFWRTVRGMLPHKLYRGKTALAKLKCFEGVPPPYDKKKRVVVPSALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+   K+C L +LSSEVGW + + I
Sbjct  128  LRLKQRRKFCTLSRLSSEVGWKYENVI  154



>gb|EUB62915.1| 60S ribosomal protein L13a [Echinococcus granulosus]
 emb|CDI99730.1| ribosomal protein rpl13a [Echinococcus multilocularis]
 emb|CDS18961.1| ribosomal protein rpl13a [Echinococcus granulosus]
 emb|CDS37012.1| ribosomal protein rpl13a [Echinococcus multilocularis]
Length=202

 Score =   218 bits (555),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++DAR H+LGRLASI+AK LL GQR+VVVRCEEI +SG L R K+KYH FLRKRMNT P
Sbjct  8    IIIDARGHLLGRLASIVAKTLLQGQRIVVVRCEEINISGSLYRNKLKYHEFLRKRMNTNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            SHGP H+RAP+KI WRT+RGM+PHK  RG  AL+RLK +EG+PPPYDK KR+V+P AL+V
Sbjct  68   SHGPYHYRAPAKIFWRTVRGMLPHKLYRGKEALSRLKCFEGIPPPYDKKKRVVVPSALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+   K+C L +LSSEVGW + + I
Sbjct  128  LRLKQRRKFCTLSRLSSEVGWKYENVI  154



>ref|XP_002507247.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68505.1| predicted protein [Micromonas sp. RCC299]
Length=199

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D R H+LGRLASI+AK+LL GQ VVVVR E I +SGG+VR + +Y  F R RMNTKP
Sbjct  5    VVIDGRGHLLGRLASIVAKQLLQGQHVVVVRAEGIVISGGIVRARQRYDYFKRLRMNTKP  64

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            SHGP H+ AP+++LWRT+RGM+P+KT RGA A  R K YEG+PPPYDKVKR V+P+ALKV
Sbjct  65   SHGPFHYAAPARMLWRTVRGMLPYKTTRGACAFERFKAYEGIPPPYDKVKRAVVPEALKV  124

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL AGHKYC+LG LS +VGW H  T+
Sbjct  125  LRLAAGHKYCVLGDLSHQVGWKHKTTV  151



>ref|XP_003054822.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60074.1| predicted protein [Micromonas pusilla CCMP1545]
Length=199

 Score =   216 bits (550),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            V++D R H+LGRLASI+AK+LL GQ VVVVR E I +SGG+VR + KY  F R RMNTKP
Sbjct  5    VIIDGRGHLLGRLASIVAKQLLQGQHVVVVRAEGIVISGGMVRAQQKYDFFKRLRMNTKP  64

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            SHGP H+ +PS++LWRT+RGM+P+KTKRGAAA  R K YEG+PPPYDK KR V+P+ALKV
Sbjct  65   SHGPFHYASPSRMLWRTVRGMVPYKTKRGAAAFERFKSYEGIPPPYDKCKRAVVPEALKV  124

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL AGHKYC+LG LS  VGW H  T+
Sbjct  125  LRLGAGHKYCVLGDLSHRVGWKHQATV  151



>ref|XP_005833834.1| large subunit ribosomal protein L13Ae_2, cytoplasmic [Guillardia 
theta CCMP2712]
 gb|EKX46854.1| large subunit ribosomal protein L13Ae_2, cytoplasmic [Guillardia 
theta CCMP2712]
Length=177

 Score =   212 bits (540),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VVVD R H+LGRLASI+AKELLNGQRVV+VRCEE+ +SG  +R K+ +  +LRKR N+ P
Sbjct  6    VVVDCRGHLLGRLASIIAKELLNGQRVVLVRCEEVNISGAFIRNKLLFMSYLRKRKNSNP  65

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+++WRTIR M+ HKT R  AAL RLKV++GVPPPYDKVKRMV+PDAL+V
Sbjct  66   SSGPYHFRAPSRMVWRTIRAMMKHKTPRCQAALDRLKVFDGVPPPYDKVKRMVMPDALRV  125

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G KY  LG++ SEVGW H DT+
Sbjct  126  LRLRPGRKYTNLGRMCSEVGWKHRDTV  152



>ref|XP_009035047.1| hypothetical protein AURANDRAFT_58864 [Aureococcus anophagefferens]
 gb|EGB10230.1| hypothetical protein AURANDRAFT_58864 [Aureococcus anophagefferens]
Length=199

 Score =   212 bits (540),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            V+VD R HMLGRLASI+AKELL GQ+VVVVRCE++C+SG LVR K+K+  FL+KR NT P
Sbjct  7    VLVDGRTHMLGRLASIIAKELLCGQKVVVVRCEQLCVSGSLVRNKVKFTAFLKKRTNTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GPIH+R+P+++LWRT+RGM+PHKT RG  ALARL+ +EGVPPPYDK+K+MV+P+ALKV
Sbjct  67   KRGPIHYRSPARMLWRTVRGMLPHKTHRGQQALARLQCFEGVPPPYDKMKKMVVPEALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G ++ +L +L+SE GW H   I
Sbjct  127  LRLKPGRRFTVLARLASEFGWKHEALI  153



>gb|EPZ33870.1| 60S ribosomal protein L13a [Rozella allomycis CSF55]
Length=201

 Score =   212 bits (539),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            V++D + H+LGRLASI+AK+LL GQ+VVVVRCEEI +SG   R K+KY  F+RKR    P
Sbjct  7    VIIDGKGHLLGRLASIVAKQLLKGQKVVVVRCEEINISGSFFRNKLKYAEFVRKRCVVNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPS+I WR +RGMIPHKT RGAAAL R+KV+EGVP PYDKVKR+V+PDAL+V
Sbjct  67   SRGPFHFRAPSRIFWRVVRGMIPHKTARGAAALERMKVFEGVPSPYDKVKRVVVPDALRV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G K+C+L +LS E GW + + +
Sbjct  127  LRLKPGRKFCVLSRLSQEYGWKYQEVV  153



>gb|EWM30220.1| 60s ribosomal protein l13a [Nannochloropsis gaditana]
Length=213

 Score =   212 bits (540),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +3

Query  87   ARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMN  266
            ++ VV+D R H+LGRL+SI+AKELL+GQ+VVVVRCEE+ +SGGLVR   +Y +FLRKR N
Sbjct  5    SKEVVIDGRGHLLGRLSSIVAKELLSGQKVVVVRCEELMISGGLVRNHTRYMQFLRKRTN  64

Query  267  TKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDA  446
            T P  GP H+RAPS+ILWRTIRGM+PHKT RGA ALARL  +EG+P PYD  KR+V+P A
Sbjct  65   TNPKRGPFHYRAPSRILWRTIRGMLPHKTFRGAQALARLTTFEGIPAPYDTKKRVVVPQA  124

Query  447  LKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LK+LRL+ G ++C L +L+ EVGW H D +
Sbjct  125  LKILRLKPGRRFCTLSRLAHEVGWGHRDLV  154



>ref|NP_001187674.1| 60S ribosomal protein l13a [Ictalurus punctatus]
 gb|ADO28968.1| 60S ribosomal protein l13a [Ictalurus punctatus]
Length=202

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++DAR H+LGRLASI AK LL GQ+VVVVRCEEI +SG L R K+KY  FLRKRMNT P
Sbjct  8    IIIDARGHLLGRLASITAKTLLQGQKVVVVRCEEINISGSLYRNKLKYLDFLRKRMNTNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            SHGP H+RAPSKI WRT+RGM+PHK  RG  AL +LK +EGVPPPYDK KR+V+P AL+V
Sbjct  68   SHGPYHYRAPSKIFWRTVRGMLPHKLYRGKEALRKLKCFEGVPPPYDKKKRVVVPSALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+   K+C L +LSSEVGW + + I
Sbjct  128  LRLKQRRKFCTLSRLSSEVGWKYENVI  154



>ref|XP_006292546.1| hypothetical protein CARUB_v10018781mg, partial [Capsella rubella]
 gb|EOA25444.1| hypothetical protein CARUB_v10018781mg, partial [Capsella rubella]
Length=120

 Score =   208 bits (530),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 115/158 (73%), Gaps = 39/158 (25%)
 Frame = +3

Query  63   MVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYH  242
            MVSGS ICA+RVVVDARHHM+GRLASI AKELLNGQ+VV+VRCEEICLSGGLVRQKMKY 
Sbjct  1    MVSGSGICAKRVVVDARHHMIGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM  60

Query  243  RFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKV  422
            RFLRKRMNTKPSHGPI+FRAPSKI WRT+RG                             
Sbjct  61   RFLRKRMNTKPSHGPIYFRAPSKIFWRTVRG-----------------------------  91

Query  423  KRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
                      VLRLQAGHKYCLLG+LSSEVGWNHYD+I
Sbjct  92   ----------VLRLQAGHKYCLLGRLSSEVGWNHYDSI  119



>ref|XP_002436282.1| ribosomal protein L13A, putative [Ixodes scapularis]
 gb|EEC09112.1| ribosomal protein L13A, putative [Ixodes scapularis]
Length=205

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = +3

Query  81   ICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKR  260
            I ++ +++D + H+LGRL++++AK LL+GQRVVVVRCE IC+SG   R K+KY  FLRKR
Sbjct  4    ISSKPIIIDGQGHLLGRLSALIAKTLLHGQRVVVVRCEGICISGSFFRSKLKYLSFLRKR  63

Query  261  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  440
             N  P  GP HFRAPSKILWRT+RGM+PHKTKRGA AL RLK++EGVPPPYD+ KRMV+P
Sbjct  64   CNVNPKRGPYHFRAPSKILWRTVRGMVPHKTKRGALALDRLKMFEGVPPPYDRKKRMVVP  123

Query  441  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
             AL+VLRL    KYC LG+L  EVGW + + I
Sbjct  124  SALRVLRLNPRRKYCTLGRLGHEVGWKYQNVI  155



>ref|XP_004349662.1| ribosomal protein L13, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR22573.1| ribosomal protein L13, putative [Acanthamoeba castellanii str. 
Neff]
Length=204

 Score =   210 bits (534),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLASI+AK++LNGQR+VVVRCEEI +SG   R K+KY  FL+K  N +P
Sbjct  10   LVIDGRGHLLGRLASIVAKQILNGQRLVVVRCEEINVSGSFFRNKLKYLSFLKKCSNVRP  69

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            +HGP H+RAPSKI WRT+RGM+ HKT RGA AL RLKV+EGVPPPYDK+KRMV P AL+V
Sbjct  70   THGPYHYRAPSKIFWRTVRGMVAHKTARGAEALGRLKVFEGVPPPYDKMKRMVCPAALRV  129

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G  Y ++G+LS EVGW H  T+
Sbjct  130  LRLKPGRAYTVIGRLSEEVGWKHAATV  156



>gb|ABW23219.1| ribosomal protein rpl13a [Eurythoe complanata]
Length=202

 Score =   210 bits (534),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+DAR HMLGRLASI+AK +L GQ VV+VRCE I +SG   R K+KY  FLRKR NTKP
Sbjct  7    IVIDARGHMLGRLASIVAKTILQGQNVVIVRCEGINISGNFYRNKLKYLDFLRKRCNTKP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP H+RAPSKI WRT+RGM+PHK KRG  AL R+KV+EG+PPPYDK KRMV+P ALKV
Sbjct  67   SRGPYHYRAPSKIFWRTVRGMLPHKLKRGKEALDRMKVFEGIPPPYDKEKRMVVPAALKV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LR++   K+C+LG+LS EVGW + + I
Sbjct  127  LRVKPRRKFCVLGRLSHEVGWKYQNVI  153



>ref|XP_011112396.1| hypothetical protein H072_6613 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39543.1| hypothetical protein H072_6613 [Dactylellina haptotyla CBS 200.50]
Length=199

 Score =   209 bits (533),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+LLNGQ++VVVRCE++ +SG   R K+KYH +LRK      
Sbjct  8    VVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEDMNISGEFFRAKLKYHAYLRKATRYNK  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            +HGP HFRAPS+I ++ +RGMIPHKT RG AA+ RLKV+EGVPPPYDK KRMV+P AL+V
Sbjct  68   THGPFHFRAPSRIFYKAVRGMIPHKTARGTAAMERLKVFEGVPPPYDKKKRMVVPQALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G KYC +G+LS EVGW + D +
Sbjct  128  LRLRPGRKYCTIGRLSKEVGWKYADVV  154



>ref|XP_004226142.1| PREDICTED: 60S ribosomal protein L13a-like [Ciona intestinalis]
Length=206

 Score =   209 bits (533),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  99   VVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKPS  278
            ++DA+ H+LGRLA+++AK LLNGQ++VVVRCE I +SG   R K+KY  FLRKR+ T P 
Sbjct  10   IIDAKDHLLGRLAALIAKNLLNGQKIVVVRCESILISGNFYRNKLKYLDFLRKRIRTNPK  69

Query  279  HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKVL  458
             GP HFRAPSKILWRT+RGM+PHK KRGA AL RLKV+EGVPPPYDK KRMV+P  +KV+
Sbjct  70   RGPFHFRAPSKILWRTVRGMLPHKLKRGAEALDRLKVFEGVPPPYDKKKRMVVPSCMKVV  129

Query  459  RLQAGHKYCLLGKLSSEVGWNHYDTI  536
            +L+   K+ LL +LSSEVGW + D I
Sbjct  130  KLKPKRKFALLSRLSSEVGWKYNDVI  155



>emb|CCI10404.1| unnamed protein product [Albugo candida]
Length=214

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VVVD R H+LGRLAS++AKELL GQ+VV VRCE + +SG  VR K+K+ +FL KR  T P
Sbjct  7    VVVDCRGHLLGRLASLIAKELLQGQQVVAVRCEALEISGSHVRNKVKFMQFLNKRTATNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GPIH+RAPS++LWRTIRGM+PHKT RGAAAL RLK ++GVP PYDK KRMVIPDAL+V
Sbjct  67   KKGPIHYRAPSRMLWRTIRGMLPHKTARGAAALQRLKAFDGVPSPYDKQKRMVIPDALRV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            +RL+A  ++ +LG+L+SEVGW H D +
Sbjct  127  IRLKANRRFTILGQLASEVGWKHGDLV  153



>ref|XP_003384047.1| PREDICTED: 60S ribosomal protein L13a-like [Amphimedon queenslandica]
Length=202

 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            ++VDA+ H+LGRLASI+AK+LLNGQ++V++RCE I +SG + R K+KY +FLR R N KP
Sbjct  7    IIVDAKDHLLGRLASIVAKQLLNGQKIVILRCEYINISGSIYRNKVKYLKFLRLRCNVKP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAPSKI WRT+RGM+PHKT+RG AAL RL VYEG+PP Y K KR+V+P AL++
Sbjct  67   SRGPFHFRAPSKIFWRTVRGMLPHKTERGKAALGRLSVYEGIPPMYIKKKRVVVPQALRI  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G K+C+LG+LS EVGW + D +
Sbjct  127  LRLKPGRKFCVLGRLSHEVGWKYRDVM  153



>ref|XP_002112893.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV25003.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=202

 Score =   208 bits (529),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++D R+H+LGRLAS +AK +L+GQRVVVVRCEE+ +SGG  R K+KY  FLRKR N  P
Sbjct  7    IIIDGRNHLLGRLASTIAKTILSGQRVVVVRCEELNISGGFYRNKLKYLDFLRKRCNVNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GP HFRAPS+ILWRT+RGM+PHKTKRG  AL RLK +EG+P PYDK+KR+V+P AL+V
Sbjct  67   RRGPFHFRAPSRILWRTVRGMVPHKTKRGEEALNRLKTFEGIPAPYDKMKRLVVPAALRV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            ++L+   K+ ++GKLSSEVGW + D I
Sbjct  127  VQLKPRRKFTVVGKLSSEVGWKYNDII  153



>ref|XP_009848042.1| hypothetical protein NEUTE1DRAFT_115903 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO60857.1| hypothetical protein NEUTE1DRAFT_115903 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ75152.1| putative ribosomal protein l13a [Neurospora tetrasperma FGSC 
2509]
Length=202

 Score =   208 bits (529),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+LLNGQ++VVVRCE + +SG   R K+KYH +LRK     P
Sbjct  8    VVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHSYLRKMTRYNP  67

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EGVPPPYDK K+MV+P AL+
Sbjct  68   TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVPQALR  127

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G K+C +G+LSSEVGW + D +
Sbjct  128  VLRLQPGRKFCTVGRLSSEVGWKYEDVV  155



>ref|XP_011394487.1| 60S ribosomal protein L16, variant [Neurospora crassa OR74A]
 sp|Q9P720.1|RL16_NEUCR RecName: Full=60S ribosomal protein L16; AltName: Full=Cytoplasmic 
ribosomal protein 46 [Neurospora crassa OR74A]
 emb|CAB88562.1| probable ribosomal protein l13a [Neurospora crassa]
 gb|ESA42523.1| 60S ribosomal protein L16, variant [Neurospora crassa OR74A]
Length=202

 Score =   208 bits (529),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+LLNGQ++VVVRCE + +SG   R K+KYH +LRK     P
Sbjct  8    VVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHSYLRKMTRYNP  67

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EGVPPPYDK K+MV+P AL+
Sbjct  68   TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVPQALR  127

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G K+C +G+LSSEVGW + D +
Sbjct  128  VLRLQPGRKFCTVGRLSSEVGWKYEDVV  155



>ref|XP_011125712.1| hypothetical protein AOL_s00169g53 [Arthrobotrys oligospora ATCC 
24927]
 gb|EGX45447.1| hypothetical protein AOL_s00169g53 [Arthrobotrys oligospora ATCC 
24927]
Length=199

 Score =   207 bits (528),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+LLNGQ++VVVRCE++ +SG   R K+KYH +LRK      
Sbjct  8    VVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEDLNISGEFFRAKLKYHAYLRKATRFNK  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            +HGP HFRAPS+I ++ +RGM+PHKT RG AA+ RLKV+EGVPPPYDK KRMV+P AL+V
Sbjct  68   THGPFHFRAPSRIFYKAVRGMMPHKTARGTAAMERLKVFEGVPPPYDKKKRMVVPQALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G KYC +G+LS EVGW + D +
Sbjct  128  LRLRPGRKYCSVGRLSKEVGWKYADVV  154



>ref|XP_003348078.1| 60S ribosomal protein L16 [Sordaria macrospora k-hell]
 emb|CCC11219.1| unnamed protein product [Sordaria macrospora k-hell]
Length=202

 Score =   208 bits (529),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+LLNGQ++VVVRCE + +SG   R K+KYH +LRK     P
Sbjct  8    VVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHSYLRKMTRYNP  67

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EGVPPPYDK K+MV+P AL+
Sbjct  68   TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVPQALR  127

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G K+C +G+LSSEVGW + D +
Sbjct  128  VLRLQPGRKFCTVGRLSSEVGWKYEDVV  155



>ref|XP_008861430.1| ribosomal protein L13 [Aphanomyces invadans]
 gb|ETW10019.1| ribosomal protein L13 [Aphanomyces invadans]
Length=203

 Score =   207 bits (528),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D R H++GRLAS++AKELL GQ VV VRCEE+ +SG LVR K+K+ +FL K+  T P
Sbjct  7    VVIDCRAHLVGRLASLVAKELLLGQHVVAVRCEELNISGSLVRNKVKFLQFLNKKSCTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GP+H+RAPS++ WRT+RGM+PHKT RGAAAL RLKV++GVP PYDKVKRMV+PDAL+V
Sbjct  67   KKGPLHYRAPSRMFWRTVRGMLPHKTARGAAALQRLKVFDGVPSPYDKVKRMVVPDALRV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+A  +Y  LG+LSS+VGW H+D +
Sbjct  127  LRLKANRRYTNLGQLSSQVGWRHHDLV  153



>gb|KFM61542.1| 60S ribosomal protein L13a, partial [Stegodyphus mimosarum]
Length=205

 Score =   208 bits (529),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++D R H+LGRLA++ AK LLNGQ+VVVVRC+ I +SG   R K+KY  FLRKR N  P
Sbjct  9    IIIDGRGHLLGRLAALTAKTLLNGQKVVVVRCDGINISGSFFRSKLKYLSFLRKRCNVNP  68

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPSKI WRT+RGM+PHKTKRG AAL RLKVYEG+PPPYDK KRMV+P AL+V
Sbjct  69   ARGPFHFRAPSKIFWRTVRGMLPHKTKRGDAALERLKVYEGIPPPYDKKKRMVVPSALRV  128

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            L+L    KYC L +LS EVGW + + I
Sbjct  129  LKLHPRRKYCSLSRLSHEVGWKYQNVI  155



>gb|AAX48846.1| L13a [Suberites domuncula]
Length=199

 Score =   207 bits (528),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +3

Query  90   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  269
            R+V++D + H+LGRLASI+AK +L GQR+V+VRCE+I +SG   R K+KY +FL  R N 
Sbjct  2    RQVLIDGKGHLLGRLASIVAKCILQGQRIVIVRCEDINISGSFYRNKLKYLKFLNLRCNV  61

Query  270  KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL  449
             P  GP HFRAPS+I WRT+RGM+PHKTKRG  AL RLKV+EG+PPPYDK KRMV+P+AL
Sbjct  62   NPKRGPFHFRAPSRIFWRTVRGMVPHKTKRGMEALNRLKVFEGIPPPYDKQKRMVVPNAL  121

Query  450  KVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            +VLRL+ G KYC +G++S E+GW + D +
Sbjct  122  RVLRLKPGRKYCDIGRISHEIGWKYKDVV  150



>ref|XP_011394488.1| 60S ribosomal protein L16 [Neurospora crassa OR74A]
 gb|ESA42522.1| 60S ribosomal protein L16 [Neurospora crassa OR74A]
 gb|KHE87785.1| hypothetical protein GE21DRAFT_7643 [Neurospora crassa]
Length=231

 Score =   209 bits (531),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 127/166 (77%), Gaps = 6/166 (4%)
 Frame = +3

Query  45   REDA-AKMVSGSRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLV  221
            RE + AKM S   +    VV+D + H+LGRLASI+AK+LLNGQ++VVVRCE + +SG   
Sbjct  23   RESSPAKMSSFESV----VVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFF  78

Query  222  RQKMKYHRFLRKRMNTKPSHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEG  398
            R K+KYH +LRK     P+ G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EG
Sbjct  79   RAKLKYHSYLRKMTRYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEG  138

Query  399  VPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VPPPYDK K+MV+P AL+VLRLQ G K+C +G+LSSEVGW + D +
Sbjct  139  VPPPYDKKKKMVVPQALRVLRLQPGRKFCTVGRLSSEVGWKYEDVV  184



>emb|CCQ18645.1| 60S ribosomal protein L13a [Sycon ciliatum]
Length=201

 Score =   207 bits (527),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = +3

Query  81   ICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKR  260
            +  R +++D R+H+LGRLAS +AK LL+GQRVVVVRCEEI +SG   R K+KY ++LR R
Sbjct  2    VFERLILIDGRNHLLGRLASTIAKALLSGQRVVVVRCEEINISGSFYRNKLKYLKYLRLR  61

Query  261  MNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIP  440
             N KPS GP HFRAPSK+L R +RGMIPHK+ RGAAA+ RLKV+EGVPPPYD++K+MVIP
Sbjct  62   CNVKPSRGPFHFRAPSKMLVRVVRGMIPHKSVRGAAAMKRLKVFEGVPPPYDQMKKMVIP  121

Query  441  DALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
             AL+V+RL+ G K+C LG+++ EVGW + D +
Sbjct  122  SALRVIRLRPGRKFCRLGRIAHEVGWKYQDVV  153



>ref|XP_008602497.1| 60S ribosomal protein L16 [Beauveria bassiana ARSEF 2860]
 gb|EJP61841.1| 60S ribosomal protein L16 [Beauveria bassiana ARSEF 2860]
Length=202

 Score =   207 bits (528),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VVVD + H+LGRLASI+AK+LLNGQ+VVVVRCE + +SG   R K+KYH +LRK     P
Sbjct  8    VVVDGKGHLLGRLASIVAKQLLNGQKVVVVRCEALNISGEFFRSKLKYHAYLRKMTRFNP  67

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EGVPPPYDK K+MV+P AL+
Sbjct  68   TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVPQALR  127

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G KYC +G+LS EVGW + D +
Sbjct  128  VLRLQPGRKYCTVGRLSHEVGWKYQDVV  155



>gb|EHK49489.1| hypothetical protein TRIATDRAFT_297491 [Trichoderma atroviride 
IMI 206040]
Length=202

 Score =   207 bits (527),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VVVD + H+LGRLASI+AK+LLNGQ+VVVVRCE + +SG   R K+KYH +LRK     P
Sbjct  8    VVVDGKGHLLGRLASIVAKQLLNGQKVVVVRCEALNISGEFFRAKLKYHAYLRKMTRYNP  67

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EGVPPPYDK K+MV+P AL+
Sbjct  68   TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVPQALR  127

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G KYC +G+LS EVGW + D +
Sbjct  128  VLRLQPGRKYCTVGRLSHEVGWKYQDVV  155



>gb|ESA01198.1| hypothetical protein GLOINDRAFT_334214 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX57733.1| ribosomal 60S subunit protein L16A [Rhizophagus irregularis DAOM 
197198w]
Length=202

 Score =   207 bits (527),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VVVD + H++GRLASI+AK++L GQ+VV+VR EE+ +SG   R K+KYH +LRKRM   P
Sbjct  8    VVVDGKGHLIGRLASIVAKQILTGQKVVIVRAEELNVSGSFFRNKIKYHDYLRKRMIVNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPSK+ ++TIRGMIPHKT RGA AL RLK++EG+PPPYDK KRMV+PDAL+V
Sbjct  68   ARGPFHFRAPSKLFYKTIRGMIPHKTARGAEALKRLKIFEGIPPPYDKKKRMVVPDALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G KY  + +LS+EVGW + + +
Sbjct  128  LRLKPGRKYTTISRLSNEVGWKYGEVV  154



>ref|XP_009822374.1| ribosomal protein L13 [Aphanomyces astaci]
 gb|ETV87511.1| ribosomal protein L13 [Aphanomyces astaci]
Length=203

 Score =   207 bits (527),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D R H++GRLAS++AKELL GQ VV VRCEE+ +SG LVR K+K+ +FL K+  T P
Sbjct  7    VVIDCRAHLVGRLASLVAKELLLGQHVVAVRCEELNISGSLVRNKVKFLQFLNKKSCTNP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GP+H+RAPS++ WRT+RGM+PHKT RGAAAL RLKV++GVP PYDKVKR+V+PDAL+V
Sbjct  67   KKGPLHYRAPSRMFWRTVRGMLPHKTARGAAALQRLKVFDGVPSPYDKVKRLVVPDALRV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+A  +Y  LG+LSS+VGW H+D +
Sbjct  127  LRLKANRRYTNLGQLSSQVGWRHHDLV  153



>gb|EQL04215.1| Ribosomal protein L13, eukaryotic/archaeal [Ophiocordyceps sinensis 
CO18]
Length=202

 Score =   207 bits (527),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+LLNGQ++V+VRCE + +SG   R K+KYH +LRK     P
Sbjct  8    VVIDGKGHLLGRLASIVAKQLLNGQKIVIVRCEALNISGEFFRAKLKYHAYLRKMTRYNP  67

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++ IRGMIPHKT RGAAAL RLKV+EGVPPPYDK+K+MV+P AL+
Sbjct  68   TRGGPFHFRAPSRIFYKAIRGMIPHKTARGAAALERLKVFEGVPPPYDKMKKMVVPQALR  127

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G KYC +G+LS EVGW + D +
Sbjct  128  VLRLQPGRKYCTVGRLSHEVGWKYQDVV  155



>gb|AFX72999.1| 60S ribosomal protein L13a [Spirometra erinaceieuropaei]
Length=202

 Score =   207 bits (527),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++DAR H+LGRLASI+AK LL GQ+VVVVRCE+I +SG   R K+KY  FLRKRMNT P
Sbjct  8    IIIDARGHLLGRLASIVAKTLLQGQKVVVVRCEQINISGSFYRNKLKYREFLRKRMNTNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            SHGP H+R+P+KI WRT+RGM+PHK  RG  AL +LK YEG+PPPYDK KR+ +P AL+V
Sbjct  68   SHGPYHYRSPAKIFWRTVRGMLPHKLYRGKEALGKLKCYEGIPPPYDKKKRVAVPSALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+   K+C+L +LS EVGW + + I
Sbjct  128  LRLKQRRKFCVLSRLSHEVGWKYQNVI  154



>ref|XP_007279305.1| 60s ribosomal protein l16 [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ELA31573.1| 60s ribosomal protein l16 [Colletotrichum gloeosporioides Nara 
gc5]
 gb|EQB58698.1| hypothetical protein CGLO_01028 [Colletotrichum gloeosporioides 
Cg-14]
Length=202

 Score =   207 bits (527),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VVVD + H+LGRLASI+AK+LLNGQ+VVVVRCE + +SG   R K+KYH +LRK     P
Sbjct  8    VVVDGKGHLLGRLASIVAKQLLNGQKVVVVRCEALNISGEFFRAKLKYHAYLRKMTRYNP  67

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++T+RGMIPHKT RGAAA+ RLKV+EGVPPPYDK K+MV+P AL+
Sbjct  68   TRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAAMERLKVFEGVPPPYDKQKKMVVPQALR  127

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G K+C +G+LS EVGW + D +
Sbjct  128  VLRLQPGRKFCTVGRLSHEVGWKYQDVV  155



>gb|ABX75375.1| 60S ribosomal protein L13A [Lycosa singoriensis]
Length=205

 Score =   207 bits (527),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +V+D R H+LGRLA++ AK LLNGQ+VVVVRCE I +SG   R K+KY  FLRKR N  P
Sbjct  9    IVIDGRGHLLGRLAALTAKTLLNGQKVVVVRCEGINISGSFFRSKLKYLSFLRKRCNVNP  68

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPSKI WRT+RGM+PHKTKRG AAL RLK +EG+PPPYDK KRMV+P AL+V
Sbjct  69   ARGPFHFRAPSKIFWRTVRGMLPHKTKRGEAALDRLKAFEGIPPPYDKKKRMVVPSALRV  128

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            L+L    KYC L +LS EVGW + + I
Sbjct  129  LKLHPRRKYCSLSRLSHEVGWKYQNVI  155



>ref|XP_004990512.1| ribosomal protein L13Ae [Salpingoeca rosetta]
 gb|EGD77624.1| ribosomal protein L13Ae [Salpingoeca rosetta]
Length=198

 Score =   207 bits (526),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +3

Query  90   RRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNT  269
            +R+V+DAR H+LGRLASI+AKE+L+GQ VVVVRCE+I +SG   R K+KY  FLRKR N 
Sbjct  4    KRIVIDARGHLLGRLASIVAKEILSGQHVVVVRCEQINISGSFYRNKLKYKEFLRKRCNV  63

Query  270  KPSHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL  449
             P+ GP H RAPS+I WR +RGM+PHK  +GAAAL RLK +EGVPPPYDKVKR+V+P AL
Sbjct  64   NPARGPFHLRAPSRIFWRVVRGMLPHKKAKGAAALGRLKCFEGVPPPYDKVKRVVVPGAL  123

Query  450  KVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            +VLRL+   K+C +G+LS E+GW + D +
Sbjct  124  RVLRLRPDRKFCTVGRLSHEMGWKYKDIV  152



>ref|XP_003038672.1| 60S ribosomal protein L16 [Schizophyllum commune H4-8]
 gb|EFJ03770.1| ribosomal protein L13A [Schizophyllum commune H4-8]
Length=200

 Score =   207 bits (526),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 123/155 (79%), Gaps = 1/155 (1%)
 Frame = +3

Query  75   SRICARRVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLR  254
            S   A  +V+D + H+LGRLASI+AK++L+GQ++VVVRCEEI +SG   R K++YH FL 
Sbjct  2    STFSATPIVIDGKGHLLGRLASIIAKQILSGQKIVVVRCEEINISGSFFRNKLRYHNFLH  61

Query  255  KRMNTKPS-HGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRM  431
            K+    P  +GP HFRAPSKIL+R+IRGMIPHKT RGAAAL RLK++EGVPPPYD+ K+M
Sbjct  62   KKHLVNPKKNGPFHFRAPSKILYRSIRGMIPHKTARGAAALERLKLFEGVPPPYDRKKKM  121

Query  432  VIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            V+PDAL+VLRL+ G KYC + +LS EVGW + D +
Sbjct  122  VVPDALRVLRLKPGRKYCTVKRLSHEVGWGYKDVV  156



>gb|EIE90993.1| 60S ribosomal protein L16 [Rhizopus delemar RA 99-880]
Length=202

 Score =   207 bits (526),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+ LNGQ+VVVVRCEE+ +SG   R K+KYH +L KR    P
Sbjct  8    VVIDGKGHLLGRLASIIAKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRCLVNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPS+IL++ IRGM+PHKT RGAAAL R+K++EGVP PYD+VKRMV+PDAL+V
Sbjct  68   TRGPFHFRAPSRILYKAIRGMVPHKTARGAAALDRIKLFEGVPAPYDRVKRMVVPDALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G KY  +G++S EVGW + D +
Sbjct  128  LRLKPGRKYTTIGRISHEVGWKYQDIV  154



>gb|ERT00595.1| 60S ribosomal protein L16 [Sporothrix schenckii ATCC 58251]
 gb|KIH92017.1| large subunit ribosomal protein L13Ae [Sporothrix brasiliensis 
5110]
Length=202

 Score =   206 bits (525),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+LLNGQ++VVVRCE + +SG   R K+KYH +LRK     P
Sbjct  8    VVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHSYLRKMTRYNP  67

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EGVPPPYDK K+MV+P AL+
Sbjct  68   TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKQKKMVVPQALR  127

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G KYC +G+LS EVGW + D +
Sbjct  128  VLRLQPGRKYCTVGRLSHEVGWKYQDVV  155



>gb|EIE79164.1| 60S ribosomal protein L16 [Rhizopus delemar RA 99-880]
Length=202

 Score =   206 bits (525),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+ LNGQ+VVVVRCEE+ +SG   R K+KYH +L KR    P
Sbjct  8    VVIDGKGHLLGRLASIIAKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRCLVNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPS+IL++ IRGM+PHKT RGAAAL R+K++EGVP PYD+VKRMV+PDAL+V
Sbjct  68   TRGPFHFRAPSRILYKAIRGMVPHKTARGAAALDRIKLFEGVPAPYDRVKRMVVPDALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G KY  +G++S EVGW + D +
Sbjct  128  LRLKPGRKYTTIGRISHEVGWKYQDIV  154



>ref|XP_007873114.1| hypothetical protein PNEG_01198 [Pneumocystis murina B123]
 gb|EMR10485.1| hypothetical protein PNEG_01198 [Pneumocystis murina B123]
Length=197

 Score =   206 bits (525),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +VVD + H+LGRLAS++AK+LLNGQ++V+VRCEEI +SG   R K+K H FLRKR     
Sbjct  8    IVVDGKGHLLGRLASVVAKQLLNGQKIVIVRCEEINISGEFFRNKLKMHAFLRKRTRFNA  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPS+I++R IRGMIPHK  RG++AL RLKV+EG+PPPYDK KRMV+P+AL+V
Sbjct  68   TRGPFHFRAPSRIMYRAIRGMIPHKMARGSSALERLKVFEGIPPPYDKKKRMVVPEALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G K+C +G+LS E+GW + + I
Sbjct  128  LRLKPGRKFCTVGRLSKEIGWKYENII  154



>gb|AAW27674.1| SJCHGC04249 protein [Schistosoma japonicum]
Length=203

 Score =   206 bits (525),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++DA+ H+LGRLA+++AK LLNGQ+VVVVRCE + +SG   R K+KY  FLRKRMNT P
Sbjct  8    IIIDAQGHLLGRLAAVVAKTLLNGQKVVVVRCENLNISGSFYRNKLKYLDFLRKRMNTNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAP+KI WRT+RGM+PHK  RG  AL RLKV+EG+PPPYDK KRMV+P AL+V
Sbjct  68   SRGPYHFRAPAKIFWRTVRGMLPHKLHRGKQALDRLKVFEGIPPPYDKKKRMVVPSALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            +RL+ G K+ +L +LS++VGW + + I
Sbjct  128  IRLKPGRKFSVLSQLSNDVGWKYKNVI  154



>gb|KEZ46607.1| hypothetical protein SAPIO_CDS0424 [Scedosporium apiospermum]
Length=202

 Score =   206 bits (525),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+LL+GQ++VVVRCE + +SG   R K+KYH +LRK     P
Sbjct  8    VVIDGKGHLLGRLASIVAKQLLSGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRYNP  67

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++T+RGMIPHKT RGAAA+ RLKV+EGVPPPYDK+K+MV+P AL+
Sbjct  68   TRGGPFHFRAPSRIFYKTVRGMIPHKTARGAAAMERLKVFEGVPPPYDKMKKMVVPQALR  127

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G KYC +G+LS EVGW + D +
Sbjct  128  VLRLQPGRKYCTVGRLSHEVGWKYQDVV  155



>gb|EHK19473.1| hypothetical protein TRIVIDRAFT_111666 [Trichoderma virens Gv29-8]
Length=202

 Score =   206 bits (525),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+LLNGQ++VVVRCE + +SG   R K+KYH +LRK     P
Sbjct  8    VVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRYNP  67

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EGVPPPYDK K+MV+P AL+
Sbjct  68   TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVPQALR  127

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G KYC +G+LS EVGW + D +
Sbjct  128  VLRLQPGRKYCTVGRLSHEVGWKYQDVV  155



>gb|EPE08609.1| 60s ribosomal protein l16 [Ophiostoma piceae UAMH 11346]
Length=225

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 120/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  93   RVVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTK  272
            +VV+D + H+LGRLASI+AK+LLNGQ++VVVRCE + +SG   R K+KYH +LRK     
Sbjct  30   QVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKMTRYN  89

Query  273  PSHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDAL  449
            P+ G P HFRAPS+IL++ +RGMIPHKT RGAAAL RLKV+EGVPPPYDK K+MV+P AL
Sbjct  90   PTRGGPFHFRAPSRILYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKQKKMVVPQAL  149

Query  450  KVLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            +VLRLQ G KYC +G+LS EVGW + D +
Sbjct  150  RVLRLQPGRKYCTVGRLSHEVGWKYQDVV  178



>gb|EIE78513.1| 60S ribosomal protein L16 [Rhizopus delemar RA 99-880]
Length=202

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI++K+ LNGQ+VVVVRCEE+ +SG   R K+KYH +L KR    P
Sbjct  8    VVIDGKGHLLGRLASIISKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRCLVNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            + GP HFRAPS+IL++ IRGMIPHKT RGAAAL R+K++EGVP PYD+VKRMV+PDAL+V
Sbjct  68   TRGPFHFRAPSRILYKAIRGMIPHKTARGAAALDRIKLFEGVPAPYDRVKRMVVPDALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G KY  +G++S EVGW + D +
Sbjct  128  LRLKPGRKYTTIGRISHEVGWKYQDIV  154



>emb|CEG67074.1| Putative 60S ribosomal protein L16 [Rhizopus microsporus]
Length=202

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+ LNGQ+VVVVRCEE+ +SG   R K+KYH +L KR    P
Sbjct  8    VVIDGKGHLLGRLASIIAKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRCVVNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GP HFRAPS+IL++ IRGMIPHKT RGAAAL R+K++EGVP PYD+VKRMV+PDAL+V
Sbjct  68   RRGPFHFRAPSRILYKAIRGMIPHKTARGAAALDRIKLFEGVPAPYDRVKRMVVPDALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G KY  +G++S EVGW + D +
Sbjct  128  LRLKPGRKYTTIGRISHEVGWKYQDVV  154



>ref|XP_001911222.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP73047.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP25447.1| Putative cytosolic 60S ribosomal protein Rpl13a [Podospora anserina 
S mat+]
Length=202

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+LLNGQ++VVVRCE + +SG   R K+KYH +LRK     P
Sbjct  8    VVIDGKGHLLGRLASIVAKQLLNGQQIVVVRCEALNISGEFFRAKLKYHAYLRKMTRYNP  67

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EGVPPPYDK K+MV+P AL+
Sbjct  68   TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVPQALR  127

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G KYC +G+LS EVGW + D +
Sbjct  128  VLRLQPGRKYCTVGRLSHEVGWKYQDVV  155



>emb|CCD82603.1| putative 60s ribosomal protein L13a [Schistosoma mansoni]
Length=203

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++DA+ H+LGRLAS++AK LLNGQ+VVVVRCE I +SG   R K+KY  FLRKRMNT P
Sbjct  8    IIIDAQGHLLGRLASVVAKTLLNGQKVVVVRCESINISGSFYRNKLKYLDFLRKRMNTNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP HFRAP+KI WRT+RGM+PHK  RG  AL +LKV+EG+PPPYDK KRMV+P AL+ 
Sbjct  68   SRGPYHFRAPAKIFWRTVRGMLPHKLHRGKQALDKLKVFEGIPPPYDKKKRMVVPSALRA  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            +RL+ G K+ +L +LS++VGW + + I
Sbjct  128  IRLKPGRKFSVLSRLSNDVGWKYKNII  154



>emb|CEG78600.1| Putative 60S ribosomal protein L16 [Rhizopus microsporus]
Length=202

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VV+D + H+LGRLASI+AK+ LNGQ+VVVVRCEE+ +SG   R K+KYH +L KR    P
Sbjct  8    VVIDGKGHLLGRLASIIAKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRCVVNP  67

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
              GP HFRAPS+IL++ IRGMIPHKT RGAAAL R+K++EGVP PYD+VKRMV+PDAL+V
Sbjct  68   RRGPFHFRAPSRILYKAIRGMIPHKTARGAAALDRIKLFEGVPAPYDRVKRMVVPDALRV  127

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            LRL+ G KY  +G++S EVGW + D +
Sbjct  128  LRLKPGRKYTTIGRISHEVGWKYQDVV  154



>ref|XP_002590758.1| hypothetical protein BRAFLDRAFT_280074 [Branchiostoma floridae]
 gb|EEN46769.1| hypothetical protein BRAFLDRAFT_280074 [Branchiostoma floridae]
Length=204

 Score =   206 bits (523),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            +++DA +H+LGRLA+++AK +L GQ++VVVRCE I +SG   R K+KY  FLRKR NTKP
Sbjct  7    LIIDANNHLLGRLAAVVAKSILQGQKIVVVRCEGINISGSFYRNKLKYLEFLRKRTNTKP  66

Query  276  SHGPIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALKV  455
            S GP H RAPS+I WRT+RGM+PHKT RGA AL RLKV+EG+PPPYDK KR+V+P AL+V
Sbjct  67   SRGPFHLRAPSRIFWRTVRGMLPHKTTRGAQALERLKVFEGIPPPYDKQKRLVVPSALRV  126

Query  456  LRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            +RL    ++C LG+LS EVGW + + +
Sbjct  127  IRLMPNRRFCSLGRLSHEVGWKYKEVV  153



>emb|CCE29838.1| probable ribosomal protein l13a [Claviceps purpurea 20.1]
Length=203

 Score =   206 bits (523),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = +3

Query  96   VVVDARHHMLGRLASILAKELLNGQRVVVVRCEEICLSGGLVRQKMKYHRFLRKRMNTKP  275
            VVVD + H+LGRLASI+AK+LLNGQ+VVVVRCE + +SG   R K+KYH +LRK     P
Sbjct  9    VVVDGKGHLLGRLASIVAKQLLNGQKVVVVRCEALNISGEFFRAKLKYHAYLRKMTRYNP  68

Query  276  SHG-PIHFRAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKVKRMVIPDALK  452
            + G P HFRAPS+I ++ +RGMIPHKT RGAAAL RLKV+EGVPPPYD  K+MV+P AL+
Sbjct  69   TRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDTQKKMVVPQALR  128

Query  453  VLRLQAGHKYCLLGKLSSEVGWNHYDTI  536
            VLRLQ G KYC +G+LS EVGW + D +
Sbjct  129  VLRLQPGRKYCTVGRLSHEVGWKYQDVV  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000