BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L12

Length=553
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361688.1|  PREDICTED: serine carboxypeptidase-like 49-like    194   1e-55   Solanum tuberosum [potatoes]
ref|XP_004250045.1|  PREDICTED: serine carboxypeptidase-like            192   5e-55   
ref|XP_010243256.1|  PREDICTED: serine carboxypeptidase-like            185   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_009774966.1|  PREDICTED: serine carboxypeptidase-like 49         178   2e-51   Nicotiana sylvestris
ref|XP_010267214.1|  PREDICTED: serine carboxypeptidase-like            182   3e-51   
ref|XP_010103537.1|  Serine carboxypeptidase-like 49                    177   3e-49   Morus notabilis
ref|XP_009617439.1|  PREDICTED: serine carboxypeptidase-like            175   2e-48   Nicotiana tomentosiformis
ref|XP_008363544.1|  PREDICTED: serine carboxypeptidase-like            175   2e-48   Malus domestica [apple tree]
ref|XP_007010003.1|  Serine carboxypeptidase-like 49                    175   3e-48   
emb|CAC86383.1|  carboxypeptidase type III                              175   3e-48   Theobroma cacao [chocolate]
ref|XP_007220656.1|  hypothetical protein PRUPE_ppa003691mg             175   3e-48   
ref|XP_011094551.1|  PREDICTED: serine carboxypeptidase-like            175   5e-48   Sesamum indicum [beniseed]
gb|KJB60534.1|  hypothetical protein B456_009G310800                    173   6e-48   Gossypium raimondii
gb|KJB60533.1|  hypothetical protein B456_009G310800                    173   6e-48   Gossypium raimondii
emb|CDO99792.1|  unnamed protein product                                173   1e-47   Coffea canephora [robusta coffee]
gb|AAL67992.1|  putative serine carboxypeptidase precursor              173   1e-47   Gossypium hirsutum [American cotton]
gb|KJB60536.1|  hypothetical protein B456_009G310800                    173   2e-47   Gossypium raimondii
gb|KJB60532.1|  hypothetical protein B456_009G310800                    172   4e-47   Gossypium raimondii
ref|XP_008233268.1|  PREDICTED: serine carboxypeptidase-like            172   4e-47   Prunus mume [ume]
gb|EYU39640.1|  hypothetical protein MIMGU_mgv1a0046371mg               162   5e-47   Erythranthe guttata [common monkey flower]
gb|KJB74771.1|  hypothetical protein B456_012G006300                    171   6e-47   Gossypium raimondii
gb|KJB74772.1|  hypothetical protein B456_012G006300                    171   1e-46   Gossypium raimondii
ref|XP_009368926.1|  PREDICTED: serine carboxypeptidase-like            170   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_010543556.1|  PREDICTED: serine carboxypeptidase-like 49         170   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_004150367.1|  PREDICTED: serine carboxypeptidase-like 49-like    170   2e-46   
ref|XP_004164209.1|  PREDICTED: serine carboxypeptidase-like 49-like    170   2e-46   
gb|ACU18836.1|  unknown                                                 164   3e-46   Glycine max [soybeans]
ref|XP_008456530.1|  PREDICTED: serine carboxypeptidase-like            167   2e-45   Cucumis melo [Oriental melon]
gb|EPS63355.1|  hypothetical protein M569_11430                         159   3e-45   Genlisea aurea
ref|XP_009135107.1|  PREDICTED: serine carboxypeptidase-like 49         167   3e-45   Brassica rapa
emb|CDX73927.1|  BnaA03g31200D                                          167   3e-45   
emb|CDY56704.1|  BnaC01g38630D                                          167   4e-45   Brassica napus [oilseed rape]
gb|AAD42963.2|AF141384_1  serine carboxypeptidase precursor             166   5e-45   Matricaria chamomilla
ref|XP_010681991.1|  PREDICTED: serine carboxypeptidase-like            166   5e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006588979.1|  PREDICTED: serine carboxypeptidase-like 49-l...    164   9e-45   
ref|XP_010067346.1|  PREDICTED: serine carboxypeptidase-like            165   1e-44   Eucalyptus grandis [rose gum]
ref|XP_011031665.1|  PREDICTED: serine carboxypeptidase-like            165   1e-44   Populus euphratica
ref|XP_003535900.1|  PREDICTED: serine carboxypeptidase-like 49-l...    165   1e-44   Glycine max [soybeans]
ref|XP_006407571.1|  hypothetical protein EUTSA_v10020509mg             165   1e-44   Eutrema salsugineum [saltwater cress]
ref|XP_002266451.1|  PREDICTED: serine carboxypeptidase-like            164   2e-44   Vitis vinifera
ref|XP_002529593.1|  Serine carboxypeptidase, putative                  164   3e-44   Ricinus communis
ref|XP_004307353.1|  PREDICTED: serine carboxypeptidase-like            163   5e-44   Fragaria vesca subsp. vesca
ref|XP_003536330.1|  PREDICTED: serine carboxypeptidase-like 49-like    163   6e-44   Glycine max [soybeans]
gb|KFK38420.1|  hypothetical protein AALP_AA3G110900                    163   7e-44   Arabis alpina [alpine rockcress]
ref|XP_010031406.1|  PREDICTED: serine carboxypeptidase-like            162   8e-44   Eucalyptus grandis [rose gum]
emb|CDP07043.1|  unnamed protein product                                162   9e-44   Coffea canephora [robusta coffee]
ref|XP_002311071.2|  Serine carboxypeptidase precursor family pro...    162   2e-43   Populus trichocarpa [western balsam poplar]
emb|CDY00669.1|  BnaC03g36530D                                          162   2e-43   
ref|XP_007145525.1|  hypothetical protein PHAVU_007G245800g             161   3e-43   Phaseolus vulgaris [French bean]
ref|XP_002316392.2|  Serine carboxypeptidase precursor family pro...    161   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006436507.1|  hypothetical protein CICLE_v10031297mg             159   1e-42   Citrus clementina [clementine]
ref|XP_011024373.1|  PREDICTED: serine carboxypeptidase-like            159   1e-42   Populus euphratica
emb|CDP07044.1|  unnamed protein product                                159   1e-42   Coffea canephora [robusta coffee]
gb|KDO60256.1|  hypothetical protein CISIN_1g010473mg                   159   1e-42   Citrus sinensis [apfelsine]
ref|XP_006488020.1|  PREDICTED: serine carboxypeptidase-like 48-l...    159   1e-42   Citrus sinensis [apfelsine]
ref|XP_006424468.1|  hypothetical protein CICLE_v10028234mg             159   1e-42   Citrus clementina [clementine]
gb|KDO60255.1|  hypothetical protein CISIN_1g010473mg                   159   2e-42   Citrus sinensis [apfelsine]
ref|XP_010034179.1|  PREDICTED: serine carboxypeptidase-like            159   2e-42   Eucalyptus grandis [rose gum]
ref|NP_187652.1|  serine carboxypeptidase-like 49                       159   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KDP30482.1|  hypothetical protein JCGZ_16161                         159   2e-42   Jatropha curcas
gb|AAB04606.1|  carboxypeptidase Y-like protein                         159   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KDO60257.1|  hypothetical protein CISIN_1g010473mg                   159   2e-42   Citrus sinensis [apfelsine]
ref|XP_011084286.1|  PREDICTED: serine carboxypeptidase-like            159   2e-42   Sesamum indicum [beniseed]
ref|XP_010464713.1|  PREDICTED: serine carboxypeptidase-like 49         159   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009775797.1|  PREDICTED: serine carboxypeptidase-like            159   3e-42   Nicotiana sylvestris
ref|XP_010486643.1|  PREDICTED: serine carboxypeptidase-like 49         159   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_011089952.1|  PREDICTED: serine carboxypeptidase-like            158   3e-42   Sesamum indicum [beniseed]
ref|XP_009607096.1|  PREDICTED: serine carboxypeptidase-like            158   3e-42   Nicotiana tomentosiformis
ref|XP_006349013.1|  PREDICTED: serine carboxypeptidase-like 48-like    157   6e-42   Solanum tuberosum [potatoes]
gb|KHG01758.1|  Serine carboxypeptidase-like 48                         157   1e-41   Gossypium arboreum [tree cotton]
ref|XP_006851290.1|  hypothetical protein AMTR_s00050p00101210          157   1e-41   Amborella trichopoda
gb|ABQ65860.1|  serine carboxypeptidase III                             156   2e-41   Nicotiana tabacum [American tobacco]
ref|XP_010483821.1|  PREDICTED: serine carboxypeptidase-like 49         156   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006347201.1|  PREDICTED: serine carboxypeptidase 3-like          155   3e-41   Solanum tuberosum [potatoes]
gb|KHN38716.1|  Serine carboxypeptidase-like 49                         155   4e-41   Glycine soja [wild soybean]
gb|KJB26224.1|  hypothetical protein B456_004G231300                    155   4e-41   Gossypium raimondii
gb|KJB26223.1|  hypothetical protein B456_004G231300                    155   5e-41   Gossypium raimondii
ref|XP_004952144.1|  PREDICTED: serine carboxypeptidase 3-like is...    155   6e-41   Setaria italica
ref|XP_006299685.1|  hypothetical protein CARUB_v10015873mg             155   6e-41   Capsella rubella
ref|XP_003539193.1|  PREDICTED: serine carboxypeptidase-like 48-like    155   6e-41   Glycine max [soybeans]
ref|XP_004952145.1|  PREDICTED: serine carboxypeptidase 3-like is...    154   7e-41   Setaria italica
ref|XP_011089190.1|  PREDICTED: serine carboxypeptidase-like            154   9e-41   Sesamum indicum [beniseed]
ref|XP_002521640.1|  Serine carboxypeptidase, putative                  153   1e-40   
ref|XP_003546386.1|  PREDICTED: serine carboxypeptidase-like 49-like    153   2e-40   Glycine max [soybeans]
gb|KHN47738.1|  Serine carboxypeptidase-like 49                         153   2e-40   Glycine soja [wild soybean]
ref|XP_009356926.1|  PREDICTED: serine carboxypeptidase-like            153   2e-40   Pyrus x bretschneideri [bai li]
gb|KEH29967.1|  serine carboxypeptidase-like protein                    153   3e-40   Medicago truncatula
ref|XP_007150149.1|  hypothetical protein PHAVU_005G131000g             152   4e-40   Phaseolus vulgaris [French bean]
gb|EYU37039.1|  hypothetical protein MIMGU_mgv1a025090mg                152   5e-40   Erythranthe guttata [common monkey flower]
ref|XP_010111833.1|  Serine carboxypeptidase-like 48                    152   5e-40   Morus notabilis
ref|XP_009335971.1|  PREDICTED: serine carboxypeptidase-like            152   5e-40   Pyrus x bretschneideri [bai li]
ref|XP_009345743.1|  PREDICTED: serine carboxypeptidase-like            152   5e-40   Pyrus x bretschneideri [bai li]
emb|CDY08605.1|  BnaA05g28410D                                          152   5e-40   Brassica napus [oilseed rape]
ref|XP_007207364.1|  hypothetical protein PRUPE_ppa004507mg             152   6e-40   Prunus persica
ref|XP_007016860.1|  Serine carboxypeptidase-like 48                    152   6e-40   
ref|XP_009146842.1|  PREDICTED: serine carboxypeptidase-like 49 i...    152   6e-40   Brassica rapa
gb|ACJ85699.1|  unknown                                                 147   8e-40   Medicago truncatula
gb|KDP43980.1|  hypothetical protein JCGZ_05447                         151   9e-40   Jatropha curcas
ref|XP_010658339.1|  PREDICTED: serine carboxypeptidase-like isof...    151   1e-39   
ref|XP_008226415.1|  PREDICTED: serine carboxypeptidase-like            151   1e-39   
ref|XP_010689129.1|  PREDICTED: serine carboxypeptidase-like            151   1e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008344883.1|  PREDICTED: serine carboxypeptidase-like            151   1e-39   
ref|XP_004163685.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    151   2e-39   
ref|XP_009592158.1|  PREDICTED: serine carboxypeptidase-like            150   2e-39   Nicotiana tomentosiformis
ref|XP_006343737.1|  PREDICTED: serine carboxypeptidase-like 48-like    150   2e-39   Solanum tuberosum [potatoes]
ref|XP_002523707.1|  Serine carboxypeptidase, putative                  150   2e-39   Ricinus communis
ref|XP_004241292.1|  PREDICTED: serine carboxypeptidase-like            150   3e-39   Solanum lycopersicum
ref|XP_007132319.1|  hypothetical protein PHAVU_011G084700g             150   3e-39   Phaseolus vulgaris [French bean]
gb|KGN64810.1|  Serine carboxypeptidase                                 150   3e-39   Cucumis sativus [cucumbers]
dbj|BAE48666.1|  Serine carboxypeptidase                                150   3e-39   Prunus mume [ume]
emb|CDY00930.1|  BnaC05g42700D                                          150   4e-39   
ref|XP_009617667.1|  PREDICTED: serine carboxypeptidase-like            149   5e-39   Nicotiana tomentosiformis
ref|XP_003534860.1|  PREDICTED: serine carboxypeptidase-like 49-like    149   5e-39   
ref|XP_004147293.1|  PREDICTED: serine carboxypeptidase-like 48-like    149   5e-39   Cucumis sativus [cucumbers]
ref|XP_008799516.1|  PREDICTED: serine carboxypeptidase 3-like          145   7e-39   Phoenix dactylifera
gb|KEH43478.1|  serine carboxypeptidase-like protein                    149   7e-39   Medicago truncatula
ref|XP_002453162.1|  hypothetical protein SORBIDRAFT_04g001030          149   7e-39   Sorghum bicolor [broomcorn]
gb|KJB20374.1|  hypothetical protein B456_003G145400                    149   7e-39   Gossypium raimondii
gb|KEH29968.1|  serine carboxypeptidase-like protein                    149   1e-38   Medicago truncatula
gb|AFK43520.1|  unknown                                                 148   1e-38   Medicago truncatula
ref|XP_009382132.1|  PREDICTED: serine carboxypeptidase-like            148   1e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008463013.1|  PREDICTED: serine carboxypeptidase-like            148   1e-38   Cucumis melo [Oriental melon]
ref|XP_007132322.1|  hypothetical protein PHAVU_011G085000g             148   2e-38   Phaseolus vulgaris [French bean]
gb|EYU37040.1|  hypothetical protein MIMGU_mgv1a024049mg                148   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_003597272.1|  Serine carboxypeptidase                            148   2e-38   Medicago truncatula
gb|KHG17096.1|  Serine carboxypeptidase-like 48                         147   2e-38   Gossypium arboreum [tree cotton]
ref|XP_004292565.1|  PREDICTED: serine carboxypeptidase-like            147   3e-38   Fragaria vesca subsp. vesca
ref|XP_007221636.1|  hypothetical protein PRUPE_ppb018374mg             138   4e-38   
gb|KCW50687.1|  hypothetical protein EUGRSUZ_J00372                     146   4e-38   Eucalyptus grandis [rose gum]
ref|XP_011028255.1|  PREDICTED: serine carboxypeptidase-like            147   4e-38   Populus euphratica
ref|XP_006342273.1|  PREDICTED: serine carboxypeptidase-like 48-like    147   5e-38   Solanum tuberosum [potatoes]
ref|XP_009758588.1|  PREDICTED: serine carboxypeptidase-like            147   5e-38   Nicotiana sylvestris
gb|KHN06879.1|  Serine carboxypeptidase-like 49                         146   6e-38   Glycine soja [wild soybean]
ref|XP_004240682.1|  PREDICTED: serine carboxypeptidase-like            146   7e-38   Solanum lycopersicum
ref|XP_003540200.1|  PREDICTED: serine carboxypeptidase-like 48-like    146   7e-38   Glycine max [soybeans]
ref|XP_004496230.1|  PREDICTED: serine carboxypeptidase-like 49-like    146   7e-38   Cicer arietinum [garbanzo]
emb|CDP07045.1|  unnamed protein product                                146   8e-38   Coffea canephora [robusta coffee]
ref|XP_004514874.1|  PREDICTED: serine carboxypeptidase-like 49-like    146   1e-37   Cicer arietinum [garbanzo]
ref|XP_006384950.1|  serine carboxypeptidase family protein             145   2e-37   Populus trichocarpa [western balsam poplar]
ref|XP_002273281.1|  PREDICTED: serine carboxypeptidase-like            145   2e-37   Vitis vinifera
emb|CBI17153.3|  unnamed protein product                                144   3e-37   Vitis vinifera
ref|XP_009395427.1|  PREDICTED: serine carboxypeptidase-like            145   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146351.1|  uncharacterized protein LOC100279929 precursor     145   3e-37   Zea mays [maize]
ref|XP_008385518.1|  PREDICTED: serine carboxypeptidase-like            145   3e-37   Malus domestica [apple tree]
gb|KHN21489.1|  Serine carboxypeptidase-like 48                         144   3e-37   Glycine soja [wild soybean]
ref|XP_003543449.1|  PREDICTED: serine carboxypeptidase-like 48-like    144   3e-37   Glycine max [soybeans]
ref|XP_007138863.1|  hypothetical protein PHAVU_009G243900g             144   3e-37   Phaseolus vulgaris [French bean]
ref|XP_003538168.1|  PREDICTED: serine carboxypeptidase-like 48-like    144   4e-37   
ref|XP_010906753.1|  PREDICTED: serine carboxypeptidase-like            144   5e-37   Elaeis guineensis
sp|P21529.2|CBP3_HORVU  RecName: Full=Serine carboxypeptidase 3; ...    144   5e-37   Hordeum vulgare [barley]
gb|AFK46969.1|  unknown                                                 144   5e-37   Lotus japonicus
ref|XP_003570803.1|  PREDICTED: serine carboxypeptidase 3               144   5e-37   Brachypodium distachyon [annual false brome]
ref|XP_004250970.1|  PREDICTED: serine carboxypeptidase-like            144   6e-37   Solanum lycopersicum
ref|XP_010658340.1|  PREDICTED: serine carboxypeptidase-like isof...    144   7e-37   Vitis vinifera
ref|NP_001045667.1|  Os02g0114200                                       144   7e-37   
ref|XP_010658342.1|  PREDICTED: serine carboxypeptidase-like isof...    143   7e-37   Vitis vinifera
ref|XP_007143762.1|  hypothetical protein PHAVU_007G099400g             143   8e-37   Phaseolus vulgaris [French bean]
gb|EMT06979.1|  Serine carboxypeptidase 3                               143   1e-36   
ref|XP_002273251.1|  PREDICTED: serine carboxypeptidase-like isof...    143   1e-36   Vitis vinifera
ref|NP_197689.1|  serine carboxypeptidase-like 47                       143   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541311.1|  PREDICTED: serine carboxypeptidase-like 48         143   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_008805718.1|  PREDICTED: serine carboxypeptidase-like            143   1e-36   Phoenix dactylifera
ref|XP_002884793.1|  predicted protein                                  143   1e-36   
dbj|BAK05932.1|  predicted protein                                      142   2e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004487064.1|  PREDICTED: serine carboxypeptidase-like 48-like    142   2e-36   Cicer arietinum [garbanzo]
ref|XP_009785283.1|  PREDICTED: serine carboxypeptidase-like            142   2e-36   Nicotiana sylvestris
sp|P11515.1|CBP3_WHEAT  RecName: Full=Serine carboxypeptidase 3; ...    141   4e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009150318.1|  PREDICTED: serine carboxypeptidase-like 48         141   4e-36   Brassica rapa
emb|CDX99171.1|  BnaA06g18620D                                          141   5e-36   
emb|CDY31020.1|  BnaC03g55150D                                          141   6e-36   Brassica napus [oilseed rape]
gb|KCW50683.1|  hypothetical protein EUGRSUZ_J00369                     141   6e-36   Eucalyptus grandis [rose gum]
ref|XP_006648225.1|  PREDICTED: serine carboxypeptidase 3-like          140   7e-36   Oryza brachyantha
ref|XP_010503154.1|  PREDICTED: serine carboxypeptidase-like 48         140   8e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004240167.1|  PREDICTED: serine carboxypeptidase-like            140   9e-36   Solanum lycopersicum
gb|KEH29969.1|  serine carboxypeptidase-like protein                    140   1e-35   Medicago truncatula
ref|XP_001786217.1|  predicted protein                                  138   3e-35   
tpg|DAA62687.1|  TPA: hypothetical protein ZEAMMB73_228197              135   4e-35   
ref|XP_010918615.1|  PREDICTED: serine carboxypeptidase-like            139   4e-35   Elaeis guineensis
ref|NP_190087.1|  serine carboxypeptidase-like 48                       139   4e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAL15270.1|  AT3g45010/F14D17_80                                     139   4e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380664.1|  PREDICTED: serine carboxypeptidase-like            138   6e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK33913.1|  serine carboxypeptidase                                 138   7e-35   Arabis alpina [alpine rockcress]
ref|XP_002875707.1|  hypothetical protein ARALYDRAFT_484895             137   1e-34   
ref|XP_004506096.1|  PREDICTED: serine carboxypeptidase-like 48-like    137   1e-34   
ref|XP_010514837.1|  PREDICTED: serine carboxypeptidase-like 48         137   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006488021.1|  PREDICTED: serine carboxypeptidase-like 48-l...    137   2e-34   
ref|XP_003597270.1|  Serine carboxypeptidase                            137   2e-34   
gb|AES67521.2|  serine carboxypeptidase-like protein                    137   2e-34   Medicago truncatula
ref|XP_008784501.1|  PREDICTED: serine carboxypeptidase-like isof...    136   2e-34   
ref|XP_008784499.1|  PREDICTED: serine carboxypeptidase-like isof...    136   2e-34   Phoenix dactylifera
ref|XP_006419082.1|  hypothetical protein EUTSA_v10002473mg             137   2e-34   
dbj|BAJ34078.1|  unnamed protein product                                136   3e-34   Eutrema halophilum
ref|XP_010535626.1|  PREDICTED: serine carboxypeptidase-like 48 i...    135   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_010535623.1|  PREDICTED: serine carboxypeptidase-like 48 i...    135   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_010535625.1|  PREDICTED: serine carboxypeptidase-like 48 i...    135   4e-34   Tarenaya hassleriana [spider flower]
gb|KEH41429.1|  serine carboxypeptidase-like protein                    135   5e-34   Medicago truncatula
ref|XP_002872027.1|  hypothetical protein ARALYDRAFT_489152             135   6e-34   Arabidopsis lyrata subsp. lyrata
ref|NP_001141041.1|  uncharacterized protein LOC100273121 precursor     135   7e-34   Zea mays [maize]
ref|XP_001772397.1|  predicted protein                                  135   9e-34   
ref|XP_006290935.1|  hypothetical protein CARUB_v10017048mg             135   9e-34   Capsella rubella
ref|XP_010425935.1|  PREDICTED: serine carboxypeptidase-like 48         135   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002462855.1|  hypothetical protein SORBIDRAFT_02g033170          135   1e-33   
ref|XP_003560222.1|  PREDICTED: serine carboxypeptidase-like            134   1e-33   Brachypodium distachyon [annual false brome]
ref|XP_004506061.1|  PREDICTED: serine carboxypeptidase-like 48-l...    134   1e-33   
ref|XP_004506060.1|  PREDICTED: serine carboxypeptidase-like 48-l...    134   1e-33   
ref|XP_010920652.1|  PREDICTED: serine carboxypeptidase-like            133   4e-33   Elaeis guineensis
ref|XP_002960122.1|  serine carboxypeptidase-like enzyme                132   8e-33   
ref|XP_006400808.1|  hypothetical protein EUTSA_v10013297mg             131   1e-32   Eutrema salsugineum [saltwater cress]
emb|CDY09183.1|  BnaA02g06090D                                          130   4e-32   Brassica napus [oilseed rape]
gb|AES67519.2|  serine carboxypeptidase-like protein                    129   7e-32   Medicago truncatula
ref|XP_007132321.1|  hypothetical protein PHAVU_011G084900g             129   7e-32   Phaseolus vulgaris [French bean]
ref|XP_003597268.1|  Serine carboxypeptidase                            129   8e-32   
gb|KEH29964.1|  serine carboxypeptidase-like protein                    129   9e-32   Medicago truncatula
ref|XP_002984019.1|  serine carboxypeptidase-like enzyme                129   1e-31   Selaginella moellendorffii
ref|XP_004957681.1|  PREDICTED: serine carboxypeptidase-like            128   2e-31   Setaria italica
ref|XP_006657694.1|  PREDICTED: serine carboxypeptidase-like            128   3e-31   Oryza brachyantha
ref|XP_006400807.1|  hypothetical protein EUTSA_v10015901mg             127   7e-31   Eutrema salsugineum [saltwater cress]
gb|KDO35820.1|  hypothetical protein CISIN_1g038976mg                   122   1e-30   Citrus sinensis [apfelsine]
ref|XP_010658343.1|  PREDICTED: serine carboxypeptidase-like isof...    125   2e-30   Vitis vinifera
ref|XP_009131902.1|  PREDICTED: serine carboxypeptidase-like 47         125   2e-30   Brassica rapa
gb|KCW50690.1|  hypothetical protein EUGRSUZ_J003741                    117   4e-30   Eucalyptus grandis [rose gum]
ref|XP_010421096.1|  PREDICTED: serine carboxypeptidase-like 47         124   4e-30   Camelina sativa [gold-of-pleasure]
gb|EPS70311.1|  hypothetical protein M569_04452                         124   6e-30   Genlisea aurea
ref|XP_009126578.1|  PREDICTED: serine carboxypeptidase-like 47         124   9e-30   Brassica rapa
ref|NP_001059634.1|  Os07g0479300                                       122   3e-29   
gb|EAZ03855.1|  hypothetical protein OsI_25989                          122   3e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_010493406.1|  PREDICTED: serine carboxypeptidase-like 47         121   8e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006400806.1|  hypothetical protein EUTSA_v10013304mg             120   2e-28   Eutrema salsugineum [saltwater cress]
ref|XP_006289997.1|  hypothetical protein CARUB_v10003627mg             119   5e-28   Capsella rubella
ref|XP_004506097.1|  PREDICTED: serine carboxypeptidase-like 48-like    118   5e-28   Cicer arietinum [garbanzo]
dbj|BAA04511.1|  serine carboxypeptidase-like protein                   116   3e-27   Oryza sativa Japonica Group [Japonica rice]
sp|P52712.2|CBPX_ORYSJ  RecName: Full=Serine carboxypeptidase-lik...    116   3e-27   Oryza sativa Japonica Group [Japonica rice]
gb|KFK27622.1|  hypothetical protein AALP_AA8G407400                    108   3e-25   Arabis alpina [alpine rockcress]
ref|XP_007208698.1|  hypothetical protein PRUPE_ppa023575mg           98.2    2e-22   
ref|XP_001763185.1|  predicted protein                                  102   5e-22   
ref|XP_002945957.1|  hypothetical protein VOLCADRAFT_102913             101   2e-21   Volvox carteri f. nagariensis
emb|CDX71025.1|  BnaC03g11090D                                        99.8    3e-21   
emb|CDX88772.1|  BnaA03g08770D                                        99.4    6e-21   
ref|XP_003055284.1|  predicted protein                                99.0    1e-20   Micromonas pusilla CCMP1545
ref|XP_006407570.1|  hypothetical protein EUTSA_v10020509mg           96.7    5e-20   
gb|EMT11612.1|  Serine carboxypeptidase-like protein                  97.1    5e-20   
ref|XP_010657851.1|  PREDICTED: serine carboxypeptidase 3-like        92.8    2e-19   Vitis vinifera
ref|XP_001695303.1|  predicted protein                                94.4    6e-19   Chlamydomonas reinhardtii
gb|ACF85628.1|  unknown                                               92.0    1e-18   Zea mays [maize]
emb|CAN60574.1|  hypothetical protein VITISV_013750                   93.6    1e-18   Vitis vinifera
emb|CDY26973.1|  BnaC09g36100D                                        91.3    3e-18   Brassica napus [oilseed rape]
gb|ABR16556.1|  unknown                                               90.5    4e-18   Picea sitchensis
ref|XP_009121241.1|  PREDICTED: serine carboxypeptidase-like 47       89.7    4e-18   Brassica rapa
gb|EMS57267.1|  Serine carboxypeptidase-like protein                  91.3    5e-18   Triticum urartu
ref|XP_006407572.1|  hypothetical protein EUTSA_v10020509mg           89.0    1e-17   
ref|XP_004342296.1|  carboxypeptidase Ylike protein                   88.2    3e-17   Acanthamoeba castellanii str. Neff
gb|KCW50685.1|  hypothetical protein EUGRSUZ_J003712                  86.3    1e-16   Eucalyptus grandis [rose gum]
gb|KJB74773.1|  hypothetical protein B456_012G006300                  85.9    2e-16   Gossypium raimondii
gb|EFA80920.1|  peptidase S10 family protein                          85.1    3e-16   Heterostelium album PN500
ref|XP_008612376.1|  hypothetical protein SDRG_08278                  85.9    3e-16   Saprolegnia diclina VS20
gb|KDO33082.1|  hypothetical protein SPRG_01896                       85.9    3e-16   Saprolegnia parasitica CBS 223.65
gb|KHN46633.1|  Serine carboxypeptidase-like 49                       79.7    4e-16   Glycine soja [wild soybean]
ref|XP_004361668.1|  peptidase S10 family protein                     85.1    4e-16   Cavenderia fasciculata
ref|XP_010651777.1|  PREDICTED: serine carboxypeptidase 3 isoform X2  84.3    5e-16   
ref|WP_028830922.1|  hypothetical protein                             84.7    7e-16   
ref|XP_004336027.1|  serine carboxypeptidase (CBP1), putative         84.3    9e-16   Acanthamoeba castellanii str. Neff
gb|AIG56099.1|  secreted protein                                      84.3    1e-15   Achlya hypogyna
gb|AIG55528.1|  secreted protein                                      83.2    2e-15   Thraustotheca clavata
ref|XP_006378945.1|  hypothetical protein POPTR_0009s01220g           80.1    5e-15   
ref|XP_009035935.1|  hypothetical protein AURANDRAFT_58883            82.0    6e-15   Aureococcus anophagefferens
ref|XP_008873199.1|  hypothetical protein H310_09024                  78.2    2e-14   Aphanomyces invadans
ref|XP_004354412.1|  peptidase S10 family protein                     80.9    2e-14   Cavenderia fasciculata
ref|XP_001019030.1|  Serine carboxypeptidase family protein           80.1    2e-14   Tetrahymena thermophila SB210
ref|XP_001019021.1|  Serine carboxypeptidase family protein           79.7    3e-14   Tetrahymena thermophila SB210
emb|CDY50329.1|  BnaA10g13620D                                        79.7    3e-14   Brassica napus [oilseed rape]
ref|XP_009525970.1|  hypothetical protein PHYSODRAFT_544689           79.7    3e-14   Phytophthora sojae
gb|EWM30038.1|  serine protease family                                80.5    3e-14   Nannochloropsis gaditana
ref|XP_629909.1|  peptidase S10 family protein                        79.0    6e-14   Dictyostelium discoideum AX4
dbj|GAM27668.1|  hypothetical protein SAMD00019534_108440             79.0    7e-14   Acytostelium subglobosum LB1
ref|XP_004363289.2|  serine carboxypeptidase                          79.0    7e-14   Capsaspora owczarzaki ATCC 30864
ref|XP_005645486.1|  peptidase S10, serine carboxypeptidase           79.0    8e-14   Coccomyxa subellipsoidea C-169
emb|CCA25925.1|  serine protease family S10 putative                  79.7    9e-14   Albugo laibachii Nc14
gb|EFA81762.1|  peptidase S10 family protein                          78.6    1e-13   Heterostelium album PN500
ref|XP_002908112.1|  serine protease family S10, putative             78.6    1e-13   Phytophthora infestans T30-4
ref|XP_009822236.1|  hypothetical protein H257_00972                  78.6    1e-13   
ref|XP_001019018.1|  Serine carboxypeptidase family protein           77.8    1e-13   
emb|CCI44408.1|  unnamed protein product                              78.2    1e-13   
gb|ETP43878.1|  hypothetical protein F442_09507                       78.2    1e-13   
gb|ETK85961.1|  hypothetical protein L915_09396                       78.6    1e-13   
ref|XP_008906515.1|  hypothetical protein PPTG_12069                  78.6    1e-13   
gb|ETM45792.1|  hypothetical protein L914_09258                       78.2    1e-13   
gb|ETL92484.1|  hypothetical protein L917_09233                       78.2    1e-13   
gb|EJY70217.1|  Serine carboxypeptidase family protein                77.8    1e-13   
gb|ETI45962.1|  hypothetical protein F443_09601                       78.2    1e-13   
gb|ETO74657.1|  hypothetical protein F444_09663                       78.2    1e-13   
ref|XP_005776517.1|  hypothetical protein EMIHUDRAFT_450683           78.2    1e-13   
ref|XP_010034181.1|  PREDICTED: serine carboxypeptidase-like          78.2    2e-13   
ref|XP_008861319.1|  hypothetical protein H310_00346                  77.8    2e-13   
ref|XP_011409052.1|  PREDICTED: serine carboxypeptidase S10 famil...  74.3    2e-13   
ref|NP_197687.1|  alpha/beta-Hydrolases superfamily protein           73.9    4e-13   
dbj|GAM28682.1|  hypothetical protein SAMD00019534_118580             77.0    4e-13   
ref|XP_003390988.2|  PREDICTED: serine carboxypeptidase S10 famil...  74.3    5e-13   
ref|XP_003387315.1|  PREDICTED: serine carboxypeptidase-like 49       76.3    5e-13   
ref|XP_009837674.1|  hypothetical protein H257_12226                  76.6    6e-13   
ref|NP_986339.1|  AGL328Cp                                            76.3    8e-13   
ref|XP_005855029.1|  cathepsin A (carboxypeptidase C)                 76.6    9e-13   
ref|XP_502099.1|  YALI0C21604p                                        75.9    1e-12   
ref|XP_003389312.1|  PREDICTED: serine carboxypeptidase S10 famil...  75.5    1e-12   
gb|KDO21362.1|  hypothetical protein SPRG_13675                       75.9    1e-12   
ref|XP_008611456.1|  hypothetical protein SDRG_07403                  75.5    1e-12   
gb|EAR98760.2|  serine carboxypeptidase family protein                74.7    2e-12   
ref|XP_001019007.1|  Serine carboxypeptidase family protein           74.7    2e-12   
ref|XP_002888070.1|  hypothetical protein ARALYDRAFT_893323           70.5    2e-12   
ref|XP_003389311.1|  PREDICTED: serine carboxypeptidase S10 famil...  74.7    2e-12   
ref|XP_001019005.1|  Serine carboxypeptidase family protein           74.7    2e-12   
ref|XP_007307312.1|  serine carboxypeptidase                          74.7    2e-12   
ref|XP_004993485.1|  serine carboxypeptidase CBP1                     74.7    2e-12   
gb|EWM30035.1|  serine carboxypeptidase                               74.7    2e-12   
ref|XP_008614092.1|  hypothetical protein SDRG_09908                  74.3    3e-12   
ref|XP_006684255.1|  hypothetical protein CANTEDRAFT_112550           74.3    3e-12   
ref|XP_500385.1|  YALI0B01408p                                        74.3    3e-12   
gb|KDO32675.1|  hypothetical protein SPRG_02375                       73.6    5e-12   
gb|KDO17762.1|  hypothetical protein SPRG_16804                       73.6    5e-12   
gb|KIP03916.1|  hypothetical protein PHLGIDRAFT_121161                73.9    5e-12   
ref|XP_005836393.1|  hypothetical protein GUITHDRAFT_85780            73.6    5e-12   
ref|XP_001019006.1|  Serine carboxypeptidase family protein           73.2    6e-12   
gb|ETK76109.1|  hypothetical protein L915_17395                       70.5    7e-12   
ref|XP_002499869.1|  predicted protein                                72.8    9e-12   
gb|EYU40664.1|  hypothetical protein MIMGU_mgv1a004824mg              72.8    1e-11   
ref|XP_007810620.1|  carboxypeptidase Y precursor                     72.8    1e-11   
gb|KID87338.1|  carboxypeptidase Y precursor                          72.4    1e-11   
gb|KIE02402.1|  carboxypeptidase Y precursor                          72.4    1e-11   
gb|KID76498.1|  carboxypeptidase Y precursor                          72.4    1e-11   
ref|XP_007876003.1|  hypothetical protein PFL1_00316                  72.8    1e-11   
gb|KFG78851.1|  carboxypeptidase Y precursor                          72.4    1e-11   
ref|XP_002905113.1|  serine protease family S10, putative             72.4    1e-11   
gb|ESZ93509.1|  carboxypeptidase Y precursor                          72.4    1e-11   
ref|XP_004334804.1|  cathepsin A, putative                            72.4    1e-11   
ref|XP_007512042.1|  predicted protein                                72.4    1e-11   
gb|KCW50686.1|  hypothetical protein EUGRSUZ_J003711                  67.0    2e-11   
gb|AGO13554.1|  AaceriAGL328Cp                                        72.4    2e-11   
dbj|GAC92699.1|  potential serine carboxypeptidase                    72.4    2e-11   
ref|XP_011387820.1|  hypothetical protein UMAG_01886                  72.4    2e-11   
ref|XP_008896412.1|  hypothetical protein PPTG_04272                  72.0    2e-11   
ref|XP_008871130.1|  hypothetical protein H310_07524                  72.0    2e-11   
gb|EST07828.1|  serine carboxypeptidase                               72.4    2e-11   
ref|XP_005779613.1|  hypothetical protein EMIHUDRAFT_56897            68.6    2e-11   
gb|ETP05733.1|  hypothetical protein F441_17755                       72.0    2e-11   
emb|CBQ72117.1|  related to carboxypeptidase                          72.4    2e-11   
ref|XP_001387427.2|  carboxypeptidase C                               72.0    2e-11   
ref|XP_009521299.1|  hypothetical protein PHYSODRAFT_555555           72.0    2e-11   
ref|XP_004036721.1|  serine carboxypeptidase family protein, puta...  71.2    2e-11   
gb|ETM36006.1|  hypothetical protein L914_17198                       72.0    2e-11   
ref|XP_500219.1|  YALI0A18810p                                        72.0    2e-11   
ref|XP_005771165.1|  hypothetical protein EMIHUDRAFT_424894           71.6    2e-11   
gb|ETL82770.1|  hypothetical protein L917_17119                       69.7    2e-11   
gb|ETI35918.1|  hypothetical protein F443_17878                       71.6    2e-11   
gb|ETO64630.1|  hypothetical protein F444_17914                       71.6    2e-11   
ref|XP_008896410.1|  hypothetical protein PPTG_04269                  71.6    2e-11   
gb|ETM36002.1|  hypothetical protein L914_17195                       71.6    2e-11   
gb|KFX44144.1|  Carboxypeptidase Y like A                             72.0    2e-11   
ref|XP_003424792.1|  PREDICTED: venom serine carboxypeptidase iso...  71.6    2e-11   
ref|XP_003669270.1|  hypothetical protein NDAI_0C03670                72.0    2e-11   
gb|ETK76098.1|  hypothetical protein L915_17404                       71.6    2e-11   
emb|CDW86360.1|  serine carboxypeptidase family protein               71.2    3e-11   
gb|EXV01401.1|  peptidase S10 family protein                          71.6    3e-11   
gb|ETK76110.1|  hypothetical protein L915_17396                       68.2    3e-11   
ref|XP_004180003.1|  hypothetical protein TBLA_0C06920                71.6    3e-11   
ref|XP_001748887.1|  hypothetical protein                             71.2    3e-11   
ref|XP_502558.1|  YALI0D08052p                                        71.2    3e-11   
ref|XP_006671615.1|  carboxypeptidase Y                               71.2    3e-11   
emb|CCE44538.1|  hypothetical protein CPAR2_403410                    71.2    3e-11   
ref|XP_001031129.1|  Serine carboxypeptidase family protein           70.9    3e-11   
ref|XP_009521295.1|  hypothetical protein PHYSODRAFT_555553           71.2    3e-11   
gb|EGE01457.1|  carboxypeptidase Y                                    69.7    3e-11   
ref|XP_007834809.1|  Carboxypeptidase Y                               71.2    3e-11   
gb|ETO64634.1|  hypothetical protein F444_17917                       71.2    3e-11   
gb|ETL82766.1|  hypothetical protein L917_17131                       71.2    3e-11   
gb|ETL29540.1|  hypothetical protein L916_17300                       71.2    3e-11   
gb|ETK76102.1|  hypothetical protein L915_17407                       71.2    3e-11   
gb|KIK42752.1|  hypothetical protein CY34DRAFT_755127                 71.2    4e-11   
gb|ETP33859.1|  hypothetical protein F442_17736                       71.2    4e-11   
gb|ETI35922.1|  hypothetical protein F443_17881                       71.2    4e-11   
ref|XP_001031128.1|  Serine carboxypeptidase family protein           70.5    4e-11   
ref|XP_002604286.1|  hypothetical protein BRAFLDRAFT_88575            70.9    4e-11   
gb|KHJ98480.1|  serine carboxypeptidase                               68.2    4e-11   
emb|CEP64030.1|  LALA0S10e00628g1_1                                   70.9    5e-11   
gb|KIL00466.1|  hypothetical protein PAXRUDRAFT_821664                70.9    5e-11   
gb|ETL82771.1|  hypothetical protein L917_17120                       67.4    5e-11   
gb|EAR83465.2|  serine carboxypeptidase family protein                70.5    5e-11   
ref|XP_001557447.1|  hypothetical protein BC1G_03711                  70.9    6e-11   
ref|XP_008543174.1|  PREDICTED: venom serine carboxypeptidase         70.5    6e-11   
gb|EFW13322.1|  carboxypeptidase                                      70.5    6e-11   
ref|XP_002958371.1|  hypothetical protein VOLCADRAFT_108101           70.9    6e-11   
gb|EGO01539.1|  hypothetical protein SERLA73DRAFT_103364              70.5    6e-11   
gb|EMG47549.1|  Carboxypeptidase Y                                    70.5    6e-11   
ref|XP_007315283.1|  hypothetical protein SERLADRAFT_413693           70.5    6e-11   
ref|XP_009831068.1|  hypothetical protein H257_07294                  70.5    6e-11   
ref|XP_011266008.1|  PREDICTED: venom serine carboxypeptidase-lik...  69.7    6e-11   
ref|XP_007049588.1|  Serine carboxypeptidase-like 20 isoform 2        70.5    6e-11   
ref|XP_458246.2|  DEHA2C13112p                                        70.5    6e-11   
ref|XP_502601.1|  YALI0D09042p                                        70.1    7e-11   
ref|XP_005844152.1|  hypothetical protein CHLNCDRAFT_32614            70.1    7e-11   
ref|XP_007049587.1|  Serine carboxypeptidase-like 20 isoform 1        70.5    7e-11   
ref|XP_009831058.1|  hypothetical protein H257_07284                  70.1    7e-11   
ref|XP_009549689.1|  serine carboxypeptidase S10                      70.5    7e-11   
ref|XP_008601680.1|  serine carboxypeptidase                          70.5    8e-11   
ref|XP_001599671.2|  PREDICTED: venom serine carboxypeptidase-like    70.1    8e-11   
ref|XP_011266005.1|  PREDICTED: venom serine carboxypeptidase-lik...  70.1    8e-11   
ref|XP_008059156.1|  PREDICTED: probable serine carboxypeptidase ...  67.8    8e-11   
ref|XP_008614093.1|  hypothetical protein SDRG_09909                  70.1    8e-11   
gb|KGQ08099.1|  Carboxypeptidase Y A                                  70.1    8e-11   
ref|XP_001238946.1|  hypothetical protein CIMG_09968                  70.1    8e-11   
ref|XP_009831066.1|  hypothetical protein H257_07292                  70.1    8e-11   
ref|XP_011266006.1|  PREDICTED: venom serine carboxypeptidase-lik...  70.1    9e-11   
ref|XP_011266004.1|  PREDICTED: venom serine carboxypeptidase-lik...  69.7    9e-11   
gb|KIK71004.1|  hypothetical protein GYMLUDRAFT_33108                 70.1    9e-11   
ref|XP_010323102.1|  PREDICTED: serine carboxypeptidase-like 20       70.1    9e-11   
gb|EPS74136.1|  hypothetical protein M569_00619                       69.7    9e-11   
gb|KGQ06561.1|  Carboxypeptidase Y A                                  69.7    1e-10   
ref|XP_002786655.1|  Serine carboxypeptidase, putative                69.7    1e-10   
ref|XP_002905123.1|  serine protease family S10, putative             69.7    1e-10   
ref|XP_010678976.1|  PREDICTED: serine carboxypeptidase-like 20       69.7    1e-10   
ref|XP_003014599.1|  hypothetical protein ARB_07161                   70.1    1e-10   
ref|XP_002786656.1|  conserved hypothetical protein                   69.7    1e-10   
ref|XP_002905122.1|  serine protease family S10, putative             69.7    1e-10   
gb|EGD99419.1|  serine carboxypeptidase                               69.7    1e-10   
gb|EYC23744.1|  hypothetical protein Y032_0015g2811                   70.5    1e-10   
gb|EHL01914.1|  putative Carboxypeptidase Y like protein A            69.7    1e-10   
ref|XP_008602128.1|  carboxypeptidase Y                               70.5    1e-10   
gb|EPS59025.1|  hypothetical protein M569_15786                       67.0    1e-10   
ref|XP_008896403.1|  hypothetical protein PPTG_04261                  69.7    1e-10   
ref|XP_003678239.1|  hypothetical protein NCAS_0I02290                69.7    1e-10   
ref|XP_002550523.1|  carboxypeptidase Y precursor                     69.7    1e-10   
gb|EYC23741.1|  hypothetical protein Y032_0015g2811                   70.1    1e-10   
gb|EYC23743.1|  hypothetical protein Y032_0015g2811                   70.1    1e-10   
emb|CCI43630.1|  unnamed protein product                              69.3    1e-10   
gb|ETP05722.1|  hypothetical protein F441_17745                       69.7    1e-10   
gb|KIJ70392.1|  hypothetical protein HYDPIDRAFT_35782                 69.7    1e-10   
ref|XP_003870062.1|  hypothetical protein CORT_0E03430                69.3    1e-10   
gb|KHC57527.1|  cathepsin A (carboxypeptidase C)                      69.7    1e-10   
ref|XP_006366827.1|  PREDICTED: serine carboxypeptidase-like 20-like  69.7    1e-10   
ref|XP_718495.1|  potential serine carboxypeptidase                   69.7    1e-10   
dbj|GAK63744.1|  serine carboxypeptidase                              69.7    1e-10   
ref|XP_008084992.1|  alpha/beta-Hydrolase                             69.7    1e-10   
gb|ETI35911.1|  hypothetical protein F443_17871                       69.7    1e-10   
gb|KGR03775.1|  cathepsin A (carboxypeptidase C)                      69.7    1e-10   
gb|ETS63106.1|  hypothetical protein PaG_02883                        69.7    1e-10   
gb|KHC43398.1|  cathepsin A (carboxypeptidase C)                      69.7    1e-10   
gb|KHC40604.1|  cathepsin A (carboxypeptidase C)                      69.7    1e-10   
gb|KGR23622.1|  cathepsin A (carboxypeptidase C)                      69.7    1e-10   
gb|KGR15695.1|  cathepsin A (carboxypeptidase C)                      69.7    1e-10   
gb|KGQ98958.1|  cathepsin A (carboxypeptidase C)                      69.7    1e-10   
gb|ETO64622.1|  hypothetical protein F444_17906                       69.7    1e-10   
gb|KGU17575.1|  cathepsin A (carboxypeptidase C)                      69.7    1e-10   
dbj|GAC76856.1|  serine carboxypeptidases                             69.7    1e-10   
gb|KGU36153.1|  cathepsin A (carboxypeptidase C)                      69.7    1e-10   
gb|EEQ42612.1|  carboxypeptidase Y precursor                          69.7    1e-10   
gb|EYC23740.1|  hypothetical protein Y032_0015g2811                   70.1    1e-10   
ref|XP_007199794.1|  hypothetical protein PRUPE_ppa004538mg           69.3    1e-10   
gb|KGQ91831.1|  cathepsin A (carboxypeptidase C)                      69.7    1e-10   
gb|KEZ42917.1|  Carboxypeptidase Y-like protein A                     69.7    1e-10   
ref|XP_718579.1|  potential serine carboxypeptidase                   69.7    1e-10   
gb|EUC56960.1|  peptidase S10, serine carboxypeptidase                69.3    1e-10   
ref|XP_008896402.1|  hypothetical protein PPTG_04260                  69.3    1e-10   
ref|XP_002417210.1|  carboxypeptidase Y precursor, putative; seri...  69.7    1e-10   
ref|XP_006366824.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...  69.3    1e-10   
ref|XP_003035959.1|  hypothetical protein SCHCODRAFT_50901            69.3    1e-10   
gb|KEP50202.1|  peptidase S10, serine carboxypeptidase                69.3    1e-10   
emb|CDY49647.1|  BnaC09g41250D                                        69.3    1e-10   
gb|ETI35910.1|  hypothetical protein F443_17870                       69.3    1e-10   
ref|XP_008235895.1|  PREDICTED: serine carboxypeptidase-like 20       69.3    1e-10   
ref|XP_001586513.1|  hypothetical protein SS1G_12500                  69.7    1e-10   
gb|EYC23742.1|  hypothetical protein Y032_0015g2811                   70.1    1e-10   
ref|XP_004242440.1|  PREDICTED: serine carboxypeptidase-like 20       69.3    1e-10   
gb|KJA21088.1|  hypothetical protein HYPSUDRAFT_42466                 69.3    1e-10   
gb|EMG47853.1|  Carboxypeptidase Y                                    69.3    1e-10   
ref|XP_004242437.1|  PREDICTED: serine carboxypeptidase-like 20       69.3    1e-10   
ref|XP_002145840.1|  carboxypeptidase CpyA/Prc1, putative             69.3    1e-10   
gb|EFX00513.1|  carboxypeptidase y precursor                          69.3    1e-10   
gb|EZF33603.1|  hypothetical protein H101_02839                       69.3    1e-10   
ref|XP_009521352.1|  hypothetical protein PHYSODRAFT_326997           69.3    2e-10   
dbj|GAA96604.1|  hypothetical protein E5Q_03274                       69.3    2e-10   
ref|XP_007411030.1|  putative carboxypeptidase C                      69.3    2e-10   
gb|KHN99363.1|  carboxypeptidase Y precursor                          69.3    2e-10   
gb|KDB17426.1|  carboxypeptidase Y precursor                          68.9    2e-10   
emb|CDR41809.1|  CYFA0S08e00276g1_1                                   69.3    2e-10   
gb|KGQ82278.1|  carboxypeptidase Y                                    69.3    2e-10   
sp|P30574.2|CBPY_CANAX  RecName: Full=Carboxypeptidase Y; AltName...  69.3    2e-10   
gb|EEQ47110.1|  carboxypeptidase Y precursor                          69.3    2e-10   
emb|CDM84698.1|  unnamed protein product                              68.9    2e-10   
ref|XP_006366830.1|  PREDICTED: serine carboxypeptidase-like 20-like  69.3    2e-10   
ref|XP_002421512.1|  carboxypeptidase yscY, putative; proteinase ...  69.3    2e-10   
gb|KGU24089.1|  carboxypeptidase Y                                    69.3    2e-10   
ref|XP_711679.1|  potential serine carboxypeptidase                   69.3    2e-10   
ref|XP_011158000.1|  PREDICTED: venom serine carboxypeptidase         68.9    2e-10   
gb|KGQ84848.1|  carboxypeptidase Y                                    69.3    2e-10   
ref|XP_009521305.1|  hypothetical protein PHYSODRAFT_555569           68.9    2e-10   
ref|XP_009521306.1|  hypothetical protein PHYSODRAFT_478999           68.9    2e-10   
ref|XP_003084075.1|  Serine carboxypeptidases (lysosomal cathepsi...  68.9    2e-10   
ref|XP_001018531.1|  Serine carboxypeptidase family protein           68.9    2e-10   
gb|EAR98286.2|  serine carboxypeptidase family protein                68.6    2e-10   
emb|CCF53328.1|  related to carboxypeptidase                          69.3    2e-10   
gb|KJA21650.1|  hypothetical protein HYPSUDRAFT_41773                 68.9    2e-10   
ref|XP_009843291.1|  hypothetical protein H257_16537                  68.9    2e-10   



>ref|XP_006361688.1| PREDICTED: serine carboxypeptidase-like 49-like [Solanum tuberosum]
Length=504

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 109/129 (84%), Gaps = 3/129 (2%)
 Frame = +2

Query  167  LFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTV  346
            +FPS  RFAS QAEKLIRELNLFPKES NIV R      ++G ++VEK F FPNLA+ +V
Sbjct  28   VFPS--RFASKQAEKLIRELNLFPKESDNIVDRDPFQTDDEGSRIVEKRFSFPNLANSSV  85

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            S EDLGHHAGY+KI+HS+AAR+FYFFFES RG KDDPVVIWL+GGPGCSSELALF+ENGP
Sbjct  86   SFEDLGHHAGYYKIKHSHAARLFYFFFES-RGSKDDPVVIWLSGGPGCSSELALFYENGP  144

Query  527  FKIANNLSL  553
            F I+ NLSL
Sbjct  145  FSISKNLSL  153



>ref|XP_004250045.1| PREDICTED: serine carboxypeptidase-like [Solanum lycopersicum]
Length=501

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDL  361
            SRFA+ QAEKLI+ELNLFPKES NIV R      ++G ++VEK F FPNLA+ +V++EDL
Sbjct  28   SRFATKQAEKLIQELNLFPKESDNIVDRDPFQTDDEGSRIVEKRFSFPNLANSSVTIEDL  87

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
            GHHAGY+KI+HS+AAR+FYFFFES RG KDDPVVIWL+GGPGCSSELALF+ENGPF I+ 
Sbjct  88   GHHAGYYKIKHSHAARLFYFFFES-RGSKDDPVVIWLSGGPGCSSELALFYENGPFSISK  146

Query  542  NLSL  553
            NLSL
Sbjct  147  NLSL  150



>ref|XP_010243256.1| PREDICTED: serine carboxypeptidase-like [Nelumbo nucifera]
Length=498

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 107/128 (84%), Gaps = 6/128 (5%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVS  349
             PS ++F + QAEKLIR+LNLFPK++V++V   S++     PKLVE+ F FPNLADP+VS
Sbjct  30   LPSTAKFPTIQAEKLIRDLNLFPKDAVDVVGDSSVA-----PKLVERRFSFPNLADPSVS  84

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            ++DLGHHAGY+++QHS+AARMFY  FESR  KK DPVVIWLTGGPGCSSELA+F+ENGPF
Sbjct  85   LDDLGHHAGYYRLQHSHAARMFYLLFESRNSKK-DPVVIWLTGGPGCSSELAVFYENGPF  143

Query  530  KIANNLSL  553
             IA NLSL
Sbjct  144  TIAKNLSL  151



>ref|XP_009774966.1| PREDICTED: serine carboxypeptidase-like 49, partial [Nicotiana 
sylvestris]
Length=296

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 104/126 (83%), Gaps = 4/126 (3%)
 Frame = +2

Query  179  NSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTV-SVE  355
            +S+ AS QAEKLI ELNLFPKES NIV R     A    ++VEK F FPNLA+ ++ S E
Sbjct  30   SSKLASKQAEKLIHELNLFPKESDNIVDRDPFPTA--ASRIVEKRFSFPNLANSSIISFE  87

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            DLGHHAGY+KI+HS+AAR+FYFFFES+ G KDDPVVIWL+GGPGCSSELALF+ENGPF I
Sbjct  88   DLGHHAGYYKIKHSHAARLFYFFFESQ-GSKDDPVVIWLSGGPGCSSELALFYENGPFSI  146

Query  536  ANNLSL  553
            ANNLSL
Sbjct  147  ANNLSL  152



>ref|XP_010267214.1| PREDICTED: serine carboxypeptidase-like [Nelumbo nucifera]
Length=501

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 6/128 (5%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT--VS  349
            S ++F  AQAEKLIRELNL PK++V +V   S++ A   PKL+EK FKFPNLADP   V+
Sbjct  36   SRAKFPKAQAEKLIRELNLLPKDAVEVVDDSSVAVA---PKLIEKRFKFPNLADPEPEVT  92

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
             EDLGH+AGY+++QHS+AARMFYFFF+SR  K+D PVVIWLTGGPGCSSE+ALF+ENGPF
Sbjct  93   AEDLGHYAGYYRLQHSHAARMFYFFFQSRNSKRD-PVVIWLTGGPGCSSEIALFYENGPF  151

Query  530  KIANNLSL  553
             IANNLSL
Sbjct  152  TIANNLSL  159



>ref|XP_010103537.1| Serine carboxypeptidase-like 49 [Morus notabilis]
 gb|EXB96197.1| Serine carboxypeptidase-like 49 [Morus notabilis]
Length=511

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 101/130 (78%), Gaps = 5/130 (4%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRG----SLSAAEQGPKLVEKLFKFPNLADPT  343
            + S F S QA+ LIR LNLFP   VN++       SLS+A+   +LVEK F  PNLAD  
Sbjct  33   ARSSFPSVQAQSLIRALNLFPDHDVNLIDGADAGDSLSSADPNKRLVEKRFTMPNLADSG  92

Query  344  VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENG  523
            VSVEDLGHHAGY+KI+HSYAA+MFY FFES RG K DPVVIWLTGGPGCSSELA+F+ENG
Sbjct  93   VSVEDLGHHAGYYKIEHSYAAKMFYLFFES-RGSKKDPVVIWLTGGPGCSSELAVFYENG  151

Query  524  PFKIANNLSL  553
            PF IA+NLSL
Sbjct  152  PFSIADNLSL  161



>ref|XP_009617439.1| PREDICTED: serine carboxypeptidase-like [Nicotiana tomentosiformis]
Length=505

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 102/126 (81%), Gaps = 4/126 (3%)
 Frame = +2

Query  179  NSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTV-SVE  355
            +S+ AS QAEKLI ELNLFPKES NIV R     A    ++VEK F F NL + +V S E
Sbjct  32   SSKLASKQAEKLIHELNLFPKESDNIVDRDPFPTA--ASRIVEKRFNFANLTNSSVISFE  89

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            DLGHHAGY+KI+HS+AAR+FYFFFESR G KDDPVVIWL+GGPGCSSELALF+ENGPF I
Sbjct  90   DLGHHAGYYKIKHSHAARLFYFFFESR-GSKDDPVVIWLSGGPGCSSELALFYENGPFSI  148

Query  536  ANNLSL  553
            +NNLSL
Sbjct  149  SNNLSL  154



>ref|XP_008363544.1| PREDICTED: serine carboxypeptidase-like [Malus domestica]
Length=515

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 100/128 (78%), Gaps = 3/128 (2%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIV--PRGSLSAAEQGPKLVEKLFKFPNLADPTVS  349
            + S F S  A++LIR  NLFP+E +NI+  P  S +A    P+LVEK F+ PNL +  VS
Sbjct  39   ARSSFPSVHAKQLIRAFNLFPEEDINIIDGPDSSTAAVADAPRLVEKPFRLPNLIESGVS  98

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            VEDLGHHAGYF I+HS+AA+MFY FFESR  KK DPVVIWLTGGPGCSSELA+F+ENGPF
Sbjct  99   VEDLGHHAGYFNIEHSHAAKMFYLFFESRTNKK-DPVVIWLTGGPGCSSELAVFYENGPF  157

Query  530  KIANNLSL  553
             IANNLSL
Sbjct  158  TIANNLSL  165



>ref|XP_007010003.1| Serine carboxypeptidase-like 49 [Theobroma cacao]
 gb|EOY18813.1| Serine carboxypeptidase-like 49 [Theobroma cacao]
Length=508

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 101/125 (81%), Gaps = 3/125 (2%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT-VSVED  358
            S F S  A+KLIRELNLFPKE VN+V  G +S  E   +LVEK FKFPNLA P  VSVED
Sbjct  37   SSFPSIHAKKLIRELNLFPKEEVNVVDGGQVSLPEDS-RLVEKRFKFPNLAVPGGVSVED  95

Query  359  LGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIA  538
            LGHHAGY+K+ +S+ ARMFYFFFESR  KKD PVVIWLTGGPGCSSELALF+ENGPF IA
Sbjct  96   LGHHAGYYKLANSHDARMFYFFFESRNSKKD-PVVIWLTGGPGCSSELALFYENGPFTIA  154

Query  539  NNLSL  553
             N+SL
Sbjct  155  ENMSL  159



>emb|CAC86383.1| carboxypeptidase type III [Theobroma cacao]
Length=508

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 101/125 (81%), Gaps = 3/125 (2%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT-VSVED  358
            S F S  A+KLIRELNLFPKE VN+V  G +S  E   +LVEK FKFPNLA P  VSVED
Sbjct  37   SSFPSIHAKKLIRELNLFPKEEVNVVDGGQVSLPEDS-RLVEKRFKFPNLAVPGGVSVED  95

Query  359  LGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIA  538
            LGHHAGY+K+ +S+ ARMFYFFFESR  KKD PVVIWLTGGPGCSSELALF+ENGPF IA
Sbjct  96   LGHHAGYYKLANSHDARMFYFFFESRNSKKD-PVVIWLTGGPGCSSELALFYENGPFTIA  154

Query  539  NNLSL  553
             N+SL
Sbjct  155  ENMSL  159



>ref|XP_007220656.1| hypothetical protein PRUPE_ppa003691mg [Prunus persica]
 gb|EMJ21855.1| hypothetical protein PRUPE_ppa003691mg [Prunus persica]
Length=555

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVE  355
            + S F S  A++LIR  NLFPKE +NI+     S     P+LVEK F  PNL    VSVE
Sbjct  81   ARSSFPSVHAQELIRAFNLFPKEDINIIDGPDSSIFHDSPRLVEKRFNLPNLVGSGVSVE  140

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            DLGHHAGYFKI+HS+AARMFY FFESR  KK DPVVIWLTGGPGCSSELA+F+ENGPF I
Sbjct  141  DLGHHAGYFKIEHSHAARMFYLFFESRTNKK-DPVVIWLTGGPGCSSELAVFYENGPFNI  199

Query  536  ANNLSL  553
            ANNLSL
Sbjct  200  ANNLSL  205



>ref|XP_011094551.1| PREDICTED: serine carboxypeptidase-like [Sesamum indicum]
Length=592

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = +2

Query  185  RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT-VSVEDL  361
            R  S  AE+LIR+LNLFPK+S+NIV           PK+VE+ FKFPNL DP+ VS EDL
Sbjct  33   RLPSVSAERLIRDLNLFPKQSINIVDDDVRFL--DTPKIVERRFKFPNLVDPSGVSAEDL  90

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
            GHHAGY++IQHS+ ARMFYFFFESR   KD PVVIWLTGGPGCSSE+ALF+ENGPF IAN
Sbjct  91   GHHAGYYQIQHSHGARMFYFFFESRNSSKD-PVVIWLTGGPGCSSEMALFYENGPFTIAN  149

Query  542  NLSL  553
            NLSL
Sbjct  150  NLSL  153



>gb|KJB60534.1| hypothetical protein B456_009G310800 [Gossypium raimondii]
 gb|KJB60535.1| hypothetical protein B456_009G310800 [Gossypium raimondii]
Length=451

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 103/132 (78%), Gaps = 3/132 (2%)
 Frame = +2

Query  161  GDLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP  340
             DL  ++S F S  A+KLIRELNLFPK  VN+V    +S  E GPKLVEK FKFP L  P
Sbjct  29   ADLRLTDSSFPSVHAKKLIRELNLFPKGEVNVVDEHRVSLPE-GPKLVEKRFKFPTLEVP  87

Query  341  T-VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
              VS EDLGHHAGY+K+ +S+ ARMFYFFFESR  KKD PVVIWLTGGPGCSSELALF+E
Sbjct  88   GGVSFEDLGHHAGYYKLPNSHDARMFYFFFESRNSKKD-PVVIWLTGGPGCSSELALFYE  146

Query  518  NGPFKIANNLSL  553
            NGPF IA+N+SL
Sbjct  147  NGPFTIADNMSL  158



>gb|KJB60533.1| hypothetical protein B456_009G310800 [Gossypium raimondii]
Length=451

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 103/132 (78%), Gaps = 3/132 (2%)
 Frame = +2

Query  161  GDLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP  340
             DL  ++S F S  A+KLIRELNLFPK  VN+V    +S  E GPKLVEK FKFP L  P
Sbjct  29   ADLRLTDSSFPSVHAKKLIRELNLFPKGEVNVVDEHRVSLPE-GPKLVEKRFKFPTLEVP  87

Query  341  T-VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
              VS EDLGHHAGY+K+ +S+ ARMFYFFFESR  KKD PVVIWLTGGPGCSSELALF+E
Sbjct  88   GGVSFEDLGHHAGYYKLPNSHDARMFYFFFESRNSKKD-PVVIWLTGGPGCSSELALFYE  146

Query  518  NGPFKIANNLSL  553
            NGPF IA+N+SL
Sbjct  147  NGPFTIADNMSL  158



>emb|CDO99792.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 103/131 (79%), Gaps = 4/131 (3%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAE--QGPKLVEKLFKFPNL-ADP  340
             P N+ F S  AEKLIR+LNLFPK+ +NI     LS++   +  K+VEK  K  NL +DP
Sbjct  29   LPPNAYFPSVHAEKLIRQLNLFPKQLINIADHDPLSSSPFPEAEKIVEKPLKLSNLVSDP  88

Query  341  TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
            +V+V+DL HHAGYFKI+HS+AARMFYFFF+SR  KKD PVVIWLTGGPGCSSELALF+EN
Sbjct  89   SVTVQDLAHHAGYFKIEHSHAARMFYFFFQSRNSKKD-PVVIWLTGGPGCSSELALFYEN  147

Query  521  GPFKIANNLSL  553
            GPF IA NLSL
Sbjct  148  GPFSIAKNLSL  158



>gb|AAL67992.1| putative serine carboxypeptidase precursor [Gossypium hirsutum]
Length=507

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 103/132 (78%), Gaps = 3/132 (2%)
 Frame = +2

Query  161  GDLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP  340
             DL  ++S F S  A+KLIRELNLFPK  VN+V    +S  E GPKLVEK FKFP L  P
Sbjct  29   ADLRLTDSSFPSVHAKKLIRELNLFPKGEVNVVDEHRVSLPE-GPKLVEKRFKFPTLEVP  87

Query  341  T-VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
              VS EDLGHHAGY+K+ +S+ ARMFYFFFESR  KKD PVVIWLTGGPGCSSELALF+E
Sbjct  88   GGVSFEDLGHHAGYYKLPNSHDARMFYFFFESRNSKKD-PVVIWLTGGPGCSSELALFYE  146

Query  518  NGPFKIANNLSL  553
            NGPF IA+N+SL
Sbjct  147  NGPFTIADNMSL  158



>gb|KJB60536.1| hypothetical protein B456_009G310800 [Gossypium raimondii]
Length=530

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +2

Query  164  DLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT  343
            DL  ++S F S  A+KLIRELNLFPK  VN+V    +S  E GPKLVEK FKFP L  P 
Sbjct  30   DLRLTDSSFPSVHAKKLIRELNLFPKGEVNVVDEHRVSLPE-GPKLVEKRFKFPTLEVPG  88

Query  344  -VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
             VS EDLGHHAGY+K+ +S+ ARMFYFFFESR  KKD PVVIWLTGGPGCSSELALF+EN
Sbjct  89   GVSFEDLGHHAGYYKLPNSHDARMFYFFFESRNSKKD-PVVIWLTGGPGCSSELALFYEN  147

Query  521  GPFKIANNLSL  553
            GPF IA+N+SL
Sbjct  148  GPFTIADNMSL  158



>gb|KJB60532.1| hypothetical protein B456_009G310800 [Gossypium raimondii]
Length=564

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 103/132 (78%), Gaps = 3/132 (2%)
 Frame = +2

Query  161  GDLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP  340
             DL  ++S F S  A+KLIRELNLFPK  VN+V    +S  E GPKLVEK FKFP L  P
Sbjct  86   ADLRLTDSSFPSVHAKKLIRELNLFPKGEVNVVDEHRVSLPE-GPKLVEKRFKFPTLEVP  144

Query  341  T-VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
              VS EDLGHHAGY+K+ +S+ ARMFYFFFESR  KKD PVVIWLTGGPGCSSELALF+E
Sbjct  145  GGVSFEDLGHHAGYYKLPNSHDARMFYFFFESRNSKKD-PVVIWLTGGPGCSSELALFYE  203

Query  518  NGPFKIANNLSL  553
            NGPF IA+N+SL
Sbjct  204  NGPFTIADNMSL  215



>ref|XP_008233268.1| PREDICTED: serine carboxypeptidase-like [Prunus mume]
Length=505

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVE  355
            + S F S  A++LIR  NLFPKE +NI+     S     P+LVEK F  PNL    VS+E
Sbjct  31   ARSSFPSVHAQELIRAFNLFPKEDINIIDGPDSSIFHDSPRLVEKRFNLPNLVGSGVSLE  90

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            DL HHAGYFKI+HS+AARMFY FFESR  KK DPVVIWLTGGPGCSSELA+F+ENGPF I
Sbjct  91   DLSHHAGYFKIEHSHAARMFYLFFESRTNKK-DPVVIWLTGGPGCSSELAVFYENGPFNI  149

Query  536  ANNLSL  553
            ANNLSL
Sbjct  150  ANNLSL  155



>gb|EYU39640.1| hypothetical protein MIMGU_mgv1a0046371mg, partial [Erythranthe 
guttata]
 gb|EYU39641.1| hypothetical protein MIMGU_mgv1a0046371mg, partial [Erythranthe 
guttata]
Length=161

 Score =   162 bits (411),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 96/124 (77%), Gaps = 4/124 (3%)
 Frame = +2

Query  185  RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT-VSVEDL  361
              +   AEKLIR+LNLFP +  NI+     SA    P +VE+ FKFP+L DP+ VS E+L
Sbjct  32   HLSPVSAEKLIRDLNLFPNKPFNIIADDLQSA--DAPSIVERRFKFPDLVDPSGVSAEEL  89

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
            GHHAGY++IQHS++A+MFYFFFESR    D PVVIWLTGGPGCSSE+ALF+ENGPF IAN
Sbjct  90   GHHAGYYQIQHSHSAKMFYFFFESRNSTTD-PVVIWLTGGPGCSSEMALFYENGPFTIAN  148

Query  542  NLSL  553
            NLSL
Sbjct  149  NLSL  152



>gb|KJB74771.1| hypothetical protein B456_012G006300 [Gossypium raimondii]
Length=511

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +2

Query  164  DLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL-ADP  340
            DL  + S F S QA+KLIRELNLFPKE VN+V RG +S   Q  KLVEK FKFP L A  
Sbjct  34   DLRFAGSSFPSVQAKKLIRELNLFPKEEVNLVDRGRVSLP-QDSKLVEKRFKFPGLEALG  92

Query  341  TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
             VSV+DL HHAGY+K+ +SY ARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+EN
Sbjct  93   GVSVDDLSHHAGYYKLPNSYDARMFYFFFESR-SNKEDPVVIWLTGGPGCSSELALFYEN  151

Query  521  GPFKIANNLSL  553
            GPF I++N+SL
Sbjct  152  GPFSISDNMSL  162



>gb|KJB74772.1| hypothetical protein B456_012G006300 [Gossypium raimondii]
Length=582

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 104/131 (79%), Gaps = 3/131 (2%)
 Frame = +2

Query  164  DLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL-ADP  340
            DL  + S F S QA+KLIRELNLFPKE VN+V RG +S   Q  KLVEK FKFP L A  
Sbjct  34   DLRFAGSSFPSVQAKKLIRELNLFPKEEVNLVDRGRVSLP-QDSKLVEKRFKFPGLEALG  92

Query  341  TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
             VSV+DL HHAGY+K+ +SY ARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+EN
Sbjct  93   GVSVDDLSHHAGYYKLPNSYDARMFYFFFESR-SNKEDPVVIWLTGGPGCSSELALFYEN  151

Query  521  GPFKIANNLSL  553
            GPF I++N+SL
Sbjct  152  GPFSISDNMSL  162



>ref|XP_009368926.1| PREDICTED: serine carboxypeptidase-like [Pyrus x bretschneideri]
Length=515

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 98/128 (77%), Gaps = 3/128 (2%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIV--PRGSLSAAEQGPKLVEKLFKFPNLADPTVS  349
            + S F S  A++LIR  NLFP+E +NI+  P  S +A    P+  EK  + PNL +  VS
Sbjct  39   ARSSFPSVHAKQLIRAFNLFPEEDINIIDGPDSSTAAVADAPRRKEKPLRLPNLIESGVS  98

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            VEDLGHHAGYFKI+HS+AA+MFY FFESR  KK DPVVIWLTGGPGCSSELA+F+ENGPF
Sbjct  99   VEDLGHHAGYFKIEHSHAAKMFYLFFESRTNKK-DPVVIWLTGGPGCSSELAVFYENGPF  157

Query  530  KIANNLSL  553
             IANNLSL
Sbjct  158  TIANNLSL  165



>ref|XP_010543556.1| PREDICTED: serine carboxypeptidase-like 49 [Tarenaya hassleriana]
Length=512

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = +2

Query  188  FASAQAEKLIRELNLFPKESVNIVP-RGSLSAAEQGPKLVEKLFKFPNLA-DPTVSVEDL  361
            F S++AE+LIRELNLFPKE VN++  R     A +G ++VE+ F+FPNL  D  V+V+DL
Sbjct  38   FPSSRAEQLIRELNLFPKEEVNVIDGRDQPLNAMEGSRIVERKFRFPNLIHDGGVNVDDL  97

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
            GHHAGY+K+ HS  ARMFYFFFESR  K DDPVVIWLTGGPGCSSELA+F+ENGPF+I+N
Sbjct  98   GHHAGYYKLPHSRGARMFYFFFESRN-KTDDPVVIWLTGGPGCSSELAMFYENGPFQISN  156

Query  542  NLSL  553
            NLSL
Sbjct  157  NLSL  160



>ref|XP_004150367.1| PREDICTED: serine carboxypeptidase-like 49-like [Cucumis sativus]
Length=509

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 101/128 (79%), Gaps = 6/128 (5%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRG----SLSAAEQGPKLVEKLFKFPNLADPTVS  349
            S F SAQAEKLIRELNLFPK   NI+ R     SL AA +  K+VE+  +FP   D  VS
Sbjct  34   SDFPSAQAEKLIRELNLFPKSDTNIIHRNIQNSSLLAAGE-KKIVERRLRFPLFDDSGVS  92

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            +E+LGHHAGY+KI+HS+AAR+FYFFFESR  +K DPVVIWLTGGPGCSSELA+F+ENGPF
Sbjct  93   LEELGHHAGYYKIEHSHAARLFYFFFESRN-RKSDPVVIWLTGGPGCSSELAMFYENGPF  151

Query  530  KIANNLSL  553
            KI  NLSL
Sbjct  152  KITKNLSL  159



>ref|XP_004164209.1| PREDICTED: serine carboxypeptidase-like 49-like [Cucumis sativus]
 gb|KGN62187.1| hypothetical protein Csa_2G324420 [Cucumis sativus]
Length=509

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 101/128 (79%), Gaps = 6/128 (5%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRG----SLSAAEQGPKLVEKLFKFPNLADPTVS  349
            S F SAQAEKLIRELNLFPK   NI+ R     SL AA +  K+VE+  +FP   D  VS
Sbjct  34   SDFPSAQAEKLIRELNLFPKSDTNIIHRNIQNSSLLAAGE-KKIVERRLRFPLFDDSGVS  92

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            +E+LGHHAGY+KI+HS+AAR+FYFFFESR  +K DPVVIWLTGGPGCSSELA+F+ENGPF
Sbjct  93   LEELGHHAGYYKIEHSHAARLFYFFFESRN-RKSDPVVIWLTGGPGCSSELAMFYENGPF  151

Query  530  KIANNLSL  553
            KI  NLSL
Sbjct  152  KITKNLSL  159



>gb|ACU18836.1| unknown [Glycine max]
Length=249

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 5/120 (4%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL--ADPTVSVEDLGHHA  373
             A+KLIR+LNLFP   VNIVP  + +   Q  ++VEK  +FP L  +D   SVEDLGHHA
Sbjct  31   HAKKLIRDLNLFPDADVNIVPVANCTL--QPRRIVEKRLRFPKLLASDSEPSVEDLGHHA  88

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GY+ IQHS+AARMFYFFFESR  +K+DPVVIWLTGGPGCSSELALF+ENGPFKIA+NLSL
Sbjct  89   GYYPIQHSHAARMFYFFFESR-NRKEDPVVIWLTGGPGCSSELALFYENGPFKIADNLSL  147



>ref|XP_008456530.1| PREDICTED: serine carboxypeptidase-like [Cucumis melo]
Length=509

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 99/128 (77%), Gaps = 6/128 (5%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRG----SLSAAEQGPKLVEKLFKFPNLADPTVS  349
            S F SAQAEKLIRELNLFPK   NI+ R     SL AA    K+VE+  +FP   D  VS
Sbjct  34   SDFPSAQAEKLIRELNLFPKSDANIIHRNIENSSLIAA-GAKKIVERQLRFPLFDDSGVS  92

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            +E+LGH AGY+KI+HS+AAR+FYFFFESR  K D PVVIWLTGGPGCSSELA+F+ENGPF
Sbjct  93   LEELGHRAGYYKIEHSHAARLFYFFFESRNSKSD-PVVIWLTGGPGCSSELAMFYENGPF  151

Query  530  KIANNLSL  553
            KI NNLSL
Sbjct  152  KITNNLSL  159



>gb|EPS63355.1| hypothetical protein M569_11430, partial [Genlisea aurea]
Length=194

 Score =   159 bits (402),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = +2

Query  194  SAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT-VSVEDLGHH  370
            S  AEKLIR LNLFP   +N+V  G  SA E  P +VE+ FKFPNL +P  V+ +DLGHH
Sbjct  27   SLSAEKLIRGLNLFPDRLINVVEGGGYSATE-APGIVERRFKFPNLVNPNGVTDDDLGHH  85

Query  371  AGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLS  550
            AGY+KI+HS+ ARMFYF FESR    D PVVIWLTGGPGC SE+ALF+ENGPF I +NLS
Sbjct  86   AGYYKIEHSHGARMFYFLFESRNSSSD-PVVIWLTGGPGCGSEMALFYENGPFTIDDNLS  144

Query  551  L  553
            L
Sbjct  145  L  145



>ref|XP_009135107.1| PREDICTED: serine carboxypeptidase-like 49 [Brassica rapa]
Length=519

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 101/129 (78%), Gaps = 5/129 (4%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNI--VPRGSLSAAEQG--PKLVEKLFKFPNL-ADPTV  346
            S   S++AEKLIRELNLFPK  VN+  V   +L++AE+   P +VE+ F+FPN+ +D   
Sbjct  34   SNLPSSRAEKLIRELNLFPKLDVNVIDVTDSTLASAEEEEVPSIVERSFRFPNIVSDGGA  93

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            +VEDLGHHAGYFK+  S  ARMFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+ENGP
Sbjct  94   TVEDLGHHAGYFKLPKSQGARMFYFFFESRTKKKDAPVVIWLTGGPGCSSELAMFYENGP  153

Query  527  FKIANNLSL  553
            FKI  N+SL
Sbjct  154  FKIDKNMSL  162



>emb|CDX73927.1| BnaA03g31200D [Brassica napus]
Length=523

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 101/129 (78%), Gaps = 5/129 (4%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNI--VPRGSLSAAEQG--PKLVEKLFKFPNL-ADPTV  346
            S   S++AEKLIRELNLFPK  VN+  V   +L++AE+   P +VE+ F+FPN+ +D   
Sbjct  34   SNLPSSRAEKLIRELNLFPKLDVNVIDVTDSTLASAEEEEVPSIVERSFRFPNIVSDGGA  93

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            +VEDLGHHAGYFK+  S  ARMFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+ENGP
Sbjct  94   TVEDLGHHAGYFKLPKSQGARMFYFFFESRTKKKDAPVVIWLTGGPGCSSELAMFYENGP  153

Query  527  FKIANNLSL  553
            FKI  N+SL
Sbjct  154  FKIDKNMSL  162



>emb|CDY56704.1| BnaC01g38630D [Brassica napus]
Length=604

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 101/129 (78%), Gaps = 5/129 (4%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGS--LSAAEQGPKLVEKLFKFPNL---ADPTV  346
            S   S++AEKLIRELNLFPK  VN++  G   L+++E+ P +VE+ F+FPN+   +D   
Sbjct  36   SNLPSSRAEKLIRELNLFPKLDVNVIDVGDSPLASSEEVPSIVERSFRFPNIVSHSDDGA  95

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            SVEDLGH AGY+K+  S  ARMFYFFFESR+ KKD PVVIWLTGGPGCSSELA+F+ENGP
Sbjct  96   SVEDLGHRAGYYKLPKSQGARMFYFFFESRKKKKDAPVVIWLTGGPGCSSELAMFYENGP  155

Query  527  FKIANNLSL  553
            FKI  N+SL
Sbjct  156  FKIDKNMSL  164



>gb|AAD42963.2|AF141384_1 serine carboxypeptidase precursor [Matricaria chamomilla]
Length=501

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 96/123 (78%), Gaps = 4/123 (3%)
 Frame = +2

Query  194  SAQAEKLIRELNLFPKESVNIVPRGSLSAAEQG--PKLVEKLFKFPNLADPT-VSVEDLG  364
            S QA  LIR LNLFPK +VN+V              K+VEKLF+FPN  +   V+VEDLG
Sbjct  30   STQASSLIRGLNLFPKHAVNLVEEDDYVRNNNSLDKKIVEKLFRFPNFVESDGVTVEDLG  89

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            HHAGY++IQHS+AA+MFYFFFESR  KKD PVVIWLTGGPGCSSELALF+ENGPFKIA+N
Sbjct  90   HHAGYYQIQHSHAAKMFYFFFESRNNKKD-PVVIWLTGGPGCSSELALFYENGPFKIADN  148

Query  545  LSL  553
            ++L
Sbjct  149  MTL  151



>ref|XP_010681991.1| PREDICTED: serine carboxypeptidase-like [Beta vulgaris subsp. 
vulgaris]
Length=495

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 105/132 (80%), Gaps = 8/132 (6%)
 Frame = +2

Query  176  SNSRFA---SAQAEKLIRELNLFPKESVNIVPRGSLSA--AEQGPKLVEKLFKFPNLADP  340
            S++RF+     Q +  IRELNLFPK+SVNI+  GS +   +  GPKLVE+ FKFPN  DP
Sbjct  16   SSARFSIYDEFQPDNSIRELNLFPKKSVNII-NGSDNGDFSHDGPKLVERRFKFPNFYDP  74

Query  341  -TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
               +VE+LGHHAGYF+I+H+  ARMFYFFF+SR   K+DPVVIWLTGGPGCSSELALF+E
Sbjct  75   KDANVEELGHHAGYFQIEHARNARMFYFFFQSRN-SKEDPVVIWLTGGPGCSSELALFYE  133

Query  518  NGPFKIANNLSL  553
            NGPFKIANN+SL
Sbjct  134  NGPFKIANNMSL  145



>ref|XP_006588979.1| PREDICTED: serine carboxypeptidase-like 49-like isoform X2 [Glycine 
max]
Length=458

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 5/120 (4%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL--ADPTVSVEDLGHHA  373
             A+KLIR+LNLFP   VNIVP  + +   Q  ++VEK  +FP L  +D   SVEDLGHHA
Sbjct  31   HAKKLIRDLNLFPDADVNIVPVANCTL--QPRRIVEKRLRFPKLLASDSEPSVEDLGHHA  88

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GY+ IQHS+AARMFYFFFESR  +K+DPVVIWLTGGPGCSSELALF+ENGPFKIA+NLSL
Sbjct  89   GYYPIQHSHAARMFYFFFESRN-RKEDPVVIWLTGGPGCSSELALFYENGPFKIADNLSL  147



>ref|XP_010067346.1| PREDICTED: serine carboxypeptidase-like [Eucalyptus grandis]
 gb|KCW65461.1| hypothetical protein EUGRSUZ_G02873 [Eucalyptus grandis]
Length=508

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 4/132 (3%)
 Frame = +2

Query  164  DLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPK-LVEKLFKFPNLA-D  337
            DL  + S F S  AE++IR+LNLFPKE VN V RG ++ +  G K +VEK F+FPNL  +
Sbjct  29   DLSFAQSSFPSVHAEQMIRQLNLFPKEDVN-VGRGGVAGSALGEKRIVEKRFRFPNLGLE  87

Query  338  PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
              V VEDLGH AGY+K++HS+ ARMFYFFFESR   ++DPVVIWLTGGPGCSSELA+F+E
Sbjct  88   SGVPVEDLGHRAGYYKLEHSHDARMFYFFFESRN-NENDPVVIWLTGGPGCSSELAMFYE  146

Query  518  NGPFKIANNLSL  553
            NGPF IA+N+SL
Sbjct  147  NGPFAIADNMSL  158



>ref|XP_011031665.1| PREDICTED: serine carboxypeptidase-like [Populus euphratica]
Length=513

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 102/132 (77%), Gaps = 9/132 (7%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGS-----LSAAEQGPKLVEKLFKFPNLA---D  337
            S F S QAEKLIRELNLFP   VN++ RG      ++ A    ++VE+ F+FPN+    +
Sbjct  33   SNFPSVQAEKLIRELNLFPNSEVNVIDRGDDGASVINQAGYNKRIVERKFRFPNVVGDEE  92

Query  338  PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
             + +V+DLG+HAGY+KI++S+ ARMFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+E
Sbjct  93   ESFTVDDLGNHAGYYKIENSHDARMFYFFFESRTSKKD-PVVIWLTGGPGCSSELAMFYE  151

Query  518  NGPFKIANNLSL  553
            NGP+ IANNLSL
Sbjct  152  NGPYTIANNLSL  163



>ref|XP_003535900.1| PREDICTED: serine carboxypeptidase-like 49-like isoformX1 [Glycine 
max]
 gb|KHN45199.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=498

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 5/120 (4%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL--ADPTVSVEDLGHHA  373
             A+KLIR+LNLFP   VNIVP  + +   Q  ++VEK  +FP L  +D   SVEDLGHHA
Sbjct  31   HAKKLIRDLNLFPDADVNIVPVANCTL--QPRRIVEKRLRFPKLLASDSEPSVEDLGHHA  88

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GY+ IQHS+AARMFYFFFESR  +K+DPVVIWLTGGPGCSSELALF+ENGPFKIA+NLSL
Sbjct  89   GYYPIQHSHAARMFYFFFESRN-RKEDPVVIWLTGGPGCSSELALFYENGPFKIADNLSL  147



>ref|XP_006407571.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
 gb|ESQ49024.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
Length=523

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 102/127 (80%), Gaps = 5/127 (4%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRG--SLSAAEQGPKLVEKLFKFPNL-ADPTVSV  352
            S   S++AEKLIRELNLFPK  VN++  G  +L++AE  P +VE+ F+FPN+ +D   +V
Sbjct  37   SSLPSSRAEKLIRELNLFPKLDVNVIDGGDSTLTSAEV-PSIVERNFRFPNIISDGGATV  95

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            EDLGHHAGY+K+  S  ARMFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPFK
Sbjct  96   EDLGHHAGYYKLPKSQGARMFYFFFESRN-KKDAPVVIWLTGGPGCSSELAMFYENGPFK  154

Query  533  IANNLSL  553
            IA N+SL
Sbjct  155  IAQNMSL  161



>ref|XP_002266451.1| PREDICTED: serine carboxypeptidase-like [Vitis vinifera]
 emb|CAN76135.1| hypothetical protein VITISV_040054 [Vitis vinifera]
 emb|CBI31398.3| unnamed protein product [Vitis vinifera]
Length=504

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 101/133 (76%), Gaps = 13/133 (10%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPK--ESVNIVPRGSLSAAEQGPK-LVEKLFKFPNL--A  334
            F SN +F  +QAEKLIRELNLFPK  E VN V R S       PK LVE   +FP +  +
Sbjct  27   FSSNPKFPKSQAEKLIRELNLFPKDAEPVNAVGRES-------PKSLVETRLRFPGIDYS  79

Query  335  DPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
            D +VSVEDLGHHAGY+KI+HS AARMFY FFESR  +KD PVVIWLTGGPGCSSELA+F+
Sbjct  80   DASVSVEDLGHHAGYYKIKHSSAARMFYLFFESRDNRKD-PVVIWLTGGPGCSSELAVFY  138

Query  515  ENGPFKIANNLSL  553
            ENGPF IA NLSL
Sbjct  139  ENGPFTIAKNLSL  151



>ref|XP_002529593.1| Serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF32785.1| Serine carboxypeptidase, putative [Ricinus communis]
Length=509

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 100/129 (78%), Gaps = 5/129 (4%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPR---GSLSAAEQGPKLVEKLFKFPNLADP--TV  346
            S F S QAEKLIRELNL P++ VN++ R   G     + G ++VEK  KFPN+      V
Sbjct  31   SSFPSLQAEKLIRELNLLPEKDVNVIDRRDDGVYDGVDGGGRIVEKRIKFPNVEGDYGAV  90

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            SVEDLGHHAGY+KI +S++ARMFY FFESR  KK+DPVVIWLTGGPGCSSELA+F+ENGP
Sbjct  91   SVEDLGHHAGYYKIANSHSARMFYLFFESRNKKKEDPVVIWLTGGPGCSSELAMFYENGP  150

Query  527  FKIANNLSL  553
            F IA+N+SL
Sbjct  151  FAIADNMSL  159



>ref|XP_004307353.1| PREDICTED: serine carboxypeptidase-like [Fragaria vesca subsp. 
vesca]
Length=509

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 97/128 (76%), Gaps = 3/128 (2%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPR-GSLSAAEQGPKLVEKLFKFPNL-ADPTVS  349
            + S F S  A++LIR LNLFP+   NI+   G  S    G ++VEK F  PN+  +  VS
Sbjct  33   ARSSFPSVHAQQLIRALNLFPESDANIITDAGDSSPIGAGKRIVEKRFTLPNVVGESGVS  92

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            V+DLGHHAGYFKI+HS+AARMFY FFESR   K+DPVVIWLTGGPGCSSELA+F+ENGPF
Sbjct  93   VDDLGHHAGYFKIEHSHAARMFYLFFESRT-NKEDPVVIWLTGGPGCSSELAVFYENGPF  151

Query  530  KIANNLSL  553
             IANNLSL
Sbjct  152  SIANNLSL  159



>ref|XP_003536330.1| PREDICTED: serine carboxypeptidase-like 49-like [Glycine max]
 gb|KHN37799.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=499

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 97/119 (82%), Gaps = 6/119 (5%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL--ADPTVSVEDLGHHAG  376
            A+KLIR+LNLFP E VNIVPR S S A    K+VEK  +FPNL  +D  +S++DL H AG
Sbjct  34   AKKLIRDLNLFPSEDVNIVPRHSNSHAN---KIVEKPLRFPNLVPSDSGISLDDLAHRAG  90

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            Y+ I HS+AA+MFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPFKIANN+SL
Sbjct  91   YYLIPHSHAAKMFYFFFESRNSKKD-PVVIWLTGGPGCSSELAVFYENGPFKIANNMSL  148



>gb|KFK38420.1| hypothetical protein AALP_AA3G110900 [Arabis alpina]
Length=510

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 102/128 (80%), Gaps = 6/128 (5%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRG---SLSAAEQGPKLVEKLFKFPN-LADPTVS  349
            +   S++AEKLIRELNLFPK  VN++  G   +L+A+++ P +VE+ F FPN L+D   +
Sbjct  32   TNLPSSRAEKLIRELNLFPKLDVNVIDVGDDLTLTASDE-PSIVERNFVFPNILSDGEAT  90

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            VEDLGHHAGY+K+  S  ARMFYFFFESR  KKDDP+VIWLTGGPGCSSELA+F+ENGPF
Sbjct  91   VEDLGHHAGYYKLPKSQGARMFYFFFESRH-KKDDPLVIWLTGGPGCSSELAMFYENGPF  149

Query  530  KIANNLSL  553
            KI  N+SL
Sbjct  150  KIDKNMSL  157



>ref|XP_010031406.1| PREDICTED: serine carboxypeptidase-like [Eucalyptus grandis]
 gb|KCW50697.1| hypothetical protein EUGRSUZ_J00381 [Eucalyptus grandis]
Length=510

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNIVPRGSLSAAE--QGPKLVEKLFKFPNLADPTVSVEDLGHH  370
             QAEKLIR  NLFP+ESVNI      SAA    G K+VE   K P L +   S++DLGHH
Sbjct  43   TQAEKLIRGFNLFPRESVNIGAGDVDSAASLASGGKIVESRLKLPLLGNSGSSIQDLGHH  102

Query  371  AGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLS  550
            AGY+++ HS+AARMFYFFFESR    DDPVVIWLTGGPGCSSELALF+ENGPF IANNLS
Sbjct  103  AGYYRLPHSHAARMFYFFFESRS-SADDPVVIWLTGGPGCSSELALFYENGPFHIANNLS  161

Query  551  L  553
            L
Sbjct  162  L  162



>emb|CDP07043.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 97/131 (74%), Gaps = 7/131 (5%)
 Frame = +2

Query  167  LFPSNSRFASAQAEKLIRELNLFPKESVNIVPR--GSLSAAEQGPKLVEKLFKFPNLADP  340
            L  S   F  AQAE+LIR+LNLFP+  +NI P   G+LS    G ++ EK F    L D 
Sbjct  35   LSSSTLNFPKAQAERLIRQLNLFPELEINISPGHPGNLS----GSRIEEKQFSLSCLGDS  90

Query  341  TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
              +VE+LGHHAGY+K+QHS  ARMFY FFESR+  K DPVVIWLTGGPGCSSELALF+EN
Sbjct  91   GATVENLGHHAGYYKLQHSKGARMFYLFFESRK-SKSDPVVIWLTGGPGCSSELALFYEN  149

Query  521  GPFKIANNLSL  553
            GPFKIANNLSL
Sbjct  150  GPFKIANNLSL  160



>ref|XP_002311071.2| Serine carboxypeptidase precursor family protein [Populus trichocarpa]
 gb|EEE88438.2| Serine carboxypeptidase precursor family protein [Populus trichocarpa]
Length=513

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 100/132 (76%), Gaps = 9/132 (7%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGS-----LSAAEQGPKLVEKLFKFPNLA---D  337
            S F S QAEKLIRELNLFP   VN++  G      +  A    ++VE+ F+FPN+    +
Sbjct  33   SNFPSVQAEKLIRELNLFPNSEVNVIDGGDDGVSFIDQAGYNKRIVERKFRFPNVVGDEE  92

Query  338  PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
             + +V+DLG+HAGY+KI++S+ ARMFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+E
Sbjct  93   ESFTVDDLGNHAGYYKIENSHDARMFYFFFESRTSKKD-PVVIWLTGGPGCSSELAMFYE  151

Query  518  NGPFKIANNLSL  553
            NGP+ IANNLSL
Sbjct  152  NGPYTIANNLSL  163



>emb|CDY00669.1| BnaC03g36530D [Brassica napus]
Length=522

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 5/123 (4%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNI--VPRGSL-SAAEQGPKLVEKLFKFPNL-ADPTVSVEDLG  364
            ++AEKLIRELNLFPK  VN+  V   +L SA E+ P +VE+ F+FPN+ +D   +VEDLG
Sbjct  39   SRAEKLIRELNLFPKLDVNVIDVTDSTLASAEEEVPSIVERSFRFPNIISDGGATVEDLG  98

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            HHAGYFK+  S  ARMFYFFFESR+ KKD PVVIWLTGGPGCSSELA+F+ENGPFKI  N
Sbjct  99   HHAGYFKLPKSQGARMFYFFFESRK-KKDAPVVIWLTGGPGCSSELAMFYENGPFKIDKN  157

Query  545  LSL  553
            +SL
Sbjct  158  MSL  160



>ref|XP_007145525.1| hypothetical protein PHAVU_007G245800g [Phaseolus vulgaris]
 gb|ESW17519.1| hypothetical protein PHAVU_007G245800g [Phaseolus vulgaris]
Length=500

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 5/130 (4%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL--ADPT  343
            + S S  A+ QA+KLI  LNLFP + VN+VP  + S   Q  K+VEK  +FPNL  +D  
Sbjct  23   YASPSDEAALQAKKLISALNLFPDDGVNVVPVANSSL--QPRKIVEKRLRFPNLVASDSE  80

Query  344  VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENG  523
             SVEDLGH+AGY+ I HS+AARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENG
Sbjct  81   PSVEDLGHYAGYYPIVHSHAARMFYFFFESRN-TKEDPVVIWLTGGPGCSSELALFYENG  139

Query  524  PFKIANNLSL  553
            PFKIA++LSL
Sbjct  140  PFKIADDLSL  149



>ref|XP_002316392.2| Serine carboxypeptidase precursor family protein [Populus trichocarpa]
 gb|EEF02563.2| Serine carboxypeptidase precursor family protein [Populus trichocarpa]
Length=513

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 9/132 (7%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSL-----SAAEQGPKLVEKLFKFPNLA---D  337
            S F S QA K+IRELNLFPK  VN++  G       S +    ++VE+ F+FPN+    +
Sbjct  33   SNFPSVQAGKMIRELNLFPKSEVNVIGGGDDGAGAISESGHNKRIVERKFRFPNVVGDEE  92

Query  338  PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
             + +V+DLGHHAGY+KI+HS+ ARMFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+E
Sbjct  93   ESFTVDDLGHHAGYYKIEHSHDARMFYFFFESRTSKKD-PVVIWLTGGPGCSSELAMFYE  151

Query  518  NGPFKIANNLSL  553
            NGP+ IANNLSL
Sbjct  152  NGPYTIANNLSL  163



>ref|XP_006436507.1| hypothetical protein CICLE_v10031297mg [Citrus clementina]
 ref|XP_006485587.1| PREDICTED: serine carboxypeptidase-like 49-like [Citrus sinensis]
 gb|ESR49747.1| hypothetical protein CICLE_v10031297mg [Citrus clementina]
Length=506

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 97/127 (76%), Gaps = 5/127 (4%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSLSA---AEQGPKLVEKLFKFPNLADPTVSV  352
            S F S QAEKLIR+LNLFPKE VN+V  G  SA   A  G ++VEK       +   VSV
Sbjct  32   STFPSLQAEKLIRQLNLFPKEDVNLVD-GRQSAPLLAGTGKRIVEKRINLLRESGGGVSV  90

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            EDLGHHAGY+K+ HS+ A+MFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPF 
Sbjct  91   EDLGHHAGYYKLPHSHDAKMFYFFFESRNSKKD-PVVIWLTGGPGCSSELAVFYENGPFS  149

Query  533  IANNLSL  553
            IA+N+SL
Sbjct  150  IADNMSL  156



>ref|XP_011024373.1| PREDICTED: serine carboxypeptidase-like [Populus euphratica]
Length=513

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 100/132 (76%), Gaps = 9/132 (7%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSL-----SAAEQGPKLVEKLFKFPNLA---D  337
            S F S QA K+IRELNLFPK  VN++  G       S +    ++VE+ F+FP++    +
Sbjct  33   SNFPSVQAGKMIRELNLFPKSEVNVIGGGDDGAGAISESGHNKRIVERKFRFPDVVGDEE  92

Query  338  PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
             + +V+DLGHHAGY+KI+HS+ ARMFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+E
Sbjct  93   ESFTVDDLGHHAGYYKIEHSHDARMFYFFFESRTSKKD-PVVIWLTGGPGCSSELAMFYE  151

Query  518  NGPFKIANNLSL  553
            NGP+ IANNLSL
Sbjct  152  NGPYTIANNLSL  163



>emb|CDP07044.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 98/131 (75%), Gaps = 3/131 (2%)
 Frame = +2

Query  164  DLFPSNS-RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP  340
            +L PS++  F   QAEKLIRELNLFP+  +NI   G+ SAA     +VEK    P L D 
Sbjct  35   NLLPSSTLNFPKKQAEKLIRELNLFPEHDINI-NTGNNSAAAAATSVVEKRLNLPVLGDS  93

Query  341  TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
              +V+DLGHHAGYF++ ++ AARMFYFFFESR+  K DPVVIWLTGGPGC  ELALF+EN
Sbjct  94   GATVQDLGHHAGYFRLPNTKAARMFYFFFESRK-DKTDPVVIWLTGGPGCGCELALFYEN  152

Query  521  GPFKIANNLSL  553
            GPFKIANNLSL
Sbjct  153  GPFKIANNLSL  163



>gb|KDO60256.1| hypothetical protein CISIN_1g010473mg [Citrus sinensis]
Length=509

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGY  379
            QAEKLIR LNLFPK SVN    G   A+   PKLVEK      L DP  SV++ GHHAGY
Sbjct  45   QAEKLIRGLNLFPKSSVNTAAAGD-HASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAGY  103

Query  380  FKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            + + HS +ARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+ENGPF IANNLSL
Sbjct  104  YTLPHSQSARMFYFFFESRNNKSD-PVVIWLTGGPGCSSELALFYENGPFHIANNLSL  160



>ref|XP_006488020.1| PREDICTED: serine carboxypeptidase-like 48-like isoform X1 [Citrus 
sinensis]
Length=508

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGY  379
            QAEKLIR LNLFPK SVN    G   A+   PKLVEK      L DP  SV++ GHHAGY
Sbjct  45   QAEKLIRGLNLFPKSSVNTAAAGD-HASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAGY  103

Query  380  FKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            + + HS +ARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+ENGPF IANNLSL
Sbjct  104  YTLPHSQSARMFYFFFESRNNKSD-PVVIWLTGGPGCSSELALFYENGPFHIANNLSL  160



>ref|XP_006424468.1| hypothetical protein CICLE_v10028234mg [Citrus clementina]
 gb|ESR37708.1| hypothetical protein CICLE_v10028234mg [Citrus clementina]
Length=508

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGY  379
            QAEKLIR LNLFPK SVN    G   A+   PKLVEK      L DP  SV++ GHHAGY
Sbjct  45   QAEKLIRGLNLFPKSSVNTAAAGD-HASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAGY  103

Query  380  FKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            + + HS +ARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+ENGPF IANNLSL
Sbjct  104  YTLPHSQSARMFYFFFESRNNKSD-PVVIWLTGGPGCSSELALFYENGPFHIANNLSL  160



>gb|KDO60255.1| hypothetical protein CISIN_1g010473mg [Citrus sinensis]
Length=508

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGY  379
            QAEKLIR LNLFPK SVN    G   A+   PKLVEK      L DP  SV++ GHHAGY
Sbjct  45   QAEKLIRGLNLFPKSSVNTAAAGD-HASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAGY  103

Query  380  FKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            + + HS +ARMFYFFFESR   K DPVVIWLTGGPGCSSELALF+ENGPF IANNLSL
Sbjct  104  YTLPHSQSARMFYFFFESRN-NKSDPVVIWLTGGPGCSSELALFYENGPFHIANNLSL  160



>ref|XP_010034179.1| PREDICTED: serine carboxypeptidase-like [Eucalyptus grandis]
Length=503

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 93/122 (76%), Gaps = 4/122 (3%)
 Frame = +2

Query  194  SAQAEKLIRELNLFPKESVNIVPRG--SLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGH  367
            +AQAE LI+ LNL PKE+VNI  R   S S A  G K+VE  F+ P L D   SV+DLGH
Sbjct  37   TAQAEMLIKGLNLHPKEAVNIRTRDKDSSSLASDG-KIVEMRFELPVLGDSGSSVQDLGH  95

Query  368  HAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNL  547
            HAGY+ + HSYAARMFYFFFESR    +DPVVIWLTGGPGCSS LALF+ENGPF IANNL
Sbjct  96   HAGYYPLPHSYAARMFYFFFESRN-SANDPVVIWLTGGPGCSSSLALFYENGPFHIANNL  154

Query  548  SL  553
            SL
Sbjct  155  SL  156



>ref|NP_187652.1| serine carboxypeptidase-like 49 [Arabidopsis thaliana]
 sp|P32826.2|SCP49_ARATH RecName: Full=Serine carboxypeptidase-like 49; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51389.1|AC011560_21 putative serine carboxypeptidase precursor; 109294-111839 [Arabidopsis 
thaliana]
 gb|AAM10315.1| AT3g10410/F13M14_32 [Arabidopsis thaliana]
 gb|AAN31108.1| At3g10410/F13M14_32 [Arabidopsis thaliana]
 gb|AEE74902.1| serine carboxypeptidase-like 49 [Arabidopsis thaliana]
Length=516

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSLS-AAEQGPKLVEKLFKFPN-LADPTVSVE  355
            S   S +AEKLIRELNLFP++ +N++    L   A +GP +VE+ F FPN LAD   +V+
Sbjct  36   SNLPSTRAEKLIRELNLFPQQDLNVIDVADLPLTAAEGPGIVERKFVFPNILADGGPTVD  95

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            DLGHHAGY+K+  S  A MFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPFKI
Sbjct  96   DLGHHAGYYKLPKSRGASMFYFFFESRN-KKDAPVVIWLTGGPGCSSELAVFYENGPFKI  154

Query  536  ANNLSL  553
             +N+SL
Sbjct  155  TSNMSL  160



>gb|KDP30482.1| hypothetical protein JCGZ_16161 [Jatropha curcas]
Length=514

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 104/136 (76%), Gaps = 9/136 (7%)
 Frame = +2

Query  164  DLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGS----LSAAEQGPKLVEKLFKFPNL  331
            +L    S F S QA+K+IRELNLFP + +N++  G     L + E+  ++VEK F+F N+
Sbjct  26   NLHLERSSFPSVQADKMIRELNLFPDKDINVIDGGDGDGGLVSGEK--RIVEKRFRFRNV  83

Query  332  AD--PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELA  505
                 +VSV+DLGHHAGY+KI +S+AARMFYFFFESR  KKD P+VIWLTGGPGCSSELA
Sbjct  84   VGGYDSVSVDDLGHHAGYYKIANSHAARMFYFFFESRNSKKD-PIVIWLTGGPGCSSELA  142

Query  506  LFFENGPFKIANNLSL  553
            +F+ENGPF IA+NLSL
Sbjct  143  MFYENGPFTIADNLSL  158



>gb|AAB04606.1| carboxypeptidase Y-like protein [Arabidopsis thaliana]
 prf||1908426A carboxypeptidase Y
Length=539

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSLS-AAEQGPKLVEKLFKFPN-LADPTVSVE  355
            S   S +AEKLIRELNLFP++ +N++    L   A +GP +VE+ F FPN LAD   +V+
Sbjct  36   SNLPSTRAEKLIRELNLFPQQDLNVIDVADLPLTAAEGPGIVERKFVFPNILADGGPTVD  95

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            DLGHHAGY+K+  S  A MFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPFKI
Sbjct  96   DLGHHAGYYKLPKSRGASMFYFFFESRN-KKDAPVVIWLTGGPGCSSELAVFYENGPFKI  154

Query  536  ANNLSL  553
             +N+SL
Sbjct  155  TSNMSL  160



>gb|KDO60257.1| hypothetical protein CISIN_1g010473mg [Citrus sinensis]
Length=505

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGY  379
            QAEKLIR LNLFPK SVN    G   A+   PKLVEK      L DP  SV++ GHHAGY
Sbjct  45   QAEKLIRGLNLFPKSSVNTAAAGD-HASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAGY  103

Query  380  FKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            + + HS +ARMFYFFFESR   K DPVVIWLTGGPGCSSELALF+ENGPF IANNLSL
Sbjct  104  YTLPHSQSARMFYFFFESRN-NKSDPVVIWLTGGPGCSSELALFYENGPFHIANNLSL  160



>ref|XP_011084286.1| PREDICTED: serine carboxypeptidase-like [Sesamum indicum]
Length=503

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 95/129 (74%), Gaps = 14/129 (11%)
 Frame = +2

Query  185  RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQG-----PKLVEKLFKFPNLADPT-V  346
            R  S  AEKLIR+LNLFP E VNI       AA  G     P+LVE+ FKFPNL   T  
Sbjct  33   RLPSLYAEKLIRQLNLFPDEPVNI-------AANAGRFLDAPRLVERRFKFPNLVGSTDA  85

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            SV +LGHHAGY++I  S+AARMFYFFFESR   +D PVVIWLTGGPGCSSE+ALF+ENGP
Sbjct  86   SVRELGHHAGYYQIPRSHAARMFYFFFESRHSTQD-PVVIWLTGGPGCSSEMALFYENGP  144

Query  527  FKIANNLSL  553
            F IANNLSL
Sbjct  145  FTIANNLSL  153



>ref|XP_010464713.1| PREDICTED: serine carboxypeptidase-like 49 [Camelina sativa]
Length=516

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 99/128 (77%), Gaps = 6/128 (5%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGS--LSAAEQGPKLVEKLFKFPNL--ADPTVS  349
            S   S +AEKLIRELNLFP++ +N++      L+AAE G  +VE+ F FPN+  AD   +
Sbjct  36   SNLPSTRAEKLIRELNLFPQQDLNVIDVADSPLTAAE-GSGIVERKFVFPNILAADGGDT  94

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            VEDLGHHAGY+K+  S  A MFYFFFESR+ KKD PVVIWLTGGPGCSSELA+F+ENGPF
Sbjct  95   VEDLGHHAGYYKLPKSRGASMFYFFFESRK-KKDAPVVIWLTGGPGCSSELAVFYENGPF  153

Query  530  KIANNLSL  553
            KI NN+SL
Sbjct  154  KITNNMSL  161



>ref|XP_009775797.1| PREDICTED: serine carboxypeptidase-like [Nicotiana sylvestris]
 gb|ABQ65859.1| serine carboxypeptidase III [Nicotiana tabacum]
Length=502

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +2

Query  185  RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLG  364
            +F    AEK IR+LNLFPK ++NI+      A     +L EK    P L D   +V+DLG
Sbjct  42   KFPVTMAEKFIRQLNLFPKHNINIISSNDNIALANEERLFEKKLNLPYLGDSGATVQDLG  101

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            HHAGYF++ H+ AARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENGPFK+++N
Sbjct  102  HHAGYFRLAHTKAARMFYFFFESRS-NKNDPVVIWLTGGPGCSSELALFYENGPFKLSDN  160

Query  545  LSL  553
            +SL
Sbjct  161  MSL  163



>ref|XP_010486643.1| PREDICTED: serine carboxypeptidase-like 49 [Camelina sativa]
Length=516

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 99/128 (77%), Gaps = 6/128 (5%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGS--LSAAEQGPKLVEKLFKFPNL--ADPTVS  349
            S   S +AEKLIRELNLFP++ +N++      L+AAE G  +VE+ F FPN+  AD   +
Sbjct  36   SNLPSTRAEKLIRELNLFPQQDLNVIDVADSPLTAAE-GSGIVERKFVFPNILAADGGDT  94

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            VEDLGHHAGY+K+  S  A MFYFFFESR+ KKD PVVIWLTGGPGCSSELA+F+ENGPF
Sbjct  95   VEDLGHHAGYYKLPKSRGASMFYFFFESRK-KKDAPVVIWLTGGPGCSSELAVFYENGPF  153

Query  530  KIANNLSL  553
            KI NN+SL
Sbjct  154  KITNNMSL  161



>ref|XP_011089952.1| PREDICTED: serine carboxypeptidase-like [Sesamum indicum]
Length=510

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = +2

Query  188  FASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGH  367
            F   QAE+LIR LNLFPK  VN          E   ++VEK FKFP L D   SV+DLGH
Sbjct  44   FPRTQAERLIRALNLFPKNEVNHHAGKDHGFGES--RIVEKQFKFPFLGDSGASVQDLGH  101

Query  368  HAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNL  547
            HAGY+++QHS  ARMFYFFFESR  +  DPVVIWLTGGPGCSSELALF+ENGPF I NNL
Sbjct  102  HAGYYRLQHSKDARMFYFFFESRNSRT-DPVVIWLTGGPGCSSELALFYENGPFHITNNL  160

Query  548  SL  553
            SL
Sbjct  161  SL  162



>ref|XP_009607096.1| PREDICTED: serine carboxypeptidase-like [Nicotiana tomentosiformis]
Length=502

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 90/126 (71%), Gaps = 1/126 (1%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVE  355
            S  +     AEK IR+LNLFPK  +NI+      A     +L EK    P L D   +V+
Sbjct  39   SQKKIPVTMAEKFIRQLNLFPKHDINIISSKDNIALANEERLFEKKLNLPYLGDSGATVQ  98

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            DLGHHAGYF++ H+ AARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENGPFK+
Sbjct  99   DLGHHAGYFRLAHTKAARMFYFFFESRS-NKNDPVVIWLTGGPGCSSELALFYENGPFKL  157

Query  536  ANNLSL  553
            +NN+SL
Sbjct  158  SNNMSL  163



>ref|XP_006349013.1| PREDICTED: serine carboxypeptidase-like 48-like [Solanum tuberosum]
Length=502

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +2

Query  185  RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLG  364
            +F     EKLIR+LNLFPK  +NIV     S      KL EK      L D   +V+DLG
Sbjct  44   KFQLTMGEKLIRQLNLFPKHDINIVSSKDNSVNNYENKLFEKKLDLSYLGDSGSTVQDLG  103

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            HHAGYF + H+ AARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENGPFKI+NN
Sbjct  104  HHAGYFPLVHTKAARMFYFFFESRS-NKNDPVVIWLTGGPGCSSELALFYENGPFKISNN  162

Query  545  LSL  553
            LSL
Sbjct  163  LSL  165



>gb|KHG01758.1| Serine carboxypeptidase-like 48 [Gossypium arboreum]
Length=503

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 98/127 (77%), Gaps = 5/127 (4%)
 Frame = +2

Query  173  PSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSV  352
            PS+S+ A  QAEKLIR LNLFPK+++N    G  + A +  K+VEK F+FP L +P  S+
Sbjct  34   PSSSQ-AKLQAEKLIRGLNLFPKDAIN---AGDNAPAVETSKIVEKQFRFPVLGEPGPSI  89

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            ++ GHHAGY+K+ H+ +ARMFY FFESR  KK DPVVIWLTGGPGCSSELALF+ENGPF 
Sbjct  90   QEFGHHAGYYKLPHAVSARMFYLFFESRNSKK-DPVVIWLTGGPGCSSELALFYENGPFH  148

Query  533  IANNLSL  553
            +  NLSL
Sbjct  149  LTKNLSL  155



>ref|XP_006851290.1| hypothetical protein AMTR_s00050p00101210 [Amborella trichopoda]
 gb|ERN12871.1| hypothetical protein AMTR_s00050p00101210 [Amborella trichopoda]
Length=501

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 92/128 (72%), Gaps = 5/128 (4%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVS  349
             PS + F    AEKLIRELNL P    ++            P+LVEK F +P +    VS
Sbjct  31   LPSEASFPRPHAEKLIRELNLLP----SVAEPEPHEVGASMPRLVEKRFVWPGIVGDAVS  86

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            VE+LGHHAGY+ +QH++AA+MFYFFFESR G KDDP+VIWLTGGPGCSSELA+F+ENGPF
Sbjct  87   VEELGHHAGYYSLQHTHAAKMFYFFFESR-GSKDDPIVIWLTGGPGCSSELAVFYENGPF  145

Query  530  KIANNLSL  553
             IA NLSL
Sbjct  146  SIAKNLSL  153



>gb|ABQ65860.1| serine carboxypeptidase III [Nicotiana tabacum]
Length=502

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVE  355
            S  +     AEK IR+LNLFPK  +NI+      A     +L EK    P L D   +V+
Sbjct  39   SQKKIPVTMAEKFIRQLNLFPKHDINIISSKDNIALANEERLFEKKLNLPYLGDSGATVQ  98

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            DLGHHAGYF++ H+ AARMFYF FESR   K+DPVVIWLTGGPGCSSELALF+ENGPFK+
Sbjct  99   DLGHHAGYFRLAHTKAARMFYFLFESRS-NKNDPVVIWLTGGPGCSSELALFYENGPFKL  157

Query  536  ANNLSL  553
            +NN+SL
Sbjct  158  SNNMSL  163



>ref|XP_010483821.1| PREDICTED: serine carboxypeptidase-like 49 [Camelina sativa]
Length=513

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 97/127 (76%), Gaps = 5/127 (4%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGS--LSAAEQGPKLVEKLFKFPN-LADPTVSV  352
            S   S +AEKLIRELNLFP++ +N++      L+AAE G  + E+   FPN LAD   +V
Sbjct  36   SNLLSTRAEKLIRELNLFPQQDLNVIDVADSPLTAAE-GSGIFERKLVFPNILADGGDTV  94

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            EDLGHHAGY+K+  S  A MFYFFFESR+ KKD PVVIWLTGGPGCSSELA+F+ENGPFK
Sbjct  95   EDLGHHAGYYKLPKSRGASMFYFFFESRK-KKDAPVVIWLTGGPGCSSELAVFYENGPFK  153

Query  533  IANNLSL  553
            I NN+SL
Sbjct  154  ITNNMSL  160



>ref|XP_006347201.1| PREDICTED: serine carboxypeptidase 3-like [Solanum tuberosum]
Length=500

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = +2

Query  164  DLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT  343
            +   S  +F    AEKLIR+LNLFPK  +N     S +A EQG  L EK      + D  
Sbjct  28   NFLSSAQKFPITMAEKLIRQLNLFPKHEINKATEDSAAATEQG--LFEKKLNLSYIGDSG  85

Query  344  VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENG  523
             +V++LGHHAGY+++ H+  ARMFYFFFESR  +K+DPVVIWLTGGPGCSSELA+F+ENG
Sbjct  86   ATVQNLGHHAGYYRLPHTKDARMFYFFFESR-SRKNDPVVIWLTGGPGCSSELAVFYENG  144

Query  524  PFKIANNLSL  553
            PFKIA+N+SL
Sbjct  145  PFKIADNMSL  154



>gb|KHN38716.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=473

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 91/121 (75%), Gaps = 5/121 (4%)
 Frame = +2

Query  191  ASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHH  370
              +QAEKLIR LNL PK+SVNIV +G       G K+VEK  KF    D   S+EDLGHH
Sbjct  20   TQSQAEKLIRSLNLLPKDSVNIV-KGDHVGFVPG-KIVEK--KFSLFCDSGPSIEDLGHH  75

Query  371  AGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLS  550
            AGY+ + HS AARMFYFFFESR   KDDPVVIWLTGGPGC SELALF+ENGPF IANNLS
Sbjct  76   AGYYSLPHSKAARMFYFFFESRN-NKDDPVVIWLTGGPGCGSELALFYENGPFHIANNLS  134

Query  551  L  553
            L
Sbjct  135  L  135



>gb|KJB26224.1| hypothetical protein B456_004G231300 [Gossypium raimondii]
Length=502

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 98/127 (77%), Gaps = 5/127 (4%)
 Frame = +2

Query  173  PSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSV  352
            PS+S+ A  +AEKLIR LNLFPK+++N    G  + A +  K+VEK F+FP L +P  S+
Sbjct  34   PSSSQ-AKLRAEKLIRGLNLFPKDAIN---AGDNAPAVETSKIVEKQFRFPVLGEPGPSI  89

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            ++ GHHAGY+K+ H+ +ARMFY FFESR  KK DPVVIWLTGGPGCSSELALF+ENGPF 
Sbjct  90   QEFGHHAGYYKLPHAVSARMFYLFFESRNSKK-DPVVIWLTGGPGCSSELALFYENGPFH  148

Query  533  IANNLSL  553
            +  NLSL
Sbjct  149  LTKNLSL  155



>gb|KJB26223.1| hypothetical protein B456_004G231300 [Gossypium raimondii]
Length=503

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 98/127 (77%), Gaps = 5/127 (4%)
 Frame = +2

Query  173  PSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSV  352
            PS+S+ A  +AEKLIR LNLFPK+++N    G  + A +  K+VEK F+FP L +P  S+
Sbjct  34   PSSSQ-AKLRAEKLIRGLNLFPKDAIN---AGDNAPAVETSKIVEKQFRFPVLGEPGPSI  89

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            ++ GHHAGY+K+ H+ +ARMFY FFESR  KK DPVVIWLTGGPGCSSELALF+ENGPF 
Sbjct  90   QEFGHHAGYYKLPHAVSARMFYLFFESRNSKK-DPVVIWLTGGPGCSSELALFYENGPFH  148

Query  533  IANNLSL  553
            +  NLSL
Sbjct  149  LTKNLSL  155



>ref|XP_004952144.1| PREDICTED: serine carboxypeptidase 3-like isoform X1 [Setaria 
italica]
Length=503

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (76%), Gaps = 8/129 (6%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-KLVEKLFKFPNLADPTV  346
             P ++ F +AQAE+LIR LNL PKE+    P GS  A    P +L+E+  + P + D   
Sbjct  28   LPRDASFPAAQAERLIRALNLLPKEAG---PAGSGDAPSVAPGELLERRVRLPGVPD---  81

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
             ++DLGHHAGYF++ H++ ARMFYFFFESR GKK+DPVVIWLTGGPGCSSELA+F+ENGP
Sbjct  82   GIQDLGHHAGYFRLPHTHDARMFYFFFESR-GKKEDPVVIWLTGGPGCSSELAVFYENGP  140

Query  527  FKIANNLSL  553
            F IANN+SL
Sbjct  141  FTIANNMSL  149



>ref|XP_006299685.1| hypothetical protein CARUB_v10015873mg [Capsella rubella]
 gb|EOA32583.1| hypothetical protein CARUB_v10015873mg [Capsella rubella]
Length=515

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 96/127 (76%), Gaps = 4/127 (3%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGS--LSAAEQGPKLVEKLFKFPN-LADPTVSV  352
            S   S +AEKLIRELNLFP++ +N++      L+AAE G  +VE+ F FPN L D   +V
Sbjct  36   SNLPSTRAEKLIRELNLFPQQDLNVIDVADSPLTAAE-GLGIVERKFVFPNILPDGGATV  94

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
             DLGHHAGY+K+  S  A +FYFFFESR  K+D PVVIWLTGGPGCSSELA+F+ENGPFK
Sbjct  95   ADLGHHAGYYKLPKSGGASIFYFFFESRHKKEDAPVVIWLTGGPGCSSELAVFYENGPFK  154

Query  533  IANNLSL  553
            I NN+SL
Sbjct  155  ITNNMSL  161



>ref|XP_003539193.1| PREDICTED: serine carboxypeptidase-like 48-like [Glycine max]
Length=498

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 91/121 (75%), Gaps = 5/121 (4%)
 Frame = +2

Query  191  ASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHH  370
              +QAEKLIR LNL PK+SVNIV +G       G K+VEK  KF    D   S+EDLGHH
Sbjct  41   TQSQAEKLIRSLNLLPKDSVNIV-KGDHVGFVPG-KIVEK--KFSLFCDSGPSIEDLGHH  96

Query  371  AGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLS  550
            AGY+ + HS AARMFYFFFESR   KDDPVVIWLTGGPGC SELALF+ENGPF IANNLS
Sbjct  97   AGYYSLPHSKAARMFYFFFESRN-NKDDPVVIWLTGGPGCGSELALFYENGPFHIANNLS  155

Query  551  L  553
            L
Sbjct  156  L  156



>ref|XP_004952145.1| PREDICTED: serine carboxypeptidase 3-like isoform X2 [Setaria 
italica]
Length=499

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 98/129 (76%), Gaps = 8/129 (6%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-KLVEKLFKFPNLADPTV  346
             P ++ F +AQAE+LIR LNL PKE+    P GS  A    P +L+E+  + P + D   
Sbjct  28   LPRDASFPAAQAERLIRALNLLPKEAG---PAGSGDAPSVAPGELLERRVRLPGVPD---  81

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
             ++DLGHHAGYF++ H++ ARMFYFFFESR GKK+DPVVIWLTGGPGCSSELA+F+ENGP
Sbjct  82   GIQDLGHHAGYFRLPHTHDARMFYFFFESR-GKKEDPVVIWLTGGPGCSSELAVFYENGP  140

Query  527  FKIANNLSL  553
            F IANN+SL
Sbjct  141  FTIANNMSL  149



>ref|XP_011089190.1| PREDICTED: serine carboxypeptidase-like [Sesamum indicum]
Length=516

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 9/133 (7%)
 Frame = +2

Query  173  PSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLA------  334
            PS  +F   QAEK IRELNLFP+  VNIV       A   PK++EK  +FP L+      
Sbjct  50   PSTLQFPKKQAEKFIRELNLFPRNDVNIVED---DPAADTPKIIEKRIQFPYLSYSKAGN  106

Query  335  DPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
                ++ED GHHAGY+++ H+  ARMFYFFFESR+   +DPVV+WLTGGPGCSS LALF+
Sbjct  107  SAGATLEDFGHHAGYYRLPHTKGARMFYFFFESRKKNINDPVVLWLTGGPGCSSSLALFY  166

Query  515  ENGPFKIANNLSL  553
            ENGPF++ NNLSL
Sbjct  167  ENGPFQLTNNLSL  179



>ref|XP_002521640.1| Serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40747.1| Serine carboxypeptidase, putative [Ricinus communis]
Length=460

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 96/129 (74%), Gaps = 5/129 (4%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGS---LSAAEQGPKLVEKLFKFPNLADP--TV  346
            S F S QAEKLIRELNL P++ VN++ R       + + G ++VEK  KF N+      V
Sbjct  25   SSFPSLQAEKLIRELNLLPEKDVNVIDRRDDVVYDSVDGGGRIVEKRIKFLNVEGDYGAV  84

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            SVEDLGHHAGY+KI +S+ ARMFY FFESR  KK+DP+VIWLTGGPG SSELA+F+ENG 
Sbjct  85   SVEDLGHHAGYYKIANSHFARMFYLFFESRNKKKEDPMVIWLTGGPGNSSELAMFYENGL  144

Query  527  FKIANNLSL  553
            F IA+N+SL
Sbjct  145  FAIADNMSL  153



>ref|XP_003546386.1| PREDICTED: serine carboxypeptidase-like 49-like [Glycine max]
Length=493

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAG  376
            ++AEKLIR LNLFPK  +NIV    L+ A     +VEK F F  L D   S+EDLGHHAG
Sbjct  40   SRAEKLIRSLNLFPKNPINIVKGDGLANAFVSGNIVEKKFSF--LGDSGPSIEDLGHHAG  97

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            YF + +S AARMFYFFFESR   KDDPVVIWLTGGPGC  ELALF+ENGPF I NNLSL
Sbjct  98   YFSLPNSKAARMFYFFFESRN-NKDDPVVIWLTGGPGCGGELALFYENGPFHIGNNLSL  155



>gb|KHN47738.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=493

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAG  376
            ++AEKLIR LNLFPK  +NIV    L+ A     +VEK F F  L D   S+EDLGHHAG
Sbjct  40   SRAEKLIRSLNLFPKNPINIVKGDGLANAFVSGNIVEKKFSF--LGDSGPSIEDLGHHAG  97

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            YF + +S AARMFYFFFESR   KDDPVVIWLTGGPGC  ELALF+ENGPF I NNLSL
Sbjct  98   YFSLPNSKAARMFYFFFESRN-NKDDPVVIWLTGGPGCGGELALFYENGPFHIGNNLSL  155



>ref|XP_009356926.1| PREDICTED: serine carboxypeptidase-like [Pyrus x bretschneideri]
Length=519

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = +2

Query  161  GDLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQ--GPKLVEKLFKFPNL-  331
            G   PS +  A  QAEK IR LNLFPK  +N +P   L  AE   G K+VEK F+ P L 
Sbjct  33   GGRLPSPTLSAKRQAEKFIRALNLFPKHDINTLPHRPLLDAESAAGAKIVEKQFQMPFLD  92

Query  332  ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALF  511
            A    SVE+LGHHAGY+++ HS AARMFY FFESR   K +PVVIWLTGGPGCSSELALF
Sbjct  93   AALGPSVEELGHHAGYYRLPHSNAARMFYLFFESRT-NKSNPVVIWLTGGPGCSSELALF  151

Query  512  FENGPFKIANNLSL  553
            +ENGPF+I  NLSL
Sbjct  152  YENGPFRIQKNLSL  165



>gb|KEH29967.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=494

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 97/130 (75%), Gaps = 5/130 (4%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-KLVEKLFKF-PNLADPT  343
            FPS +   + QAEKLIR  NLFPK+SVN++  G  S     P K+VEK F F  +   P 
Sbjct  32   FPSTTFSPNQQAEKLIRSFNLFPKQSVNVI-HGDHSLDHFLPGKIVEKKFSFFGDSGGP-  89

Query  344  VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENG  523
             S+EDLGHHAGY+ +  S ++R+FYFFFESR+  KD PVVIWLTGGPGCSSELALF+ENG
Sbjct  90   -SIEDLGHHAGYYSLPRSNSSRLFYFFFESRKNNKDAPVVIWLTGGPGCSSELALFYENG  148

Query  524  PFKIANNLSL  553
            PFKIANNLSL
Sbjct  149  PFKIANNLSL  158



>ref|XP_007150149.1| hypothetical protein PHAVU_005G131000g [Phaseolus vulgaris]
 gb|ESW22143.1| hypothetical protein PHAVU_005G131000g [Phaseolus vulgaris]
Length=506

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 94/128 (73%), Gaps = 5/128 (4%)
 Frame = +2

Query  173  PSNSRFA-SAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVS  349
            P+ +  + S+ AEKLIR  NLFPK+ +N +   SL  A     +VEK   FP+L  P  S
Sbjct  35   PTTTELSFSSTAEKLIRGFNLFPKDPINTLESDSLLVA---GNIVEKKLTFPSLVAPGSS  91

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            VE+LGHHAGY+ +  S AARMFYFFFESR  +KDDPVVIWLTGGPGCSSELALF+ENGPF
Sbjct  92   VEELGHHAGYYSLPRSKAARMFYFFFESRS-RKDDPVVIWLTGGPGCSSELALFYENGPF  150

Query  530  KIANNLSL  553
            ++  NLSL
Sbjct  151  QLTKNLSL  158



>gb|EYU37039.1| hypothetical protein MIMGU_mgv1a025090mg [Erythranthe guttata]
Length=485

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = +2

Query  188  FASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGH  367
            F   QAEK IR LNLFPK  VN      L+ +    ++VEK  KFP L D   SV+DLGH
Sbjct  30   FPKTQAEKQIRALNLFPKHEVN--HHAGLNYSLGASQIVEKRLKFPVLGDSGTSVQDLGH  87

Query  368  HAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNL  547
            HAGY+K+ H+  ARMFYFFFESR    D PVVIWLTGGPGCSSELALF+ENGPF I +NL
Sbjct  88   HAGYYKLPHTKDARMFYFFFESRNSTAD-PVVIWLTGGPGCSSELALFYENGPFHITSNL  146

Query  548  SL  553
            SL
Sbjct  147  SL  148



>ref|XP_010111833.1| Serine carboxypeptidase-like 48 [Morus notabilis]
 gb|EXC31798.1| Serine carboxypeptidase-like 48 [Morus notabilis]
Length=517

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 93/124 (75%), Gaps = 2/124 (2%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDL  361
            ++F   QA+KLI ELNLFP + +N+    +    +   K+VEK F+ P   +   SV++L
Sbjct  48   AKFPKLQAQKLITELNLFPDDDINVAAH-AFRNLQPEKKIVEKRFELPVAGNSGASVKEL  106

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
            GHHAGY+++ HS AARMFY FFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPF+IAN
Sbjct  107  GHHAGYYRLPHSKAARMFYLFFESRNSKKD-PVVIWLTGGPGCSSELAVFYENGPFQIAN  165

Query  542  NLSL  553
            NLSL
Sbjct  166  NLSL  169



>ref|XP_009335971.1| PREDICTED: serine carboxypeptidase-like [Pyrus x bretschneideri]
Length=516

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 94/124 (76%), Gaps = 4/124 (3%)
 Frame = +2

Query  191  ASAQAEKLIRELNLFPKESVNIVPRG-SLSA-AEQGPKLVEKLFKFPNL-ADPTVSVEDL  361
            A  QAEK IR LNLFPK+ VNI+ R  SL A A+ G ++VEK FK P L A    S +DL
Sbjct  45   AKGQAEKFIRALNLFPKDDVNILSRKPSLDAEADAGVEIVEKQFKMPFLDAASGPSAKDL  104

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
            GHHAGY+++ HS  AR+FY FFESR   K+DPVVIWLTGGPGCSSELALF+ENGPF I N
Sbjct  105  GHHAGYYRLPHSEGARLFYLFFESRV-NKNDPVVIWLTGGPGCSSELALFYENGPFHIQN  163

Query  542  NLSL  553
            NLSL
Sbjct  164  NLSL  167



>ref|XP_009345743.1| PREDICTED: serine carboxypeptidase-like [Pyrus x bretschneideri]
Length=516

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 94/124 (76%), Gaps = 4/124 (3%)
 Frame = +2

Query  191  ASAQAEKLIRELNLFPKESVNIVPRG-SLSA-AEQGPKLVEKLFKFPNL-ADPTVSVEDL  361
            A  QAEK IR LNLFPK+ VNI+ R  SL A A+ G ++VEK FK P L A    S +DL
Sbjct  45   AKGQAEKFIRALNLFPKDDVNILSRKPSLDAEADAGVEIVEKQFKMPFLDAASGPSAKDL  104

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
            GHHAGY+++ HS  AR+FY FFESR   K+DPVVIWLTGGPGCSSELALF+ENGPF I N
Sbjct  105  GHHAGYYRLPHSEGARLFYLFFESRV-NKNDPVVIWLTGGPGCSSELALFYENGPFHIQN  163

Query  542  NLSL  553
            NLSL
Sbjct  164  NLSL  167



>emb|CDY08605.1| BnaA05g28410D [Brassica napus]
Length=515

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 7/125 (6%)
 Frame = +2

Query  194  SAQAEKLIRELNLFPKESVNIVPRG--SLSAAEQGPKLVEKLFKFPNL---ADPTVSVED  358
            S++AEKLIRELNLFP   VN++  G  +L++ E+ P +VE+ F FPN+     P  S+ED
Sbjct  40   SSRAEKLIRELNLFPNLEVNVIDVGDSTLTSDEELPSIVERRFIFPNILPDGGPP-SLED  98

Query  359  LGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIA  538
            LGHHAGY+K+  S  ARMFYFFFESR  KKD P+VIWLTGGPGCSSELA+F+ENGPFK+ 
Sbjct  99   LGHHAGYYKLPKSQGARMFYFFFESRS-KKDAPLVIWLTGGPGCSSELAMFYENGPFKLD  157

Query  539  NNLSL  553
             N+SL
Sbjct  158  KNMSL  162



>ref|XP_007207364.1| hypothetical protein PRUPE_ppa004507mg [Prunus persica]
 gb|EMJ08563.1| hypothetical protein PRUPE_ppa004507mg [Prunus persica]
Length=506

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 101/135 (75%), Gaps = 8/135 (6%)
 Frame = +2

Query  170  FPSNS--RFASA---QAEKLIRELNLFPKESVNIVP-RGSLSAAEQGPKLVEKLFKFPNL  331
            FP+N   +F+S    QAE  IR+LNLFP + +N VP + SL  A  GP LVEK FK P L
Sbjct  25   FPNNGPLQFSSTPKLQAENFIRDLNLFPIDEINTVPHKTSLDEAFAGPMLVEKQFKMPFL  84

Query  332  -ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELAL  508
             A    SV++LGHHAGY+++ +S AARMFY FFESR   K+DPVV+WLTGGPGC SE+A+
Sbjct  85   GAASGPSVQELGHHAGYYRLPNSKAARMFYLFFESRT-NKNDPVVMWLTGGPGCGSEIAV  143

Query  509  FFENGPFKIANNLSL  553
            F+ENGPF+IANNLSL
Sbjct  144  FYENGPFQIANNLSL  158



>ref|XP_007016860.1| Serine carboxypeptidase-like 48 [Theobroma cacao]
 gb|EOY34479.1| Serine carboxypeptidase-like 48 [Theobroma cacao]
Length=503

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 90/124 (73%), Gaps = 4/124 (3%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDL  361
            S  A  QAEKLIR LNL P+  VN    G    A +  K+VEK F FP L  P  S+++ 
Sbjct  40   SSLAKQQAEKLIRGLNLSPQGGVN---AGFDDLAVETSKIVEKQFSFPVLGAPGPSIQEF  96

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
            GHHAGY+K+ H+ AARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENGPF IA 
Sbjct  97   GHHAGYYKLAHAKAARMFYFFFESRN-SKNDPVVIWLTGGPGCSSELALFYENGPFHIAK  155

Query  542  NLSL  553
            NLSL
Sbjct  156  NLSL  159



>ref|XP_009146842.1| PREDICTED: serine carboxypeptidase-like 49 isoform X1 [Brassica 
rapa]
 ref|XP_009146843.1| PREDICTED: serine carboxypeptidase-like 49 isoform X2 [Brassica 
rapa]
Length=518

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 97/125 (78%), Gaps = 7/125 (6%)
 Frame = +2

Query  194  SAQAEKLIRELNLFPKESVNIVPRG--SLSAAEQGPKLVEKLFKFPNL---ADPTVSVED  358
            S++AEKLIRELNLFP   VN++  G  +L++ E+ P +VE+ F FPN+     P  S+ED
Sbjct  40   SSRAEKLIRELNLFPNLEVNVIDVGDSTLTSDEELPSIVERRFIFPNILPDGGPP-SLED  98

Query  359  LGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIA  538
            LGHHAGY+K+  S  ARMFYFFFESR  KKD P+VIWLTGGPGCSSELA+F+ENGPFK+ 
Sbjct  99   LGHHAGYYKLPKSQGARMFYFFFESRS-KKDAPLVIWLTGGPGCSSELAMFYENGPFKLD  157

Query  539  NNLSL  553
             N+SL
Sbjct  158  KNMSL  162



>gb|ACJ85699.1| unknown [Medicago truncatula]
Length=269

 Score =   147 bits (371),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 92/136 (68%), Gaps = 16/136 (12%)
 Frame = +2

Query  167  LFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-----KLVEKLFKFPNL  331
            L  S + +   QAE LIR LNLFPK+S+N          E  P      ++EK F FP  
Sbjct  37   LLSSTASYPKLQAENLIRGLNLFPKDSIN--------TPENDPHFLHGNIMEKKFTFPGF  88

Query  332  ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALF  511
             D   SVE+LGHHAGY+++ HS AARMFYFFFESR   KDDPVVIWLTGGPGCSSE+A+F
Sbjct  89   VDSGASVEELGHHAGYYRLPHSKAARMFYFFFESRN-TKDDPVVIWLTGGPGCSSEIAMF  147

Query  512  FENGPFKIA--NNLSL  553
            +ENGPFK +   NLSL
Sbjct  148  YENGPFKFSKDKNLSL  163



>gb|KDP43980.1| hypothetical protein JCGZ_05447 [Jatropha curcas]
Length=500

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 88/120 (73%), Gaps = 4/120 (3%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTV--SVEDLGHHA  373
            QAE  IR  NLFPK S+N+      S     P++VEK  K   L D  +  SV+DLGHHA
Sbjct  35   QAEHFIRGFNLFPKHSINLPINDESSVTV--PEIVEKPLKLNLLGDSGLGPSVQDLGHHA  92

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GY+K+ H+ AARMFYF FESR  K DDPVVIWLTGGPGCSSELALF+ENGPF+IANNLSL
Sbjct  93   GYYKLPHTKAARMFYFLFESRNSKNDDPVVIWLTGGPGCSSELALFYENGPFQIANNLSL  152



>ref|XP_010658339.1| PREDICTED: serine carboxypeptidase-like isoform X1 [Vitis vinifera]
Length=507

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 95/132 (72%), Gaps = 4/132 (3%)
 Frame = +2

Query  161  GDLFPS-NSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLAD  337
            G L PS N +F + QAEKLIRELNLFPK++  +   G     E   KLVE+  +FP +  
Sbjct  25   GFLRPSLNPKFPTLQAEKLIRELNLFPKDAEAV--NGMDWEGESTKKLVERRLRFPGIDY  82

Query  338  PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
               SV+DL  HAGY+K++HS AARMFY FFESR  +KD PVVIWLTGGPGC SELALF+E
Sbjct  83   SDASVKDLSQHAGYYKLRHSLAARMFYLFFESRDSRKD-PVVIWLTGGPGCGSELALFYE  141

Query  518  NGPFKIANNLSL  553
            NGPF IA N+SL
Sbjct  142  NGPFTIAANMSL  153



>ref|XP_008226415.1| PREDICTED: serine carboxypeptidase-like [Prunus mume]
Length=506

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 99/135 (73%), Gaps = 8/135 (6%)
 Frame = +2

Query  170  FPSN-----SRFASAQAEKLIRELNLFPKESVNIVP-RGSLSAAEQGPKLVEKLFKFPNL  331
            FP+N     S     QAEK IR+LNLFP + +N VP + SL  A  GP LVEK FK P L
Sbjct  25   FPNNGPLQLSSTPKLQAEKFIRDLNLFPTDEINTVPHKTSLDEAFAGPMLVEKQFKMPFL  84

Query  332  -ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELAL  508
             A    SV++LGHHAGY+++ +S AARMFY FFESR   K++PVV+WLTGGPGC SE+A+
Sbjct  85   GAASGPSVQELGHHAGYYRLPNSKAARMFYLFFESRT-DKNNPVVMWLTGGPGCGSEIAV  143

Query  509  FFENGPFKIANNLSL  553
            F+ENGPF+IANNLSL
Sbjct  144  FYENGPFQIANNLSL  158



>ref|XP_010689129.1| PREDICTED: serine carboxypeptidase-like [Beta vulgaris subsp. 
vulgaris]
Length=517

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 91/131 (69%), Gaps = 6/131 (5%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKE----SVNIVPRGSLSAAEQGPKLVEKLFKFPNLA-DP  340
            S + F   QAE+LIR LNLFPK      V          +  G  LVEK FK   L  DP
Sbjct  40   STTTFPKLQAERLIRHLNLFPKHPFNNRVENENENEAGLSVDGSGLVEKRFKISELGGDP  99

Query  341  TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
              SVEDLGHHAGY+++ HS  ARMFYFFFESR   K+DP+VIWLTGGPGCSSELALF+EN
Sbjct  100  GTSVEDLGHHAGYYRLPHSKDARMFYFFFESRS-SKNDPIVIWLTGGPGCSSELALFYEN  158

Query  521  GPFKIANNLSL  553
            GPF+IANN+SL
Sbjct  159  GPFQIANNMSL  169



>ref|XP_008344883.1| PREDICTED: serine carboxypeptidase-like [Malus domestica]
Length=516

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 93/124 (75%), Gaps = 4/124 (3%)
 Frame = +2

Query  191  ASAQAEKLIRELNLFPKESVNIVPRG-SLSA-AEQGPKLVEKLFKFPNL-ADPTVSVEDL  361
            A  QAEK IR LNLFPK  VNI+ R  SL A A+ G ++VEK FK P L A    S +DL
Sbjct  45   AKGQAEKFIRALNLFPKXDVNILSRKPSLDAEADAGVZIVEKQFKMPFLDAASGPSAKDL  104

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
            GHHAGY+++ HS  AR+FY FFESR   K+DPVVIWLTGGPGCSSELALF+ENGPF I N
Sbjct  105  GHHAGYYRLPHSEGARLFYLFFESRI-NKNDPVVIWLTGGPGCSSELALFYENGPFHIQN  163

Query  542  NLSL  553
            NLSL
Sbjct  164  NLSL  167



>ref|XP_004163685.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
48-like [Cucumis sativus]
Length=502

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 95/124 (77%), Gaps = 14/124 (11%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQ----GPKLVEKLFKFPNLADPTV--SVEDL  361
            QAEKLIR+LNLFPK+S+NI       AAE+       +VEK F+FP +   +   SV+DL
Sbjct  39   QAEKLIRDLNLFPKDSINI-------AAEEPSFSSSGIVEKSFQFPFIKKKSQGPSVQDL  91

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
            GHHAGY+ + H+ +ARMFY FFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPF+IAN
Sbjct  92   GHHAGYYPLPHTKSARMFYLFFESRNSKKD-PVVIWLTGGPGCSSELAMFYENGPFQIAN  150

Query  542  NLSL  553
            NLSL
Sbjct  151  NLSL  154



>ref|XP_009592158.1| PREDICTED: serine carboxypeptidase-like [Nicotiana tomentosiformis]
Length=501

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 94/127 (74%), Gaps = 4/127 (3%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIV-PRGSLSAAEQGPKLVEKLFKFPNLADPTVSV  352
            S+++F    AEKLI +LNLFPK  +N V P  S++  EQ  +L EK F    L D   +V
Sbjct  33   SSTKFPVPMAEKLINQLNLFPKHDINKVEPGKSVATTEQ--RLFEKKFNLSYLGDSGATV  90

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            +DLGHHAGY+ + H+  ARMFYFFFESR   ++DPVVIWLTGGPGCSSELA+F+ENGPF 
Sbjct  91   QDLGHHAGYYSLPHTKDARMFYFFFESRS-SQNDPVVIWLTGGPGCSSELAVFYENGPFN  149

Query  533  IANNLSL  553
            IA+N+SL
Sbjct  150  IADNMSL  156



>ref|XP_006343737.1| PREDICTED: serine carboxypeptidase-like 48-like [Solanum tuberosum]
Length=504

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVE  355
            S+++F    AEKLI++LNLFPK  +N      L+A  Q   L EK F    L D   +V+
Sbjct  36   SSAKFPVPMAEKLIKQLNLFPKHDINKASSSPLAATHQ-QTLFEKRFNLSYLGDSGATVQ  94

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            DLGHHAGY+++ H+  ARMFYFFFESR   ++DPVVIWLTGGPGCSSELA+F+ENGPF I
Sbjct  95   DLGHHAGYYRLPHTKDARMFYFFFESR-SSQNDPVVIWLTGGPGCSSELAVFYENGPFNI  153

Query  536  ANNLSL  553
            A+N+SL
Sbjct  154  ADNMSL  159



>ref|XP_002523707.1| Serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF38647.1| Serine carboxypeptidase, putative [Ricinus communis]
Length=506

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGY  379
            QAE+LIR  NL PK S+N+ P+ +  + E  P LVEK      L D   SV+D GHHAGY
Sbjct  44   QAERLIRGFNLSPKHSINL-PKIADDSLENSPDLVEKPLNLNLLGDSGPSVQDFGHHAGY  102

Query  380  FKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            FK+ H+ AARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENGP+ ++NN+SL
Sbjct  103  FKLPHTKAARMFYFFFESRN-NKNDPVVIWLTGGPGCSSELALFYENGPYHLSNNMSL  159



>ref|XP_004241292.1| PREDICTED: serine carboxypeptidase-like [Solanum lycopersicum]
Length=494

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 93/130 (72%), Gaps = 5/130 (4%)
 Frame = +2

Query  164  DLFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT  343
            +   S  +F    AEKLIR+LNLFPK  +N     S  A +QG  L EK      + D  
Sbjct  24   NFLSSTQKFPITMAEKLIRQLNLFPKHEINKATDDS--ATQQG--LFEKKLNLSYIGDSG  79

Query  344  VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENG  523
             +V++LGHHAGY+++ H+  ARMFYFFFESR  +K+DPVVIWLTGGPGCSSELA+F+ENG
Sbjct  80   ATVQNLGHHAGYYRLPHTKDARMFYFFFESR-SRKNDPVVIWLTGGPGCSSELAVFYENG  138

Query  524  PFKIANNLSL  553
            PFKIA+N+SL
Sbjct  139  PFKIADNMSL  148



>ref|XP_007132319.1| hypothetical protein PHAVU_011G084700g [Phaseolus vulgaris]
 gb|ESW04313.1| hypothetical protein PHAVU_011G084700g [Phaseolus vulgaris]
Length=527

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 89/119 (75%), Gaps = 5/119 (4%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAG  376
            + AE+LIR LN+FPK+SVNI  +G       G  +VEK F F  L D   SVEDLGHHAG
Sbjct  41   SHAERLIRSLNVFPKDSVNIT-KGDHGGFVPG-MIVEKKFSF--LGDSGPSVEDLGHHAG  96

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            Y+ + HS AARMFYFFFESR   KDDPVVIWLTGGPGC SELALF+ENGPF I NNLSL
Sbjct  97   YYSLPHSKAARMFYFFFESRN-SKDDPVVIWLTGGPGCGSELALFYENGPFHITNNLSL  154



>gb|KGN64810.1| Serine carboxypeptidase [Cucumis sativus]
Length=476

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 94/125 (75%), Gaps = 15/125 (12%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQ----GPKLVEKLFKFPNLADPTV---SVED  358
            QAEKLIR+LNLFPK+S+NI       AAE+       +VEK F+FP +        SV+D
Sbjct  39   QAEKLIRDLNLFPKDSINI-------AAEEPSFSSSGIVEKSFQFPFIERKKSQGPSVQD  91

Query  359  LGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIA  538
            LGHHAGY+ + H+ +ARMFY FFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPF+IA
Sbjct  92   LGHHAGYYPLPHTKSARMFYLFFESRNSKKD-PVVIWLTGGPGCSSELAMFYENGPFQIA  150

Query  539  NNLSL  553
            NNLSL
Sbjct  151  NNLSL  155



>dbj|BAE48666.1| Serine carboxypeptidase [Prunus mume]
Length=506

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 98/135 (73%), Gaps = 8/135 (6%)
 Frame = +2

Query  170  FPSN-----SRFASAQAEKLIRELNLFPKESVNIVP-RGSLSAAEQGPKLVEKLFKFPNL  331
            FP+N     S     QAEK IR LNLFP + +N VP + SL  A  GP LVEK FK P L
Sbjct  25   FPNNGPLQLSSTPKLQAEKFIRGLNLFPTDEINTVPHKTSLDEAFAGPMLVEKQFKMPFL  84

Query  332  -ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELAL  508
             A    SV++LGHHAGY+++ +S AARMFY FFESR   K++PVV+WLTGGPGC SE+A+
Sbjct  85   GAASGPSVQELGHHAGYYRLPNSKAARMFYLFFESRT-DKNNPVVMWLTGGPGCGSEIAV  143

Query  509  FFENGPFKIANNLSL  553
            F+ENGPF+IANNLSL
Sbjct  144  FYENGPFQIANNLSL  158



>emb|CDY00930.1| BnaC05g42700D [Brassica napus]
Length=514

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 95/123 (77%), Gaps = 4/123 (3%)
 Frame = +2

Query  194  SAQAEKLIRELNLFPKESVNIVPRG-SLSAAEQGPKLVEKLFKFPN-LADPTV-SVEDLG  364
            S++AEKLIRELNLFP   VN++  G S  A+E+ P +VE+ F FPN L D    S+EDLG
Sbjct  40   SSRAEKLIRELNLFPNLEVNVIDVGGSTLASEELPPIVERRFIFPNILPDGGAPSLEDLG  99

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            HHAGY+K+  S  ARMFY FFESR  KKD P+VIWLTGGPGCSSELA+F+ENGPFK+  N
Sbjct  100  HHAGYYKLPKSQGARMFYLFFESRS-KKDAPLVIWLTGGPGCSSELAMFYENGPFKLDKN  158

Query  545  LSL  553
            +SL
Sbjct  159  MSL  161



>ref|XP_009617667.1| PREDICTED: serine carboxypeptidase-like [Nicotiana tomentosiformis]
Length=505

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +2

Query  164  DLFPSNS-RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP  340
            D F S++ +     AEKLIR+LNLFPK  +N       SAA    +L EK      + + 
Sbjct  31   DFFLSSTPKLPLTMAEKLIRQLNLFPKHDINKAAATGDSAAVTEQRLFEKKLNLSYVGNS  90

Query  341  TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
              +V+DLGHHAGY+++ H+  ARMFYFFFES R +K+DPVVIWLTGGPGCSSELA+F+EN
Sbjct  91   GSTVQDLGHHAGYYRLPHTKDARMFYFFFES-RSRKNDPVVIWLTGGPGCSSELAVFYEN  149

Query  521  GPFKIANNLSL  553
            GPFKIA+N+SL
Sbjct  150  GPFKIADNMSL  160



>ref|XP_003534860.1| PREDICTED: serine carboxypeptidase-like 49-like [Glycine max]
 gb|KHN26598.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=497

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAG  376
            ++AEKLIR LNL PK+ VNIV    L+       +VEK F F  L D   S+EDLGHHAG
Sbjct  44   SRAEKLIRSLNLSPKDPVNIVKGDDLANGFVPGNIVEKKFSF--LGDSGPSIEDLGHHAG  101

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            Y+ + +S AARMFYFFFESR   KDDPVVIWLTGGPGC  ELALF+ENGPF IANNLSL
Sbjct  102  YYSLPNSKAARMFYFFFESRS-NKDDPVVIWLTGGPGCGGELALFYENGPFHIANNLSL  159



>ref|XP_004147293.1| PREDICTED: serine carboxypeptidase-like 48-like [Cucumis sativus]
Length=503

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 94/125 (75%), Gaps = 15/125 (12%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQ----GPKLVEKLFKFPNLADPTV---SVED  358
            QAEKLIR+LNLFPK+S+NI       AAE+       +VEK F+FP +        SV+D
Sbjct  39   QAEKLIRDLNLFPKDSINI-------AAEEPSFSSSGIVEKSFQFPFIERKKSQGPSVQD  91

Query  359  LGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIA  538
            LGHHAGY+ + H+ +ARMFY FFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPF+IA
Sbjct  92   LGHHAGYYPLPHTKSARMFYLFFESRNSKKD-PVVIWLTGGPGCSSELAMFYENGPFQIA  150

Query  539  NNLSL  553
            NNLSL
Sbjct  151  NNLSL  155



>ref|XP_008799516.1| PREDICTED: serine carboxypeptidase 3-like [Phoenix dactylifera]
Length=305

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 93/129 (72%), Gaps = 10/129 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPK-LVEKLFKFPNLADPTV  346
             PS++ F SAQAEKLIR LNL PK+     P    SAA+   K +VE+ F    L     
Sbjct  31   LPSSATFPSAQAEKLIRSLNLLPKDPS---PESVASAADAPAKGIVERRFNLAGL-----  82

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            S +DLGHHAGY+++ HS+ ARMFY FFESR  KKD PVVIWLTGGPGCSSELA+F+ENGP
Sbjct  83   SGDDLGHHAGYYRLPHSHDARMFYLFFESRHSKKD-PVVIWLTGGPGCSSELAVFYENGP  141

Query  527  FKIANNLSL  553
            F IA+N+SL
Sbjct  142  FTIADNMSL  150



>gb|KEH43478.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=502

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 93/122 (76%), Gaps = 6/122 (5%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIV-PRGSLSAAEQGPKL-VEKLFKFPNLA---DPTVSVEDLGH  367
            A+ LIR LNLFP   +NI+  + ++   +   K+ VEK  KFPN +   D  V ++DL H
Sbjct  31   AKNLIRNLNLFPSHDINILDAKPNVEENQNNNKIIVEKPLKFPNFSGEYDEGVCIDDLAH  90

Query  368  HAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNL  547
             AGY+ IQHS+AA+MFYFFFESR+ KKD PVVIWLTGGPGCSSELA+F+ENGPFKIANNL
Sbjct  91   RAGYYPIQHSHAAKMFYFFFESRKNKKD-PVVIWLTGGPGCSSELAVFYENGPFKIANNL  149

Query  548  SL  553
            SL
Sbjct  150  SL  151



>ref|XP_002453162.1| hypothetical protein SORBIDRAFT_04g001030 [Sorghum bicolor]
 gb|EES06138.1| hypothetical protein SORBIDRAFT_04g001030 [Sorghum bicolor]
Length=498

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 94/129 (73%), Gaps = 11/129 (9%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-KLVEKLFKFPNLADPTV  346
             P ++ F +AQAE+LIR LNL PKE      +G        P +L+E+  + P + D   
Sbjct  30   LPRDATFPAAQAERLIRALNLLPKE------KGGGDGPSVAPGELLERRIRLPGVPD---  80

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
             V DLGHHAGYF++ H++ ARMFYFFFESR GKK+DPVVIWLTGGPGCSSELA+F+ENGP
Sbjct  81   GVGDLGHHAGYFRLPHTHDARMFYFFFESR-GKKEDPVVIWLTGGPGCSSELAVFYENGP  139

Query  527  FKIANNLSL  553
            F IANN+SL
Sbjct  140  FTIANNMSL  148



>gb|KJB20374.1| hypothetical protein B456_003G145400 [Gossypium raimondii]
Length=504

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +2

Query  191  ASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHH  370
            A  QAEKLIR LNLFP+ + N      L+   +  K+VEK FKFP +  P  S+++  HH
Sbjct  39   AKIQAEKLIRGLNLFPRHAANEGVNEDLT--NEPSKIVEKQFKFPVIDAPGPSIQNFAHH  96

Query  371  AGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLS  550
            AGY+K+ HS +ARMFYFFFESR  KKD PVVIWLTGGPGCSSELALF+ENGPF +A NLS
Sbjct  97   AGYYKLPHSKSARMFYFFFESRNSKKD-PVVIWLTGGPGCSSELALFYENGPFHLAKNLS  155

Query  551  L  553
            L
Sbjct  156  L  156



>gb|KEH29968.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=500

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 96/130 (74%), Gaps = 4/130 (3%)
 Frame = +2

Query  170  FPSNSRFASAQ-AEKLIRELNLFPKESVNIVPRGSLSAAEQGP-KLVEKLFKFPNLADPT  343
            F S  +F+  Q AEKLI+  NL PK+ VNI+  G  S     P KLVEK F F + ++  
Sbjct  32   FSSTPKFSPNQRAEKLIKSFNLLPKDPVNII-HGDHSIDHFVPGKLVEKKFSFFSDSNGP  90

Query  344  VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENG  523
             S+EDLGHHAGY+ +  S +ARMFYFFFESR+  KD PVVIWLTGGPGCSSELALF+ENG
Sbjct  91   -SIEDLGHHAGYYSLPRSKSARMFYFFFESRKNNKDAPVVIWLTGGPGCSSELALFYENG  149

Query  524  PFKIANNLSL  553
            PFKIANNLSL
Sbjct  150  PFKIANNLSL  159



>gb|AFK43520.1| unknown [Medicago truncatula]
Length=443

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 92/136 (68%), Gaps = 16/136 (12%)
 Frame = +2

Query  167  LFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-----KLVEKLFKFPNL  331
            L  S + +   QAE LIR LNLFPK+S+N          E  P      ++EK F FP  
Sbjct  37   LLSSTASYPKLQAENLIRGLNLFPKDSIN--------TPENDPHFLHGNIMEKKFTFPGF  88

Query  332  ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALF  511
             D   SVE+LGHHAGY+++ HS AARMFYFFFESR   KDDPVVIWLTGGPGCSSE+A+F
Sbjct  89   VDSGASVEELGHHAGYYRLPHSKAARMFYFFFESRN-TKDDPVVIWLTGGPGCSSEIAMF  147

Query  512  FENGPFKIA--NNLSL  553
            +ENGPFK +   NLSL
Sbjct  148  YENGPFKFSKDKNLSL  163



>ref|XP_009382132.1| PREDICTED: serine carboxypeptidase-like [Musa acuminata subsp. 
malaccensis]
Length=507

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVS  349
             PS S F  A A+KLIR LNL PK++      G  S A +  ++ E+ F+FP L+D T S
Sbjct  33   LPSTSAFPRASAKKLIRALNLIPKDASPESTVGFSSDASRN-RIFERRFRFPGLSDGT-S  90

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            V+DLGHHAGY+ + H++ ARMFY FFESR   KD P+VIWLTGGPGCSSELA+F+ENGPF
Sbjct  91   VDDLGHHAGYYSLPHTHDARMFYLFFESRNSNKD-PIVIWLTGGPGCSSELAVFYENGPF  149

Query  530  KIANNLSL  553
             IA+N+SL
Sbjct  150  SIADNMSL  157



>ref|XP_008463013.1| PREDICTED: serine carboxypeptidase-like [Cucumis melo]
Length=503

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 94/125 (75%), Gaps = 15/125 (12%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQ----GPKLVEKLFKFPNLADPTV---SVED  358
            QAEKLIR+LNLFPK+S+NI       AAE+       LVEK F+FP +        SV++
Sbjct  39   QAEKLIRDLNLFPKDSINI-------AAEEPSFSSSGLVEKSFQFPFIERKKSRGPSVQE  91

Query  359  LGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIA  538
            LGHHAGY+ + H+ +ARMFY FFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPF+IA
Sbjct  92   LGHHAGYYPLPHTKSARMFYLFFESRNSKKD-PVVIWLTGGPGCSSELAMFYENGPFQIA  150

Query  539  NNLSL  553
            NNLSL
Sbjct  151  NNLSL  155



>ref|XP_007132322.1| hypothetical protein PHAVU_011G085000g [Phaseolus vulgaris]
 gb|ESW04316.1| hypothetical protein PHAVU_011G085000g [Phaseolus vulgaris]
Length=496

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 89/123 (72%), Gaps = 11/123 (9%)
 Frame = +2

Query  194  SAQAEKLIRELNLFPKESVNIVPRGSLSAAEQG---PKLVEKLFKFPNLADPTVSVEDLG  364
            +++AEKLIR LNLFPKE     P  S+    +G    K+VEK F F  L D   SVEDLG
Sbjct  38   TSKAEKLIRSLNLFPKE-----PFNSIEGDHEGFVPGKIVEKKFSF--LGDSGPSVEDLG  90

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            HHAGY+ + HS AARMFYF FESR   KDDPVV+WLTGGPGC SELALF+ENGPF I NN
Sbjct  91   HHAGYYSLPHSKAARMFYFLFESRS-SKDDPVVVWLTGGPGCGSELALFYENGPFHITNN  149

Query  545  LSL  553
            LSL
Sbjct  150  LSL  152



>gb|EYU37040.1| hypothetical protein MIMGU_mgv1a024049mg [Erythranthe guttata]
Length=477

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 94/131 (72%), Gaps = 6/131 (5%)
 Frame = +2

Query  164  DLFPSNS-RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP  340
            +L P+++  F   QAEK IRELNLFP   +NIV     +     P++VEK F+ P+L++ 
Sbjct  26   NLLPASTFVFPKKQAEKFIRELNLFPVNDINIVENDDFAPQ---PRIVEKSFRLPHLSES  82

Query  341  TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
            T+  +D GHHAGY+K+ H+  ARMFY+FFESR+   + PVV+WLTGGPGCS  LALF+EN
Sbjct  83   TI--QDFGHHAGYYKLPHTKGARMFYYFFESRKKDINAPVVLWLTGGPGCSGSLALFYEN  140

Query  521  GPFKIANNLSL  553
            GPF + NNLSL
Sbjct  141  GPFHLTNNLSL  151



>ref|XP_003597272.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES67523.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=511

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 92/136 (68%), Gaps = 16/136 (12%)
 Frame = +2

Query  167  LFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-----KLVEKLFKFPNL  331
            L  S + +   QAE LIR LNLFPK+S+N          E  P      ++EK F FP  
Sbjct  37   LLSSTASYPKLQAENLIRGLNLFPKDSIN--------TPENDPHFLHGNIMEKKFTFPGF  88

Query  332  ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALF  511
             D   SVE+LGHHAGY+++ HS AARMFYFFFESR   KDDPVVIWLTGGPGCSSE+A+F
Sbjct  89   VDSGASVEELGHHAGYYRLPHSKAARMFYFFFESRN-TKDDPVVIWLTGGPGCSSEIAMF  147

Query  512  FENGPFKIA--NNLSL  553
            +ENGPFK +   NLSL
Sbjct  148  YENGPFKFSKDKNLSL  163



>gb|KHG17096.1| Serine carboxypeptidase-like 48 [Gossypium arboreum]
Length=504

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = +2

Query  191  ASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHH  370
            A  QAEKLIR LNLFP+ + N      L+   +  K+VEK FKFP +  P  S+++  HH
Sbjct  39   AKIQAEKLIRGLNLFPRHAANEGVNEDLT--NEPSKIVEKQFKFPVIDAPGPSIQNFAHH  96

Query  371  AGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLS  550
            AGY+K+ HS +ARMFYFFFESR  +KD PVVIWLTGGPGCSSELALF+ENGPF +A NLS
Sbjct  97   AGYYKLPHSKSARMFYFFFESRNSEKD-PVVIWLTGGPGCSSELALFYENGPFHLAKNLS  155

Query  551  L  553
            L
Sbjct  156  L  156



>ref|XP_004292565.1| PREDICTED: serine carboxypeptidase-like [Fragaria vesca subsp. 
vesca]
Length=509

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = +2

Query  188  FASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT-VSVEDLG  364
            F   QAEKLIR+LNLFP + +N       +++   PKLVEK FK P  A     ++ +LG
Sbjct  42   FPKLQAEKLIRDLNLFPNDEINT--GAYYNSSLDAPKLVEKRFKMPYFAAANGTTIAELG  99

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            HHAGY+++ +S+AARMFY FFESR   K+DPVVIWLTGGPGCSSELA+F+ENGPF I NN
Sbjct  100  HHAGYYRLPNSHAARMFYLFFESRT-NKNDPVVIWLTGGPGCSSELAVFYENGPFHIVNN  158

Query  545  LSL  553
            LSL
Sbjct  159  LSL  161



>ref|XP_007221636.1| hypothetical protein PRUPE_ppb018374mg [Prunus persica]
 gb|EMJ22835.1| hypothetical protein PRUPE_ppb018374mg [Prunus persica]
Length=113

 Score =   138 bits (348),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = +2

Query  209  KLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGYFKI  388
            +LIR  NLFPKE +NI+     S     P+LVEK F  PNL    VSVEDLGHHAGYFKI
Sbjct  14   ELIRAFNLFPKEDINIIDGPDSSIFHDSPRLVEKRFNLPNLVGSGVSVEDLGHHAGYFKI  73

Query  389  QHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALF  511
            +HS+AAR+FY FFESR   K DPVVIWLTGGPGCSSELA+F
Sbjct  74   EHSHAARIFYLFFESRTNNK-DPVVIWLTGGPGCSSELAVF  113



>gb|KCW50687.1| hypothetical protein EUGRSUZ_J00372 [Eucalyptus grandis]
Length=428

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 90/122 (74%), Gaps = 4/122 (3%)
 Frame = +2

Query  194  SAQAEKLIRELNLFPKESVNIVPRG--SLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGH  367
            + QAE LI+ LNL PKE+VNI  R   S S A  G K+VE+ F+ P L D   SV+DLG 
Sbjct  37   TVQAEILIKGLNLHPKEAVNIRIRDKDSFSLASDG-KIVERRFELPVLGDSRSSVQDLGQ  95

Query  368  HAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNL  547
            +AGY+ + HS+AA MFYFFFESR    +DPVVIWLTGGPGCSS LALF ENGPF IANNL
Sbjct  96   NAGYYPLPHSHAATMFYFFFESR-SSANDPVVIWLTGGPGCSSSLALFHENGPFHIANNL  154

Query  548  SL  553
            SL
Sbjct  155  SL  156



>ref|XP_011028255.1| PREDICTED: serine carboxypeptidase-like [Populus euphratica]
 ref|XP_011012692.1| PREDICTED: serine carboxypeptidase-like [Populus euphratica]
Length=508

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = +2

Query  161  GDLFPSNSRFASAQAEKLIRELNLFPKESVNIVP-RGSLSAAEQGPKLVEKLFKFPNLAD  337
            G L  S S     QAE  IR LNLFPK ++N+     +       P +VEK F+F  L +
Sbjct  30   GQLDLSASFLPRLQAETQIRGLNLFPKHAINVPAFDDNELLGTSSPSIVEKQFQFHLLGN  89

Query  338  PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
            P  SV++ GH+AGY+++ H+ AARMFY+FFESR   K+DPVVIWLTGGPGCSSELALF+E
Sbjct  90   PGPSVQEFGHYAGYYRLSHTKAARMFYYFFESRT-NKNDPVVIWLTGGPGCSSELALFYE  148

Query  518  NGPFKIANNLSL  553
            NGPF IANNLSL
Sbjct  149  NGPFNIANNLSL  160



>ref|XP_006342273.1| PREDICTED: serine carboxypeptidase-like 48-like [Solanum tuberosum]
Length=494

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAG  376
              AEK IR+LNLFPK  +NI+       A+Q  +L EK      L     +V+DLGHHAG
Sbjct  39   TMAEKFIRQLNLFPKHDINIIVSSKDQIADQ-HRLFEKKLNLSYLGYSGATVQDLGHHAG  97

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            Y+ + HS AARMFYFFFESR   K+DPVV+WLTGGPGCSSELALF+ENGPF+I++N+SL
Sbjct  98   YYHLLHSKAARMFYFFFESR-SNKNDPVVMWLTGGPGCSSELALFYENGPFQISHNMSL  155



>ref|XP_009758588.1| PREDICTED: serine carboxypeptidase-like [Nicotiana sylvestris]
Length=501

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 92/127 (72%), Gaps = 4/127 (3%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVN-IVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSV  352
            S+ +F    AEK I +LNLFPK  +N   P  S++  EQ  +L EK F    L D   +V
Sbjct  33   SSPKFPVPMAEKFINQLNLFPKHDINKFEPGKSVATTEQ--RLFEKKFNLSYLGDSGATV  90

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            +DLGHHAGY+++ H+  ARMFYFFFESR   ++DPVVIWLTGGPGCSSELA+F+ENGPF 
Sbjct  91   QDLGHHAGYYRLPHTKDARMFYFFFESRS-SQNDPVVIWLTGGPGCSSELAVFYENGPFN  149

Query  533  IANNLSL  553
            IA+N+SL
Sbjct  150  IADNMSL  156



>gb|KHN06879.1| Serine carboxypeptidase-like 49 [Glycine soja]
Length=499

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 94/127 (74%), Gaps = 5/127 (4%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT-VSV  352
            SN    S+ AEKLIR LNLFPK+ +N +    L  +     +VEK F FP+LA  +  SV
Sbjct  34   SNDLRFSSTAEKLIRGLNLFPKDPINTLENDPLFVS---GSIVEKSFTFPSLAASSESSV  90

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            E+LGHHAGY+++  S AARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENGPF+
Sbjct  91   EELGHHAGYYRLPRSKAARMFYFFFESR-SSKNDPVVIWLTGGPGCSSELALFYENGPFQ  149

Query  533  IANNLSL  553
            +  NLSL
Sbjct  150  LTKNLSL  156



>ref|XP_004240682.1| PREDICTED: serine carboxypeptidase-like [Solanum lycopersicum]
Length=504

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 89/126 (71%), Gaps = 2/126 (2%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVE  355
            S+ +F    AEKLI++ NLFPK  +N      L+A  Q   L EK F    L D   +V+
Sbjct  36   SSVKFPVPMAEKLIKQFNLFPKHDINKASSSPLAATHQ-QTLFEKRFNLSYLGDSGATVQ  94

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            DLGHHAGY+ + H+  ARMFYFFFESR   ++DPVVIWLTGGPGCSSELA+F+ENGPF I
Sbjct  95   DLGHHAGYYILPHTKDARMFYFFFESRS-SQNDPVVIWLTGGPGCSSELAVFYENGPFNI  153

Query  536  ANNLSL  553
            A+N+SL
Sbjct  154  ADNMSL  159



>ref|XP_003540200.1| PREDICTED: serine carboxypeptidase-like 48-like [Glycine max]
Length=504

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 94/127 (74%), Gaps = 5/127 (4%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT-VSV  352
            SN    S+ AEKLIR LNLFPK+ +N +    L  +     +VEK F FP+LA  +  SV
Sbjct  34   SNDLRFSSTAEKLIRGLNLFPKDPINTLENDPLFVS---GSIVEKSFTFPSLAASSESSV  90

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            E+LGHHAGY+++  S AARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENGPF+
Sbjct  91   EELGHHAGYYRLPRSKAARMFYFFFESR-SSKNDPVVIWLTGGPGCSSELALFYENGPFQ  149

Query  533  IANNLSL  553
            +  NLSL
Sbjct  150  LTKNLSL  156



>ref|XP_004496230.1| PREDICTED: serine carboxypeptidase-like 49-like [Cicer arietinum]
Length=506

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 90/119 (76%), Gaps = 3/119 (3%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT--VSVEDLGHHAG  376
             + LIR LNLFP   +NI+   ++   ++  K+VEK  +FPN +     +S++DL H AG
Sbjct  38   VKNLIRNLNLFPPHDINILANPNVVPTDKNNKIVEKPLRFPNFSGEGEGISLDDLAHRAG  97

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            Y+ +QHS+AA+MFY FFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPFKIANN+SL
Sbjct  98   YYPLQHSHAAKMFYLFFESRINKKD-PVVIWLTGGPGCSSELAVFYENGPFKIANNMSL  155



>emb|CDP07045.1| unnamed protein product [Coffea canephora]
Length=494

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 85/123 (69%), Gaps = 2/123 (2%)
 Frame = +2

Query  185  RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLG  364
            +F  + A+ LIR LNL P++ VNIV      AA    ++VEK  K   L  P  SV DLG
Sbjct  38   KFRVSPAKGLIRGLNLHPRQDVNIVANDF--AAANDSRIVEKPLKLNILGAPDPSVADLG  95

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            HHAGYF + H+  ARMFYFFFESRR    DPVVIWLTGGPGCSSELALF+ENGPF I + 
Sbjct  96   HHAGYFNLPHTVGARMFYFFFESRRKNNSDPVVIWLTGGPGCSSELALFYENGPFHITDG  155

Query  545  LSL  553
            LSL
Sbjct  156  LSL  158



>ref|XP_004514874.1| PREDICTED: serine carboxypeptidase-like 49-like [Cicer arietinum]
Length=505

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVED-LGHHAG  376
            +A+KL+R+LNLFP  ++NI    S S+ E   K+VEK  +F NL        D  GH+AG
Sbjct  37   EAKKLVRDLNLFPDVNLNIAAANSSSSLEHHGKIVEKRLRFSNLVSDDDVSVDDFGHYAG  96

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            Y+ I+HS+AARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENGPFKI N+LSL
Sbjct  97   YYPIRHSHAARMFYFFFESRN-SKEDPVVIWLTGGPGCSSELALFYENGPFKINNDLSL  154



>ref|XP_006384950.1| serine carboxypeptidase family protein [Populus trichocarpa]
 gb|ERP62747.1| serine carboxypeptidase family protein [Populus trichocarpa]
Length=508

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = +2

Query  161  GDLFPSNSRFASAQAEKLIRELNLFPKESVNIVP-RGSLSAAEQGPKLVEKLFKFPNLAD  337
            G L  S S      AE  IR LNLFPK ++N+     +       P +VEK F+F  L +
Sbjct  30   GQLDLSASFLPRLHAETQIRGLNLFPKHAINVPAFDDNELLGTSSPSIVEKQFQFHLLGN  89

Query  338  PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
            P  SV++ GH+AGY+++ H+ AARMFY+FFESR   K+DPVVIWLTGGPGCSSELALF+E
Sbjct  90   PGPSVQEFGHYAGYYRLSHTKAARMFYYFFESRT-NKNDPVVIWLTGGPGCSSELALFYE  148

Query  518  NGPFKIANNLSL  553
            NGPF IANNLSL
Sbjct  149  NGPFNIANNLSL  160



>ref|XP_002273281.1| PREDICTED: serine carboxypeptidase-like [Vitis vinifera]
Length=501

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 91/120 (76%), Gaps = 7/120 (6%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNI-VPRGSLSAAEQGPKLVEKLFKFPNLADPT-VSVEDLGHHA  373
            QAE+LIR LNL PK++VN+ V  G   A    P+++EK  +FP L   +  S++DLGHHA
Sbjct  43   QAERLIRSLNLSPKKAVNLDVSHGEAVA----PRMIEKSLEFPFLDGSSGTSIQDLGHHA  98

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GYF++ HS  ARMFYFFFESR  KKD PVV+WLTGGPGC SE+ALF+ENGPF + +NL+L
Sbjct  99   GYFRLAHSIDARMFYFFFESRHSKKD-PVVVWLTGGPGCGSEVALFYENGPFHVRDNLTL  157



>emb|CBI17153.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 91/120 (76%), Gaps = 7/120 (6%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNI-VPRGSLSAAEQGPKLVEKLFKFPNLADPT-VSVEDLGHHA  373
            QAE+LIR LNL PK++VN+ V  G   A    P+++EK  +FP L   +  S++DLGHHA
Sbjct  2    QAERLIRSLNLSPKKAVNLDVSHGEAVA----PRMIEKSLEFPFLDGSSGTSIQDLGHHA  57

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GYF++ HS  ARMFYFFFESR  KKD PVV+WLTGGPGC SE+ALF+ENGPF + +NL+L
Sbjct  58   GYFRLAHSIDARMFYFFFESRHSKKD-PVVVWLTGGPGCGSEVALFYENGPFHVRDNLTL  116



>ref|XP_009395427.1| PREDICTED: serine carboxypeptidase-like [Musa acuminata subsp. 
malaccensis]
Length=500

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 2/128 (2%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVS  349
             P  + F + QAE+LIR LNL PKE +      +  A     +LVEK  +FP L+    S
Sbjct  27   LPEGANFPAPQAERLIRGLNLVPKE-ICADAGSAAGAGAGAGRLVEKRVRFPGLSGGGPS  85

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            VE+LGHHAGY+++ HS+AARMFY FFESR  KK DPVVIWLTGGPGCS ELALF+ENGPF
Sbjct  86   VEELGHHAGYYRLPHSHAARMFYLFFESRHNKK-DPVVIWLTGGPGCSGELALFYENGPF  144

Query  530  KIANNLSL  553
             +  ++SL
Sbjct  145  SVTEHMSL  152



>ref|NP_001146351.1| uncharacterized protein LOC100279929 precursor [Zea mays]
 gb|ACL53752.1| unknown [Zea mays]
 gb|AFW69788.1| hypothetical protein ZEAMMB73_192167 [Zea mays]
Length=516

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 91/130 (70%), Gaps = 5/130 (4%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-KLVEKLFKFPNLADPTV  346
             P ++ F +AQAE+LIR LNL PKE       G        P +L+E+  + P       
Sbjct  39   LPRDATFPAAQAERLIRALNLLPKEKEAGPAAGGGDGPSVAPGELLERRVRLPG---APA  95

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESR-RGKKDDPVVIWLTGGPGCSSELALFFENG  523
             V DLGHHAGYF++ H++ ARMFYFFFESR + K+DDPVVIWLTGGPGCSSELA+F+ENG
Sbjct  96   GVGDLGHHAGYFRLPHTHDARMFYFFFESRGKKKEDDPVVIWLTGGPGCSSELAVFYENG  155

Query  524  PFKIANNLSL  553
            PF IANN+SL
Sbjct  156  PFTIANNMSL  165



>ref|XP_008385518.1| PREDICTED: serine carboxypeptidase-like [Malus domestica]
Length=522

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 91/124 (73%), Gaps = 4/124 (3%)
 Frame = +2

Query  191  ASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQ--GPKLVEKLFKFPNL-ADPTVSVEDL  361
            A  QAEK IR LNLFPK+ +N +P   L  AE   G K+VEK F+ P L A    SV++L
Sbjct  46   AKRQAEKFIRALNLFPKDDINTLPHRPLLDAESDAGAKIVEKQFQMPFLDAALGPSVKEL  105

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
            GHHAGY+++  S AA MFY FFESR   K++PVVIWLTGGPGCSSELALF+ENGPF+I  
Sbjct  106  GHHAGYYRLPRSNAASMFYLFFESRT-NKNNPVVIWLTGGPGCSSELALFYENGPFRIQK  164

Query  542  NLSL  553
            NLSL
Sbjct  165  NLSL  168



>gb|KHN21489.1| Serine carboxypeptidase-like 48 [Glycine soja]
Length=492

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 95/130 (73%), Gaps = 10/130 (8%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGS---LSAAEQGPKLVEKLFKFPNLADPT-  343
            SN    S+ AEKLIR LNLFPK+ +N + +     +S +     +VEK F FP LA  + 
Sbjct  21   SNDLRFSSTAEKLIRGLNLFPKDPINTLKKNDPLFVSGS-----IVEKRFTFPTLAASSE  75

Query  344  VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENG  523
             S+E+LGHHAGY+++  S AARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENG
Sbjct  76   SSIEELGHHAGYYRLPRSKAARMFYFFFESR-SSKNDPVVIWLTGGPGCSSELALFYENG  134

Query  524  PFKIANNLSL  553
            PF++  NLSL
Sbjct  135  PFQLTKNLSL  144



>ref|XP_003543449.1| PREDICTED: serine carboxypeptidase-like 48-like [Glycine max]
Length=506

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 95/130 (73%), Gaps = 10/130 (8%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGS---LSAAEQGPKLVEKLFKFPNLADPT-  343
            SN    S+ AEKLIR LNLFPK+ +N + +     +S +     +VEK F FP LA  + 
Sbjct  35   SNDLRFSSTAEKLIRGLNLFPKDPINTLKKNDPLFVSGS-----IVEKRFTFPTLAASSE  89

Query  344  VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENG  523
             S+E+LGHHAGY+++  S AARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENG
Sbjct  90   SSIEELGHHAGYYRLPRSKAARMFYFFFESR-SSKNDPVVIWLTGGPGCSSELALFYENG  148

Query  524  PFKIANNLSL  553
            PF++  NLSL
Sbjct  149  PFQLTKNLSL  158



>ref|XP_007138863.1| hypothetical protein PHAVU_009G243900g [Phaseolus vulgaris]
 gb|ESW10857.1| hypothetical protein PHAVU_009G243900g [Phaseolus vulgaris]
Length=498

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 88/120 (73%), Gaps = 11/120 (9%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIV---PRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHA  373
            A+KLIR  NLFPK  +N V   P+  +S      ++VEK F F  LAD   S++DLGHHA
Sbjct  44   AQKLIRSFNLFPKYPINTVKDDPQAFVSG-----RIVEKKFSF--LADSEPSIQDLGHHA  96

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GY+ +  S AARMFYFFFESR   KDDPVVIWLTGGPGC SELALF+ENGPF IANNLSL
Sbjct  97   GYYSLPSSKAARMFYFFFESRN-SKDDPVVIWLTGGPGCGSELALFYENGPFHIANNLSL  155



>ref|XP_003538168.1| PREDICTED: serine carboxypeptidase-like 48-like [Glycine max]
 gb|KHN38715.1| Serine carboxypeptidase-like 48 [Glycine soja]
Length=488

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 89/119 (75%), Gaps = 5/119 (4%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAG  376
            +QAE L R LNLFPK+ VNI+ +G   +   G K+VEK F     + P  S++ LGHHAG
Sbjct  37   SQAEMLTRNLNLFPKDPVNII-KGDFDSFVPG-KIVEKKFSLLGHSGP--SIQHLGHHAG  92

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            ++ + HS AARMFYFFFESR   KDDPVVIWLTGGPGC SELALF+ENGPF IANNLSL
Sbjct  93   HYSLPHSKAARMFYFFFESRN-NKDDPVVIWLTGGPGCGSELALFYENGPFHIANNLSL  150



>ref|XP_010906753.1| PREDICTED: serine carboxypeptidase-like [Elaeis guineensis]
Length=508

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 94/129 (73%), Gaps = 6/129 (5%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQ-GPKLVEKLFKFPNLADPTV  346
            FPS++ F SA AEKLIR LNL PK+     P  + +AA+    ++VE+ F    L    V
Sbjct  35   FPSSATFPSAHAEKLIRALNLVPKDPS---PEPAEAAADVPAKRIVERRFSLAGLTG-GV  90

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            SVEDLGH+AGYF + H++ ARMFY FFESR   KD PVVIWLTGGPGCSSELA+F+ENGP
Sbjct  91   SVEDLGHYAGYFSLPHTHDARMFYLFFESRNSNKD-PVVIWLTGGPGCSSELAVFYENGP  149

Query  527  FKIANNLSL  553
            F IA+N++L
Sbjct  150  FTIADNMTL  158



>sp|P21529.2|CBP3_HORVU RecName: Full=Serine carboxypeptidase 3; AltName: Full=CP-MIII; 
AltName: Full=Serine carboxypeptidase III; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA70817.1| serine carboxypeptidase III, CP-MIII [Hordeum vulgare subsp. 
vulgare]
Length=508

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 93/132 (70%), Gaps = 9/132 (7%)
 Frame = +2

Query  173  PSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-----KLVEKLFKFPNLAD  337
            P ++ F  AQAE+LIR LNL PK+S +   R      E        +L+E+    P L +
Sbjct  27   PPDASFPGAQAERLIRALNLLPKDSSSSSGRHGARVGEGNEDVAPGQLLERRVTLPGLPE  86

Query  338  PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
                V DLGHHAGY+++ +++ ARMFYFFFESR GKK+DPVVIWLTGGPGCSSELA+F+E
Sbjct  87   ---GVADLGHHAGYYRLPNTHDARMFYFFFESR-GKKEDPVVIWLTGGPGCSSELAVFYE  142

Query  518  NGPFKIANNLSL  553
            NGPF IANN+SL
Sbjct  143  NGPFTIANNMSL  154



>gb|AFK46969.1| unknown [Lotus japonicus]
Length=498

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 6/119 (5%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-KLVEKLFKFPNLADPTVSVEDLGHHAG  376
            QAE+LIR  NLFP+++VNI  R      E  P K+VEK F F  L D   SVE+LGHHAG
Sbjct  48   QAERLIRSFNLFPRDTVNI--RLDDENDEFIPGKIVEKKFSF--LGDSGPSVEELGHHAG  103

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            Y+ + HS AARMFY FFESR   KDDPVVIWLTGGPGC SELALF+ENGPF I +NLSL
Sbjct  104  YYSLPHSKAARMFYLFFESRN-SKDDPVVIWLTGGPGCGSELALFYENGPFHITSNLSL  161



>ref|XP_003570803.1| PREDICTED: serine carboxypeptidase 3 [Brachypodium distachyon]
Length=510

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 92/130 (71%), Gaps = 6/130 (5%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP--KLVEKLFKFPNLADPT  343
             P ++ F +AQAE+LIR LNL P  +        L A E     +L+E+    P L D  
Sbjct  33   LPRDASFPAAQAERLIRALNLLPNGAGPTGGGLGLDAPEAVAPGELLERRVTLPGLPD--  90

Query  344  VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENG  523
              V DLGHHAGY+++ +++ ARMFYFFFESR GKK+DPVVIWLTGGPGCSSELA+F+ENG
Sbjct  91   -GVGDLGHHAGYYRLPNTHDARMFYFFFESR-GKKEDPVVIWLTGGPGCSSELAVFYENG  148

Query  524  PFKIANNLSL  553
            PF IANN+SL
Sbjct  149  PFTIANNMSL  158



>ref|XP_004250970.1| PREDICTED: serine carboxypeptidase-like [Solanum lycopersicum]
Length=499

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 86/123 (70%), Gaps = 4/123 (3%)
 Frame = +2

Query  185  RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLG  364
            +      EKLIR+LNLFPK  +NIV   S        KL EK      L D   +V+DLG
Sbjct  44   KLQLTMGEKLIRQLNLFPKHDINIV---SSKDNNYENKLFEKKLDLSYLGDSGATVQDLG  100

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            HHAGYF + ++ +ARMFYFFFESR   K+DPVVIWLTGGPGCSSELALF+ENGPFKI+ N
Sbjct  101  HHAGYFPLINTKSARMFYFFFESRS-NKNDPVVIWLTGGPGCSSELALFYENGPFKISKN  159

Query  545  LSL  553
            +SL
Sbjct  160  MSL  162



>ref|XP_010658340.1| PREDICTED: serine carboxypeptidase-like isoform X2 [Vitis vinifera]
Length=492

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = +2

Query  185  RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLG  364
            ++   + EKLIRELNLFPK++  +   G     E   KLVE+  +FP +     SV+DL 
Sbjct  19   KWNYMKREKLIRELNLFPKDAEAV--NGMDWEGESTKKLVERRLRFPGIDYSDASVKDLS  76

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
             HAGY+K++HS AARMFY FFESR  +KD PVVIWLTGGPGC SELALF+ENGPF IA N
Sbjct  77   QHAGYYKLRHSLAARMFYLFFESRDSRKD-PVVIWLTGGPGCGSELALFYENGPFTIAAN  135

Query  545  LSL  553
            +SL
Sbjct  136  MSL  138



>ref|NP_001045667.1| Os02g0114200 [Oryza sativa Japonica Group]
 sp|P37891.1|CBP3_ORYSJ RecName: Full=Serine carboxypeptidase 3; AltName: Full=Serine 
carboxypeptidase III; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA01757.1| serine carboxypeptidase III [Oryza sativa Japonica Group]
 dbj|BAD07926.1| Serine carboxypeptidase III precursor [Oryza sativa Japonica 
Group]
 dbj|BAD07648.1| Serine carboxypeptidase III precursor [Oryza sativa Japonica 
Group]
 dbj|BAF07581.1| Os02g0114200 [Oryza sativa Japonica Group]
 gb|EAY84186.1| hypothetical protein OsI_05564 [Oryza sativa Indica Group]
 gb|EAZ21483.1| hypothetical protein OsJ_05092 [Oryza sativa Japonica Group]
 dbj|BAG87715.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 94/129 (73%), Gaps = 8/129 (6%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-KLVEKLFKFPNLADPTV  346
             P +++F +AQAE+LIR LNL PKE+    P G+       P +L+E+    P L     
Sbjct  26   LPRDAKFPAAQAERLIRSLNLLPKEAG---PTGAGDVPSVAPGELLERRVTLPGLPQ---  79

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
             V DLGHHAGY+++ +++ ARMFYF FESR GKK+DPVVIWLTGGPGCSSELA+F+ENGP
Sbjct  80   GVGDLGHHAGYYRLPNTHDARMFYFLFESR-GKKEDPVVIWLTGGPGCSSELAVFYENGP  138

Query  527  FKIANNLSL  553
            F I+NN+SL
Sbjct  139  FTISNNMSL  147



>ref|XP_010658342.1| PREDICTED: serine carboxypeptidase-like isoform X3 [Vitis vinifera]
Length=476

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 85/117 (73%), Gaps = 3/117 (3%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGYF  382
             EKLIRELNLFPK++  +   G     E   KLVE+  +FP +     SV+DL  HAGY+
Sbjct  9    GEKLIRELNLFPKDAEAV--NGMDWEGESTKKLVERRLRFPGIDYSDASVKDLSQHAGYY  66

Query  383  KIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            K++HS AARMFY FFESR  +KD PVVIWLTGGPGC SELALF+ENGPF IA N+SL
Sbjct  67   KLRHSLAARMFYLFFESRDSRKD-PVVIWLTGGPGCGSELALFYENGPFTIAANMSL  122



>ref|XP_007143762.1| hypothetical protein PHAVU_007G099400g [Phaseolus vulgaris]
 gb|ESW15756.1| hypothetical protein PHAVU_007G099400g [Phaseolus vulgaris]
Length=495

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 89/115 (77%), Gaps = 7/115 (6%)
 Frame = +2

Query  215  IRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL--ADPTVSVEDLGHHAGYFKI  388
            IR+LNLFP + VNIV   +  A     K+VEK  +FPNL  +   VS+++L H AGY+ I
Sbjct  35   IRDLNLFPSQDVNIVHHPNCHAN----KVVEKPLRFPNLLPSHSGVSLDNLTHSAGYYPI  90

Query  389  QHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
             HS+AARMFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPFKIA+N+SL
Sbjct  91   VHSHAARMFYFFFESRNSKKD-PVVIWLTGGPGCSSELAVFYENGPFKIADNMSL  144



>gb|EMT06979.1| Serine carboxypeptidase 3 [Aegilops tauschii]
Length=529

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 92/129 (71%), Gaps = 5/129 (4%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-KLVEKLFKFPNLADPTV  346
             P ++ F  AQAE+LIR LNL P  S     +    A +  P +L+E+    P L +   
Sbjct  26   LPPDASFPGAQAERLIRALNLLPGASSGRGGKVGAGAEDVAPGQLLERRVTLPGLPE---  82

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
             V DLGHHAGY+++ +++ ARMFYFFFESR GKK+DPVVIWLTGGPGCSSELA+F+ENGP
Sbjct  83   GVSDLGHHAGYYRLPNTHDARMFYFFFESR-GKKEDPVVIWLTGGPGCSSELAVFYENGP  141

Query  527  FKIANNLSL  553
            F IANN+SL
Sbjct  142  FAIANNMSL  150



>ref|XP_002273251.1| PREDICTED: serine carboxypeptidase-like isoform X1 [Vitis vinifera]
 emb|CBI17152.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 87/120 (73%), Gaps = 6/120 (5%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPT-VSVEDLGHHA  373
             +AE+LIR LNL PK++VN+         E  P++VEK   FP L   +  SV+DLGH A
Sbjct  41   TEAERLIRSLNLSPKKAVNM----GFDHGEVAPRMVEKSLNFPFLEGSSGSSVQDLGHRA  96

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GYFK+ H+  ARMFYFFFESR G K DPVVIWLTGGPGCS +LALF+ENGPF I +NL+L
Sbjct  97   GYFKLAHTVDARMFYFFFESR-GSKKDPVVIWLTGGPGCSGQLALFYENGPFHITDNLTL  155



>ref|NP_197689.1| serine carboxypeptidase-like 47 [Arabidopsis thaliana]
 sp|Q9FFB0.1|SCP47_ARATH RecName: Full=Serine carboxypeptidase-like 47; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB10619.1| serine carboxypeptidase [Arabidopsis thaliana]
 gb|AED93104.1| serine carboxypeptidase-like 47 [Arabidopsis thaliana]
Length=505

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 97/134 (72%), Gaps = 10/134 (7%)
 Frame = +2

Query  167  LFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLA---D  337
            +F S+  F+S  AE+LI+  NL PK  VN++P+GSL A    P+L+E+   F   A   +
Sbjct  31   VFSSSLNFSSGNAERLIKSFNLMPKYDVNVIPKGSLDA----PRLIERQIDFLATAGSKN  86

Query  338  PTV--SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALF  511
             +V  SV++ GH+AGY+ + HS +A+MFYFFFESR  K  DPVVIWLTGGPGCSS +A+F
Sbjct  87   ASVGPSVQEFGHYAGYYSLPHSKSAKMFYFFFESRN-KTTDPVVIWLTGGPGCSSSVAMF  145

Query  512  FENGPFKIANNLSL  553
            +ENGPFKI+ +LSL
Sbjct  146  YENGPFKISKDLSL  159



>ref|XP_010541311.1| PREDICTED: serine carboxypeptidase-like 48 [Tarenaya hassleriana]
Length=508

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 90/132 (68%), Gaps = 9/132 (7%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVS  349
            F +++      AE+LIR  NL PK  VNIV   +      G +LVE+ F FP +     S
Sbjct  35   FLTSASLPKLSAERLIRSFNLLPKHDVNIVAGDT----PDGTRLVERQFNFPAVLSGGES  90

Query  350  ----VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
                V++ GHHAGY+++ HS AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+E
Sbjct  91   GGPSVKEFGHHAGYYRLPHSKAARMFYFFFESRSSKTD-PVVIWLTGGPGCSSELALFYE  149

Query  518  NGPFKIANNLSL  553
            NGPF I+NNLSL
Sbjct  150  NGPFTISNNLSL  161



>ref|XP_008805718.1| PREDICTED: serine carboxypeptidase-like [Phoenix dactylifera]
Length=508

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 6/129 (5%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPK-LVEKLFKFPNLADPTV  346
             PS++ F SA AEKLIR LNL PK++    P  + +A +   K ++E+ F    L    V
Sbjct  35   LPSSATFPSAHAEKLIRALNLLPKDAS---PEPAEAADDASAKRIIERRFNLAGLTG-GV  90

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            S E+LGHHAGY+++ H++ ARMFY FFESR  KKD PVVIWLTGGPGCSSELA+F+ENGP
Sbjct  91   SDEELGHHAGYYRLPHTHDARMFYLFFESRHSKKD-PVVIWLTGGPGCSSELAVFYENGP  149

Query  527  FKIANNLSL  553
            F IA+N+SL
Sbjct  150  FTIADNMSL  158



>ref|XP_002884793.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61052.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=543

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 97/153 (63%), Gaps = 30/153 (20%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSLS-AAEQGPKLVEKLFKFPN-LADPT-VSV  352
            S   S +AEKLIRELNLFP++ +N++    L   A +G  +VE+ F FPN LAD    +V
Sbjct  36   SNLPSTRAEKLIRELNLFPQQDLNVIDVADLPLTAAEGSGIVERKFVFPNILADNGGATV  95

Query  353  EDLGHHAGYFKIQHSYAAR--------------------------MFYFFFESRRGKKDD  454
            EDLGHHAGY+K+  S  AR                          MFYFFFESR  KKD 
Sbjct  96   EDLGHHAGYYKLPKSRGARFISNSRFWFMHLYICVREDSASDLLCMFYFFFESRN-KKDA  154

Query  455  PVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            PVVIWLTGGPGCSSELA+F+ENGPFKI +N+SL
Sbjct  155  PVVIWLTGGPGCSSELAMFYENGPFKITSNMSL  187



>dbj|BAK05932.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93590.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 96/132 (73%), Gaps = 9/132 (7%)
 Frame = +2

Query  173  PSNSRFASAQAEKLIRELNLFPKESVNIVPR--GSLSAAEQG---PKLVEKLFKFPNLAD  337
            P ++ F  AQAE+LIR LNL PK+S +   R    + A ++     +L+E+    P L +
Sbjct  27   PPDASFPGAQAERLIRALNLLPKDSSSSSGRHGARVGAGKEDVAPGQLLERRVTLPGLPE  86

Query  338  PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFE  517
                V DLGHHAGY+++ +++ ARMFYFFFESR GKK+DPVVIWLTGGPGCSSELA+F+E
Sbjct  87   ---GVADLGHHAGYYRLPNTHDARMFYFFFESR-GKKEDPVVIWLTGGPGCSSELAVFYE  142

Query  518  NGPFKIANNLSL  553
            NGPF IANN+SL
Sbjct  143  NGPFTIANNMSL  154



>ref|XP_004487064.1| PREDICTED: serine carboxypeptidase-like 48-like [Cicer arietinum]
Length=502

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 87/123 (71%), Gaps = 14/123 (11%)
 Frame = +2

Query  191  ASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-----KLVEKLFKFPNLADPTVSVE  355
             ++ AEKLIR +NLFPK+S+N+         E  P      +VEK F FP   D + S E
Sbjct  35   TASLAEKLIRGMNLFPKDSINL--------PENDPHFVHGNIVEKKFTFPGFDDTSASAE  86

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            +LGHHAGY+++ +S AARMFYFFFESR   KDDPVVIWLTGGPGCSSELALF+ENGPF+ 
Sbjct  87   ELGHHAGYYRLPNSKAARMFYFFFESRN-NKDDPVVIWLTGGPGCSSELALFYENGPFQF  145

Query  536  ANN  544
              N
Sbjct  146  TKN  148



>ref|XP_009785283.1| PREDICTED: serine carboxypeptidase-like [Nicotiana sylvestris]
Length=498

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVE  355
            S  +F    AEKLIR+LNLFPK  +N     + +  +   +  E+      + +   +V+
Sbjct  33   STPKFPLTMAEKLIRQLNLFPKHDIN----KAAATGDSEQRHFERKLNLSYVGNSGSTVQ  88

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            DLGHHAGY+++ H+  ARMFYFFFESR  +K+DPVVIWLTGGPGCSSELA+F+ENGPFKI
Sbjct  89   DLGHHAGYYRLPHTKDARMFYFFFESR-SRKNDPVVIWLTGGPGCSSELAVFYENGPFKI  147

Query  536  ANNLSL  553
            A+N+SL
Sbjct  148  ADNMSL  153



>sp|P11515.1|CBP3_WHEAT RecName: Full=Serine carboxypeptidase 3; AltName: Full=CP-WIII; 
AltName: Full=Serine carboxypeptidase III; Flags: Precursor 
[Triticum aestivum]
 gb|AAA34273.1| gibberellin responsive protein [Triticum aestivum]
Length=500

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 92/130 (71%), Gaps = 12/130 (9%)
 Frame = +2

Query  173  PSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQG---PKLVEKLFKFPNLADPT  343
            P ++ F  AQAE+LIR LNL P       PR  L A  +     +L+E+    P L +  
Sbjct  27   PPDASFPGAQAERLIRALNLLPGR-----PRRGLGAGAEDVAPGQLLERRVTLPGLPE--  79

Query  344  VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENG  523
              V DLGHHAGY+++ +++ ARMFYFFFESR GKK+DPVVIWLTGGPGCSSELA+F+ENG
Sbjct  80   -GVGDLGHHAGYYRLPNTHDARMFYFFFESR-GKKEDPVVIWLTGGPGCSSELAVFYENG  137

Query  524  PFKIANNLSL  553
            PF IANN+SL
Sbjct  138  PFTIANNMSL  147



>ref|XP_009150318.1| PREDICTED: serine carboxypeptidase-like 48 [Brassica rapa]
Length=509

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP---  340
            F S++   +  AE+LI+  NL P   VN++P        + P+LVE+ F  P   D    
Sbjct  35   FSSSASLPTLTAERLIKGFNLMPTRDVNVIPED----GSEAPRLVERNFDLPATIDRRDS  90

Query  341  --TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
              + S++D GHHAGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  91   GGSPSLQDFGHHAGYYKLPNSKAARMFYFFFESRSNKAD-PVVIWLTGGPGCSSELALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  150  ENGPFTVSNNSSL  162



>emb|CDX99171.1| BnaA06g18620D [Brassica napus]
Length=509

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP---  340
            F S++   +  AE+LI+  NL P   VN++P        + P+LVE+ F  P   D    
Sbjct  35   FSSSASLPTLTAERLIKGFNLMPTRDVNVIPED----GSEAPRLVERNFDLPATIDRRDS  90

Query  341  --TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
              + S++D GHHAGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  91   GGSPSLQDFGHHAGYYKLPNSKAARMFYFFFESRSNKAD-PVVIWLTGGPGCSSELALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  150  ENGPFTVSNNSSL  162



>emb|CDY31020.1| BnaC03g55150D [Brassica napus]
Length=509

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP---  340
            F S++   +  AE+LI+  NL P   VN++P        + P+LVE+ F  P   D    
Sbjct  35   FSSSASLPTLTAERLIKGFNLMPTRDVNVIPED----GSEAPRLVERNFDLPATIDRRDS  90

Query  341  --TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
              + S++D GHHAGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  91   GGSPSLQDFGHHAGYYKLPNSKAARMFYFFFESRSNKAD-PVVIWLTGGPGCSSELALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  150  ENGPFTVSNNSSL  162



>gb|KCW50683.1| hypothetical protein EUGRSUZ_J00369 [Eucalyptus grandis]
Length=484

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 88/122 (72%), Gaps = 14/122 (11%)
 Frame = +2

Query  194  SAQAEKLIRELNLFPKESVNIVPRG--SLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGH  367
            +AQAE LI+ LNL PKE+VNI  R   S S A  G K+VE+ F+ P          DLGH
Sbjct  37   TAQAEMLIKGLNLHPKEAVNIRTRDKDSSSLASDG-KIVERRFELP----------DLGH  85

Query  368  HAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNL  547
            HAGY+ + HS+AAR+FYFFF+SR    +DPVVIWLTGGPGCS  LALF+ENGPF IANNL
Sbjct  86   HAGYYPLPHSHAARIFYFFFDSRN-SANDPVVIWLTGGPGCSCSLALFYENGPFHIANNL  144

Query  548  SL  553
            SL
Sbjct  145  SL  146



>ref|XP_006648225.1| PREDICTED: serine carboxypeptidase 3-like [Oryza brachyantha]
Length=497

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 90/128 (70%), Gaps = 8/128 (6%)
 Frame = +2

Query  173  PSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGP-KLVEKLFKFPNLADPTVS  349
            P ++ F   QAE+LIR LNL PKE+    P G        P +L+E+    P L      
Sbjct  27   PRDASFPKTQAERLIRSLNLLPKEAG---PAGGGDVPSVAPGELLERRVTLPGLPQ---G  80

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
            V DLGHHAGY+++ +++ ARMFYF FESR GKK+DPVVIWLTGGPGCSSELA+F+ENGPF
Sbjct  81   VGDLGHHAGYYRLPNTHDARMFYFLFESR-GKKEDPVVIWLTGGPGCSSELAVFYENGPF  139

Query  530  KIANNLSL  553
             IANN+SL
Sbjct  140  TIANNMSL  147



>ref|XP_010503154.1| PREDICTED: serine carboxypeptidase-like 48 [Camelina sativa]
Length=510

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP---  340
            F  ++   +  AE+LI+  NL P   VN++ +       + P+LVE+ F F    DP   
Sbjct  35   FSPSASLPTLTAERLIKGFNLLPTHDVNVIDKD----GSEAPRLVEREFDFSAEVDPRGS  90

Query  341  --TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
              + SV+D GHHAGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  91   GGSPSVQDFGHHAGYYKLPNSKAARMFYFFFESRTNKAD-PVVIWLTGGPGCSSELALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  150  ENGPFTVSNNSSL  162



>ref|XP_004240167.1| PREDICTED: serine carboxypeptidase-like [Solanum lycopersicum]
Length=491

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 84/119 (71%), Gaps = 2/119 (2%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAG  376
              AEK I +LNLFPK  +NI+        +Q  +L EK      L     +V+DL HHAG
Sbjct  36   TMAEKFISQLNLFPKHDINIIVSSKDQIVDQ-QRLFEKKLILSYLGHSGATVQDLAHHAG  94

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            Y+ + H+ AARMFYFFFESR   K+DPVV+WLTGGPGCSSELALF+ENGPF+I++N+SL
Sbjct  95   YYHLLHTKAARMFYFFFESR-SNKNDPVVMWLTGGPGCSSELALFYENGPFQISHNMSL  152



>gb|KEH29969.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=494

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +2

Query  194  SAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHA  373
            + +AEKLIR LNLFPK  V ++   S+       K+VEK F F   +D  +S+++LGHHA
Sbjct  39   NQRAEKLIRSLNLFPKNPVKMIHGHSVLDDFVPGKIVEKKFSFFGHSD-GLSIDNLGHHA  97

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GY+ + HS AARMFY+FF+SR    DDPVVIWL GGPGCS  + LF+ENGPFKIANNLSL
Sbjct  98   GYYSLPHSKAARMFYYFFKSRNNTNDDPVVIWLAGGPGCSGAIPLFYENGPFKIANNLSL  157



>ref|XP_001786217.1| predicted protein [Physcomitrella patens]
 gb|EDQ48972.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 86/127 (68%), Gaps = 4/127 (3%)
 Frame = +2

Query  173  PSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSV  352
            P++SRF   QAE+LI+ LNL P  S        +     G +L E+        D  +S 
Sbjct  14   PTSSRFPQGQAERLIKALNLVPGAS----DGPGVDEMLGGARLQERRINLNIEGDAGIST  69

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            E+LG +AGYFK+  ++AA MFYFFFESR  K DDPVV+W+TGGPGC+SELALF+ENGPFK
Sbjct  70   EELGQYAGYFKLARTHAANMFYFFFESRGNKTDDPVVLWMTGGPGCASELALFYENGPFK  129

Query  533  IANNLSL  553
            I +NL+L
Sbjct  130  ITDNLTL  136



>tpg|DAA62687.1| TPA: hypothetical protein ZEAMMB73_228197 [Zea mays]
Length=264

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 91/133 (68%), Gaps = 6/133 (5%)
 Frame = +2

Query  170  FPSNS--RFASAQAEKLIRELNLFPKE-SVNIVPRGSLSAAEQGPKLVEKLFKFPNLAD-  337
             PS+S  RF  + A  LI  LNL P + S  +   G   A      LVE+  +  + A+ 
Sbjct  44   LPSSSPRRFPRSAAVDLIHALNLHPADASPPLSTAGVEGALAPAGTLVERPIRIASFANG  103

Query  338  -PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
                SVEDLGHHAGY+++ +++ ARMFYFFFESR G KDDPVVIWLTGGPGCSSELALF+
Sbjct  104  GAATSVEDLGHHAGYYRLANTHDARMFYFFFESR-GHKDDPVVIWLTGGPGCSSELALFY  162

Query  515  ENGPFKIANNLSL  553
            ENGPF IA+NLSL
Sbjct  163  ENGPFNIADNLSL  175



>ref|XP_010918615.1| PREDICTED: serine carboxypeptidase-like [Elaeis guineensis]
Length=503

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 93/129 (72%), Gaps = 6/129 (5%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKE-SVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTV  346
             PS++ F S  AE LIR LNL PK+ S   V   + + A+   ++VE+ F    L+   V
Sbjct  31   LPSSATFPSVHAETLIRSLNLLPKDPSPEPVAAAADAPAK---RIVERRFDLVGLSG-GV  86

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            SV+DLGHHAGY+++ HS+ ARMFY FFESR  KKD PVVIWLTGGPGCSSELA+F+ENGP
Sbjct  87   SVDDLGHHAGYYRLPHSHDARMFYLFFESRHSKKD-PVVIWLTGGPGCSSELAVFYENGP  145

Query  527  FKIANNLSL  553
            F IA N+SL
Sbjct  146  FTIAENMSL  154



>ref|NP_190087.1| serine carboxypeptidase-like 48 [Arabidopsis thaliana]
 sp|Q56WF8.2|SCP48_ARATH RecName: Full=Serine carboxypeptidase-like 48; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB89316.1| carboxypeptidase precursor-like protein [Arabidopsis thaliana]
 gb|AAK91443.1| AT3g45010/F14D17_80 [Arabidopsis thaliana]
 gb|AAM16254.1| AT3g45010/F14D17_80 [Arabidopsis thaliana]
 gb|AEE77979.1| serine carboxypeptidase-like 48 [Arabidopsis thaliana]
Length=510

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 88/133 (66%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLAD----  337
            F  ++   +  AE+LI+  NL P   VN++         + P+LVE+ F  P   D    
Sbjct  35   FSPSASLPTLTAERLIKGFNLMPTRDVNVIDE----EGSEAPRLVERAFDLPAAVDRRGS  90

Query  338  -PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
              + SV+D GHHAGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  91   GGSPSVQDFGHHAGYYKLPNSKAARMFYFFFESRTNKAD-PVVIWLTGGPGCSSELALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  150  ENGPFTVSNNSSL  162



>gb|AAL15270.1| AT3g45010/F14D17_80 [Arabidopsis thaliana]
Length=510

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 88/133 (66%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLAD----  337
            F  ++   +  AE+LI+  NL P   VN++         + P+LVE+ F  P   D    
Sbjct  35   FSPSASLPTLTAERLIKGFNLMPTRDVNVIDE----EGSEAPRLVERAFDLPAAVDRRGS  90

Query  338  -PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
              + SV+D GHHAGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  91   GGSPSVQDFGHHAGYYKLPNSKAARMFYFFFESRTNKAD-PVVIWLTGGPGCSSELALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  150  ENGPFTVSNNSSL  162



>ref|XP_009380664.1| PREDICTED: serine carboxypeptidase-like [Musa acuminata subsp. 
malaccensis]
Length=501

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 88/119 (74%), Gaps = 5/119 (4%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP--TVSVEDLGHHAG  376
            AE LIR+LNL P   +  +  G+ +     P+LVE+      L +    + VE LGHHAG
Sbjct  38   AESLIRDLNLLP--GIQELGAGTEADDPSSPRLVERRLDLRILGESGSEIPVEQLGHHAG  95

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            Y++++H++AA+MFYFFFESR G+  DPVVIWLTGGPGCSSELALF+ENGPFKIA+N+SL
Sbjct  96   YYRLEHTHAAKMFYFFFESR-GRSSDPVVIWLTGGPGCSSELALFYENGPFKIADNMSL  153



>gb|KFK33913.1| serine carboxypeptidase [Arabis alpina]
Length=509

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP---  340
            F  ++   +  AE+LI+  NL P   VN++         + P+LVE+ F  P   D    
Sbjct  35   FSPSASLPTLTAERLIKGFNLMPTLDVNVIAED----GSEAPRLVEREFDLPAEIDGRDS  90

Query  341  --TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
              + S++D GHHAGY+K+ +S AARMFYFFFESR  K  DPVVIWLTGGPGCSSELALF+
Sbjct  91   AGSPSLKDFGHHAGYYKLPNSKAARMFYFFFESRSNKATDPVVIWLTGGPGCSSELALFY  150

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  151  ENGPFTVSNNSSL  163



>ref|XP_002875707.1| hypothetical protein ARALYDRAFT_484895 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51966.1| hypothetical protein ARALYDRAFT_484895 [Arabidopsis lyrata subsp. 
lyrata]
Length=510

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 89/133 (67%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP---  340
            F  ++   +  AE+LI+  NL P   VN++         + P+LVE+ F+ P   D    
Sbjct  35   FSPSASLPTLTAERLIKGFNLMPTRDVNVIDED----GSEAPRLVEREFELPAEVDRRGS  90

Query  341  --TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
              + SV+D GHHAGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  91   GGSPSVQDFGHHAGYYKLPNSKAARMFYFFFESRTNKAD-PVVIWLTGGPGCSSELALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  150  ENGPFTVSNNSSL  162



>ref|XP_004506096.1| PREDICTED: serine carboxypeptidase-like 48-like [Cicer arietinum]
Length=496

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 87/119 (73%), Gaps = 6/119 (5%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTV-SVEDLGHHAG  376
            +AEKLI+ LNLFPK  VNIV     S      K+VEK F    L D    S+E+LGHHAG
Sbjct  45   RAEKLIKSLNLFPKNPVNIVNN---SIDFVPGKIVEKHFSI--LGDSYEPSIENLGHHAG  99

Query  377  YFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            Y+ +  S +ARMFYFFFESR+   DDP+VIWLTGGPGCSS+LALF+ENGPF I+++LSL
Sbjct  100  YYSLPRSKSARMFYFFFESRKNTSDDPIVIWLTGGPGCSSQLALFYENGPFHISDDLSL  158



>ref|XP_010514837.1| PREDICTED: serine carboxypeptidase-like 48 [Camelina sativa]
Length=510

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 89/133 (67%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP---  340
            F  ++   +  AE+LI+  NL P   VN++ +       + P+LVE+ F F    D    
Sbjct  35   FSPSASLPTLTAERLIKGFNLLPTRDVNVIDKD----GSEAPRLVEREFDFSAEVDRRGS  90

Query  341  --TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
              + SV+D GHHAGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  91   GGSPSVQDFGHHAGYYKLPNSKAARMFYFFFESRTNKAD-PVVIWLTGGPGCSSELALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  150  ENGPFTVSNNSSL  162



>ref|XP_006488021.1| PREDICTED: serine carboxypeptidase-like 48-like isoform X2 [Citrus 
sinensis]
Length=499

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 79/118 (67%), Gaps = 11/118 (9%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGY  379
            QAEKLIR LNLFPK SVN    G   A+   PKLVEK      L DP  SV++ GHHAGY
Sbjct  45   QAEKLIRGLNLFPKSSVNTAAAGD-HASVSAPKLVEKQLSLNPLGDPGPSVQEFGHHAGY  103

Query  380  FKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            + + HS          +S R  K DPVVIWLTGGPGCSSELALF+ENGPF IANNLSL
Sbjct  104  YTLPHS----------QSARNNKSDPVVIWLTGGPGCSSELALFYENGPFHIANNLSL  151



>ref|XP_003597270.1| Serine carboxypeptidase [Medicago truncatula]
Length=509

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 83/119 (70%), Gaps = 6/119 (5%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGYF  382
            +  LIR LNLFPK S+NI P            +VEK F FP   D   SVE+LGHHAGY+
Sbjct  43   SSTLIRGLNLFPKSSINI-PENDPHVLH--GNIVEKKFTFPGFDDSGYSVEELGHHAGYY  99

Query  383  KIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIA--NNLSL  553
             + HS AARMFYFFFESR   KDDPV+IWLTGGPGC SE+ALF+ENGPF+ +   NLSL
Sbjct  100  SLPHSKAARMFYFFFESRN-SKDDPVIIWLTGGPGCGSEIALFYENGPFQFSKDKNLSL  157



>gb|AES67521.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=508

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 83/119 (70%), Gaps = 6/119 (5%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGYF  382
            +  LIR LNLFPK S+NI P            +VEK F FP   D   SVE+LGHHAGY+
Sbjct  43   SSTLIRGLNLFPKSSINI-PENDPHVLH--GNIVEKKFTFPGFDDSGYSVEELGHHAGYY  99

Query  383  KIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIA--NNLSL  553
             + HS AARMFYFFFESR   KDDPV+IWLTGGPGC SE+ALF+ENGPF+ +   NLSL
Sbjct  100  SLPHSKAARMFYFFFESRN-SKDDPVIIWLTGGPGCGSEIALFYENGPFQFSKDKNLSL  157



>ref|XP_008784501.1| PREDICTED: serine carboxypeptidase-like isoform X2 [Phoenix dactylifera]
Length=498

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 90/120 (75%), Gaps = 7/120 (6%)
 Frame = +2

Query  203  AEKLIRELNLFPK-ESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP--TVSVEDLGHHA  373
            AE LIR+LNL P  + +    +G  S++   P+LVEK      L +    + +E LGHHA
Sbjct  44   AEDLIRDLNLQPVIQEIEGEQKGDDSSS---PRLVEKRINLEILGESGSDIPIEQLGHHA  100

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GY++++H++AA+MFYFFFESR GK  DPVVIWLTGGPGCSSELALF+ENGPFKIA+N+SL
Sbjct  101  GYYRLEHTHAAKMFYFFFESR-GKSSDPVVIWLTGGPGCSSELALFYENGPFKIADNMSL  159



>ref|XP_008784499.1| PREDICTED: serine carboxypeptidase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008784500.1| PREDICTED: serine carboxypeptidase-like isoform X1 [Phoenix dactylifera]
Length=507

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 90/120 (75%), Gaps = 7/120 (6%)
 Frame = +2

Query  203  AEKLIRELNLFPK-ESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP--TVSVEDLGHHA  373
            AE LIR+LNL P  + +    +G  S++   P+LVEK      L +    + +E LGHHA
Sbjct  44   AEDLIRDLNLQPVIQEIEGEQKGDDSSS---PRLVEKRINLEILGESGSDIPIEQLGHHA  100

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GY++++H++AA+MFYFFFESR GK  DPVVIWLTGGPGCSSELALF+ENGPFKIA+N+SL
Sbjct  101  GYYRLEHTHAAKMFYFFFESR-GKSSDPVVIWLTGGPGCSSELALFYENGPFKIADNMSL  159



>ref|XP_006419082.1| hypothetical protein EUTSA_v10002473mg [Eutrema salsugineum]
 gb|ESQ37518.1| hypothetical protein EUTSA_v10002473mg [Eutrema salsugineum]
Length=542

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 88/133 (66%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVS  349
            F S++   +  AE+LI+  NL P+  VN++         + P+LVE+ F  P   D   S
Sbjct  67   FSSSASLPTLTAERLIKGFNLMPQRDVNVISED----GSEAPRLVEREFDLPAALDRRDS  122

Query  350  -----VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
                 V+D GH AGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  123  SGLPSVQDFGHRAGYYKLPNSKAARMFYFFFESRTNKAD-PVVIWLTGGPGCSSELALFY  181

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  182  ENGPFTVSNNSSL  194



>dbj|BAJ34078.1| unnamed protein product [Thellungiella halophila]
Length=510

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 88/133 (66%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVS  349
            F S++   +  AE+LI+  NL P+  VN++         + P+LVE+ F  P   D   S
Sbjct  35   FSSSASLPTLTAERLIKGFNLMPQRDVNVISED----GSEAPRLVEREFDLPAALDRRDS  90

Query  350  -----VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
                 V+D GH AGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  91   SGLPSVQDFGHRAGYYKLPNSKAARMFYFFFESRTNKAD-PVVIWLTGGPGCSSELALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  150  ENGPFTVSNNSSL  162



>ref|XP_010535626.1| PREDICTED: serine carboxypeptidase-like 48 isoform X3 [Tarenaya 
hassleriana]
Length=475

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 83/122 (68%), Gaps = 10/122 (8%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL-----ADPTVSVEDLGH  367
            AEKLI+  NL P+  VNIVP        Q  +LVE+   FP       A    +V++ GH
Sbjct  48   AEKLIKSFNLMPERDVNIVPED----VAQSLRLVEREIDFPATFAGESAADVPTVKEYGH  103

Query  368  HAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNL  547
            HAGY+K+ HS AARMFY FFESR  K D PVVIWLTGGPGCSS+LALF+ENGPF I+ NL
Sbjct  104  HAGYYKLPHSKAARMFYLFFESRSNKTD-PVVIWLTGGPGCSSQLALFYENGPFNISKNL  162

Query  548  SL  553
            SL
Sbjct  163  SL  164



>ref|XP_010535623.1| PREDICTED: serine carboxypeptidase-like 48 isoform X1 [Tarenaya 
hassleriana]
Length=510

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 83/122 (68%), Gaps = 10/122 (8%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL-----ADPTVSVEDLGH  367
            AEKLI+  NL P+  VNIVP        Q  +LVE+   FP       A    +V++ GH
Sbjct  48   AEKLIKSFNLMPERDVNIVPED----VAQSLRLVEREIDFPATFAGESAADVPTVKEYGH  103

Query  368  HAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNL  547
            HAGY+K+ HS AARMFY FFESR  K D PVVIWLTGGPGCSS+LALF+ENGPF I+ NL
Sbjct  104  HAGYYKLPHSKAARMFYLFFESRSNKTD-PVVIWLTGGPGCSSQLALFYENGPFNISKNL  162

Query  548  SL  553
            SL
Sbjct  163  SL  164



>ref|XP_010535625.1| PREDICTED: serine carboxypeptidase-like 48 isoform X2 [Tarenaya 
hassleriana]
Length=509

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 83/122 (68%), Gaps = 10/122 (8%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL-----ADPTVSVEDLGH  367
            AEKLI+  NL P+  VNIVP        Q  +LVE+   FP       A    +V++ GH
Sbjct  48   AEKLIKSFNLMPERDVNIVPED----VAQSLRLVEREIDFPATFAGESAADVPTVKEYGH  103

Query  368  HAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNL  547
            HAGY+K+ HS AARMFY FFESR  K D PVVIWLTGGPGCSS+LALF+ENGPF I+ NL
Sbjct  104  HAGYYKLPHSKAARMFYLFFESRSNKTD-PVVIWLTGGPGCSSQLALFYENGPFNISKNL  162

Query  548  SL  553
            SL
Sbjct  163  SL  164



>gb|KEH41429.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=496

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 94/120 (78%), Gaps = 4/120 (3%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL--ADPTVSVEDLGHHA  373
            +A+KL+R+LNLFP  ++NI    + S++    K+VE    F NL   D  VSVED GH+A
Sbjct  28   EAKKLVRDLNLFPDVNLNIASSAANSSSRG--KIVENPLNFRNLISDDDDVSVEDFGHYA  85

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GY+ IQHS+AA+MFYFFFESR  K+DDPVVIWLTGGPGCSSELALF+ENGPFKI ++LSL
Sbjct  86   GYYPIQHSHAAKMFYFFFESRNHKEDDPVVIWLTGGPGCSSELALFYENGPFKIKDDLSL  145



>ref|XP_002872027.1| hypothetical protein ARALYDRAFT_489152 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48286.1| hypothetical protein ARALYDRAFT_489152 [Arabidopsis lyrata subsp. 
lyrata]
Length=508

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 87/123 (71%), Gaps = 10/123 (8%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL-----ADPTVSVEDLG  364
             AEKLI+  NL PK  VN++P+GS  A    P+L+E+   FP       A    SV++ G
Sbjct  45   NAEKLIKSFNLMPKYDVNVIPKGSPDA----PRLIERQIDFPATIGSQNASKGPSVQEFG  100

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            H+AGY+ + HS +A+MFYFFFESR  K  DPVVIWLTGGPGCSS +A+F+ENGPFK++ +
Sbjct  101  HYAGYYSLPHSKSAKMFYFFFESRN-KNTDPVVIWLTGGPGCSSSVAMFYENGPFKLSED  159

Query  545  LSL  553
            LSL
Sbjct  160  LSL  162



>ref|NP_001141041.1| uncharacterized protein LOC100273121 precursor [Zea mays]
 gb|ACF79445.1| unknown [Zea mays]
 gb|ACF85265.1| unknown [Zea mays]
 gb|ACF87906.1| unknown [Zea mays]
 gb|ACG46232.1| serine carboxypeptidase-like precursor [Zea mays]
Length=525

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 91/133 (68%), Gaps = 6/133 (5%)
 Frame = +2

Query  170  FPSNS--RFASAQAEKLIRELNLFPKE-SVNIVPRGSLSAAEQGPKLVEKLFKFPNLAD-  337
             PS+S  RF  + A  LI  LNL P + S  +   G   A      LVE+  +  + A+ 
Sbjct  44   LPSSSPRRFPRSAAVDLIHALNLHPADASPPLSTAGVEGALAPAGTLVERPIRIASFANG  103

Query  338  -PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
                SVEDLGHHAGY+++ +++ ARMFYFFFESR G KDDPVVIWLTGGPGCSSELALF+
Sbjct  104  GAATSVEDLGHHAGYYRLANTHDARMFYFFFESR-GHKDDPVVIWLTGGPGCSSELALFY  162

Query  515  ENGPFKIANNLSL  553
            ENGPF IA+NLSL
Sbjct  163  ENGPFNIADNLSL  175



>ref|XP_001772397.1| predicted protein [Physcomitrella patens]
 gb|EDQ62868.1| predicted protein [Physcomitrella patens]
Length=516

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 86/128 (67%), Gaps = 4/128 (3%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVS  349
            F ++S     QA++LI+ LNLFP    +++          G KL E+        D  VS
Sbjct  32   FATSSVDPQGQAQRLIKALNLFP----DVLSVSDGEEVFDGAKLQERRLNLDVGGDAGVS  87

Query  350  VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPF  529
             E+LG +AGYFK+  ++AA+MFYFFFESR  K DDPVV+W+TGGPGC+SELALF+ENGPF
Sbjct  88   TEELGQYAGYFKLARTHAAKMFYFFFESRGNKTDDPVVLWMTGGPGCASELALFYENGPF  147

Query  530  KIANNLSL  553
            KI +NL L
Sbjct  148  KITDNLIL  155



>ref|XP_006290935.1| hypothetical protein CARUB_v10017048mg [Capsella rubella]
 gb|EOA23833.1| hypothetical protein CARUB_v10017048mg [Capsella rubella]
Length=510

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 89/133 (67%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLAD----  337
            F  ++   +  AE+LI+  NL P   VN++   S     + P+LVE+ F F    D    
Sbjct  35   FSPSASLPTLTAERLIKGFNLLPTRDVNVIDVDS----SEAPRLVEREFDFSAEVDRRGS  90

Query  338  -PTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
              + SV++ GHHAGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  91   GGSPSVQEFGHHAGYYKLPNSKAARMFYFFFESRTNKAD-PVVIWLTGGPGCSSELALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  150  ENGPFTVSNNSSL  162



>ref|XP_010425935.1| PREDICTED: serine carboxypeptidase-like 48 [Camelina sativa]
Length=510

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 89/133 (67%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP---  340
            F  ++   +  AE+LI+  NL P   +N++ +       + P+LVE+ F F    D    
Sbjct  35   FSPSASLPTLTAERLIKGFNLLPTRDINVIDKD----GSEAPRLVEREFDFSAEVDRRGS  90

Query  341  --TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
              + SV++ GHHAGY+K+ +S AARMFYFFFESR  K D PVVIWLTGGPGCSSELALF+
Sbjct  91   GGSPSVQEFGHHAGYYKLPNSKAARMFYFFFESRTNKAD-PVVIWLTGGPGCSSELALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF ++NN SL
Sbjct  150  ENGPFTVSNNSSL  162



>ref|XP_002462855.1| hypothetical protein SORBIDRAFT_02g033170 [Sorghum bicolor]
 gb|EER99376.1| hypothetical protein SORBIDRAFT_02g033170 [Sorghum bicolor]
Length=521

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 88/121 (73%), Gaps = 5/121 (4%)
 Frame = +2

Query  203  AEKLIRELNLFPKE----SVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHH  370
            A  LIR LNL P +    S      G+L++A    +   +L  F +  D + SVEDLGHH
Sbjct  52   AVDLIRALNLHPSDASPPSSTAGVEGALASAGTLVERPIRLAFFADAGDASTSVEDLGHH  111

Query  371  AGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLS  550
            AGY+++ +++ ARMFYFFFESR G++DDPVVIWLTGGPGCSSELALF+ENGPF IA+NLS
Sbjct  112  AGYYRLPNTHDARMFYFFFESR-GQEDDPVVIWLTGGPGCSSELALFYENGPFNIADNLS  170

Query  551  L  553
            L
Sbjct  171  L  171



>ref|XP_003560222.1| PREDICTED: serine carboxypeptidase-like [Brachypodium distachyon]
Length=519

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 10/126 (8%)
 Frame = +2

Query  194  SAQAEKLIRELNLFPKESVNIVPRGSLSA-AEQGPKLVEKLFKFPNLADPT-----VSVE  355
            SA AE LIR LNL P++S+   PR S S  A     LVE+     +L   T      SV 
Sbjct  48   SAGAE-LIRALNLHPRDSL---PRRSGSGDALPAGTLVERPIHLASLVAGTDDAGDTSVS  103

Query  356  DLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            +LGHHAGY+++ +++ AR+FYFFFESRR KK+DPVVIWLTGGPGCSSELALF+ENGPF I
Sbjct  104  NLGHHAGYYRLANTHDARLFYFFFESRRHKKEDPVVIWLTGGPGCSSELALFYENGPFHI  163

Query  536  ANNLSL  553
            A+N+SL
Sbjct  164  ADNMSL  169



>ref|XP_004506061.1| PREDICTED: serine carboxypeptidase-like 48-like isoform X2 [Cicer 
arietinum]
Length=496

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 90/131 (69%), Gaps = 7/131 (5%)
 Frame = +2

Query  167  LFPSNSRFASAQ-AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKF-PNLADP  340
            LF     F+  Q AEKLI+ LNLFPK   NIV     S      K+VEK F F    ++P
Sbjct  33   LFRKTPTFSPNQRAEKLIKSLNLFPKNPANIVNN---SIDFVPGKIVEKKFSFLSGSSEP  89

Query  341  TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
              S+E+LGHHAGY+ +  S ++R+FYFFFESR   +DDPVVIWLTGGPGCS  LALF+EN
Sbjct  90   --SIENLGHHAGYYSLPRSNSSRLFYFFFESRNSTRDDPVVIWLTGGPGCSGNLALFYEN  147

Query  521  GPFKIANNLSL  553
            GPF I+N+LSL
Sbjct  148  GPFHISNDLSL  158



>ref|XP_004506060.1| PREDICTED: serine carboxypeptidase-like 48-like isoform X1 [Cicer 
arietinum]
Length=497

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 90/131 (69%), Gaps = 7/131 (5%)
 Frame = +2

Query  167  LFPSNSRFASAQ-AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKF-PNLADP  340
            LF     F+  Q AEKLI+ LNLFPK   NIV     S      K+VEK F F    ++P
Sbjct  33   LFRKTPTFSPNQRAEKLIKSLNLFPKNPANIVNN---SIDFVPGKIVEKKFSFLSGSSEP  89

Query  341  TVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
              S+E+LGHHAGY+ +  S ++R+FYFFFESR   +DDPVVIWLTGGPGCS  LALF+EN
Sbjct  90   --SIENLGHHAGYYSLPRSNSSRLFYFFFESRNSTRDDPVVIWLTGGPGCSGNLALFYEN  147

Query  521  GPFKIANNLSL  553
            GPF I+N+LSL
Sbjct  148  GPFHISNDLSL  158



>ref|XP_010920652.1| PREDICTED: serine carboxypeptidase-like [Elaeis guineensis]
Length=523

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 89/120 (74%), Gaps = 7/120 (6%)
 Frame = +2

Query  203  AEKLIRELNLFPK-ESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP--TVSVEDLGHHA  373
            AE LIR+LNL P  + +    +G   ++   P+LVEK      L +    + +E LGHHA
Sbjct  60   AEDLIRDLNLQPVIQEIEGEQKGDDFSS---PRLVEKRLNLEILGESGSEIPIEQLGHHA  116

Query  374  GYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            GY++++H++AA+MFYFFFESR GK  DPVVIWLTGGPGCSSELALF+ENGPFKIA+N+SL
Sbjct  117  GYYRLEHTHAAKMFYFFFESR-GKSSDPVVIWLTGGPGCSSELALFYENGPFKIADNMSL  175



>ref|XP_002960122.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ37661.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=509

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 87/127 (69%), Gaps = 17/127 (13%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKL---VEKLFK------FPNLADPTVSV  352
            QAE++IR +NL P            SA +  P+L   VE+L +          ++  V+V
Sbjct  35   QAEQMIRAMNLLPHVDD--------SAEDSSPELEMSVERLVERRVELGIKGDSESEVTV  86

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            EDLGHHAGYFK++ +++ARMFYFFFESRR +  DP+V+W+TGGPGC SE+ALF+ENGPF 
Sbjct  87   EDLGHHAGYFKLEGTHSARMFYFFFESRRNRSKDPLVLWMTGGPGCGSEVALFYENGPFH  146

Query  533  IANNLSL  553
            IA NLSL
Sbjct  147  IAKNLSL  153



>ref|XP_006400808.1| hypothetical protein EUTSA_v10013297mg [Eutrema salsugineum]
 gb|ESQ42261.1| hypothetical protein EUTSA_v10013297mg [Eutrema salsugineum]
Length=508

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 90/134 (67%), Gaps = 10/134 (7%)
 Frame = +2

Query  167  LFPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFP-----NL  331
            +F S +  +   AE+LI+  NL P+ +VN++P+GS  A    P+LVE  F F        
Sbjct  34   VFSSPASLSIQNAERLIKSFNLMPQHNVNLIPKGSSDA----PRLVESQFDFSASILAGN  89

Query  332  ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALF  511
            A    SV++ GH+AGY+ + HS +A+MFYFFFESR     DPVVIWL+GGPGCSS +ALF
Sbjct  90   ASGGPSVQEFGHYAGYYALPHSKSAKMFYFFFESRN-NSSDPVVIWLSGGPGCSSSVALF  148

Query  512  FENGPFKIANNLSL  553
            +ENGPF I+ +LSL
Sbjct  149  YENGPFTISEDLSL  162



>emb|CDY09183.1| BnaA02g06090D [Brassica napus]
Length=504

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 87/133 (65%), Gaps = 10/133 (8%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL-----A  334
            F S++   S  AE+LIR  NL P+  VN++ +GS      GP+LVE    F  +      
Sbjct  32   FSSSASLPSGNAERLIRSFNLMPEHDVNVIAKGS----PDGPRLVESQINFQEMIGMRNT  87

Query  335  DPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
                SV++ GH+AGY+ +  S +A+MFYFFFESR    D PVVIWL+GGPGCSS +ALF+
Sbjct  88   SGGPSVQEFGHYAGYYSLTRSKSAKMFYFFFESRTNNTD-PVVIWLSGGPGCSSSVALFY  146

Query  515  ENGPFKIANNLSL  553
            ENGPF I+++LSL
Sbjct  147  ENGPFTISDDLSL  159



>gb|AES67519.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=483

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGYF  382
            +  LIR LNLFPK S+NI     L        +VEK F FP   DP  SVE+LGHHAGY+
Sbjct  43   SSTLIRGLNLFPKSSINIPENDPLVLYRN---IVEKKFTFPGFDDPGYSVEELGHHAGYY  99

Query  383  KIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIA--NNLSL  553
             +  S+   MFYFFFESR   KDDPVVIWLTGGPGC SE+ALF+ENGPF+ +   NLSL
Sbjct  100  SLLRSW---MFYFFFESRN-SKDDPVVIWLTGGPGCGSEIALFYENGPFQFSKDKNLSL  154



>ref|XP_007132321.1| hypothetical protein PHAVU_011G084900g [Phaseolus vulgaris]
 gb|ESW04315.1| hypothetical protein PHAVU_011G084900g [Phaseolus vulgaris]
Length=488

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 86/121 (71%), Gaps = 9/121 (7%)
 Frame = +2

Query  191  ASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHH  370
            +SA + +LI    L PKE VN + +G  +    G K+VEK F F    D    VEDLGHH
Sbjct  24   SSAISHRLI----LDPKEPVNTI-KGDYAGFVPG-KIVEKKFSF--FGDSGPPVEDLGHH  75

Query  371  AGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLS  550
            AGY+ + HS AARMFYFFFESR+  ++DPVVIWL+GGPGC SELALF+ENGPF I NNLS
Sbjct  76   AGYYSLPHSKAARMFYFFFESRK-SRNDPVVIWLSGGPGCGSELALFYENGPFHITNNLS  134

Query  551  L  553
            L
Sbjct  135  L  135



>ref|XP_003597268.1| Serine carboxypeptidase [Medicago truncatula]
Length=531

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGYF  382
            +  LIR LNLFPK S+NI     L        +VEK F FP   DP  SVE+LGHHAGY+
Sbjct  43   SSTLIRGLNLFPKSSINIPENDPLVLYRN---IVEKKFTFPGFDDPGYSVEELGHHAGYY  99

Query  383  KIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIA--NNLSL  553
             +  S+   MFYFFFESR   KDDPVVIWLTGGPGC SE+ALF+ENGPF+ +   NLSL
Sbjct  100  SLLRSW---MFYFFFESRN-SKDDPVVIWLTGGPGCGSEIALFYENGPFQFSKDKNLSL  154



>gb|KEH29964.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 82/116 (71%), Gaps = 4/116 (3%)
 Frame = +2

Query  206  EKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGYFK  385
            EKL+R  NL PK+ VN++  G+ S      K+VEK F F +  + T   E+L HH GY+ 
Sbjct  40   EKLVRSFNLSPKDPVNLI-HGNQSFDYFPGKIVEKKFSFLSNTNET---ENLNHHFGYYS  95

Query  386  IQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            I  +  ARMFYFFFESR   KDDPVVIWLTGGPGC SELALF+ENGPF IA++LSL
Sbjct  96   IPRALGARMFYFFFESRDTPKDDPVVIWLTGGPGCGSELALFYENGPFHIADDLSL  151



>ref|XP_002984019.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ15031.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=509

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 86/127 (68%), Gaps = 17/127 (13%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKL---VEKLFK------FPNLADPTVSV  352
            QAE++IR +NL P            SA +  P+L   VE+L +          ++  V+V
Sbjct  35   QAEQMIRAMNLLPHVDD--------SAEDSSPELEMSVERLVERRVELGIKGDSESEVTV  86

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            EDLGHHAGYFK++ +++ARMFYFFFESR  +  DP+V+W+TGGPGC SE+ALF+ENGPF 
Sbjct  87   EDLGHHAGYFKLEGTHSARMFYFFFESRGNRSKDPLVLWMTGGPGCGSEVALFYENGPFH  146

Query  533  IANNLSL  553
            IA NLSL
Sbjct  147  IAKNLSL  153



>ref|XP_004957681.1| PREDICTED: serine carboxypeptidase-like [Setaria italica]
Length=520

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 88/129 (68%), Gaps = 8/129 (6%)
 Frame = +2

Query  185  RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLA------DPTV  346
            R   + A  LIR LNL P ++ +  P    +A      LVE+  +  +LA          
Sbjct  46   RLPRSAAVDLIRALNLHPADA-SPRPATPGAAPAPAGTLVERPIRLASLAAGGGVASEGT  104

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            SV+DLGHHAGY+++ +++ ARMFYFFFESR G KDDPVVIWLTGGPGCSSELALF+ENGP
Sbjct  105  SVKDLGHHAGYYRLPNTHDARMFYFFFESR-GHKDDPVVIWLTGGPGCSSELALFYENGP  163

Query  527  FKIANNLSL  553
            F IA+NLSL
Sbjct  164  FHIADNLSL  172



>ref|XP_006657694.1| PREDICTED: serine carboxypeptidase-like [Oryza brachyantha]
Length=523

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 87/131 (66%), Gaps = 6/131 (5%)
 Frame = +2

Query  179  NSRFASAQAEKLIRELNLFPKES-VNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVS--  349
             ++   + A  LI  LNL P+++  +   R +   A     LVE+      +A    S  
Sbjct  43   TTQLPRSAAVGLIHALNLHPRDADASPSRRSADDDAAPAGTLVERPIHLAAMATGGGSGG  102

Query  350  ---VEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
               V+DLGHHAGY+++ +++ ARMFYFFFESR  KKDDPVVIWLTGGPGCSSELALF+EN
Sbjct  103  GSSVKDLGHHAGYYRLPNTHDARMFYFFFESRGSKKDDPVVIWLTGGPGCSSELALFYEN  162

Query  521  GPFKIANNLSL  553
            GPF IA+N+SL
Sbjct  163  GPFHIADNMSL  173



>ref|XP_006400807.1| hypothetical protein EUTSA_v10015901mg [Eutrema salsugineum]
 gb|ESQ42260.1| hypothetical protein EUTSA_v10015901mg [Eutrema salsugineum]
Length=504

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 85/131 (65%), Gaps = 10/131 (8%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTV---  346
            S++   S  AE+LI+  NL PK  +N++P+GS  A     +LVE    F           
Sbjct  37   SSASLWSRNAERLIKSFNLMPKRDINVIPKGSHGAL----RLVESQRNFSATIGAVNTSS  92

Query  347  --SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFEN  520
              SV++ GH+AGY+ + HS +A+MFYFFFESR    D PVVIWL+GGPGCSS +ALF+EN
Sbjct  93   GPSVQEFGHYAGYYSLPHSKSAKMFYFFFESRNNSTD-PVVIWLSGGPGCSSSVALFYEN  151

Query  521  GPFKIANNLSL  553
            GPF I+ NLSL
Sbjct  152  GPFTISGNLSL  162



>gb|KDO35820.1| hypothetical protein CISIN_1g038976mg, partial [Citrus sinensis]
Length=220

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 64/70 (91%), Gaps = 1/70 (1%)
 Frame = +2

Query  344  VSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENG  523
            VSVEDLGHHAGY+K+ HS+ A+MFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+ENG
Sbjct  5    VSVEDLGHHAGYYKLPHSHDAKMFYFFFESRNSKKD-PVVIWLTGGPGCSSELAVFYENG  63

Query  524  PFKIANNLSL  553
            PF IA+N+SL
Sbjct  64   PFSIADNMSL  73



>ref|XP_010658343.1| PREDICTED: serine carboxypeptidase-like isoform X4 [Vitis vinifera]
 emb|CBI31399.3| unnamed protein product [Vitis vinifera]
Length=448

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +2

Query  281  AEQGPKLVEKLFKFPNLADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPV  460
             E   KLVE+  +FP +     SV+DL  HAGY+K++HS AARMFY FFESR  +KD PV
Sbjct  5    GESTKKLVERRLRFPGIDYSDASVKDLSQHAGYYKLRHSLAARMFYLFFESRDSRKD-PV  63

Query  461  VIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            VIWLTGGPGC SELALF+ENGPF IA N+SL
Sbjct  64   VIWLTGGPGCGSELALFYENGPFTIAANMSL  94



>ref|XP_009131902.1| PREDICTED: serine carboxypeptidase-like 47 [Brassica rapa]
 emb|CDX88773.1| BnaA03g08760D [Brassica napus]
Length=512

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 85/133 (64%), Gaps = 14/133 (11%)
 Frame = +2

Query  176  SNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFP-------NLA  334
            S++   S  AE+LI+  NL P   VN++ +GS       P+L+E    FP        + 
Sbjct  37   SSASLVSRNAERLIKSFNLMPDHDVNVIAKGSPDV----PRLIESQINFPETIGIRNTIG  92

Query  335  DPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
             P  SV+  GH+ GY+ + H+ +A+MFYFFFESR    D PVVIWL+GGPGCSS +ALF+
Sbjct  93   GP--SVQQFGHYGGYYSLTHTKSAKMFYFFFESRTNNTD-PVVIWLSGGPGCSSSVALFY  149

Query  515  ENGPFKIANNLSL  553
            ENGPF I+++LSL
Sbjct  150  ENGPFTISDDLSL  162



>gb|KCW50690.1| hypothetical protein EUGRSUZ_J003741, partial [Eucalyptus grandis]
Length=83

 Score =   117 bits (292),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +2

Query  329  LADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELAL  508
            L D   S++DLGHHAGY+ + HS+AARMFYFFFESR    +DPVVIW TGGPGCS  LAL
Sbjct  1    LGDSGSSIQDLGHHAGYYPLPHSHAARMFYFFFESRN-SANDPVVIWFTGGPGCSGSLAL  59

Query  509  FFENGPFKIANNLSL  553
            F+ENGPF IANNLSL
Sbjct  60   FYENGPFHIANNLSL  74



>ref|XP_010421096.1| PREDICTED: serine carboxypeptidase-like 47 [Camelina sativa]
Length=506

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 81/123 (66%), Gaps = 10/123 (8%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL-----ADPTVSVEDLG  364
             A+ LI   NL PK  VN++P+GS  A    P+LVE    FP            SV+  G
Sbjct  45   NAKMLISSFNLTPKYDVNVIPKGSPDA----PRLVESQIDFPTTFGVQNVSGGPSVQQFG  100

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            H+AGY+ + HS +A+MFYFFFESR    D PVVIWL+GGPGCSS +A+F+ENGPFKI+++
Sbjct  101  HYAGYYSLPHSKSAKMFYFFFESRNSSTD-PVVIWLSGGPGCSSSVAMFYENGPFKISDD  159

Query  545  LSL  553
             SL
Sbjct  160  FSL  162



>gb|EPS70311.1| hypothetical protein M569_04452, partial [Genlisea aurea]
Length=454

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 82/121 (68%), Gaps = 10/121 (8%)
 Frame = +2

Query  203  AEKLIRELNLFPKESVNIV----PRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDLGHH  370
            A KLI ELNLFPK+  N+V    P  + + +   P + EKL     LAD  V   DL HH
Sbjct  2    ALKLINELNLFPKQDANVVIDLIPDHNDAKSFSEP-ISEKLIS---LADSPVG--DLAHH  55

Query  371  AGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLS  550
            AGYF + ++  ARMFY+FFESR G + +PVV WLTGGPGCS  LALF+ENGPF+I +NLS
Sbjct  56   AGYFTLPNTTGARMFYYFFESRSGNRSEPVVAWLTGGPGCSGSLALFYENGPFQITSNLS  115

Query  551  L  553
            L
Sbjct  116  L  116



>ref|XP_009126578.1| PREDICTED: serine carboxypeptidase-like 47 [Brassica rapa]
Length=502

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = +2

Query  170  FPSNSRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL-----A  334
            F S++   S  AE+LIR  NL P+  VN++ +GS      GP+LVE    F  +      
Sbjct  32   FSSSASLPSGNAERLIRSFNLMPEHDVNVIAKGS----PDGPRLVESQINFQEMIGMRNT  87

Query  335  DPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
                SV++ GH+AGY+ +  S +A+MFYFFFESR    D   +IWL+GGPGCSS +ALF+
Sbjct  88   SGGPSVQEFGHYAGYYSLTRSKSAKMFYFFFESRTNNTD---LIWLSGGPGCSSSVALFY  144

Query  515  ENGPFKIANNLSL  553
            ENGPF I+++LSL
Sbjct  145  ENGPFTISDDLSL  157



>ref|NP_001059634.1| Os07g0479300 [Oryza sativa Japonica Group]
 dbj|BAF21548.1| Os07g0479300 [Oryza sativa Japonica Group]
 gb|EAZ39796.1| hypothetical protein OsJ_24236 [Oryza sativa Japonica Group]
Length=524

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTV---SVEDLGH  367
            + A  LIR LNL P+++ +  P            LVE+     ++A       S EDLGH
Sbjct  53   SAAVGLIRALNLHPRDA-SPSPSSRGDGDVPAGTLVERPIHLASMATGKSGGSSAEDLGH  111

Query  368  HAGYFKIQHSYAARMFYFFFESRRGK-KDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            HAGY+++ +++ AR+FYFFFESR  K +DDPVVIWLTGGPGCSSELALF+ENGPF IA+N
Sbjct  112  HAGYYRLPNTHDARLFYFFFESRGSKGEDDPVVIWLTGGPGCSSELALFYENGPFHIADN  171

Query  545  LSL  553
            +SL
Sbjct  172  MSL  174



>gb|EAZ03855.1| hypothetical protein OsI_25989 [Oryza sativa Indica Group]
Length=524

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = +2

Query  197  AQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTV---SVEDLGH  367
            + A  LIR LNL P+++ +  P            LVE+     ++A       S EDLGH
Sbjct  53   SAAVGLIRALNLHPRDA-SPSPSSRGDGDVPAGTLVERPIHLASMATGKSGGSSAEDLGH  111

Query  368  HAGYFKIQHSYAARMFYFFFESRRGK-KDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            HAGY+++ +++ AR+FYFFFESR  K +DDPVVIWLTGGPGCSSELALF+ENGPF IA+N
Sbjct  112  HAGYYRLPNTHDARLFYFFFESRGSKGEDDPVVIWLTGGPGCSSELALFYENGPFHIADN  171

Query  545  LSL  553
            +SL
Sbjct  172  MSL  174



>ref|XP_010493406.1| PREDICTED: serine carboxypeptidase-like 47 [Camelina sativa]
Length=505

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 81/123 (66%), Gaps = 10/123 (8%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFP-NLADPTVS----VEDLG  364
             A+ LI   NL P   VN++P+GS  A    P+L E    FP  L    VS    V+  G
Sbjct  44   NAKMLINSFNLTPMYDVNVIPKGSPDA----PRLFESQIDFPATLGVQNVSGGPSVQQFG  99

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            H+AGY+ + HS +A+MFYFFFESR    D PVVIWL+GGPGCSS +A+F+ENGPFKI+++
Sbjct  100  HYAGYYSLPHSKSAKMFYFFFESRNSSTD-PVVIWLSGGPGCSSSVAMFYENGPFKISDD  158

Query  545  LSL  553
             SL
Sbjct  159  FSL  161



>ref|XP_006400806.1| hypothetical protein EUTSA_v10013304mg [Eutrema salsugineum]
 gb|ESQ42259.1| hypothetical protein EUTSA_v10013304mg [Eutrema salsugineum]
Length=507

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 83/123 (67%), Gaps = 10/123 (8%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTV-----SVEDLG  364
             A++ I+  NL P+ +VN++P+GS  A    P+LVE  F F    D        SV + G
Sbjct  45   NADRRIQFFNLKPQHNVNVIPKGSPDA----PRLVESQFDFSASIDAGNAPGGPSVTEFG  100

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            H+AGY+ + HS AA+MFYFFFESR     DPVV+WL+GGPG SS LALF+ENGPFKI+ +
Sbjct  101  HYAGYYPLPHSKAAKMFYFFFESRS-NNSDPVVLWLSGGPGVSSSLALFYENGPFKISED  159

Query  545  LSL  553
            LSL
Sbjct  160  LSL  162



>ref|XP_006289997.1| hypothetical protein CARUB_v10003627mg [Capsella rubella]
 gb|EOA22895.1| hypothetical protein CARUB_v10003627mg [Capsella rubella]
Length=499

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 83/123 (67%), Gaps = 10/123 (8%)
 Frame = +2

Query  200  QAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNL-----ADPTVSVEDLG  364
             AE LI   NL P+ +VN++ +G+ +A    P+L E    F  +     A    SV++ G
Sbjct  45   NAESLINSFNLTPQYAVNVIQKGNPNA----PRLFESQIDFRAMFGDQNASGGPSVQEFG  100

Query  365  HHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
            H+AGY+ + HS +A+MFYFFFESR    D PVVIWL+GGPGCSS +A+F+ENGPFKI+++
Sbjct  101  HYAGYYSLPHSKSAKMFYFFFESRNNSAD-PVVIWLSGGPGCSSSIAMFYENGPFKISDD  159

Query  545  LSL  553
             SL
Sbjct  160  FSL  162



>ref|XP_004506097.1| PREDICTED: serine carboxypeptidase-like 48-like [Cicer arietinum]
Length=486

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 82/129 (64%), Gaps = 10/129 (8%)
 Frame = +2

Query  188  FASAQAEKLIRELNLF-------PKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTV  346
            F+S+ A   I    LF       P + VNI+   S+       K+VEK F F   +D   
Sbjct  19   FSSSDATSRIPHRQLFQKTPTFSPNQQVNIIHGDSVDFVPG--KMVEKNFSFLGGSDKP-  75

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGP  526
            S+E+LGHHAGY+ +  S +ARMFYFFFES+   +DDPVVIWLTGGPGCS E+ALF+ENGP
Sbjct  76   SIENLGHHAGYYSLPSSNSARMFYFFFESQNNTRDDPVVIWLTGGPGCSGEIALFYENGP  135

Query  527  FKIANNLSL  553
            F I++   L
Sbjct  136  FHISDKSQL  144



>dbj|BAA04511.1| serine carboxypeptidase-like protein [Oryza sativa Japonica Group]
Length=429

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGK-KDDPVVIWLTGGPGCSSELALFFENG  523
            S EDLGHHAGY+++ +++ AR+FYFFFESR  K +DDPVVIWLTGGPGCSSELALF+ENG
Sbjct  10   SAEDLGHHAGYYRLPNTHDARLFYFFFESRGSKGEDDPVVIWLTGGPGCSSELALFYENG  69

Query  524  PFKIANNLSL  553
            PF IA+N+SL
Sbjct  70   PFHIADNMSL  79



>sp|P52712.2|CBPX_ORYSJ RecName: Full=Serine carboxypeptidase-like; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAC45113.1| carboxypeptidase C cbp31 [Oryza sativa Japonica Group]
 dbj|BAD31260.1| carboxypeptidase C cbp31 [Oryza sativa Japonica Group]
Length=429

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 1/70 (1%)
 Frame = +2

Query  347  SVEDLGHHAGYFKIQHSYAARMFYFFFESRRGK-KDDPVVIWLTGGPGCSSELALFFENG  523
            S EDLGHHAGY+++ +++ AR+FYFFFESR  K +DDPVVIWLTGGPGCSSELALF+ENG
Sbjct  10   SAEDLGHHAGYYRLPNTHDARLFYFFFESRGSKGEDDPVVIWLTGGPGCSSELALFYENG  69

Query  524  PFKIANNLSL  553
            PF IA+N+SL
Sbjct  70   PFHIADNMSL  79



>gb|KFK27622.1| hypothetical protein AALP_AA8G407400, partial [Arabis alpina]
Length=227

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 6/96 (6%)
 Frame = +2

Query  281  AEQGPKLVEKLFKFPNL-----ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGK  445
            +   P+L E+ F FP +          S+++ GH+AGY+ + HS +A+MFYFFFESR  K
Sbjct  1    SHDAPRLFERQFDFPAIIGTGNVSNGPSIQEFGHYAGYYSLPHSKSAKMFYFFFESRS-K  59

Query  446  KDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
              DPVVIWL+GGPGCSS +ALF+ENGPF I+ +LSL
Sbjct  60   STDPVVIWLSGGPGCSSSVALFYENGPFTISKDLSL  95



>ref|XP_007208698.1| hypothetical protein PRUPE_ppa023575mg, partial [Prunus persica]
 gb|EMJ09897.1| hypothetical protein PRUPE_ppa023575mg, partial [Prunus persica]
Length=123

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 63/124 (51%), Gaps = 30/124 (24%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADPTVSVEDL  361
            S F S  A++LIR  NLFPKE +NI+   + S     P+LVE  F  PNL          
Sbjct  1    SSFPSVHAQELIRAFNLFPKEDINIIDGPNSSIFHDSPRLVENRFNLPNLVG--------  52

Query  362  GHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIAN  541
                                     R    DPVVIWL GGPGCSSELA+F+ENGPF IAN
Sbjct  53   ----------------------SGSRTNNKDPVVIWLIGGPGCSSELAVFYENGPFNIAN  90

Query  542  NLSL  553
            NLSL
Sbjct  91   NLSL  94



>ref|XP_001763185.1| predicted protein [Physcomitrella patens]
 gb|EDQ72062.1| predicted protein [Physcomitrella patens]
Length=512

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 77/131 (59%), Gaps = 9/131 (7%)
 Frame = +2

Query  164  DLFPSNS-RFASAQAEKLIRELNLFPKESVNIVPRGSLSAAEQGPKLVEKLFKFPNLADP  340
            +L P  S RF   QAE+LI+ L L P  +V        S    GP L E+  +     + 
Sbjct  38   NLSPGTSPRFPQGQAERLIKSLGLLPGAAVES------SGPVNGPGLHERKIQLDIFTNS  91

Query  341  TVSV--EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFF  514
            T +       H+AGYF ++ S+ A MFY FFESR  K  DP+V+ +TGGP C+SE+A+F+
Sbjct  92   TSASASRHAAHYAGYFTLKRSHTANMFYTFFESRGNKGMDPLVLLMTGGPACASEVAMFY  151

Query  515  ENGPFKIANNL  547
            ENGPFKI +N+
Sbjct  152  ENGPFKIQDNI  162



>ref|XP_002945957.1| hypothetical protein VOLCADRAFT_102913 [Volvox carteri f. nagariensis]
 gb|EFJ52952.1| hypothetical protein VOLCADRAFT_102913 [Volvox carteri f. nagariensis]
Length=600

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 65/96 (68%), Gaps = 6/96 (6%)
 Frame = +2

Query  269  SLSAAEQGPKLVEKLFKFPNLADP----TVSVEDLGHHAGYFKIQHSYAARMFYFFFESR  436
            ++S   QG +LVEK    P   DP    T  V+     AGYF++  ++ ARMFYFFF+SR
Sbjct  19   AVSTCGQGDRLVEKEIHLP--LDPRYADTPLVDPPKRIAGYFRLNRTHDARMFYFFFQSR  76

Query  437  RGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANN  544
               K DP+V+W+TGGPGCSSE+A+F+ENGP+ I N+
Sbjct  77   NAPKADPLVLWMTGGPGCSSEIAIFYENGPYFINND  112



>emb|CDX71025.1| BnaC03g11090D [Brassica napus]
Length=439

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  332  ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALF  511
            +DP  SV++L  HAGY+ ++HS  ARMFYFFFES+    D PVV+WLTGGPGCS  +ALF
Sbjct  26   SDP--SVDELARHAGYYTLEHSKPARMFYFFFESKNNVTD-PVVLWLTGGPGCSGSVALF  82

Query  512  FENGPFKIANNLSL  553
             ENGPF I+ NLSL
Sbjct  83   TENGPFAISENLSL  96



>emb|CDX88772.1| BnaA03g08770D [Brassica napus]
Length=500

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +2

Query  332  ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALF  511
            +DP  SV++L  HAGY+ ++HS  ARMFYFFFES+    D PVV+WLTGGPGCS  +ALF
Sbjct  87   SDP--SVDELARHAGYYTLEHSKPARMFYFFFESKNNVTD-PVVLWLTGGPGCSGSVALF  143

Query  512  FENGPFKIANNLSL  553
             ENGPF I+ NLSL
Sbjct  144  TENGPFAISENLSL  157



>ref|XP_003055284.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60536.1| predicted protein [Micromonas pusilla CCMP1545]
Length=498

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +2

Query  272  LSAAEQGPKLVEKLFKFPNLADPTVSV--EDLGHHAGYFKIQHSYAARMFYFFFESRRGK  445
            ++     P+L EK         PT S       H AGYF +  + AA MFYF+F SR   
Sbjct  1    MTTTRLSPRLFEKTLDLSAHLSPTASSPPTPFDHAAGYFALNRTRAAEMFYFYFRSRDAA  60

Query  446  KDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
             D PVV+W+TGGPGCSSE+ALF+ENGP++I ++L+L
Sbjct  61   ADAPVVLWMTGGPGCSSEIALFYENGPYRILDDLTL  96



>ref|XP_006407570.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
 gb|ESQ49023.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
Length=495

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 76/127 (60%), Gaps = 33/127 (26%)
 Frame = +2

Query  182  SRFASAQAEKLIRELNLFPKESVNIVPRG--SLSAAEQGPKLVEKLFKFPNL-ADPTVSV  352
            S   S++AEKLIRELNLFPK  VN++  G  +L++AE  P +VE+ F+FPN+ +D   +V
Sbjct  37   SSLPSSRAEKLIRELNLFPKLDVNVIDGGDSTLTSAEV-PSIVERNFRFPNIISDGGATV  95

Query  353  EDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFK  532
            EDLGHHAGY+K+  S  A                             SELA+F+ENGPFK
Sbjct  96   EDLGHHAGYYKLPKSQGA-----------------------------SELAMFYENGPFK  126

Query  533  IANNLSL  553
            IA N+SL
Sbjct  127  IAQNMSL  133



>gb|EMT11612.1| Serine carboxypeptidase-like protein [Aegilops tauschii]
Length=520

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  404  ARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
             R+FYFFFESRR KK+DPVVIWLTGGPGCSSELALF+ENGPF IA+N+SL
Sbjct  122  CRLFYFFFESRRHKKEDPVVIWLTGGPGCSSELALFYENGPFHIADNMSL  171



>ref|XP_010657851.1| PREDICTED: serine carboxypeptidase 3-like [Vitis vinifera]
Length=251

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 3/86 (3%)
 Frame = +2

Query  302  VEKLFKFPNL--ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLT  475
            +E   +FP +  +D +VSVEDL HHA  +KI+HS AARMFY FFE +  +K D VVIWL 
Sbjct  38   LETWLRFPGIDYSDASVSVEDLEHHADSYKIKHSGAARMFYLFFELQDSRK-DLVVIWLI  96

Query  476  GGPGCSSELALFFENGPFKIANNLSL  553
            GG G SSELA+F+EN  F IA NL L
Sbjct  97   GGLGHSSELAVFYENRLFTIAKNLPL  122



>ref|XP_001695303.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP01561.1| predicted protein [Chlamydomonas reinhardtii]
Length=571

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 58/97 (60%), Gaps = 16/97 (16%)
 Frame = +2

Query  275  SAAEQGPKLVEKLFKFP----------NLADPTVSVEDLGHHAGYFKIQHSYAARMFYFF  424
            S   Q  +LVEK   F            L DP   +      AGYFK+  ++ ARMFYF+
Sbjct  19   SVHAQSSRLVEKELNFAVHREHLEGDVPLIDPPKRI------AGYFKLNRTHDARMFYFY  72

Query  425  FESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKI  535
            F+SR     DPVV+W+TGGPGCSSE+A+FFENGP+ I
Sbjct  73   FQSRHNPATDPVVLWMTGGPGCSSEIAIFFENGPYSI  109



>gb|ACF85628.1| unknown [Zea mays]
Length=397

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 1/48 (2%)
 Frame = +2

Query  410  MFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            MFYFFFESR G KDDPVVIWLTGGPGCSSELALF+ENGPF IA+NLSL
Sbjct  1    MFYFFFESR-GHKDDPVVIWLTGGPGCSSELALFYENGPFNIADNLSL  47



>emb|CAN60574.1| hypothetical protein VITISV_013750 [Vitis vinifera]
Length=647

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 3/82 (4%)
 Frame = +2

Query  314  FKFPNL--ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPG  487
             +FP +  +D +VSVEDL HHA  +KI+HS AARMFY FFE +  +K D VVIWL GG G
Sbjct  124  LRFPGIDYSDASVSVEDLEHHADCYKIKHSGAARMFYLFFELQDSRK-DLVVIWLIGGLG  182

Query  488  CSSELALFFENGPFKIANNLSL  553
             SSELA+F+EN  F IA NL L
Sbjct  183  HSSELAVFYENRLFTIAKNLPL  204



>emb|CDY26973.1| BnaC09g36100D [Brassica napus]
Length=431

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  332  ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALF  511
            +DP +  E+LGHHAGY+ + ++ ++R+FYFFFESR    D PVVIWL+GGPGCSS   L 
Sbjct  27   SDPYL--EELGHHAGYYSLPNTKSSRLFYFFFESRNNITD-PVVIWLSGGPGCSSSFGLL  83

Query  512  FENGPFKIANNLSL  553
             ENGPF +  +LSL
Sbjct  84   TENGPFTLTEDLSL  97



>gb|ABR16556.1| unknown [Picea sitchensis]
Length=405

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  410  MFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            MFYFFFESR  K DDPVV+W+TGGPGCSSELA+F+ENGPFKI +NL+L
Sbjct  1    MFYFFFESRGSKADDPVVLWMTGGPGCSSELAVFYENGPFKITDNLTL  48



>ref|XP_009121241.1| PREDICTED: serine carboxypeptidase-like 47 [Brassica rapa]
Length=365

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 55/74 (74%), Gaps = 3/74 (4%)
 Frame = +2

Query  332  ADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGGPGCSSELALF  511
            +DP +  E+LGHHAGY+ + ++ ++R+FYFFFESR    D PVVIWL+GGPGCSS   L 
Sbjct  27   SDPYL--EELGHHAGYYSLPNAKSSRLFYFFFESRNNITD-PVVIWLSGGPGCSSSFGLL  83

Query  512  FENGPFKIANNLSL  553
             ENGPF +  +LSL
Sbjct  84   AENGPFTLNEDLSL  97



>gb|EMS57267.1| Serine carboxypeptidase-like protein [Triticum urartu]
Length=513

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +2

Query  302  VEKLFKFPNLADPTVSVEDLGHHAGYFKIQHSYAARMFYFFFESRRGKKDDPVVIWLTGG  481
            V++  +      P +  E          + H    R+FYFFFESRR  K+DPVVIWLTGG
Sbjct  81   VKRCLRLSLTGGPIIVAETGQKDLVAVSLPHFRQFRLFYFFFESRR-HKEDPVVIWLTGG  139

Query  482  PGCSSELALFFENGPFKIANNLSL  553
            PGCSSELALF+ENGPF IA+N+SL
Sbjct  140  PGCSSELALFYENGPFNIADNMSL  163



>ref|XP_006407572.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
 gb|ESQ49025.1| hypothetical protein EUTSA_v10020509mg [Eutrema salsugineum]
Length=409

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = +2

Query  410  MFYFFFESRRGKKDDPVVIWLTGGPGCSSELALFFENGPFKIANNLSL  553
            MFYFFFESR  KKD PVVIWLTGGPGCSSELA+F+ENGPFKIA N+SL
Sbjct  1    MFYFFFESRN-KKDAPVVIWLTGGPGCSSELAMFYENGPFKIAQNMSL  47



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760