BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L11

Length=522
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011080600.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    248   4e-78   Sesamum indicum [beniseed]
gb|ACU20171.1|  unknown                                                 242   7e-78   Glycine max [soybeans]
gb|KDO56335.1|  hypothetical protein CISIN_1g019907mg                   247   7e-78   Citrus sinensis [apfelsine]
ref|XP_007028579.1|  Ubiquitin carboxyl-terminal hydrolase isozym...    246   9e-78   Theobroma cacao [chocolate]
ref|XP_008389154.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    246   1e-77   
ref|XP_003556440.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    246   1e-77   Glycine max [soybeans]
ref|XP_009351569.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    246   1e-77   Pyrus x bretschneideri [bai li]
ref|XP_003536158.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    246   2e-77   Glycine max [soybeans]
ref|XP_010257774.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    246   2e-77   Nelumbo nucifera [Indian lotus]
ref|XP_004297418.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    246   2e-77   Fragaria vesca subsp. vesca
ref|XP_007143980.1|  hypothetical protein PHAVU_007G118800g             245   3e-77   Phaseolus vulgaris [French bean]
ref|XP_007222561.1|  hypothetical protein PRUPE_ppa008376mg             245   3e-77   Prunus persica
gb|AGV54688.1|  ubiquitin carboxyl-terminal hydrolase isozyme L5-...    245   3e-77   Phaseolus vulgaris [French bean]
ref|XP_008220928.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   4e-77   Prunus mume [ume]
ref|XP_006423934.1|  hypothetical protein CICLE_v10028809mg             245   4e-77   Citrus clementina [clementine]
ref|XP_008381769.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   4e-77   Malus domestica [apple tree]
emb|CBI37478.3|  unnamed protein product                                244   4e-77   Vitis vinifera
ref|XP_010927076.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   5e-77   Elaeis guineensis
ref|XP_006344362.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    245   5e-77   Solanum tuberosum [potatoes]
ref|XP_010274755.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    242   5e-77   Nelumbo nucifera [Indian lotus]
ref|XP_002262954.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   6e-77   Vitis vinifera
ref|XP_011089558.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    244   1e-76   Sesamum indicum [beniseed]
ref|XP_004246255.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   2e-76   Solanum lycopersicum
ref|XP_009764959.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    243   2e-76   Nicotiana sylvestris
gb|KEH42950.1|  ubiquitin carboxyl-terminal hydrolase family protein    243   2e-76   Medicago truncatula
gb|KJB19153.1|  hypothetical protein B456_003G086500                    243   3e-76   Gossypium raimondii
ref|XP_008794248.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    242   4e-76   Phoenix dactylifera
emb|CDP04012.1|  unnamed protein product                                242   4e-76   Coffea canephora [robusta coffee]
ref|XP_004495540.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    242   4e-76   Cicer arietinum [garbanzo]
ref|XP_007028582.1|  Ubiquitin carboxyl-terminal hydrolase isozym...    242   6e-76   
ref|XP_010261153.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    242   6e-76   Nelumbo nucifera [Indian lotus]
ref|XP_007028581.1|  Ubiquitin carboxyl-terminal hydrolase isozym...    242   6e-76   
ref|XP_004141571.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    242   6e-76   Cucumis sativus [cucumbers]
ref|XP_010907454.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    242   7e-76   Elaeis guineensis
ref|XP_008801564.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    241   9e-76   Phoenix dactylifera
ref|XP_008459685.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    241   9e-76   Cucumis melo [Oriental melon]
ref|XP_010058015.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    239   4e-75   Eucalyptus grandis [rose gum]
ref|XP_010676283.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    239   8e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010528618.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    238   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_009391083.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    235   2e-73   
gb|EPS66677.1|  hypothetical protein M569_08100                         234   5e-73   Genlisea aurea
ref|XP_010551649.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    234   9e-73   Tarenaya hassleriana [spider flower]
ref|XP_009385687.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    233   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010103497.1|  Ubiquitin carboxyl-terminal hydrolase isozym...    231   2e-71   
gb|ABK24529.1|  unknown                                                 229   7e-71   Picea sitchensis
gb|KDP45814.1|  hypothetical protein JCGZ_17421                         228   2e-70   Jatropha curcas
ref|XP_006391528.1|  hypothetical protein EUTSA_v10018850mg             224   5e-69   Eutrema salsugineum [saltwater cress]
gb|KHG30328.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        223   9e-69   Gossypium arboreum [tree cotton]
gb|KFK41005.1|  hypothetical protein AALP_AA2G073100                    223   9e-69   Arabis alpina [alpine rockcress]
gb|EYU46057.1|  hypothetical protein MIMGU_mgv1a009722mg                222   3e-68   Erythranthe guttata [common monkey flower]
ref|XP_004954442.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    222   3e-68   Setaria italica
emb|CDY39276.1|  BnaC06g27150D                                          222   3e-68   Brassica napus [oilseed rape]
ref|XP_002888437.1|  ubiquitin carboxyl-terminal hydrolase family...    222   3e-68   Arabidopsis lyrata subsp. lyrata
ref|XP_009105157.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    222   4e-68   Brassica rapa
ref|XP_010470444.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    221   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010511114.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    221   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010415108.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    221   6e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006302540.1|  hypothetical protein CARUB_v10020640mg             220   1e-67   Capsella rubella
gb|KJB19154.1|  hypothetical protein B456_003G086500                    220   2e-67   Gossypium raimondii
ref|XP_001754802.1|  predicted protein                                  219   2e-67   
ref|NP_564858.1|  peptidase C12, ubiquitin carboxyl-terminal hydr...    220   2e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AAL06512.1|AF412059_1  F5I14.29/F5I14.29                             220   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002323817.2|  ubiquitin carboxyl-terminal hydrolase family...    219   4e-67   Populus trichocarpa [western balsam poplar]
ref|XP_011008368.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    219   5e-67   Populus euphratica
ref|XP_006648143.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    218   1e-66   Oryza brachyantha
ref|XP_002305992.1|  hypothetical protein POPTR_0004s13540g             217   3e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010549889.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    217   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_008643982.1|  PREDICTED: uncharacterized protein LOC100382...    217   3e-66   Zea mays [maize]
ref|NP_001048557.1|  Os02g0822200                                       216   4e-66   
ref|XP_006857339.1|  hypothetical protein AMTR_s00067p00092640          217   3e-65   
gb|KCW75482.1|  hypothetical protein EUGRSUZ_E04242                     214   4e-65   Eucalyptus grandis [rose gum]
ref|XP_002519365.1|  ubiquitin carboxyl-terminal hydrolase isozym...    212   3e-64   Ricinus communis
ref|XP_003570428.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    212   3e-64   Brachypodium distachyon [annual false brome]
dbj|BAK02146.1|  predicted protein                                      211   5e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT26052.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        211   5e-64   
ref|XP_006288145.1|  hypothetical protein CARUB_v10001382mg             209   3e-63   Capsella rubella
ref|XP_010495221.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    208   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002970680.1|  hypothetical protein SELMODRAFT_94540              209   4e-63   Selaginella moellendorffii
ref|XP_010420317.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    208   1e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010453790.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    207   2e-62   Camelina sativa [gold-of-pleasure]
gb|KDO56337.1|  hypothetical protein CISIN_1g019907mg                   206   3e-62   Citrus sinensis [apfelsine]
ref|NP_197135.1|  ubiquitin thiolesterase UCH1                          206   4e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25858.1|  hypothetical protein AALP_AA8G171500                    206   5e-62   Arabis alpina [alpine rockcress]
emb|CDX78681.1|  BnaA03g05930D                                          205   2e-61   
ref|XP_002873767.1|  ubiquitin carboxyl-terminal hydrolase family...    204   2e-61   
ref|XP_009614528.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    202   1e-60   Nicotiana tomentosiformis
gb|KEH42949.1|  ubiquitin carboxyl-terminal hydrolase family protein    202   2e-60   Medicago truncatula
ref|XP_006400167.1|  hypothetical protein EUTSA_v10014049mg             201   4e-60   Eutrema salsugineum [saltwater cress]
emb|CDX70685.1|  BnaC03g07690D                                          199   2e-59   
gb|KDO56338.1|  hypothetical protein CISIN_1g019907mg                   194   9e-58   Citrus sinensis [apfelsine]
ref|XP_008678424.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    195   1e-57   Zea mays [maize]
ref|XP_002444573.1|  hypothetical protein SORBIDRAFT_07g023880          194   1e-57   Sorghum bicolor [broomcorn]
ref|XP_004974234.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    194   2e-57   Setaria italica
ref|XP_004968256.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    194   2e-57   Setaria italica
ref|XP_004974233.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    194   4e-57   
ref|XP_002468228.1|  hypothetical protein SORBIDRAFT_01g042110          193   6e-57   Sorghum bicolor [broomcorn]
gb|AFW61674.1|  hypothetical protein ZEAMMB73_636432                    196   9e-57   
ref|XP_004974232.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    194   1e-56   
ref|XP_006646976.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    191   3e-56   Oryza brachyantha
gb|EAY84730.1|  hypothetical protein OsI_06099                          191   4e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_002969347.1|  hypothetical protein SELMODRAFT_231325             189   1e-55   Selaginella moellendorffii
ref|NP_001130225.1|  uncharacterized protein LOC100191319               189   1e-55   Zea mays [maize]
gb|EAZ21969.1|  hypothetical protein OsJ_05623                          190   1e-55   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046089.1|  Os02g0180100                                       189   2e-55   
ref|XP_010907455.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    188   4e-55   
ref|XP_004170678.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    187   1e-54   
ref|XP_003570695.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    184   9e-54   Brachypodium distachyon [annual false brome]
ref|XP_006829670.1|  hypothetical protein AMTR_s00122p00131800          180   6e-52   
ref|XP_004968255.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    180   1e-51   
ref|XP_010492513.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    175   3e-50   
ref|XP_004335580.1|  ubiquitin carboxylterminal hydrolase L5, put...    173   2e-49   Acanthamoeba castellanii str. Neff
ref|XP_005846671.1|  hypothetical protein CHLNCDRAFT_10119              166   9e-47   Chlorella variabilis
dbj|BAK04925.1|  predicted protein                                      166   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KGN52725.1|  hypothetical protein Csa_5G652300                       165   2e-46   Cucumis sativus [cucumbers]
ref|XP_005647268.1|  ubiquitinyl hydrolase                              165   3e-46   Coccomyxa subellipsoidea C-169
emb|CCI48671.1|  unnamed protein product                                164   6e-46   Albugo candida
ref|XP_011398645.1|  Ubiquitin carboxyl-terminal hydrolase isozym...    164   6e-46   Auxenochlorella protothecoides
ref|XP_004364624.2|  hypothetical protein CAOG_01756                    163   1e-45   Capsaspora owczarzaki ATCC 30864
gb|AAF23845.1|AC007234_17  F1E22.3                                      164   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005761492.1|  hypothetical protein EMIHUDRAFT_68017              164   2e-45   Emiliania huxleyi CCMP1516
gb|EIE75482.1|  hypothetical protein RO3G_00186                         163   2e-45   Rhizopus delemar RA 99-880
ref|XP_001626751.1|  predicted protein                                  157   2e-45   Nematostella vectensis
ref|XP_003057386.1|  predicted protein                                  159   6e-44   Micromonas pusilla CCMP1545
gb|EFA75836.1|  peptidase C12 family protein                            159   8e-44   Heterostelium album PN500
ref|XP_008618994.1|  hypothetical protein SDRG_14628                    158   8e-44   Saprolegnia diclina VS20
emb|CDS07653.1|  hypothetical protein LRAMOSA01602                      158   1e-43   Lichtheimia ramosa
emb|CDH55441.1|  ubiquitin carboxyl-terminal hydrolase l5               159   1e-43   Lichtheimia corymbifera JMRC:FSU:9682
gb|KJE90444.1|  ubiquitin carboxyl-terminal hydrolase L5                162   2e-43   Capsaspora owczarzaki ATCC 30864
emb|CEG68983.1|  hypothetical protein RMATCC62417_05136                 157   3e-43   Rhizopus microsporus
gb|KDO23375.1|  hypothetical protein SPRG_11467                         157   4e-43   Saprolegnia parasitica CBS 223.65
ref|XP_008872212.1|  hypothetical protein H310_08294                    157   4e-43   Aphanomyces invadans
emb|CCA22598.1|  ubiquitin carboxylterminal hydrolase putative          156   5e-43   Albugo laibachii Nc14
ref|XP_009531012.1|  hypothetical protein PHYSODRAFT_514191             156   5e-43   Phytophthora sojae
gb|ETP35890.1|  hypothetical protein F442_16042                         156   6e-43   Phytophthora parasitica P10297
ref|XP_008911287.1|  hypothetical protein PPTG_15736                    156   6e-43   Phytophthora parasitica INRA-310
gb|ETK78164.1|  hypothetical protein L915_15752                         156   6e-43   Phytophthora parasitica
gb|ELT87019.1|  hypothetical protein CAPTEDRAFT_123107                  152   8e-43   Capitella teleta
ref|XP_002164730.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    156   8e-43   Hydra vulgaris
dbj|GAN06128.1|  ubiquitin carboxyl-terminal hydrolase isozyme L5...    155   1e-42   Mucor ambiguus
ref|XP_002957978.1|  hypothetical protein VOLCADRAFT_84268              155   1e-42   Volvox carteri f. nagariensis
ref|XP_011450320.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    155   1e-42   Crassostrea gigas
ref|XP_001747155.1|  hypothetical protein                               155   1e-42   Monosiga brevicollis MX1
ref|XP_002502530.1|  predicted protein                                  155   1e-42   Micromonas commoda
gb|AGM32541.1|  cysteine peptidase C12 containing ubiquitin carbo...    154   2e-42   Coptotermes formosanus
gb|KDR17906.1|  hypothetical protein L798_08213                         155   3e-42   Zootermopsis nevadensis
gb|EFX88738.1|  hypothetical protein DAPPUDRAFT_191310                  154   3e-42   Daphnia pulex
gb|EMT26482.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        156   4e-42   
ref|XP_009837018.1|  hypothetical protein H257_11711                    154   4e-42   Aphanomyces astaci
ref|XP_001607168.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    154   4e-42   Nasonia vitripennis
gb|EJY66564.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5,...    154   1e-41   Oxytricha trifallax
ref|XP_002903153.1|  ubiquitin carboxyl-terminal hydrolase, putative    152   2e-41   Phytophthora infestans T30-4
gb|KDD74588.1|  ubiquitin carboxyl-terminal hydrolase                   152   3e-41   Helicosporidium sp. ATCC 50920
ref|XP_004519004.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    152   3e-41   Ceratitis capitata [medfly]
dbj|GAM22103.1|  hypothetical protein SAMD00019534_052780               152   3e-41   Acytostelium subglobosum LB1
gb|EPB88801.1|  hypothetical protein HMPREF1544_04441                   151   5e-41   Mucor circinelloides f. circinelloides 1006PhL
gb|ELU12999.1|  hypothetical protein CAPTEDRAFT_3656                    152   5e-41   Capitella teleta
ref|NP_595456.1|  ubiquitin C-terminal hydrolase Uch2                   150   6e-41   Schizosaccharomyces pombe
gb|ACM43511.1|  ubiquitin carboxyl-terminal hydrolase isozyme L5        151   7e-41   Scylla paramamosain
ref|XP_011195803.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    150   1e-40   Zeugodacus cucurbitae [melon fruit fly]
dbj|BAH71060.1|  ACYPI000646                                            146   1e-40   Acyrthosiphon pisum
dbj|BAG30795.1|  similar to CG3431-PA                                   150   1e-40   Papilio xuthus [Chinese swallowtail]
ref|XP_011208915.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    150   1e-40   Bactrocera dorsalis [papaya fruit fly]
ref|XP_003284309.1|  ubiquitin carboxyl-terminal hydrolase isozym...    150   1e-40   Dictyostelium purpureum
gb|ABA29001.1|  ubiquitin c-terminal hydrolase                          145   2e-40   Symbiodinium sp. C3
gb|EMS59823.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        152   2e-40   Triticum urartu
ref|XP_002592491.1|  hypothetical protein BRAFLDRAFT_118926             149   2e-40   Branchiostoma floridae
gb|ESA16361.1|  hypothetical protein GLOINDRAFT_345594                  150   2e-40   
gb|EPX74250.1|  ubiquitin carboxy terminal hydrolase Uch2               149   3e-40   Schizosaccharomyces octosporus yFS286
ref|XP_638105.1|  peptidase C12 family protein                          150   3e-40   Dictyostelium discoideum AX4
gb|KFH63362.1|  ubiquitin carboxyl-terminal hydrolase L5                150   3e-40   Mortierella verticillata NRRL 6337
ref|XP_011269403.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    148   5e-40   Camponotus floridanus
ref|XP_009064786.1|  hypothetical protein LOTGIDRAFT_236234             148   8e-40   Lottia gigantea
ref|XP_009017261.1|  hypothetical protein HELRODRAFT_172351             147   1e-39   Helobdella robusta
ref|XP_003705680.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   2e-39   Megachile rotundata
gb|AAV31418.1|  ubiquitin c-terminal hydrolase UCH37-like protein       147   2e-39   Aphis citricidus
ref|XP_002431967.1|  ubiquitin carboxyl-terminal hydrolase isozym...    147   2e-39   Pediculus humanus corporis [human body lice]
ref|XP_011504501.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   3e-39   Ceratosolen solmsi marchali
ref|XP_005094091.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    147   3e-39   Aplysia californica
ref|XP_008181946.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    146   4e-39   Acyrthosiphon pisum
gb|EPY49373.1|  ubiquitin carboxy terminal hydrolase Uch2               145   5e-39   Schizosaccharomyces cryophilus OY26
gb|EHJ66626.1|  hypothetical protein KGM_08817                          146   6e-39   
ref|XP_001418005.1|  predicted protein                                  145   6e-39   Ostreococcus lucimarinus CCE9901
ref|XP_003398753.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   7e-39   Bombus terrestris [large earth bumblebee]
ref|XP_397252.2|  PREDICTED: ubiquitin carboxyl-terminal hydrolas...    145   7e-39   Apis mellifera [bee]
ref|XP_009039691.1|  hypothetical protein AURANDRAFT_69917              145   8e-39   Aureococcus anophagefferens
ref|XP_003079348.1|  Ubiquitin C-terminal hydrolase UCHL1 (ISS)         145   8e-39   Ostreococcus tauri
ref|XP_003486108.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   1e-38   Bombus impatiens
ref|XP_011157433.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    145   1e-38   
gb|EPZ34815.1|  Peptidase C12, ubiquitin carboxyl-terminal hydrol...    145   1e-38   Rozella allomycis CSF55
ref|XP_011150268.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   2e-38   Harpegnathos saltator
ref|XP_011311253.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   2e-38   Fopius arisanus
ref|XP_002409195.1|  ubiquitin C-terminal hydrolase, putative           145   2e-38   Ixodes scapularis [blacklegged tick]
ref|XP_011344648.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   2e-38   Ooceraea biroi
gb|ADD24143.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        142   2e-38   Lepeophtheirus salmonis
ref|NP_001279101.1|  ubiquitin carboxyl-terminal hydrolase L5           144   2e-38   Callorhinchus milii [Australian ghost shark]
ref|XP_011068867.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   3e-38   Acromyrmex echinatior
ref|XP_002939132.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    144   3e-38   Xenopus tropicalis [western clawed frog]
ref|XP_010566311.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   3e-38   Haliaeetus leucocephalus
ref|XP_004358376.1|  peptidase C12 family protein                       144   3e-38   Cavenderia fasciculata
ref|NP_001168238.1|  uncharacterized protein LOC100382000               144   4e-38   Zea mays [maize]
ref|XP_001696392.1|  ubiquitin carboxyl-terminal hydrolase              144   5e-38   Chlamydomonas reinhardtii
gb|AAY86988.1|  ubiquitin C-terminal hydrolase                          142   5e-38   Ictalurus punctatus
ref|XP_005348524.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   6e-38   Microtus ochrogaster [prairie voles]
ref|XP_005348523.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   6e-38   Microtus ochrogaster [prairie voles]
ref|XP_007608356.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   6e-38   
ref|XP_003507104.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   7e-38   Cricetulus griseus [Chinese hamsters]
ref|XP_007645806.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   7e-38   Cricetulus griseus [Chinese hamsters]
ref|XP_001845763.1|  ubiquitin carboxyl-terminal hydrolase isozym...    143   7e-38   Culex quinquefasciatus
gb|AAH89167.1|  LOC733154 protein                                       143   8e-38   Xenopus laevis [clawed frog]
ref|XP_010566310.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   8e-38   Haliaeetus leucocephalus
ref|NP_062508.2|  ubiquitin carboxyl-terminal hydrolase isozyme L...    143   9e-38   Mus musculus [mouse]
pdb|3RIS|A  Chain A, Crystal Structure Of The Catalytic Domain Of...    141   9e-38   Homo sapiens [man]
gb|EDL39509.1|  ubiquitin carboxyl-terminal esterase L5, isoform ...    143   9e-38   Mus musculus [mouse]
ref|XP_007421056.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   9e-38   Python bivittatus
ref|XP_005175420.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   9e-38   Musca domestica
ref|NP_001089066.1|  ubiquitin carboxyl-terminal hydrolase L5           143   9e-38   Xenopus laevis [clawed frog]
ref|XP_007645807.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   9e-38   Cricetulus griseus [Chinese hamsters]
ref|NP_001153338.1|  ubiquitin carboxyl-terminal hydrolase isozym...    143   9e-38   Mus musculus [mouse]
ref|XP_004578864.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   1e-37   Ochotona princeps [southern American pika]
ref|XP_003387076.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    143   1e-37   Amphimedon queenslandica
ref|XP_006529823.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   1e-37   Mus musculus [mouse]
ref|XP_004578863.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   1e-37   Ochotona princeps [southern American pika]
ref|XP_006250025.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   1e-37   Rattus norvegicus [brown rat]
ref|NP_001187184.1|  ubiquitin carboxy-terminal hydrolase L5            142   1e-37   Ictalurus punctatus
ref|XP_004625354.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   1e-37   
ref|XP_967733.1|  PREDICTED: ubiquitin carboxyl-terminal hydrolas...    142   1e-37   Tribolium castaneum [rust-red flour beetle]
ref|XP_002786136.1|  ubiquitin carboxyl-terminal hydrolase isozym...    142   1e-37   Perkinsus marinus ATCC 50983
gb|AAD31534.1|AF148447_1  ubiquitin C-terminal hydrolase UCH37          142   1e-37   Mus musculus [mouse]
ref|NP_001006530.1|  ubiquitin carboxyl-terminal hydrolase isozym...    142   1e-37   
ref|XP_002774137.1|  ubiquitin carboxyl-terminal hydrolase isozym...    142   2e-37   Perkinsus marinus ATCC 50983
ref|XP_010769025.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Notothenia coriiceps [yellowbelly rockcod]
gb|ACO08947.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        142   2e-37   Osmerus mordax
gb|AAT02518.1|  ubitquitin C-terminal hydrolase                         142   2e-37   Chlamydomonas reinhardtii
ref|XP_009086698.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Serinus canaria [canary]
ref|XP_005533558.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Pseudopodoces humilis [Tibetan ground-jay]
ref|NP_998249.1|  ubiquitin carboxyl-terminal hydrolase isozyme L5      142   2e-37   Danio rerio [leopard danio]
ref|XP_007421055.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Python bivittatus
ref|XP_005142948.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Melopsittacus undulatus
ref|XP_005533559.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   
ref|XP_009086700.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   
ref|XP_007560636.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Poecilia formosa
ref|XP_315540.2|  AGAP005540-PA                                         142   2e-37   Anopheles gambiae str. PEST
ref|XP_006026558.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   
ref|XP_005142949.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Melopsittacus undulatus
ref|XP_004578862.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Ochotona princeps [southern American pika]
ref|XP_006276596.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   
ref|XP_005706672.1|  ubiquitin carboxyl-terminal hydrolase L5           141   2e-37   Galdieria sulphuraria
gb|ACO12616.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        142   2e-37   Lepeophtheirus salmonis
ref|XP_009086699.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   
ref|XP_006250022.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Rattus norvegicus [brown rat]
ref|XP_005073514.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Mesocricetus auratus [Syrian golden hamster]
ref|XP_005800917.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   
ref|XP_006026557.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Alligator sinensis
ref|XP_005306932.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Chrysemys picta bellii
gb|ENN80940.1|  hypothetical protein YQE_02645                          142   2e-37   Dendroctonus ponderosae
ref|XP_005800916.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Xiphophorus maculatus
ref|XP_004068149.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Oryzias latipes [Japanese rice fish]
ref|XP_006250023.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Rattus norvegicus [brown rat]
ref|XP_005073515.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   2e-37   Mesocricetus auratus [Syrian golden hamster]
ref|XP_007116856.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   2e-37   
gb|ADD38572.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        141   2e-37   Lepeophtheirus salmonis
gb|AAD34065.1|AF151828_1  CGI-70 protein                                141   3e-37   Homo sapiens [man]
ref|XP_001367376.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   3e-37   Monodelphis domestica
ref|XP_010866918.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   3e-37   Esox lucius
ref|XP_005073517.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|NP_001012149.1|  ubiquitin carboxyl-terminal hydrolase isozym...    141   3e-37   Rattus norvegicus [brown rat]
ref|XP_005073516.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   Mesocricetus auratus [Syrian golden hamster]
ref|XP_003453569.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_004659572.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   Jaculus jaculus
ref|XP_008834440.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   Nannospalax galili
ref|XP_001655068.1|  AAEL010966-PA                                      141   3e-37   Aedes aegypti
ref|XP_006186177.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_008683875.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   Ursus maritimus [white bear]
ref|XP_006916277.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   Pteropus alecto
ref|XP_010714199.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_006186176.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|NP_001186190.1|  ubiquitin carboxyl-terminal hydrolase isozym...    141   3e-37   Homo sapiens [man]
ref|XP_008058139.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   Carlito syrichta
ref|NP_776906.2|  ubiquitin carboxyl-terminal hydrolase isozyme L5      141   3e-37   Bos taurus [bovine]
ref|XP_004751554.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_004685519.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
pdb|4WLP|A  Chain A, Crystal Structure Of Uch37-nfrkb Inhibited D...    141   3e-37   
ref|NP_057068.1|  ubiquitin carboxyl-terminal hydrolase isozyme L...    141   3e-37   
ref|XP_006889580.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_004879875.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_006889581.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_004659571.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_003785652.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_008683874.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_006916276.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_004484543.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   3e-37   
ref|XP_005375161.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_004484542.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_005882495.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_536116.2|  PREDICTED: ubiquitin carboxyl-terminal hydrolas...    141   4e-37   
ref|XP_004619973.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_006186178.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
gb|AAF67486.1|AF157320_1  AD-019 protein                                141   4e-37   
ref|XP_008058138.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_005375160.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|NP_001116682.1|  ubiquitin carboxyl-terminal hydrolase isozym...    141   4e-37   
gb|AAP36572.1|  Homo sapiens ubiquitin carboxyl-terminal hydrolas...    141   4e-37   
ref|XP_004659573.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_004685518.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_004382615.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_010607052.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_004619972.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_008584382.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_005882494.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_008148057.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_003974467.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   4e-37   
ref|XP_004659574.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|NP_001186192.1|  ubiquitin carboxyl-terminal hydrolase isozym...    141   4e-37   
ref|XP_008540969.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_008972286.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_003738956.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_008834439.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_008540970.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_008148056.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_003474763.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|NP_001186191.1|  ubiquitin carboxyl-terminal hydrolase isozym...    141   4e-37   
ref|XP_008834438.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_008148058.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_010607051.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_008584381.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_004411397.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_008540967.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
pdb|4UEL|A  Chain A, Uch-l5 In Complex With Ubiquitin-propargyl B...    141   4e-37   
emb|CAG03693.1|  unnamed protein product                                141   4e-37   
ref|XP_004706711.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_004706712.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   4e-37   
ref|XP_008266952.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   5e-37   
ref|XP_003974466.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   5e-37   
ref|XP_004275889.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   5e-37   
ref|XP_007191224.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   5e-37   
ref|XP_006276597.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   5e-37   
ref|XP_007233298.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   5e-37   
ref|XP_006834246.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   6e-37   
gb|EAW91238.1|  ubiquitin carboxyl-terminal hydrolase L5, isoform...    142   6e-37   
ref|XP_002674765.1|  predicted protein                                  139   6e-37   
ref|XP_010373856.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   6e-37   
ref|XP_003224859.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   6e-37   
ref|XP_009438192.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   7e-37   
ref|XP_010373855.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   7e-37   
ref|XP_005245302.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   7e-37   
ref|XP_001112676.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   7e-37   
ref|XP_009189428.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   7e-37   
ref|XP_005882496.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   7e-37   
ref|XP_010373857.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   7e-37   
dbj|BAG37054.1|  unnamed protein product                                140   7e-37   
ref|XP_005245303.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   7e-37   
gb|EAW91234.1|  ubiquitin carboxyl-terminal hydrolase L5, isoform...    142   8e-37   
ref|XP_009189422.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   8e-37   
ref|XP_001112706.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   8e-37   
ref|XP_003893420.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   8e-37   
ref|XP_008115100.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   8e-37   
gb|EFB28799.1|  hypothetical protein PANDA_012567                       141   9e-37   
gb|ADF43187.1|  UBCH1m                                                  140   9e-37   
ref|XP_008171169.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   9e-37   
gb|EHA99975.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        141   9e-37   
gb|EAW91235.1|  ubiquitin carboxyl-terminal hydrolase L5, isoform...    142   9e-37   
gb|ELR55213.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        140   1e-36   
ref|XP_002760499.3|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-36   
ref|XP_010750172.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-36   
ref|XP_008983373.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-36   
ref|XP_008293838.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-36   
ref|XP_004567431.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-36   
gb|EHH50705.1|  hypothetical protein EGM_01573                          140   1e-36   
ref|XP_004028123.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   1e-36   
ref|XP_006010528.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-36   
ref|XP_009438180.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-36   
pdb|3A7S|A  Chain A, Catalytic Domain Of Uch37                          137   1e-36   
ref|XP_008477841.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   1e-36   
ref|XP_008555941.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   1e-36   
pdb|3TB3|A  Chain A, Crystal Structure Of The Uch Domain Of Uch-L...    137   1e-36   
ref|NP_001127557.1|  ubiquitin carboxyl-terminal hydrolase isozym...    140   1e-36   
ref|NP_001133540.1|  ubiquitin carboxyl-terminal hydrolase isozym...    139   2e-36   
ref|XP_009438186.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   2e-36   
ref|XP_009189414.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   2e-36   
ref|XP_009189408.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   2e-36   
ref|XP_010373854.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   2e-36   
ref|XP_010373853.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   2e-36   
ref|XP_006634927.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   2e-36   
ref|XP_006711432.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   2e-36   
ref|XP_005245301.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   2e-36   
ref|XP_006711429.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   2e-36   
ref|XP_006711431.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   2e-36   
ref|XP_006711430.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    141   2e-36   
gb|ACI66093.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        139   3e-36   
ref|XP_002117146.1|  hypothetical protein TRIADDRAFT_50992              139   3e-36   
ref|XP_003264537.2|  PREDICTED: ubiquitin carboxyl-terminal hydro...    142   3e-36   
gb|AIC56442.1|  UCHL5                                                   139   3e-36   
ref|XP_004933129.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    140   3e-36   
ref|XP_008336652.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   3e-36   
pdb|3IHR|A  Chain A, Crystal Structure Of Uch37                         139   4e-36   
ref|XP_004933128.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    139   5e-36   
emb|CDQ73266.1|  unnamed protein product                                138   7e-36   
ref|XP_004013634.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    137   8e-36   
ref|XP_003117084.1|  CRE-UBH-4 protein                                  137   1e-35   
ref|XP_003148804.1|  ubiquitin C-terminal hydrolase UCH-L5              137   1e-35   
gb|KIV99744.1|  hypothetical protein PV09_08666                         137   1e-35   
gb|KFB50740.1|  hypothetical protein ZHAS_00018786                      137   1e-35   
ref|XP_001956302.1|  GF24661                                            137   2e-35   
ref|XP_002836662.1|  hypothetical protein                               136   2e-35   
pdb|3RII|A  Chain A, Crystal Structure Of The Catalytic Domain Of...    134   3e-35   
ref|XP_001268663.1|  26S proteasome-associated ubiquitin C-termin...    136   3e-35   
ref|XP_002029884.1|  GM24867                                            136   3e-35   
ref|XP_001895580.1|  ubiquitin C-terminal hydrolase UCH-L5              135   3e-35   
ref|XP_002093299.1|  GE21236                                            136   3e-35   
ref|NP_524003.1|  ubiquitin carboxy-terminal hydrolase L5 ortholo...    136   3e-35   
ref|XP_001972178.1|  GG14033                                            136   3e-35   
ref|XP_002084272.1|  GD12919                                            136   4e-35   
gb|EHA26901.1|  hypothetical protein ASPNIDRAFT_46396                   135   5e-35   
emb|CDQ03428.1|  Protein BM-UBH-4, isoform b                            135   5e-35   
gb|EJW83649.1|  ubiquitin carboxyl-terminal hydrolase                   135   5e-35   
emb|CEF69341.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5       135   5e-35   
ref|XP_005010433.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   6e-35   
emb|CCG84177.1|  protein of unknown function                            134   6e-35   
ref|XP_001389529.2|  ubiquitin carboxyl-terminal hydrolase 2            135   8e-35   
gb|ETN60654.1|  ubiquitin carboxyl-terminal hydrolase isozyme L5        135   9e-35   
emb|CAK44021.1|  unnamed protein product                                135   9e-35   
gb|ELK08903.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        135   9e-35   
dbj|GAA87350.1|  26S proteasome-associated ubiquitin C-terminal h...    135   9e-35   
gb|EXX57542.1|  Yuh1p                                                   135   1e-34   
ref|XP_002622137.1|  ubiquitin carboxyl-terminal hydrolase 2            134   1e-34   
ref|XP_007514337.1|  predicted protein                                  134   1e-34   
ref|XP_001352617.1|  GA17448                                            134   1e-34   
ref|XP_006975418.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    131   1e-34   
ref|XP_002792568.1|  ubiquitin carboxyl-terminal hydrolase              134   2e-34   
gb|ADX97186.1|  ubiquitin carboxyl-terminal hydrolase isozyme l5        129   2e-34   
ref|XP_002543358.1|  hypothetical protein UREG_02874                    134   2e-34   
gb|EGT38638.1|  hypothetical protein CAEBREN_14335                      134   2e-34   
ref|XP_009554107.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    135   2e-34   
ref|XP_001023490.3|  Ubiquitin carboxyl-terminal hydrolase, famil...    135   2e-34   
gb|KEY78499.1|  26S proteasome associated ubiquitin hydrolase           134   2e-34   
ref|XP_001454297.1|  hypothetical protein                               134   2e-34   
ref|XP_005714965.1|  Ubiquitin carboxyl-terminal hydrolase              134   3e-34   
ref|XP_002008195.1|  GI13355                                            133   3e-34   
ref|XP_002068599.1|  GK20334                                            133   4e-34   
ref|XP_752958.1|  26S proteasome-associated ubiquitin C-terminal ...    133   4e-34   
dbj|BAK04178.1|  predicted protein                                      133   4e-34   
gb|EMP32826.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        132   6e-34   
ref|XP_007063046.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    132   7e-34   
ref|XP_002046994.1|  GJ13185                                            132   7e-34   
ref|XP_001984019.1|  GH16209                                            132   8e-34   
gb|EFZ19517.1|  hypothetical protein SINV_00678                         132   8e-34   
ref|XP_005836073.1|  hypothetical protein GUITHDRAFT_85879              132   1e-33   
gb|KIW63595.1|  hypothetical protein PV04_08583                         132   2e-33   
ref|XP_001264157.1|  26S proteasome-associated ubiquitin C-termin...    131   2e-33   
gb|EER38019.1|  ubiquitin carboxyl-terminal hydrolase                   130   2e-33   
ref|XP_003069028.1|  Ubiquitin carboxyl-terminal hydrolase, family 1    131   2e-33   
ref|XP_001818074.1|  ubiquitin carboxyl-terminal hydrolase 2            131   2e-33   
ref|XP_010762180.1|  hypothetical protein PADG_06646                    131   2e-33   
dbj|GAD97902.1|  26S proteasome-associated ubiquitin C-terminal h...    131   2e-33   
gb|KIV93654.1|  hypothetical protein PV10_04849                         131   2e-33   
gb|EYE98911.1|  putative 26S proteasome-associated ubiquitin C-te...    131   2e-33   
ref|XP_001243641.1|  hypothetical protein CIMG_03082                    131   2e-33   
ref|XP_001966131.1|  GF19511                                            132   2e-33   
gb|KHN80035.1|  putative ubiquitin carboxyl-terminal hydrolase ubh-4    134   3e-33   
gb|EKG12666.1|  Peptidase C12 ubiquitin carboxyl-terminal hydrola...    130   3e-33   
ref|XP_627961.1|  ubiquitin C-terminal hydrolase                        132   3e-33   
gb|KFM83458.1|  Ubiquitin carboxyl-terminal hydrolase isozyme L5        130   4e-33   
ref|XP_001462350.1|  hypothetical protein                               131   5e-33   
ref|XP_007583665.1|  putative ubiquitin carboxyl-terminal hydrola...    130   5e-33   
gb|EEH09678.1|  ubiquitin carboxyl-terminal hydrolase                   130   5e-33   
ref|XP_668440.1|  UCHL5 protein                                         131   5e-33   
ref|XP_001542057.1|  conserved hypothetical protein                     130   5e-33   
gb|KDN70242.1|  putative ubiquitin carboxyl-terminal hydrolase, f...    130   5e-33   
gb|EGC44153.1|  ubiquitin carboxyl-terminal hydrolase                   130   6e-33   
gb|ENH80854.1|  ubiquitin carboxyl-terminal hydrolase 2                 129   7e-33   
gb|KIW99801.1|  hypothetical protein Z518_10729                         129   1e-32   
gb|ACY66638.1|  ubiquitin carboxyl-terminal hydrolase L5-like pro...    125   1e-32   
ref|XP_007721283.1|  ubiquitin carboxyl-terminal hydrolase L5           129   2e-32   
gb|EFQ26111.1|  ubiquitin carboxyl-terminal hydrolase, family 1         129   2e-32   
gb|KGO74080.1|  Ubiquitinyl hydrolase, UCH37 type                       128   2e-32   
gb|EZF30104.1|  hypothetical protein H101_06250                         128   2e-32   
ref|XP_003011562.1|  hypothetical protein ARB_02115                     128   2e-32   
ref|XP_008729568.1|  hypothetical protein G647_07029                    128   2e-32   
gb|EKV09173.1|  26S proteasome-associated ubiquitin Carboxy-termi...    128   3e-32   
gb|KIW81774.1|  hypothetical protein Z517_04800                         128   3e-32   
gb|EGD95754.1|  ubiquitin carboxyl-terminal hydrolase                   128   3e-32   
ref|XP_002146054.1|  ubiquitin hydrolase, putative                      128   3e-32   
ref|XP_002119457.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    128   4e-32   
ref|XP_002629984.1|  C. briggsae CBR-UBH-4 protein                      128   4e-32   
dbj|GAM42754.1|  hypothetical protein TCE0_044f17016                    127   4e-32   
emb|CEJ03394.1|  hypothetical protein RMCBS344292_17380                 127   5e-32   
ref|XP_002173549.1|  ubiquitin carboxy terminal hydrolase Uch2          127   5e-32   
ref|NP_495684.2|  Protein UBH-4                                         127   6e-32   
gb|KIL90532.1|  hypothetical protein FAVG1_06265                        127   6e-32   
ref|XP_002478346.1|  26S proteasome-associated ubiquitin C-termin...    127   7e-32   
ref|XP_002134052.1|  GA26899                                            127   8e-32   
ref|XP_002023383.1|  GL20225                                            127   8e-32   
ref|XP_003231292.1|  ubiquitin carboxyl-terminal hydrolase              127   9e-32   
emb|CAQ53274.1|  CG1950-PA                                              127   1e-31   
ref|XP_007760248.1|  ubiquitin carboxyl-terminal hydrolase L5           127   1e-31   
ref|XP_003171139.1|  ubiquitin carboxyl-terminal hydrolase 2            126   1e-31   
ref|XP_002561759.1|  Pc16g14620                                         126   1e-31   
ref|XP_002183394.1|  predicted protein                                  126   2e-31   
ref|XP_007421054.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...    127   2e-31   
gb|KIW60951.1|  hypothetical protein PV05_01127                         127   2e-31   



>ref|XP_011080600.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Sesamum indicum]
 ref|XP_011080601.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Sesamum indicum]
 ref|XP_011080602.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Sesamum indicum]
Length=333

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/125 (94%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+L+NLRPIYGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLDNLRPIYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+NSPDIDIGPELS LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNSPDIDIGPELSALKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|ACU20171.1| unknown [Glycine max]
Length=197

 Score =   242 bits (618),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LN+LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILSIL+NSPDIDIGPEL++LKEFTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSILMNSPDIDIGPELTKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|KDO56335.1| hypothetical protein CISIN_1g019907mg [Citrus sinensis]
 gb|KDO56336.1| hypothetical protein CISIN_1g019907mg [Citrus sinensis]
Length=334

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILSILLN PDIDIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_007028579.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1 [Theobroma 
cacao]
 ref|XP_007028580.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1 [Theobroma 
cacao]
 gb|EOY09081.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1 [Theobroma 
cacao]
 gb|EOY09082.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1 [Theobroma 
cacao]
Length=334

 Score =   246 bits (629),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+DA+NNLRP+YGLIFLFKWRP EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDAVNNLRPVYGLIFLFKWRPGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_008389154.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Malus domestica]
Length=334

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+++LNNLRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLBSLNNLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+N PD+DIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDVDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_003556440.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Glycine 
max]
 gb|KHN04977.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Glycine soja]
Length=334

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LN+LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILSIL+NSPDIDIGPEL++LKEFTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSILMNSPDIDIGPELTKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_009351569.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Pyrus 
x bretschneideri]
Length=334

 Score =   246 bits (628),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP +KDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGDKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSILLN PD+DIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILLNCPDVDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_003536158.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X1 [Glycine max]
 ref|XP_006589224.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X2 [Glycine max]
 gb|KHN14779.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Glycine soja]
Length=334

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LN+LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILSIL+NSPDIDIGPEL++LKEFTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSILMNSPDIDIGPELTKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_010257774.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Nelumbo nucifera]
 ref|XP_010257775.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Nelumbo nucifera]
Length=335

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIGPELS LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSMLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_004297418.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Fragaria 
vesca subsp. vesca]
Length=334

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/125 (94%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDID+LN+LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDSLNSLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSILLN PD+DIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILLNCPDVDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_007143980.1| hypothetical protein PHAVU_007G118800g [Phaseolus vulgaris]
 gb|ESW15974.1| hypothetical protein PHAVU_007G118800g [Phaseolus vulgaris]
Length=332

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDI++LN+LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIESLNSLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILSIL+NSPDIDIGPEL++LKEFTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSILMNSPDIDIGPELTKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_007222561.1| hypothetical protein PRUPE_ppa008376mg [Prunus persica]
 gb|EMJ23760.1| hypothetical protein PRUPE_ppa008376mg [Prunus persica]
Length=334

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP E+DD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGERDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+N PD+DIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDVDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|AGV54688.1| ubiquitin carboxyl-terminal hydrolase isozyme L5-like protein 
[Phaseolus vulgaris]
Length=332

 Score =   245 bits (626),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDI++LN+LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIESLNSLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILSIL+NSPDIDIGPEL++LKEFTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSILMNSPDIDIGPELTKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_008220928.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Prunus 
mume]
Length=334

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP E+DD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGERDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+N PD+DIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDVDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_006423934.1| hypothetical protein CICLE_v10028809mg [Citrus clementina]
 ref|XP_006480314.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Citrus sinensis]
 gb|ESR37174.1| hypothetical protein CICLE_v10028809mg [Citrus clementina]
Length=334

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQ+QVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQIQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILSILLN PDIDIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_008381769.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Malus domestica]
Length=334

 Score =   245 bits (625),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDN  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+N PD+DIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDVDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>emb|CBI37478.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   244 bits (623),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LN+LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNHLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+N PD+DIGPELS LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDVDIGPELSMLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_010927076.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Elaeis guineensis]
Length=334

 Score =   245 bits (625),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIGPELS LKEFTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSVLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_006344362.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006344363.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006344364.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X3 [Solanum tuberosum]
Length=334

 Score =   245 bits (625),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTEL+QQMQVKGVQVEELYSLD+D LN+LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELMQQMQVKGVQVEELYSLDLDELNSLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSILLNSPD+DIGPELS LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILLNSPDVDIGPELSALKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_010274755.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Nelumbo nucifera]
Length=256

 Score =   242 bits (618),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLV+KDP+PNLFFASQVINNACATQAILSIL+N PDIDIG ELS LKEFTKNFPPELKGL
Sbjct  61   RLVMKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGSELSMLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_002262954.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Vitis 
vinifera]
 emb|CAN60599.1| hypothetical protein VITISV_027729 [Vitis vinifera]
Length=334

 Score =   244 bits (624),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LN+LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNHLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+N PD+DIGPELS LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDVDIGPELSMLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_011089558.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Sesamum indicum]
Length=333

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRPIYGLIFLFKWRP EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPIYGLIFLFKWRPGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R++IKDP+P+LFFASQVINNACATQAILSIL+NSPDIDIGPELS LKEFTKNFPPELKGL
Sbjct  61   RIMIKDPNPSLFFASQVINNACATQAILSILMNSPDIDIGPELSALKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_004246255.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Solanum 
lycopersicum]
Length=334

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTEL+QQMQVKGVQVEELYSLD+D LN+LRP++GLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELMQQMQVKGVQVEELYSLDLDELNSLRPVFGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSILLNSPD+DIGPELS LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILLNSPDVDIGPELSALKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_009764959.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Nicotiana 
sylvestris]
Length=334

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D LN+LRP+YGL+FLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDELNSLRPVYGLVFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSILLNSPD+DIGPELS LKEFTKNFP ELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILLNSPDVDIGPELSALKEFTKNFPAELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|KEH42950.1| ubiquitin carboxyl-terminal hydrolase family protein [Medicago 
truncatula]
Length=334

 Score =   243 bits (620),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD DALN+LRP+YGLIFLFKWRP EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDPDALNSLRPVYGLIFLFKWRPGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VIKDP+PNLFFASQVINNACATQAILSILLNSPD+DIGPEL++LKEFTKNFPPELKGL
Sbjct  61   RAVIKDPNPNLFFASQVINNACATQAILSILLNSPDVDIGPELTKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|KJB19153.1| hypothetical protein B456_003G086500 [Gossypium raimondii]
Length=334

 Score =   243 bits (619),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKW P EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWHPGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+P+LFFASQVINNACATQAILSILLN PDIDIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPDLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_008794248.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Phoenix dactylifera]
 ref|XP_008794249.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Phoenix dactylifera]
Length=334

 Score =   242 bits (618),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D LNNLRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDFLNNLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIGPELS LKEFTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSVLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>emb|CDP04012.1| unnamed protein product [Coffea canephora]
Length=334

 Score =   242 bits (618),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRPIYGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPIYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP PNLFFASQVINNACATQAILSIL+N PD+DIGPELS LK+FTKNFPPELKGL
Sbjct  61   RVVIKDPIPNLFFASQVINNACATQAILSILMNCPDVDIGPELSALKDFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_004495540.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Cicer arietinum]
Length=334

 Score =   242 bits (618),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LN+LRP+YGLIFLFKWRP EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILSIL+NSPDI++GPEL++LKEFTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSILMNSPDIEVGPELTKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_007028582.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 4 [Theobroma 
cacao]
 gb|EOY09084.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 4 [Theobroma 
cacao]
Length=335

 Score =   242 bits (617),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 123/126 (98%), Gaps = 1/126 (1%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQV-EELYSLDIDALNNLRPIYGLIFLFKWRPDEKD  322
            MSWCTIESDPGVFTELIQQMQVKGVQV EELYSLD+DA+NNLRP+YGLIFLFKWRP EKD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVVEELYSLDLDAVNNLRPVYGLIFLFKWRPGEKD  60

Query  323  DRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKG  502
            +RLVIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIGPELS+LKEFTKNFPPELKG
Sbjct  61   ERLVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSKLKEFTKNFPPELKG  120

Query  503  LAINNS  520
            LAINNS
Sbjct  121  LAINNS  126



>ref|XP_010261153.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Nelumbo nucifera]
Length=335

 Score =   242 bits (617),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVF+ELIQQMQVKGVQVEELYSLD+D+L NLRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFSELIQQMQVKGVQVEELYSLDLDSLCNLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIGPELS LKEFTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSMLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_007028581.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 3 [Theobroma 
cacao]
 gb|EOY09083.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 3 [Theobroma 
cacao]
Length=335

 Score =   242 bits (617),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 123/126 (98%), Gaps = 1/126 (1%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNL-RPIYGLIFLFKWRPDEKD  322
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+DA+NNL RP+YGLIFLFKWRP EKD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDAVNNLSRPVYGLIFLFKWRPGEKD  60

Query  323  DRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKG  502
            +RLVIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIGPELS+LKEFTKNFPPELKG
Sbjct  61   ERLVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSKLKEFTKNFPPELKG  120

Query  503  LAINNS  520
            LAINNS
Sbjct  121  LAINNS  126



>ref|XP_004141571.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Cucumis sativus]
Length=334

 Score =   242 bits (617),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+ +LNN+RPIYGLIFLFKWRP +KDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLHSLNNMRPIYGLIFLFKWRPGDKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIGPELS+LK+FTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSKLKDFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_010907454.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X1 [Elaeis guineensis]
Length=334

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILS+L+N P+IDIGPELS LKEFTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSVLMNCPEIDIGPELSMLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_008801564.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Phoenix dactylifera]
Length=334

 Score =   241 bits (616),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+L+NLRPIYGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLDNLRPIYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQA+LSIL+N PDIDIGPELS LK+FTKNFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQALLSILMNCPDIDIGPELSALKDFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_008459685.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Cucumis melo]
Length=333

 Score =   241 bits (616),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+ +LNN+RPIYGLIFLFKWRP +KDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLHSLNNMRPIYGLIFLFKWRPGDKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIGPELS+LK+FTKNFPPELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSKLKDFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_010058015.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Eucalyptus grandis]
 gb|KCW75481.1| hypothetical protein EUGRSUZ_E04242 [Eucalyptus grandis]
Length=331

 Score =   239 bits (611),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LN+LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIGPELS LK+F++NFPPELKGL
Sbjct  61   RVVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSSLKDFSRNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_010676283.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Beta 
vulgaris subsp. vulgaris]
Length=335

 Score =   239 bits (610),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 121/125 (97%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD++ L+ LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLETLDCLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIK+P+PNLFFASQVINNACATQAILSILLNSPD+D+GPELS LKEFTKNFPPELKGL
Sbjct  61   RLVIKEPNPNLFFASQVINNACATQAILSILLNSPDVDVGPELSNLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_010528618.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Tarenaya 
hassleriana]
 ref|XP_010528619.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Tarenaya 
hassleriana]
Length=329

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGL+FLFKWR  EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLVFLFKWRAGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  IKD  PNLFFASQVINNACATQAILSILLNSP++DIGPELSQLKEFTKNFPPELKGL
Sbjct  61   RPTIKDTYPNLFFASQVINNACATQAILSILLNSPEVDIGPELSQLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_009391083.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391084.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391085.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391086.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391087.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391088.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Musa acuminata subsp. malaccensis]
Length=334

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D L+NLRP+YGLIFLFKWR  EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDFLDNLRPVYGLIFLFKWRRGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIGPELS LKEFTKNFPPELKGL
Sbjct  61   RPVIKDPNPNLFFASQVINNACATQAILSILVNCPDIDIGPELSMLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|EPS66677.1| hypothetical protein M569_08100 [Genlisea aurea]
Length=334

 Score =   234 bits (598),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTEL+QQMQVKGVQVEELYSLD+D L+NLRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELVQQMQVKGVQVEELYSLDLDVLDNLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RL++KDP+PNL+FASQVINNACATQAILSIL+NSPDIDIGPELS LK+FTK FPPELKGL
Sbjct  61   RLIVKDPNPNLYFASQVINNACATQAILSILMNSPDIDIGPELSALKDFTKTFPPELKGL  120

Query  506  AINN  517
            +++N
Sbjct  121  SVSN  124



>ref|XP_010551649.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Tarenaya hassleriana]
Length=334

 Score =   234 bits (596),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWR  EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRAGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I+D  PNLFFASQVINNACATQAILSILLNSP+++IGPELS+LKEFTKNFPPELKGL
Sbjct  61   RPTIEDTVPNLFFASQVINNACATQAILSILLNSPEVEIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_009385687.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009385688.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009385689.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009385690.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Musa acuminata subsp. malaccensis]
Length=340

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  143  IMSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKD  322
            +MSWC IESDPGVFTELIQQMQVKGVQVEELYSLD+D L+NLRPIYGLI L+KWRP EKD
Sbjct  1    MMSWCAIESDPGVFTELIQQMQVKGVQVEELYSLDMDFLDNLRPIYGLILLYKWRPGEKD  60

Query  323  DRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKG  502
            DR VIKD SPNLFFASQVINNACATQAILS+L+N PDID+GPELS LKEFTKNFPPELKG
Sbjct  61   DRPVIKDLSPNLFFASQVINNACATQAILSVLMNCPDIDVGPELSVLKEFTKNFPPELKG  120

Query  503  LAINNS  520
            LAINNS
Sbjct  121  LAINNS  126



>ref|XP_010103497.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Morus notabilis]
 gb|EXB96157.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Morus notabilis]
Length=361

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 124/152 (82%), Gaps = 27/152 (18%)
 Frame = +2

Query  146  MSWCTIESDPGV---------------------------FTELIQQMQVKGVQVEELYSL  244
            MSWCTIESDPGV                           FTELIQQMQVKGVQVEELYSL
Sbjct  1    MSWCTIESDPGVLLSFFDGDVYLRYYKIIQKILVNGQGVFTELIQQMQVKGVQVEELYSL  60

Query  245  DIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDPSPNLFFASQVINNACATQAILSILLN  424
            D+D+LNNLRP+YGLIFLFKWRP EKDDRLV+KDP+PNL+FASQVINNACATQAILSIL+N
Sbjct  61   DLDSLNNLRPVYGLIFLFKWRPGEKDDRLVMKDPNPNLYFASQVINNACATQAILSILMN  120

Query  425  SPDIDIGPELSQLKEFTKNFPPELKGLAINNS  520
            SPD+DIGPELS+LKEF+KNFPPELKGLAINNS
Sbjct  121  SPDVDIGPELSKLKEFSKNFPPELKGLAINNS  152



>gb|ABK24529.1| unknown [Picea sitchensis]
 gb|ABK24676.1| unknown [Picea sitchensis]
 gb|ACN39883.1| unknown [Picea sitchensis]
Length=340

 Score =   229 bits (584),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQV+GVQVEELYSLD+++LNNL P+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVRGVQVEELYSLDLESLNNLCPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V+K+ SPNLFFASQVINNACATQAILSIL+N  +IDIGPELS LKEFTKNFPPELKGL
Sbjct  61   RSVLKEYSPNLFFASQVINNACATQAILSILMNCSEIDIGPELSNLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|KDP45814.1| hypothetical protein JCGZ_17421 [Jatropha curcas]
Length=337

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D ++ LRP+YGLIFLFKW P EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDIVDKLRPVYGLIFLFKWHPGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V+KD + NLFFASQVINNACATQAILSIL+N PDIDIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RPVMKDSNSNLFFASQVINNACATQAILSILMNCPDIDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_006391528.1| hypothetical protein EUTSA_v10018850mg [Eutrema salsugineum]
 gb|ESQ28814.1| hypothetical protein EUTSA_v10018850mg [Eutrema salsugineum]
Length=329

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKW+   KDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWQAGVKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I+DP  NLFFA+QVINNACATQAILSILLNSP++DIGPELS LKEFTKNFP +LKGL
Sbjct  61   RPTIQDPVSNLFFANQVINNACATQAILSILLNSPEVDIGPELSALKEFTKNFPSDLKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|KHG30328.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Gossypium arboreum]
Length=333

 Score =   223 bits (569),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 117/123 (95%), Gaps = 2/123 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            +C + S  GVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP EKD+RL
Sbjct  4    FCHVFS--GVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDERL  61

Query  332  VIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAI  511
            VIKDP+PNLFFASQVINNACATQAILSILLN PDIDIGPELS+LKEFTKNFPPELKGLAI
Sbjct  62   VIKDPNPNLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGLAI  121

Query  512  NNS  520
            NNS
Sbjct  122  NNS  124



>gb|KFK41005.1| hypothetical protein AALP_AA2G073100 [Arabis alpina]
Length=329

 Score =   223 bits (569),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKW+   KDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWQAGVKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I DP  NLFFA+QVINNACATQAILSILLNSP++DIGPELS LKEFTKNFP +LKGL
Sbjct  61   RPTIHDPVSNLFFANQVINNACATQAILSILLNSPEVDIGPELSTLKEFTKNFPSDLKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|EYU46057.1| hypothetical protein MIMGU_mgv1a009722mg [Erythranthe guttata]
Length=333

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+L++LRP+YGLIFLFKWRP EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLDSLRPVYGLIFLFKWRPGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            RLVIKDP+PNLFFASQVINNACATQAILSIL+NSP++DIGPELS LK+FTKNFP ELKGL
Sbjct  61   RLVIKDPNPNLFFASQVINNACATQAILSILMNSPEVDIGPELSALKDFTKNFPSELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_004954442.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Setaria italica]
Length=328

 Score =   222 bits (565),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+L+ LRPIYGLIFLFKW P EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDVDSLSELRPIYGLIFLFKWIPGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V++DP+PNLFFA QVINNACATQAILS+L+N P+IDIGPELSQLKEFT  F P+LKGL
Sbjct  61   RPVVRDPNPNLFFAHQVINNACATQAILSVLMNRPEIDIGPELSQLKEFTGAFTPDLKGL  120

Query  506  AINNS  520
            AI NS
Sbjct  121  AIGNS  125



>emb|CDY39276.1| BnaC06g27150D [Brassica napus]
Length=329

 Score =   222 bits (565),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNL+P+YGLIFLFKW+   KDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLKPVYGLIFLFKWQAGVKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I+DP  NLFFA+QVINNACATQAILSILLNSP +DIGPELS LKEFTKNFP +LKGL
Sbjct  61   RPTIQDPVSNLFFANQVINNACATQAILSILLNSPQVDIGPELSTLKEFTKNFPSDLKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_002888437.1| ubiquitin carboxyl-terminal hydrolase family 1 protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64696.1| ubiquitin carboxyl-terminal hydrolase family 1 protein [Arabidopsis 
lyrata subsp. lyrata]
Length=330

 Score =   222 bits (565),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKW+  EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWQVGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I+D   NLFFA+QVINNACATQAIL+ILLNSP++DIGPELS LKEFTKNFP +LKGL
Sbjct  61   RPTIQDQVSNLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFTKNFPSDLKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_009105157.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Brassica 
rapa]
 emb|CDY07458.1| BnaA07g25370D [Brassica napus]
Length=329

 Score =   222 bits (565),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNL+P+YGLIFLFKW+   KDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLKPVYGLIFLFKWQAGVKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I+DP  NLFFA+QVINNACATQAILSILLNSP +DIGPELS LKEFTKNFP +LKGL
Sbjct  61   RPTIQDPVSNLFFANQVINNACATQAILSILLNSPQVDIGPELSTLKEFTKNFPSDLKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_010470444.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Camelina sativa]
Length=326

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKW+  EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWQAGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I+D   NLFFA+QVINNACATQAIL+ILLNSP++DIGPELS LKEF+KNFP +LKGL
Sbjct  61   RPTIQDQVSNLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFSKNFPSDLKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_010511114.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Camelina sativa]
Length=326

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKW+  EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWQAGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I+D   NLFFA+QVINNACATQAIL+ILLNSP++DIGPELS LKEF+KNFP +LKGL
Sbjct  61   RPTIQDQVSNLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFSKNFPSDLKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_010415108.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Camelina sativa]
Length=327

 Score =   221 bits (564),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKW+  EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWQAGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I+D   NLFFA+QVINNACATQAIL+ILLNSP++DIGPELS LKEF+KNFP +LKGL
Sbjct  61   RPTIQDQVSNLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFSKNFPSDLKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_006302540.1| hypothetical protein CARUB_v10020640mg [Capsella rubella]
 gb|EOA35438.1| hypothetical protein CARUB_v10020640mg [Capsella rubella]
Length=329

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEE+YSLD+D+LNNLRP+YGLIFLFKW+  EKDD
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEEMYSLDLDSLNNLRPVYGLIFLFKWQAGEKDD  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I+D   NLFFA+QVINNACATQAIL+ILLNSP++DIGPELS LKEF+KNFP +LKGL
Sbjct  61   RPTIQDQVSNLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFSKNFPSDLKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|KJB19154.1| hypothetical protein B456_003G086500 [Gossypium raimondii]
Length=333

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 2/126 (2%)
 Frame = +2

Query  143  IMSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKD  322
            ++ +C + S  GVFTELIQQMQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKW P EKD
Sbjct  1    MIVFCHVFS--GVFTELIQQMQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWHPGEKD  58

Query  323  DRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKG  502
            +RLVIKDP+P+LFFASQVINNACATQAILSILLN PDIDIGPELS+LKEFTKNFPPELKG
Sbjct  59   ERLVIKDPNPDLFFASQVINNACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKG  118

Query  503  LAINNS  520
            LAINNS
Sbjct  119  LAINNS  124



>ref|XP_001754802.1| predicted protein [Physcomitrella patens]
 gb|EDQ80256.1| predicted protein [Physcomitrella patens]
Length=323

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSL++++L+ LRP+YGL+FLFKWR  EKD 
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLELESLSQLRPVYGLVFLFKWRAGEKDG  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V+KD +PNLFFASQVINNACATQAILSIL+N P+I++GPELS LKEFT+ FPPELKGL
Sbjct  61   RPVLKDYNPNLFFASQVINNACATQAILSILMNRPEIEVGPELSTLKEFTRGFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|NP_564858.1| peptidase C12, ubiquitin carboxyl-terminal hydrolase 2 [Arabidopsis 
thaliana]
 gb|AAB60914.1| ESTs gb|T45673,gb|N37512 come from this gene [Arabidopsis thaliana]
 gb|AAL38259.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47868.1| unknown protein [Arabidopsis thaliana]
 gb|AEE34407.1| peptidase C12, ubiquitin carboxyl-terminal hydrolase 2 [Arabidopsis 
thaliana]
Length=330

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD D+LNNLRP+YGLIFLFKW+  EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDSDSLNNLRPVYGLIFLFKWQAGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I+D   NLFFA+QVINNACATQAIL+ILLNSP++DIGPELS LKEFTKNFP +LKGL
Sbjct  61   RPTIQDQVSNLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFTKNFPSDLKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|AAL06512.1|AF412059_1 F5I14.29/F5I14.29 [Arabidopsis thaliana]
Length=330

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD D+LNNLRP+YGLIFLFKW+  EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDSDSLNNLRPVYGLIFLFKWQAGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  I+D   NLFFA+QVINNACATQAIL+ILLNSP++DIGPELS LKEFTKNFP +LKGL
Sbjct  61   RPTIQDQVSNLFFANQVINNACATQAILAILLNSPEVDIGPELSALKEFTKNFPSDLKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_002323817.2| ubiquitin carboxyl-terminal hydrolase family 1 family protein 
[Populus trichocarpa]
 gb|EEF03950.2| ubiquitin carboxyl-terminal hydrolase family 1 family protein 
[Populus trichocarpa]
Length=334

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+L++LRP+YGLIFLFKWRP+EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLDSLRPVYGLIFLFKWRPEEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI DP+PNLFFA QVINNACA+QAILSIL+N PDIDIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RVVITDPNPNLFFARQVINNACASQAILSILMNCPDIDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINN  517
            AINN
Sbjct  121  AINN  124



>ref|XP_011008368.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Populus euphratica]
Length=334

 Score =   219 bits (558),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+D+L++LRP+YGLIFLFKWRP+EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDSLDSLRPVYGLIFLFKWRPEEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI DP+PNLFFA QVINNACA+QAILSIL+N PDIDIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RVVITDPNPNLFFARQVINNACASQAILSILMNCPDIDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINN  517
            AINN
Sbjct  121  AINN  124



>ref|XP_006648143.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Oryza brachyantha]
Length=331

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQ+MQVKGVQVEELYSLD+DA++ LRP+YGLIFLFKW   EKD+
Sbjct  1    MSWCTIESDPGVFTELIQEMQVKGVQVEELYSLDVDAISELRPVYGLIFLFKWMAGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V+KDP+PNLFFASQVI NACATQAILSIL+N P+IDIGPELS LKEFT  F P++KGL
Sbjct  61   RPVVKDPNPNLFFASQVIPNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_002305992.1| hypothetical protein POPTR_0004s13540g [Populus trichocarpa]
 gb|EEE86503.1| hypothetical protein POPTR_0004s13540g [Populus trichocarpa]
Length=334

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQM VKGVQVEELYSLD+D+L++LRP+YGL+FLFKWRP+EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMHVKGVQVEELYSLDLDSLDSLRPVYGLVFLFKWRPEEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI DP+PNLFFA QVINNACA+QAILSIL+N PD+DIGPELS+LKEFTKNFPPELKGL
Sbjct  61   RVVITDPNPNLFFARQVINNACASQAILSILMNCPDMDIGPELSKLKEFTKNFPPELKGL  120

Query  506  AINN  517
            AINN
Sbjct  121  AINN  124



>ref|XP_010549889.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Tarenaya 
hassleriana]
Length=334

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWC IESDPGVFTELIQQ+QV+GVQVEELYSLD+D+L+ LRP+YGL+ L+KWRP+EKD+
Sbjct  1    MSWCAIESDPGVFTELIQQLQVRGVQVEELYSLDLDSLDELRPVYGLLLLYKWRPEEKDN  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VI DP+PN FFASQ+INNACATQAILS+L+NS  IDIGPELS+LKE TKNFP ELKGL
Sbjct  61   RPVITDPNPNFFFASQIINNACATQAILSVLMNSSGIDIGPELSKLKEVTKNFPAELKGL  120

Query  506  AINNS  520
            AINN+
Sbjct  121  AINNN  125



>ref|XP_008643982.1| PREDICTED: uncharacterized protein LOC100382000 isoform X1 [Zea 
mays]
 gb|ACN26703.1| unknown [Zea mays]
 gb|AFW74093.1| hypothetical protein ZEAMMB73_281354 [Zea mays]
Length=328

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+ +L+ LRP+YGLIFLFKW P EKD+
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDVGSLSQLRPVYGLIFLFKWIPGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V++DP+PNLFFA QVI NACATQAILS+L+N P+IDIGPELSQLKEFT  F P+LKGL
Sbjct  61   RPVVRDPNPNLFFAHQVITNACATQAILSVLMNRPEIDIGPELSQLKEFTGAFTPDLKGL  120

Query  506  AINNS  520
            AI+NS
Sbjct  121  AISNS  125



>ref|NP_001048557.1| Os02g0822200 [Oryza sativa Japonica Group]
 dbj|BAD22892.1| putative ubitquitin C-terminal hydrolase [Oryza sativa Japonica 
Group]
 dbj|BAD23124.1| putative ubiquitin C-terminal hydrolase [Oryza sativa Japonica 
Group]
 dbj|BAF10471.1| Os02g0822200 [Oryza sativa Japonica Group]
 gb|EAY88064.1| hypothetical protein OsI_09494 [Oryza sativa Indica Group]
 gb|EAZ25121.1| hypothetical protein OsJ_08921 [Oryza sativa Japonica Group]
 dbj|BAG86677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score =   216 bits (551),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQ+MQVKGVQVEELYSLD+D+++ LRP+YGLIFLFKW   EKD+
Sbjct  1    MSWCTIESDPGVFTELIQEMQVKGVQVEELYSLDVDSISELRPVYGLIFLFKWMAGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V+KDP+PNLFFASQVI NACATQAILSIL+N P+IDIGPELS LKEFT  F P++KGL
Sbjct  61   RPVVKDPNPNLFFASQVIPNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_006857339.1| hypothetical protein AMTR_s00067p00092640 [Amborella trichopoda]
 gb|ERN18806.1| hypothetical protein AMTR_s00067p00092640 [Amborella trichopoda]
Length=425

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +2

Query  167  SDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDP  346
            SD  VFTELIQQMQVKG+QVEELYSLD+D+LN+LRP+YGLIFLFKWRP +KD+RLVIKD 
Sbjct  93   SDTRVFTELIQQMQVKGLQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGDKDERLVIKDH  152

Query  347  SPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAINNS  520
            SPNLFFASQVINNACATQAILSILLN P+IDIGPELS LKEFTKNFPPELKGLAINNS
Sbjct  153  SPNLFFASQVINNACATQAILSILLNCPEIDIGPELSMLKEFTKNFPPELKGLAINNS  210



>gb|KCW75482.1| hypothetical protein EUGRSUZ_E04242 [Eucalyptus grandis]
Length=333

 Score =   214 bits (545),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +2

Query  179  VFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDPSPNL  358
            VFTELIQQMQVKGVQVEELYSLD+D+LN+LRP+YGLIFLFKWRP EKDDR+VIKDP+PNL
Sbjct  14   VFTELIQQMQVKGVQVEELYSLDLDSLNSLRPVYGLIFLFKWRPGEKDDRVVIKDPNPNL  73

Query  359  FFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAINNS  520
            FFASQVINNACATQAILSIL+N PDIDIGPELS LK+F++NFPPELKGLAINNS
Sbjct  74   FFASQVINNACATQAILSILMNCPDIDIGPELSSLKDFSRNFPPELKGLAINNS  127



>ref|XP_002519365.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Ricinus 
communis]
 gb|EEF42982.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Ricinus 
communis]
Length=335

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQ M VKGVQVEELYSLD+D+L++LRPIYGLIFLFKW P EKD+
Sbjct  1    MSWCTIESDPGVFTELIQHMHVKGVQVEELYSLDLDSLDSLRPIYGLIFLFKWHPGEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V+KDP+PNLFFASQVINNACATQAILSIL+N PDI+IG EL++LKEFTKNFPPELKGL
Sbjct  61   RPVMKDPNPNLFFASQVINNACATQAILSILMNCPDIEIGDELTKLKEFTKNFPPELKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_003570428.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Brachypodium distachyon]
Length=329

 Score =   212 bits (539),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQ+MQVKGVQVEELYSLD+D+L+ LRP+YGLIFLFKW    KD+
Sbjct  1    MSWCTIESDPGVFTELIQEMQVKGVQVEELYSLDVDSLSELRPVYGLIFLFKWVAGGKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V+ DP+PNLFFA QVI NACATQAILSIL+N P+IDIGPELS LKEFT  F P++KGL
Sbjct  61   RPVVNDPNPNLFFARQVITNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>dbj|BAK02146.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQ+MQVKGVQVEELYSLD+D+L+ L+P+YGLIFLFKW P   D+
Sbjct  1    MSWCTIESDPGVFTELIQEMQVKGVQVEELYSLDVDSLSQLQPVYGLIFLFKWMPGGNDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V+ DP+PNLFFA QVI NACATQAILSIL+N P+IDIGPELS LKEFT  F P++KGL
Sbjct  61   RPVVSDPNPNLFFARQVITNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>gb|EMT26052.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Aegilops tauschii]
Length=335

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQ+MQVKGVQVEELYSLD+D+L+ L+P+YGLIFLFKW P   D+
Sbjct  1    MSWCTIESDPGVFTELIQEMQVKGVQVEELYSLDVDSLSQLQPVYGLIFLFKWMPGGNDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V+ DP+PNLFFA QVI NACATQAILSIL+N P+IDIGPELS LKEFT  F P++KGL
Sbjct  61   RPVVSDPNPNLFFARQVITNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMKGL  120

Query  506  AINNS  520
            AINNS
Sbjct  121  AINNS  125



>ref|XP_006288145.1| hypothetical protein CARUB_v10001382mg [Capsella rubella]
 gb|EOA21043.1| hypothetical protein CARUB_v10001382mg [Capsella rubella]
Length=336

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +ESDPGVFTE+IQQMQVKGVQVEELYSLDI++L+ +RP+YGLI L+KWRPDEK++
Sbjct  1    MSWLPVESDPGVFTEIIQQMQVKGVQVEELYSLDINSLDEIRPVYGLILLYKWRPDEKEN  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI +P+PN FFASQ+INNACATQA+LS+L+NS  IDIG ELS+LKEF K FPPELKGL
Sbjct  61   RVVIMEPNPNFFFASQIINNACATQALLSVLMNSSSIDIGSELSELKEFAKEFPPELKGL  120

Query  506  AINNS  520
            AINN+
Sbjct  121  AINNN  125



>ref|XP_010495221.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like, 
partial [Camelina sativa]
Length=301

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +ESDPGVFTE+IQQMQVKGVQVEELYSLDI++L+ +RP+YGLI L+KWRP+EKD 
Sbjct  1    MSWFPVESDPGVFTEIIQQMQVKGVQVEELYSLDINSLDEIRPVYGLILLYKWRPEEKDS  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI +P+PN FFASQ+INNACATQA+LS+LLNS  IDIG ELS+LK F K FPPELKGL
Sbjct  61   RVVIMEPNPNFFFASQIINNACATQAMLSVLLNSSSIDIGSELSELKRFAKEFPPELKGL  120

Query  506  AINNS  520
            AINN+
Sbjct  121  AINNN  125



>ref|XP_002970680.1| hypothetical protein SELMODRAFT_94540 [Selaginella moellendorffii]
 gb|EFJ28006.1| hypothetical protein SELMODRAFT_94540 [Selaginella moellendorffii]
Length=324

 Score =   209 bits (531),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD++AL+ LRP+YGLIFLFKWRP EKD 
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLEALSLLRPVYGLIFLFKWRPGEKDT  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  +KD + ++FFASQVINNACATQAILSIL+N  +IDIGPELS ++EF K+FPPELKGL
Sbjct  61   RPTVKD-NKSIFFASQVINNACATQAILSILMNRVEIDIGPELSMMREFAKDFPPELKGL  119

Query  506  AINNS  520
             INNS
Sbjct  120  TINNS  124



>ref|XP_010420317.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Camelina sativa]
Length=336

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +ESDPGVFTE+IQQMQVKGVQVEELYSLDI++L+ +RP+YGLI L+KWRP+EKD 
Sbjct  1    MSWFPVESDPGVFTEIIQQMQVKGVQVEELYSLDINSLDEIRPVYGLILLYKWRPEEKDS  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI +P+PN FFASQ+INNACATQA+LS+LLNS  IDIG ELS+LK+F K FPPELKGL
Sbjct  61   RVVIMEPNPNFFFASQIINNACATQAMLSVLLNSSSIDIGSELSELKKFAKEFPPELKGL  120

Query  506  AINNS  520
            AINN+
Sbjct  121  AINNN  125



>ref|XP_010453790.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Camelina sativa]
Length=336

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +ESDPGVFTE+IQQMQVKGVQVEELYSLDI++L+ +RP+YGLI L+KWRP+EKD 
Sbjct  1    MSWFPVESDPGVFTEIIQQMQVKGVQVEELYSLDINSLDEIRPVYGLILLYKWRPEEKDS  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI +P+PN FFASQ+INNACATQA+LS+LLNS  IDIG ELS+LK+F K FPPELKGL
Sbjct  61   RVVIMEPNPNFFFASQIINNACATQAMLSVLLNSSSIDIGSELSELKKFAKEFPPELKGL  120

Query  506  AINNS  520
            AINN+
Sbjct  121  AINNN  125



>gb|KDO56337.1| hypothetical protein CISIN_1g019907mg [Citrus sinensis]
Length=315

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/106 (92%), Positives = 104/106 (98%), Gaps = 0/106 (0%)
 Frame = +2

Query  203  MQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDPSPNLFFASQVIN  382
            MQVKGVQVEELYSLD+D+LNNLRP+YGLIFLFKWRP EKDDR+VIKDP+PNLFFASQVIN
Sbjct  1    MQVKGVQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDDRVVIKDPNPNLFFASQVIN  60

Query  383  NACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAINNS  520
            NACATQAILSILLN PDIDIGPELS+LKEFTKNFPPELKGLAINNS
Sbjct  61   NACATQAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGLAINNS  106



>ref|NP_197135.1| ubiquitin thiolesterase UCH1 [Arabidopsis thaliana]
 dbj|BAB09598.1| ubiquitin C-terminal hydrolase-like protein [Arabidopsis thaliana]
 dbj|BAC42635.1| putative ubiquitin C-terminal hydrolase [Arabidopsis thaliana]
 gb|AAO63376.1| At5g16310 [Arabidopsis thaliana]
 gb|AED92278.1| ubiquitin thiolesterase UCH1 [Arabidopsis thaliana]
Length=334

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +ESDPG+FTE+IQQMQVKGVQVEELYSLD ++L+ +RP+YGLI L+KWRP+EK++
Sbjct  1    MSWLPVESDPGIFTEIIQQMQVKGVQVEELYSLDFNSLDEIRPVYGLILLYKWRPEEKEN  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI +P+PN FFASQ+INNACATQAILS+L+NS  IDIG ELS+LK+F K FPPELKGL
Sbjct  61   RVVITEPNPNFFFASQIINNACATQAILSVLMNSSSIDIGSELSELKQFAKEFPPELKGL  120

Query  506  AINNS  520
            AINN+
Sbjct  121  AINNN  125



>gb|KFK25858.1| hypothetical protein AALP_AA8G171500 [Arabis alpina]
Length=336

 Score =   206 bits (524),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +ESDPGVFTE+IQQMQVKGVQVEELYSLD+ +L+ +RP+YGLI L+KWRP+EK++
Sbjct  1    MSWLPVESDPGVFTEIIQQMQVKGVQVEELYSLDLHSLDEMRPVYGLILLYKWRPEEKEN  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI +P+PN FFA+Q+INNACATQAILS+L+NS  I++G ELS+LKEF K+FPPELKGL
Sbjct  61   RVVITEPNPNFFFANQIINNACATQAILSVLMNSSTIELGSELSELKEFAKDFPPELKGL  120

Query  506  AINNS  520
            AINN+
Sbjct  121  AINNN  125



>emb|CDX78681.1| BnaA03g05930D [Brassica napus]
Length=337

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +ESDPGVFTE+IQQMQVKGVQVEELYSLDI +L+ +RP+YGL+ L+KWRP+EK+ 
Sbjct  1    MSWLPVESDPGVFTEIIQQMQVKGVQVEELYSLDITSLDEIRPVYGLVLLYKWRPEEKES  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI +P+PN FFASQ+INNACATQA+LS+L+NS  I+IG ELS+LKEF K+FPPELKGL
Sbjct  61   RVVITEPNPNFFFASQIINNACATQALLSVLMNSSGIEIGSELSELKEFAKDFPPELKGL  120

Query  506  AINNS  520
            AI+N+
Sbjct  121  AISNN  125



>ref|XP_002873767.1| ubiquitin carboxyl-terminal hydrolase family 1 protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH50026.1| ubiquitin carboxyl-terminal hydrolase family 1 protein [Arabidopsis 
lyrata subsp. lyrata]
Length=334

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +ESDPG+FTE+IQQMQVKGVQVEELYSLD ++L+ +RP+YGLI L+KWRP+EK++
Sbjct  1    MSWLPVESDPGIFTEIIQQMQVKGVQVEELYSLDFNSLDEIRPVYGLILLYKWRPEEKEN  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI +P+PN FFASQ+INNACATQAILS+L+NS  IDIG ELS+LK+F K FPPELKGL
Sbjct  61   RVVITEPNPNFFFASQIINNACATQAILSVLMNSSSIDIGSELSELKQFAKEFPPELKGL  120

Query  506  AINNS  520
            AI+N+
Sbjct  121  AISNN  125



>ref|XP_009614528.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Nicotiana 
tomentosiformis]
Length=315

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/106 (91%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = +2

Query  203  MQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDPSPNLFFASQVIN  382
            MQVKGVQVEELYSLD+D LN+LRP+YGL+FLFKWRP EKDDRLVIKDP+PNLFFASQVIN
Sbjct  1    MQVKGVQVEELYSLDLDELNSLRPVYGLVFLFKWRPGEKDDRLVIKDPNPNLFFASQVIN  60

Query  383  NACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAINNS  520
            NACATQAILSILLNSPD+DIGPELS LKEFTKNFP ELKGLAINNS
Sbjct  61   NACATQAILSILLNSPDVDIGPELSALKEFTKNFPAELKGLAINNS  106



>gb|KEH42949.1| ubiquitin carboxyl-terminal hydrolase family protein [Medicago 
truncatula]
Length=315

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/106 (91%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = +2

Query  203  MQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDPSPNLFFASQVIN  382
            MQVKGVQVEELYSLD DALN+LRP+YGLIFLFKWRP EKD+R VIKDP+PNLFFASQVIN
Sbjct  1    MQVKGVQVEELYSLDPDALNSLRPVYGLIFLFKWRPGEKDERAVIKDPNPNLFFASQVIN  60

Query  383  NACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAINNS  520
            NACATQAILSILLNSPD+DIGPEL++LKEFTKNFPPELKGLAINNS
Sbjct  61   NACATQAILSILLNSPDVDIGPELTKLKEFTKNFPPELKGLAINNS  106



>ref|XP_006400167.1| hypothetical protein EUTSA_v10014049mg [Eutrema salsugineum]
 gb|ESQ41620.1| hypothetical protein EUTSA_v10014049mg [Eutrema salsugineum]
Length=337

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +ESDPGVFTE+IQQMQVKGVQVEELY LDI++L+ +RP+YGLI L+KWRP+EK++
Sbjct  1    MSWLPVESDPGVFTEIIQQMQVKGVQVEELYDLDINSLDEIRPVYGLILLYKWRPEEKEN  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VI +P+PN FFASQ+INNACATQAILS+L+NS  I+IG ELS+LK F K+FPPELKGL
Sbjct  61   RSVITEPNPNFFFASQIINNACATQAILSVLMNSSSIEIGTELSELKAFAKDFPPELKGL  120

Query  506  AINNS  520
            AI N+
Sbjct  121  AITNN  125



>emb|CDX70685.1| BnaC03g07690D [Brassica napus]
Length=329

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +ESDPGVFTE+IQQMQVKGVQVEELYSLDI +L+ +RP+ GL+ L+KWRP+EK+ 
Sbjct  1    MSWLPVESDPGVFTEIIQQMQVKGVQVEELYSLDITSLDEIRPVCGLVLLYKWRPEEKES  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R+VI +P+PN FFASQ+INNACATQA+LS+L+NS  I+IG EL++LKEF K+FPPELKGL
Sbjct  61   RVVITEPNPNFFFASQIINNACATQALLSVLMNSSGIEIGSELTELKEFAKDFPPELKGL  120

Query  506  AINNS  520
            AI+N+
Sbjct  121  AISNN  125



>gb|KDO56338.1| hypothetical protein CISIN_1g019907mg [Citrus sinensis]
Length=312

 Score =   194 bits (494),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +2

Query  218  VQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDPSPNLFFASQVINNACAT  397
            +QVEELYSLD+D+LNNLRP+YGLIFLFKWRP EKDDR+VIKDP+PNLFFASQVINNACAT
Sbjct  3    MQVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDDRVVIKDPNPNLFFASQVINNACAT  62

Query  398  QAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAINNS  520
            QAILSILLN PDIDIGPELS+LKEFTKNFPPELKGLAINNS
Sbjct  63   QAILSILLNCPDIDIGPELSKLKEFTKNFPPELKGLAINNS  103



>ref|XP_008678424.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Zea mays]
Length=331

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  IE+DPGVFTEL+QQMQ+KG+QV+E+YSLD+DALN+L+PIYGLI L+KWRP EKD+
Sbjct  1    MSWAAIENDPGVFTELLQQMQLKGLQVDEIYSLDLDALNDLQPIYGLIVLYKWRPPEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VIKD  PNLFFA+Q+INNACATQAILS+LLNSP I +  EL +LKEF K+ PPELKGL
Sbjct  61   RPVIKDAIPNLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPELKGL  120

Query  506  AINN  517
            AI N
Sbjct  121  AIVN  124



>ref|XP_002444573.1| hypothetical protein SORBIDRAFT_07g023880 [Sorghum bicolor]
 gb|EES14068.1| hypothetical protein SORBIDRAFT_07g023880 [Sorghum bicolor]
Length=331

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  IE+DPGVFTEL+QQMQ+KG+QV+ELYSLD+DAL++L+PIYGLI L+KWRP EKD+
Sbjct  1    MSWAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALSDLQPIYGLIVLYKWRPPEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VIKD  PNLFFA+Q+INNACATQAILS+LLNSP I +  EL +LKEF K+ PPELKGL
Sbjct  61   RPVIKDAIPNLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPELKGL  120

Query  506  AINN  517
            AI N
Sbjct  121  AIVN  124



>ref|XP_004974234.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X3 [Setaria italica]
Length=332

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            M W  IE+DPGVFTEL+QQMQ+KG+QV+ELYSLD+DALN+L+PIYGLI L+KWRP EKD+
Sbjct  1    MPWAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALNDLQPIYGLIVLYKWRPPEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VIKD  PNLFFA+Q+INNACATQAILS+LLNSP I +  EL +LKEF K+ PPELKGL
Sbjct  61   RPVIKDTVPNLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPELKGL  120

Query  506  AINN  517
            AI N
Sbjct  121  AIVN  124



>ref|XP_004968256.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X2 [Setaria italica]
Length=332

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  IE+DPGV TEL+QQMQ+KG+QV+ELYSLD+DALN+L+PIYGLI L+KWRP EKD+
Sbjct  1    MSWAAIENDPGVLTELLQQMQLKGLQVDELYSLDLDALNDLQPIYGLIVLYKWRPPEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R V+KD  PNLFFA+Q+INNACATQAILS+LLNSP I +  EL +LKEF K+ PPELKGL
Sbjct  61   RPVMKDTIPNLFFANQIINNACATQAILSVLLNSPGITLSDELKRLKEFAKDLPPELKGL  120

Query  506  AINN  517
            AI N
Sbjct  121  AIVN  124



>ref|XP_004974233.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X2 [Setaria italica]
Length=362

 Score =   194 bits (493),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            M W  IE+DPGVFTEL+QQMQ+KG+QV+ELYSLD+DALN+L+PIYGLI L+KWRP EKD+
Sbjct  31   MPWAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALNDLQPIYGLIVLYKWRPPEKDE  90

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VIKD  PNLFFA+Q+INNACATQAILS+LLNSP I +  EL +LKEF K+ PPELKGL
Sbjct  91   RPVIKDTVPNLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPELKGL  150

Query  506  AINN  517
            AI N
Sbjct  151  AIVN  154



>ref|XP_002468228.1| hypothetical protein SORBIDRAFT_01g042110 [Sorghum bicolor]
 gb|EER95226.1| hypothetical protein SORBIDRAFT_01g042110 [Sorghum bicolor]
Length=331

 Score =   193 bits (490),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +E+DPGVFTE++QQMQ+KG+QV+ELYSLD+DALN+L+PIYGLI L+KWRP EKD+
Sbjct  1    MSWAAVENDPGVFTEMLQQMQLKGLQVDELYSLDLDALNDLQPIYGLIVLYKWRPSEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VIKD   NLFFA+Q+INNACATQAILS+LLNSP I +  EL +LKEF K+ PPELKGL
Sbjct  61   RPVIKDAIQNLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPELKGL  120

Query  506  AINN  517
            AI N
Sbjct  121  AIVN  124



>gb|AFW61674.1| hypothetical protein ZEAMMB73_636432 [Zea mays]
Length=465

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  134  RSFIMSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPD  313
            +   MSW  IE+DPGVFTEL+QQMQ+KG+QV+E+YSLD+DALN+L+PIYGLI L+KWRP 
Sbjct  131  KPLTMSWAAIENDPGVFTELLQQMQLKGLQVDEIYSLDLDALNDLQPIYGLIVLYKWRPP  190

Query  314  EKDDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPE  493
            EKD+R VIKD  PNLFFA+Q+INNACATQAILS+LLNSP I +  EL +LKEF K+ PPE
Sbjct  191  EKDERPVIKDAIPNLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPE  250

Query  494  LKGLAINN  517
            LKGLAI N
Sbjct  251  LKGLAIVN  258



>ref|XP_004974232.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X1 [Setaria italica]
Length=389

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            M W  IE+DPGVFTEL+QQMQ+KG+QV+ELYSLD+DALN+L+PIYGLI L+KWRP EKD+
Sbjct  58   MPWAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALNDLQPIYGLIVLYKWRPPEKDE  117

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VIKD  PNLFFA+Q+INNACATQAILS+LLNSP I +  EL +LKEF K+ PPELKGL
Sbjct  118  RPVIKDTVPNLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPELKGL  177

Query  506  AINN  517
            AI N
Sbjct  178  AIVN  181



>ref|XP_006646976.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X1 [Oryza brachyantha]
 ref|XP_006646977.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X2 [Oryza brachyantha]
Length=330

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW TIE+DPG+FTEL+QQMQ+KG+QV+ELYSLD+DAL++L+P+YGLI L+KWRP E+D+
Sbjct  1    MSWATIENDPGIFTELLQQMQLKGLQVDELYSLDLDALSDLQPVYGLIVLYKWRPPEEDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  IKDP PNLFFA+Q+INNACATQAILS+LLNSP I +  EL +LKEF K+ PPELKGL
Sbjct  61   R-PIKDPVPNLFFANQIINNACATQAILSVLLNSPGITLSEELKKLKEFAKDLPPELKGL  119

Query  506  AINN  517
            AI N
Sbjct  120  AIVN  123



>gb|EAY84730.1| hypothetical protein OsI_06099 [Oryza sativa Indica Group]
Length=332

 Score =   191 bits (485),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 110/127 (87%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  FIMSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEK  319
            F MSW  IE+DPGVFTEL+QQMQ+KG+QV+ELYSLD+DALN+L+P+YGLI L+KW+P EK
Sbjct  28   FDMSWAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALNDLQPVYGLIVLYKWQPPEK  87

Query  320  DDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELK  499
            D+R  IKDP PNLFFA Q+INNACATQAI+S+LLNSP I +  EL +LKEF K+ PP+LK
Sbjct  88   DER-PIKDPIPNLFFAKQIINNACATQAIVSVLLNSPGITLSEELKKLKEFAKDLPPDLK  146

Query  500  GLAINNS  520
            GLAI NS
Sbjct  147  GLAIVNS  153



>ref|XP_002969347.1| hypothetical protein SELMODRAFT_231325 [Selaginella moellendorffii]
 gb|EFJ29435.1| hypothetical protein SELMODRAFT_231325 [Selaginella moellendorffii]
Length=324

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLD+++L+ LRP+YGLIFLFKWRP EKD 
Sbjct  1    MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLESLSLLRPVYGLIFLFKWRPGEKDT  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  +KD + ++FFASQVINNACATQAILSIL+N  +IDIGPELS ++EF K+FPPELKGL
Sbjct  61   RPTVKD-NKSIFFASQVINNACATQAILSILMNRVEIDIGPELSMMREFAKDFPPELKGL  119

Query  506  AINNS  520
             INNS
Sbjct  120  TINNS  124



>ref|NP_001130225.1| uncharacterized protein LOC100191319 [Zea mays]
 gb|ACF78381.1| unknown [Zea mays]
 gb|ACR38727.1| unknown [Zea mays]
 tpg|DAA48570.1| TPA: hypothetical protein ZEAMMB73_626126 [Zea mays]
Length=327

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  IE+DPGVFTEL+QQMQ+KG+QV+ELYSLD+DALN+L+PIYGLI L+KWRP EKD+
Sbjct  1    MSWAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALNDLQPIYGLILLYKWRPPEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
              VIKD  PNLFFA+Q+IN ACATQAI+S+LLNSP I +  EL +LKEF K+ PPELKGL
Sbjct  61   GPVIKDAIPNLFFANQIINKACATQAIVSVLLNSPGITLSDELKKLKEFAKDLPPELKGL  120

Query  506  AINN  517
            AI N
Sbjct  121  AIVN  124



>gb|EAZ21969.1| hypothetical protein OsJ_05623 [Oryza sativa Japonica Group]
Length=358

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 110/127 (87%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  FIMSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEK  319
            F MSW  IE+DPG+FTEL+QQMQ+KG+QV+ELYSLD+DALN+L+P+YGLI L+KW+P EK
Sbjct  28   FDMSWAAIENDPGIFTELLQQMQLKGLQVDELYSLDLDALNDLQPVYGLIVLYKWQPPEK  87

Query  320  DDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELK  499
            D+R  IKDP PNLFFA Q+INNACATQAI+S+LLNSP I +  EL +LKEF K+ PP+LK
Sbjct  88   DER-PIKDPIPNLFFAKQIINNACATQAIVSVLLNSPGITLSEELKKLKEFAKDLPPDLK  146

Query  500  GLAINNS  520
            GLAI NS
Sbjct  147  GLAIVNS  153



>ref|NP_001046089.1| Os02g0180100 [Oryza sativa Japonica Group]
 dbj|BAD28018.1| putative ubitquitin C-terminal hydrolase [Oryza sativa Japonica 
Group]
 dbj|BAF08003.1| Os02g0180100 [Oryza sativa Japonica Group]
 dbj|BAG90384.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96890.1| unnamed protein product [Oryza sativa Japonica Group]
Length=329

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  IE+DPG+FTEL+QQMQ+KG+QV+ELYSLD+DALN+L+P+YGLI L+KW+P EKD+
Sbjct  1    MSWAAIENDPGIFTELLQQMQLKGLQVDELYSLDLDALNDLQPVYGLIVLYKWQPPEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  IKDP PNLFFA Q+INNACATQAI+S+LLNSP I +  EL +LKEF K+ PP+LKGL
Sbjct  61   R-PIKDPIPNLFFAKQIINNACATQAIVSVLLNSPGITLSEELKKLKEFAKDLPPDLKGL  119

Query  506  AINNS  520
            AI NS
Sbjct  120  AIVNS  124



>ref|XP_010907455.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X2 [Elaeis guineensis]
Length=331

 Score =   188 bits (478),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 102/110 (93%), Gaps = 1/110 (1%)
 Frame = +2

Query  191  LIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDPSPNLFFAS  370
            +I+QM +    VEELYSLD+D+LNNLRP+YGLIFLFKWRP EKD+R+VIKDP+PNLFFAS
Sbjct  14   IIKQM-INIYMVEELYSLDLDSLNNLRPVYGLIFLFKWRPGEKDERVVIKDPNPNLFFAS  72

Query  371  QVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAINNS  520
            QVINNACATQAILS+L+N P+IDIGPELS LKEFTKNFPPELKGLAINNS
Sbjct  73   QVINNACATQAILSVLMNCPEIDIGPELSMLKEFTKNFPPELKGLAINNS  122



>ref|XP_004170678.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like, 
partial [Cucumis sativus]
Length=308

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +2

Query  224  VEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDPSPNLFFASQVINNACATQA  403
            VEELYSLD+ +LNN+RPIYGLIFLFKWRP +KDDRLVIKDP+PNLFFASQVINNACATQA
Sbjct  1    VEELYSLDLHSLNNMRPIYGLIFLFKWRPGDKDDRLVIKDPNPNLFFASQVINNACATQA  60

Query  404  ILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAINNS  520
            ILSIL+N PDIDIGPELS+LK+FTKNFPPELKGLAINNS
Sbjct  61   ILSILMNCPDIDIGPELSKLKDFTKNFPPELKGLAINNS  99



>ref|XP_003570695.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Brachypodium distachyon]
Length=327

 Score =   184 bits (468),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  +E+DPGVFTEL+QQMQ+KG+QV+ELYSLD+DAL +++P+YGLI L+KWRP EKD+
Sbjct  1    MSWAAVENDPGVFTELLQQMQLKGLQVDELYSLDLDALKDIQPVYGLIILYKWRPPEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VIKD  PNLFFA+Q+IN+ACATQA++S+LLNS  I +  +L +LKEF K+ PPELKGL
Sbjct  61   RPVIKDAVPNLFFANQIINSACATQALVSVLLNSSGITLSDDLRKLKEFAKDLPPELKGL  120

Query  506  AINN  517
            AI N
Sbjct  121  AIVN  124



>ref|XP_006829670.1| hypothetical protein AMTR_s00122p00131800 [Amborella trichopoda]
 gb|ERM97086.1| hypothetical protein AMTR_s00122p00131800 [Amborella trichopoda]
Length=321

 Score =   180 bits (456),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = +2

Query  203  MQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDPSPNLFFASQVIN  382
            M+     VEELYSLD+D+LN LRP+YGLIFLFKWRP + D RLVIKD SPNLFFASQVIN
Sbjct  1    MEGSNEYVEELYSLDLDSLNCLRPVYGLIFLFKWRPGDTDQRLVIKDHSPNLFFASQVIN  60

Query  383  NACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAINNS  520
            NACATQAIL+ILLN P+IDIGPELS LKEFTKNFPPELKGLAINNS
Sbjct  61   NACATQAILAILLNCPEIDIGPELSMLKEFTKNFPPELKGLAINNS  106



>ref|XP_004968255.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
isoform X1 [Setaria italica]
Length=360

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 108/152 (71%), Gaps = 28/152 (18%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  IE+DPGV TEL+QQMQ+KG+QV+ELYSLD+DALN+L+PIYGLI L+KWRP EKD+
Sbjct  1    MSWAAIENDPGVLTELLQQMQLKGLQVDELYSLDLDALNDLQPIYGLIVLYKWRPPEKDE  60

Query  326  RLVIKDPSPNLFFASQV----------------------------INNACATQAILSILL  421
            R V+KD  PNLFFA+QV                            INNACATQAILS+LL
Sbjct  61   RPVMKDTIPNLFFANQVRSIELPSYSCHLHSAVSFKIKPVLHLQIINNACATQAILSVLL  120

Query  422  NSPDIDIGPELSQLKEFTKNFPPELKGLAINN  517
            NSP I +  EL +LKEF K+ PPELKGLAI N
Sbjct  121  NSPGITLSDELKRLKEFAKDLPPELKGLAIVN  152



>ref|XP_010492513.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Camelina sativa]
Length=317

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +2

Query  203  MQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDPSPNLFFASQVIN  382
            MQVKGVQVEELYSLDI++L+ +RP+YGLI L+KWRP+EKD R+VI +P+PN FFASQ+IN
Sbjct  1    MQVKGVQVEELYSLDINSLDEIRPVYGLILLYKWRPEEKDSRVVIMEPNPNFFFASQIIN  60

Query  383  NACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAINNS  520
            NACATQA+LS+LLNS  IDIG ELS+LK+F K FPPELKGLAINN+
Sbjct  61   NACATQAMLSVLLNSSSIDIGSELSELKKFAKEFPPELKGLAINNN  106



>ref|XP_004335580.1| ubiquitin carboxylterminal hydrolase L5, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR13567.1| ubiquitin carboxylterminal hydrolase L5, putative [Acanthamoeba 
castellanii str. Neff]
Length=316

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WCTIESDPGVFTELI+++ VK  QVEELY LD + L  L+P++GLIFLFKWR DE D+R
Sbjct  4    NWCTIESDPGVFTELIEEIGVKDCQVEELYVLDQENLQRLKPVHGLIFLFKWRADESDNR  63

Query  329  LVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLA  508
                    ++FFA+QVINNACATQAILSILLN+  +D+G EL+Q KEF++ FPPE++GLA
Sbjct  64   ATESPFDTDVFFANQVINNACATQAILSILLNASKVDLGEELAQFKEFSQEFPPEMRGLA  123

Query  509  INNS  520
            I+NS
Sbjct  124  ISNS  127



>ref|XP_005846671.1| hypothetical protein CHLNCDRAFT_10119, partial [Chlorella variabilis]
 gb|EFN54569.1| hypothetical protein CHLNCDRAFT_10119, partial [Chlorella variabilis]
Length=333

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 107/138 (78%), Gaps = 16/138 (12%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            W TIESDPGVFTEL+ +M VKGVQ+EEL+SLD D+LN+L+PIYGLIFLFKW+ +E D+R 
Sbjct  1    WTTIESDPGVFTELLDRMGVKGVQMEELWSLDDDSLNSLQPIYGLIFLFKWQKEE-DERP  59

Query  332  VIKD-PSPNLFFASQVINNACATQ--------------AILSILLNSPDIDIGPELSQLK  466
            V  D     +FFASQVI+NACATQ              AI+S+L+N P+++IGPELSQL+
Sbjct  60   VATDYEERGVFFASQVIHNACATQARRCPCSRRSFRSPAIVSVLMNRPELEIGPELSQLR  119

Query  467  EFTKNFPPELKGLAINNS  520
            EFT+ FPP++KGLAI NS
Sbjct  120  EFTRGFPPDMKGLAIGNS  137



>dbj|BAK04925.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSW  IE+DPGVFTEL+QQ+Q+KG+QV+ELYSLD+DALN+L+PIYGLI L+KWRP EKD+
Sbjct  1    MSWAPIENDPGVFTELLQQLQLKGLQVDELYSLDLDALNDLQPIYGLILLYKWRPPEKDE  60

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R VIKD  PN+FFA+Q+IN+ACATQAI+S+LLNS  I +  +L +LKEF K+ PPELKGL
Sbjct  61   RPVIKDAVPNVFFANQIINSACATQAIVSVLLNSSGITLSEDLKKLKEFAKDMPPELKGL  120

Query  506  AINN  517
            AI N
Sbjct  121  AIVN  124



>gb|KGN52725.1| hypothetical protein Csa_5G652300 [Cucumis sativus]
Length=294

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 83/85 (98%), Gaps = 0/85 (0%)
 Frame = +2

Query  266  LRPIYGLIFLFKWRPDEKDDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIG  445
            +RPIYGLIFLFKWRP +KDDRLVIKDP+PNLFFASQVINNACATQAILSIL+N PDIDIG
Sbjct  1    MRPIYGLIFLFKWRPGDKDDRLVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIG  60

Query  446  PELSQLKEFTKNFPPELKGLAINNS  520
            PELS+LK+FTKNFPPELKGLAINNS
Sbjct  61   PELSKLKDFTKNFPPELKGLAINNS  85



>ref|XP_005647268.1| ubiquitinyl hydrolase [Coccomyxa subellipsoidea C-169]
 gb|EIE22724.1| ubiquitinyl hydrolase [Coccomyxa subellipsoidea C-169]
Length=332

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 101/126 (80%), Gaps = 3/126 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +W TIESDPGVFTEL+ +M V+GVQ+EELY+LD ++L+ + P+YGLIFLFKWR  E+D+R
Sbjct  4    NWTTIESDPGVFTELMTEMGVQGVQMEELYALDSESLHAISPVYGLIFLFKWR-SEQDNR  62

Query  329  LVIKDPS--PNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKG  502
              + +      +FFA QVI NACATQAILS+LLN PDI +G EL+ LK+FT +FPPE KG
Sbjct  63   PAVSEADYLGKVFFAKQVITNACATQAILSVLLNRPDIQLGAELTNLKDFTADFPPEYKG  122

Query  503  LAINNS  520
            LAI+NS
Sbjct  123  LAISNS  128



>emb|CCI48671.1| unnamed protein product [Albugo candida]
Length=317

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 98/132 (74%), Gaps = 7/132 (5%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWR------  307
            MSWCTIESDPGVFT LI+ + VKG Q+EELYSLD D   ++ P+YGLIFLFKW       
Sbjct  1    MSWCTIESDPGVFTALIKDIGVKGAQMEELYSLDRDQFESMSPVYGLIFLFKWEQSQAAV  60

Query  308  -PDEKDDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNF  484
             P+    + +   P  NLFFA QVI+NACATQAILSI+LN+ ++DIG  L + K FTK+F
Sbjct  61   PPETASTQALNNSPPENLFFAKQVISNACATQAILSIVLNAAELDIGDTLREFKSFTKDF  120

Query  485  PPELKGLAINNS  520
            PP+LKGLAI+NS
Sbjct  121  PPDLKGLAISNS  132



>ref|XP_011398645.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Auxenochlorella 
protothecoides]
 gb|KFM25749.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Auxenochlorella 
protothecoides]
Length=330

 Score =   164 bits (416),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +W TIESDPGVFTELI+++ VKGVQVEELYSLD D+L    PIYGLIFLFKW+ +     
Sbjct  5    AWTTIESDPGVFTELIERLGVKGVQVEELYSLDADSLQAFEPIYGLIFLFKWQAEPVARP  64

Query  329  LVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLA  508
            +  +     +FFA QVINNACATQAILSILLN P++DIG ELSQ ++FT  FP +L+G A
Sbjct  65   MYPEYEERGIFFAKQVINNACATQAILSILLNRPELDIGEELSQFRDFTAGFPADLRGEA  124

Query  509  INNS  520
            I NS
Sbjct  125  IGNS  128



>ref|XP_004364624.2| hypothetical protein CAOG_01756 [Capsaspora owczarzaki ATCC 30864]
Length=326

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI+ + V+GVQVEELYSLD  +L+ L+P++GLIFLFKW+ D ++ +
Sbjct  5    NWCLIESDPGVFTELIRSIGVQGVQVEELYSLDEGSLSVLQPVHGLIFLFKWQKDLQERK  64

Query  329  LVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLA  508
                + + ++FFA+QVINNACATQAILSILLN+P++++G EL+  K FT++F PEL+GLA
Sbjct  65   TA--ENASSVFFANQVINNACATQAILSILLNTPELNLGEELTNFKAFTQDFTPELRGLA  122

Query  509  INNS  520
            I+NS
Sbjct  123  ISNS  126



>gb|AAF23845.1|AC007234_17 F1E22.3 [Arabidopsis thaliana]
Length=361

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 101/138 (73%), Gaps = 15/138 (11%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQV---EELYSLDIDALNNL------------RPIYGL  286
            +  I +  GVFTELIQQMQVKGVQV    E++ LD   +               RP+YGL
Sbjct  19   YVNIYASAGVFTELIQQMQVKGVQVINYLEVFELDFLLIYAFLDKCFSTVWLPCRPVYGL  78

Query  287  IFLFKWRPDEKDDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLK  466
            IFLFKW+  EKD+R  I+D   NLFFA+QVINNACATQAIL+ILLNSP++DIGPELS LK
Sbjct  79   IFLFKWQAGEKDERPTIQDQVSNLFFANQVINNACATQAILAILLNSPEVDIGPELSALK  138

Query  467  EFTKNFPPELKGLAINNS  520
            EFTKNFP +LKGLAINNS
Sbjct  139  EFTKNFPSDLKGLAINNS  156



>ref|XP_005761492.1| hypothetical protein EMIHUDRAFT_68017 [Emiliania huxleyi CCMP1516]
 gb|EOD09063.1| hypothetical protein EMIHUDRAFT_68017 [Emiliania huxleyi CCMP1516]
Length=362

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 4/126 (3%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQ--VEELYSLDIDALNNLRPIYGLIFLFKWRPDEKD  322
             WCTIESDPGVF+ELI ++ VKGVQ  V EL+SLD +++  + P++GLIFLF+WR  EKD
Sbjct  4    GWCTIESDPGVFSELITELGVKGVQAGVHELWSLDKESMAEVGPVHGLIFLFRWR-GEKD  62

Query  323  DRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKG  502
            DR  +  P P +FFASQ+I NACATQAILS+L+N P I +G E++  K FTK+FPP++KG
Sbjct  63   DRATV-TPGPGVFFASQMIPNACATQAILSVLMNCPSISLGEEMTAFKAFTKDFPPDVKG  121

Query  503  LAINNS  520
            LAI+NS
Sbjct  122  LAISNS  127



>gb|EIE75482.1| hypothetical protein RO3G_00186 [Rhizopus delemar RA 99-880]
Length=325

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 2/126 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPD--EKD  322
            +WC IESDPGVFTELI  M  +GVQVEE++SLD   + NL+PIYGLIFLFKW+ +   K+
Sbjct  6    NWCLIESDPGVFTELISNMGCQGVQVEEIWSLDEGTMENLKPIYGLIFLFKWQNNKAHKE  65

Query  323  DRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKG  502
            +   I   + ++FFA+QVI NACATQAILSILLN  DIDIG EL   KEFT++FPP++KG
Sbjct  66   ELPQIDTNADHVFFANQVITNACATQAILSILLNRDDIDIGQELRNFKEFTEDFPPDMKG  125

Query  503  LAINNS  520
            LAI+NS
Sbjct  126  LAISNS  131



>ref|XP_001626751.1| predicted protein [Nematostella vectensis]
 gb|EDO34651.1| predicted protein, partial [Nematostella vectensis]
Length=144

 Score =   157 bits (397),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI+     GVQVEE+YSLD  +L NLRP++G+IFLFKW+P E+    
Sbjct  7    WCLIESDPGVFTELIRGFGCTGVQVEEIYSLDDASLENLRPVHGIIFLFKWKPGEEPAGS  66

Query  332  VIKDP-SPNLFFASQVINNACATQAILSILLNS--PDIDIGPELSQLKEFTKNFPPELKG  502
            V++D  S  +FFA QVI NACATQAILS+LLN+  PDID+GP LS  K+F+  F   LKG
Sbjct  67   VVQDSRSLGIFFAKQVITNACATQAILSVLLNTAHPDIDLGPNLSSFKDFSATFDGALKG  126

Query  503  LAINNS  520
            L+++NS
Sbjct  127  LSLSNS  132



>ref|XP_003057386.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59031.1| predicted protein [Micromonas pusilla CCMP1545]
Length=339

 Score =   159 bits (403),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 97/127 (76%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            M W TIESDPGVFTELIQ+M VKGVQVEELY+LD D L ++ P+YGLIFLFKWR  +   
Sbjct  1    MDWTTIESDPGVFTELIQEMGVKGVQVEELYALDEDLLKSMAPVYGLIFLFKWRSGDPPS  60

Query  326  RLVIKDPSPN-LFFASQVINNACATQAILSILLNS-PDIDIGPELSQLKEFTKNFPPELK  499
              V  D + N +FFASQVI NACATQAILSIL+N  P + +G EL+ +KEFT  F  +LK
Sbjct  61   APVETDANANGVFFASQVITNACATQAILSILMNCPPSVTLGAELANMKEFTAEFDADLK  120

Query  500  GLAINNS  520
            GLAI+NS
Sbjct  121  GLAISNS  127



>gb|EFA75836.1| peptidase C12 family protein [Polysphondylium pallidum PN500]
Length=333

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 7/124 (6%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
             WCTIESDPGVFTELI+++ VK VQVEELY L+    N ++PIYGLIFLFKW+   +D  
Sbjct  5    GWCTIESDPGVFTELIEKIGVKDVQVEELYMLEPSEFNKIKPIYGLIFLFKWQSTTED--  62

Query  329  LVIKDPSPN--LFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKG  502
               + P+ N  LFFA+QVINNACATQAILSILLNSPDIDIG +L+ LK+FT  FPP +KG
Sbjct  63   ---RTPAENENLFFANQVINNACATQAILSILLNSPDIDIGDDLNNLKQFTAGFPPMMKG  119

Query  503  LAIN  514
             AI 
Sbjct  120  EAIG  123



>ref|XP_008618994.1| hypothetical protein SDRG_14628 [Saprolegnia diclina VS20]
 gb|EQC27574.1| hypothetical protein SDRG_14628 [Saprolegnia diclina VS20]
Length=315

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFT LI+ + VKGVQVEELYSLD      L P++GLIFLFKW P+ + +
Sbjct  1    MSWCTIESDPGVFTSLIEDIGVKGVQVEELYSLDQSEFQQLAPVFGLIFLFKWEPNHRAE  60

Query  326  RL-VIKDPSPNLFFASQVINNACATQAILSILLN---SPDIDIGPELSQLKEFTKNFPPE  493
                +    P+LFFA QVI+NACATQAILSILLN   S ++D+G  L + K FT +FP +
Sbjct  61   SAPSVGHVHPDLFFAKQVISNACATQAILSILLNLEASSNVDMGDTLKEFKGFTSDFPSD  120

Query  494  LKGLAINNS  520
            LKGLAI+NS
Sbjct  121  LKGLAISNS  129



>emb|CDS07653.1| hypothetical protein LRAMOSA01602 [Absidia idahoensis var. thermophila]
Length=328

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 97/129 (75%), Gaps = 9/129 (7%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWR-----PD  313
            +WC IESDPGVFTELI  M VKGVQVEE++SLD   +  L+P+ GLIFLFKW+     P 
Sbjct  6    NWCLIESDPGVFTELISGMGVKGVQVEEVWSLDDSLMEQLKPVLGLIFLFKWQGAQPSPA  65

Query  314  EKDDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPE  493
             + D    + P+ ++FFA+QVINNACATQAILSILLN  DID+G EL   KEFT  FPP+
Sbjct  66   MEGD----QHPTDHIFFANQVINNACATQAILSILLNRDDIDLGDELRGFKEFTAEFPPD  121

Query  494  LKGLAINNS  520
            +KGLAI+NS
Sbjct  122  MKGLAISNS  130



>emb|CDH55441.1| ubiquitin carboxyl-terminal hydrolase l5 [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=355

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 98/129 (76%), Gaps = 9/129 (7%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWR-----PD  313
            +WC IESDPGVFTELI  M VKGVQVEE++SLD   +  L+P+ GLIFLFKW+     P 
Sbjct  31   NWCLIESDPGVFTELISGMGVKGVQVEEVWSLDESLMEQLKPVLGLIFLFKWQGAQPSPA  90

Query  314  EKDDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPE  493
             + +    + P+ ++FFA+QVINNACATQAILSILLN  DID+G ELS  KEFT  FPP+
Sbjct  91   TEGE----QHPTDHIFFANQVINNACATQAILSILLNRDDIDLGQELSSFKEFTAEFPPD  146

Query  494  LKGLAINNS  520
            +KGLAI+NS
Sbjct  147  MKGLAISNS  155



>gb|KJE90444.1| ubiquitin carboxyl-terminal hydrolase L5 [Capsaspora owczarzaki 
ATCC 30864]
Length=629

 Score =   162 bits (410),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 76/124 (61%), Positives = 104/124 (84%), Gaps = 2/124 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI+ + V+GVQVEELYSLD  +L+ L+P++GLIFLFKW+ D ++ +
Sbjct  308  NWCLIESDPGVFTELIRSIGVQGVQVEELYSLDEGSLSVLQPVHGLIFLFKWQKDLQERK  367

Query  329  LVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLA  508
                + + ++FFA+QVINNACATQAILSILLN+P++++G EL+  K FT++F PEL+GLA
Sbjct  368  TA--ENASSVFFANQVINNACATQAILSILLNTPELNLGEELTNFKAFTQDFTPELRGLA  425

Query  509  INNS  520
            I+NS
Sbjct  426  ISNS  429



>emb|CEG68983.1| hypothetical protein RMATCC62417_05136 [Rhizopus microsporus]
 emb|CEI96290.1| hypothetical protein RMCBS344292_10456 [Rhizopus microsporus]
Length=325

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 96/129 (74%), Gaps = 8/129 (6%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI  M  +GVQVEE++SLD   +  L+P+YGLIFLFKW+ +     
Sbjct  6    NWCLIESDPGVFTELISNMGCRGVQVEEIWSLDEGTMGELKPVYGLIFLFKWQNNRNHQS  65

Query  329  LVIKDPSPNL-----FFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPE  493
             +   P P++     FFA+QVI NACATQAILSILLN  DIDIG EL   KEFT++FPP+
Sbjct  66   DL---PPPDMTADHVFFANQVITNACATQAILSILLNRDDIDIGQELKNFKEFTQDFPPD  122

Query  494  LKGLAINNS  520
            +KGLAI+NS
Sbjct  123  MKGLAISNS  131



>gb|KDO23375.1| hypothetical protein SPRG_11467 [Saprolegnia parasitica CBS 223.65]
Length=314

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 96/129 (74%), Gaps = 4/129 (3%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFT LI+ + VKGVQVEELYSLD      L P++GLIFLFKW P+ + +
Sbjct  1    MSWCTIESDPGVFTSLIEDIGVKGVQVEELYSLDQSEFQQLAPVFGLIFLFKWEPNHRAE  60

Query  326  RL-VIKDPSPNLFFASQVINNACATQAILSILLN---SPDIDIGPELSQLKEFTKNFPPE  493
                +    P+LFFA QVI+NACATQAILSILLN   S +++IG  L + K FT +FP +
Sbjct  61   SAPSVGQVHPDLFFAKQVISNACATQAILSILLNLEASSNVEIGDTLKEFKGFTSDFPSD  120

Query  494  LKGLAINNS  520
            +KGLAI+NS
Sbjct  121  IKGLAISNS  129



>ref|XP_008872212.1| hypothetical protein H310_08294 [Aphanomyces invadans]
 gb|ETV98784.1| hypothetical protein H310_08294 [Aphanomyces invadans]
Length=320

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 96/135 (71%), Gaps = 14/135 (10%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRP-----  310
            MSWCTIESDPGVFT LI+ +  KG+QVEELYSLD  +  ++ P+YGLIFLFKW P     
Sbjct  1    MSWCTIESDPGVFTSLIEDIGTKGIQVEELYSLDEASFQHISPVYGLIFLFKWSPVHAVA  60

Query  311  ---DEKDDRLVIKDPSPNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFT  475
                    + V    SP+LFFA QVI NACATQAIL+ILLN  SP + +G  LS+ K FT
Sbjct  61   PTTGSGQHQFV----SPDLFFAKQVITNACATQAILAILLNLESPHVVLGDTLSEFKAFT  116

Query  476  KNFPPELKGLAINNS  520
            + FPP+LKGLAI+NS
Sbjct  117  REFPPDLKGLAISNS  131



>emb|CCA22598.1| ubiquitin carboxylterminal hydrolase putative [Albugo laibachii 
Nc14]
Length=317

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 98/135 (73%), Gaps = 13/135 (10%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFT L++ + VKG Q+EELYSLD +   ++ P+YGLIFLFKW   EK  
Sbjct  1    MSWCTIESDPGVFTALLKDIGVKGAQMEELYSLDREQFQSMGPVYGLIFLFKW---EKSQ  57

Query  326  RLVIKD----------PSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFT  475
              V  +          P  NLFFA QVI+NACATQAILSI+LN+ ++DIG  L + K FT
Sbjct  58   HTVPPETTCTPKGSTPPPENLFFAKQVISNACATQAILSIVLNAAELDIGDTLREFKSFT  117

Query  476  KNFPPELKGLAINNS  520
            ++FPP+LKGLAI+NS
Sbjct  118  RDFPPDLKGLAISNS  132



>ref|XP_009531012.1| hypothetical protein PHYSODRAFT_514191 [Phytophthora sojae]
 gb|EGZ13583.1| hypothetical protein PHYSODRAFT_514191 [Phytophthora sojae]
Length=317

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFT LI+ + VKGVQVEELY+LD     +L P+YGL+FLFK+  +  +D
Sbjct  1    MSWCTIESDPGVFTALIEDIGVKGVQVEELYTLDEQQFADLSPVYGLVFLFKYESNHGED  60

Query  326  RL--VIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELK  499
                V       LFFA QVI+NACATQAILSILLN  DI++G  LS+ K FT +FP +LK
Sbjct  61   AEPPVFASEEDGLFFAKQVISNACATQAILSILLNCQDIELGETLSEFKAFTGDFPSDLK  120

Query  500  GLAINNS  520
            GLAI+NS
Sbjct  121  GLAISNS  127



>gb|ETP35890.1| hypothetical protein F442_16042 [Phytophthora parasitica P10297]
Length=313

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 95/127 (75%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFT LI+ + VKGVQVEELY+LD     +L P+YGL+FLFK+  +  +D
Sbjct  1    MSWCTIESDPGVFTALIEDIGVKGVQVEELYTLDEQQFADLSPVYGLVFLFKYESNHGED  60

Query  326  RL--VIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELK  499
                V       +FFA QVI+NACATQAILSILLN+ D+++G  LS+ K FT +FP +LK
Sbjct  61   AEPPVFATEDDGIFFAKQVISNACATQAILSILLNAQDVELGETLSEFKAFTSDFPSDLK  120

Query  500  GLAINNS  520
            GLAI+NS
Sbjct  121  GLAISNS  127



>ref|XP_008911287.1| hypothetical protein PPTG_15736 [Phytophthora parasitica INRA-310]
 gb|ETI37965.1| hypothetical protein F443_16191 [Phytophthora parasitica P1569]
 gb|ETL84837.1| hypothetical protein L917_15459 [Phytophthora parasitica]
 gb|ETM37999.1| hypothetical protein L914_15595 [Phytophthora parasitica]
 gb|ETN03514.1| hypothetical protein PPTG_15736 [Phytophthora parasitica INRA-310]
 gb|ETO66736.1| hypothetical protein F444_16174 [Phytophthora parasitica P1976]
Length=313

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 95/127 (75%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFT LI+ + VKGVQVEELY+LD     +L P+YGL+FLFK+  +  +D
Sbjct  1    MSWCTIESDPGVFTALIEDIGVKGVQVEELYTLDEQQFADLSPVYGLVFLFKYESNHGED  60

Query  326  RL--VIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELK  499
                V       +FFA QVI+NACATQAILSILLN+ D+++G  LS+ K FT +FP +LK
Sbjct  61   AEPPVFATEDDGIFFAKQVISNACATQAILSILLNAQDVELGETLSEFKAFTSDFPSDLK  120

Query  500  GLAINNS  520
            GLAI+NS
Sbjct  121  GLAISNS  127



>gb|ETK78164.1| hypothetical protein L915_15752 [Phytophthora parasitica]
 gb|ETL31601.1| hypothetical protein L916_15641 [Phytophthora parasitica]
 gb|ETP07850.1| hypothetical protein F441_16019 [Phytophthora parasitica CJ01A1]
Length=313

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 95/127 (75%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFT LI+ + VKGVQVEELY+LD     +L P+YGL+FLFK+  +  +D
Sbjct  1    MSWCTIESDPGVFTALIEDIGVKGVQVEELYTLDEQQFADLSPVYGLVFLFKYESNHGED  60

Query  326  RL--VIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELK  499
                V       +FFA QVI+NACATQAILSILLN+ D+++G  LS+ K FT +FP +LK
Sbjct  61   AEPPVFATEDDGIFFAKQVISNACATQAILSILLNAQDVELGETLSEFKAFTSDFPSDLK  120

Query  500  GLAINNS  520
            GLAI+NS
Sbjct  121  GLAISNS  127



>gb|ELT87019.1| hypothetical protein CAPTEDRAFT_123107, partial [Capitella teleta]
Length=166

 Score =   152 bits (383),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTE+I+   VKGVQVEEL+SLD +   NLRP++GLIFLFKW  +++    
Sbjct  8    WCLIESDPGVFTEVIKGFGVKGVQVEELWSLDSENFANLRPVHGLIFLFKWMANDEPQGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D     +FFA QVINNACATQAILSIL+N   PD+ +G  LS  KEFT+ F P  KG
Sbjct  68   IVQDSRLDKIFFAKQVINNACATQAILSILVNCKHPDVQLGDNLSSFKEFTQGFDPATKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_002164730.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Hydra vulgaris]
Length=342

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI+     GVQVEEL+SLD D L  L P++GLIFLFKWR  E+ D  
Sbjct  8    WCLIESDPGVFTELIRGFGCSGVQVEELWSLDSDILETLSPVHGLIFLFKWRSGEEADGA  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILL--NSPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D     +FFA QVINNACATQAI+SILL  N PD+ +G  LS  KEF+K F P LKG
Sbjct  68   IVRDSRIDEIFFAKQVINNACATQAIISILLNCNHPDLQLGETLSAFKEFSKQFDPALKG  127

Query  503  LAINNS  520
            L+++NS
Sbjct  128  LSLSNS  133



>dbj|GAN06128.1| ubiquitin carboxyl-terminal hydrolase isozyme L5-like [Mucor 
ambiguus]
Length=320

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI  M  KGVQVEE++SLD +   +L  +YGLIFLFKW+ ++K    
Sbjct  7    WCLIESDPGVFTELISNMGCKGVQVEEIWSLDPEFTADLGQVYGLIFLFKWQQNKKSYAP  66

Query  332  VIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAI  511
               + + ++FFA+QVINNACATQAILSILLN  D+D+G EL   KEFT +FPP++KGLAI
Sbjct  67   PADENADHVFFANQVINNACATQAILSILLNRDDLDLGEELRNFKEFTADFPPDMKGLAI  126

Query  512  NNS  520
            +NS
Sbjct  127  SNS  129



>ref|XP_002957978.1| hypothetical protein VOLCADRAFT_84268 [Volvox carteri f. nagariensis]
 gb|ADI46889.1| UBCH1f [Volvox carteri f. nagariensis]
 gb|ADI46961.1| UBCH1m [Volvox carteri f. nagariensis]
 gb|EFJ41004.1| hypothetical protein VOLCADRAFT_84268 [Volvox carteri f. nagariensis]
Length=316

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            M W TIESDPGVFTELI Q+ VKGVQVEEL+SLD   L  L P++GLIFLFKWR  E   
Sbjct  1    MEWTTIESDPGVFTELIAQIGVKGVQVEELWSLD--QLKELSPVFGLIFLFKWR-KEAGK  57

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R      +  +FFA QVI NACATQAILSILLN P +D+G ELS  +EF  +F P +KGL
Sbjct  58   RQTTPGGAQGVFFARQVITNACATQAILSILLNCPGLDLGTELSNFREFVADFDPNMKGL  117

Query  506  AINNS  520
            AI+NS
Sbjct  118  AISNS  122



>ref|XP_011450320.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Crassostrea gigas]
 gb|EKC23624.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Crassostrea 
gigas]
Length=318

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI+    +G+QVEEL+SLD  +  NL+P+YGLIFLFKW+P+ + +  
Sbjct  8    WCLIESDPGVFTELIRGFGCEGLQVEELWSLDSTSFENLKPVYGLIFLFKWQPESEPEGT  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLNSP--DIDIGPELSQLKEFTKNFPPELKG  502
            +++D     +FFA QVINNACATQAILS+LLN P  D+ +GP L+Q KEF + F P L+G
Sbjct  68   IVQDSRIEKIFFAKQVINNACATQAILSVLLNCPESDVKVGPTLAQFKEFAQAFDPALRG  127

Query  503  LAINNS  520
            L ++NS
Sbjct  128  LTLSNS  133



>ref|XP_001747155.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ88079.1| predicted protein [Monosiga brevicollis MX1]
Length=328

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPD-EKDDR  328
            WC +ESDPGVFT+LI+ + VKGVQVEEL++LD+DAL  L P+YGL+FLFK+ P+  K + 
Sbjct  5    WCLMESDPGVFTDLIEGVGVKGVQVEELWALDVDALKQLAPVYGLVFLFKFTPEAHKSET  64

Query  329  LVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLA  508
              I    P LFFA QVINNACATQAILSILLN+PDI++G  L+  K F     PE  GLA
Sbjct  65   QPIDYKIPGLFFAHQVINNACATQAILSILLNAPDIELGEHLTGFKSFANELDPETAGLA  124

Query  509  INNS  520
            I+NS
Sbjct  125  ISNS  128



>ref|XP_002502530.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63788.1| predicted protein [Micromonas sp. RCC299]
Length=337

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            M W TIESDPGVFTELIQ+M VKGVQVEELYSLD  +L  + P+YGLIFLFK+R  E   
Sbjct  1    MEWTTIESDPGVFTELIQEMGVKGVQVEELYSLDEGSLRAMAPVYGLIFLFKYRSGEAPS  60

Query  326  RLVIKDPSPN-LFFASQVINNACATQAILSILLNSP-DIDIGPELSQLKEFTKNFPPELK  499
              V  D S + +FFASQVI NACATQAILSIL+N P  + +G EL  +K FT  F  +LK
Sbjct  61   APVETDASSSGVFFASQVITNACATQAILSILMNCPASVQLGEELGNMKAFTAEFDADLK  120

Query  500  GLAINNS  520
            GLAI+NS
Sbjct  121  GLAISNS  127



>gb|AGM32541.1| cysteine peptidase C12 containing ubiquitin carboxyl-terminal 
hydrolase (UCH) [Coptotermes formosanus]
Length=283

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 97/127 (76%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  VKGVQVEEL+SLD +   NL+PI+GLIFLFKW  D++   
Sbjct  7    NWCLIESDPGVFTELIKEFGVKGVQVEELWSLDAEQFENLKPIHGLIFLFKWVQDDEPTG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             V++D     +FFA QVINNACATQAILSILLN   PD+ +GP L++ KEF ++F   +K
Sbjct  67   SVVQDARLDKIFFAKQVINNACATQAILSILLNCKHPDLTLGPTLTEFKEFCQSFDANMK  126

Query  500  GLAINNS  520
            GL ++NS
Sbjct  127  GLTLSNS  133



>gb|KDR17906.1| hypothetical protein L798_08213, partial [Zootermopsis nevadensis]
Length=334

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  VKGVQVEEL+SLD +  +NL PI+GLIFLFKW  D++   
Sbjct  9    NWCLIESDPGVFTELIKEFGVKGVQVEELWSLDAEQFDNLMPIHGLIFLFKWVQDDEPTG  68

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             V++D     +FFA QVINNACATQAILSILLN   PD+ +GP L++ KEF ++F   +K
Sbjct  69   SVVQDTRLDKIFFAKQVINNACATQAILSILLNCKHPDLTLGPTLTEFKEFCQSFDANMK  128

Query  500  GLAINNS  520
            GLA++NS
Sbjct  129  GLALSNS  135



>gb|EFX88738.1| hypothetical protein DAPPUDRAFT_191310 [Daphnia pulex]
Length=318

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVF+ELI+  +V+GVQVEEL+SLD +  +NL+PI+GLIFLFKW P+E+   
Sbjct  6    NWCLIESDPGVFSELIRDFEVQGVQVEELWSLDPEQFDNLKPIHGLIFLFKWVPNEEVVG  65

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             V++D     +FFA QVINNACATQAI+SILLN   PD+ +GP L + KEFT+ F   +K
Sbjct  66   TVVQDSRLDKIFFAKQVINNACATQAIISILLNCKHPDLHLGPTLGEFKEFTQAFDANMK  125

Query  500  GLAINNS  520
            GLA++NS
Sbjct  126  GLALSNS  132



>gb|EMT26482.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Aegilops tauschii]
Length=387

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 108/139 (78%), Gaps = 15/139 (11%)
 Frame = +2

Query  146  MSWCTIESDP---------------GVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIY  280
            MSW  IE+DP               GVFTEL+QQ+Q+KG+QV+ELYSLD+DALN+L+PIY
Sbjct  45   MSWAPIENDPVIDDWSITKELAMDRGVFTELLQQLQLKGLQVDELYSLDLDALNDLQPIY  104

Query  281  GLIFLFKWRPDEKDDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQ  460
            GLI L+KWRP EKD+R VIKD  PNLFFA+Q+IN+ACATQAI+S+LLNS  I +  +L +
Sbjct  105  GLIVLYKWRPPEKDERPVIKDAVPNLFFANQIINSACATQAIVSVLLNSSGITLSEDLKK  164

Query  461  LKEFTKNFPPELKGLAINN  517
            LKEF K+ PPELKGLAI N
Sbjct  165  LKEFAKDMPPELKGLAIVN  183



>ref|XP_009837018.1| hypothetical protein H257_11711 [Aphanomyces astaci]
 gb|ETV73592.1| hypothetical protein H257_11711 [Aphanomyces astaci]
Length=321

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 97/135 (72%), Gaps = 14/135 (10%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKD-  322
            MSWCTIESDPGVFT LI+ + VKG+QVEELYSLD  +  ++ P++GLIFLFKW P     
Sbjct  1    MSWCTIESDPGVFTSLIEDIGVKGIQVEELYSLDDASFQHISPVFGLIFLFKWTPGHAPA  60

Query  323  -------DRLVIKDPSPNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFT  475
                     LV    SP+LFFA QVI+NACATQAIL+ILLN  SP + +G  LS+ K FT
Sbjct  61   PATGSGLHHLV----SPDLFFAKQVISNACATQAILAILLNLESPHVVLGDTLSEFKAFT  116

Query  476  KNFPPELKGLAINNS  520
            + FP +LKGLAI+NS
Sbjct  117  REFPSDLKGLAISNS  131



>ref|XP_001607168.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Nasonia 
vitripennis]
Length=311

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 97/127 (76%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  VKGVQVEELYSLD D   N++PI+GLIFLFKW  D++   
Sbjct  7    NWCLIESDPGVFTELIKEFGVKGVQVEELYSLDDDQFENVKPIHGLIFLFKWVQDDEPSG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +++D     +FFA QVINNACATQAILS+LLN    D+ +GP L +LK F + F P++K
Sbjct  67   AIVQDNRLDKIFFAKQVINNACATQAILSVLLNCKHADMSLGPNLEELKTFCQCFDPKMK  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>gb|EJY66564.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Oxytricha 
trifallax]
 gb|EJY75152.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Oxytricha 
trifallax]
Length=353

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 93/124 (75%), Gaps = 3/124 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPD-EKDDR  328
            WCTIESDPGVFTEL++Q+ VKGVQVEEL +LD + LN ++PIYGLIFLFKW  D EK D 
Sbjct  4    WCTIESDPGVFTELMRQVGVKGVQVEELLTLDDEELNQIKPIYGLIFLFKWVQDPEKRDT  63

Query  329  LVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLA  508
            L   D    LFFA+QVINNACATQAI SIL+N  DIDIG EL  L++F+     + KG A
Sbjct  64   LT--DYDQELFFANQVINNACATQAICSILMNRKDIDIGDELRNLRDFSIEMTAKDKGWA  121

Query  509  INNS  520
            I NS
Sbjct  122  IGNS  125



>ref|XP_002903153.1| ubiquitin carboxyl-terminal hydrolase, putative [Phytophthora 
infestans T30-4]
 gb|EEY55577.1| ubiquitin carboxyl-terminal hydrolase, putative [Phytophthora 
infestans T30-4]
Length=316

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFT LI+ + VKGVQVEELY+LD    ++L P++GL+FLFK+  +  +D
Sbjct  1    MSWCTIESDPGVFTALIEDIGVKGVQVEELYTLDEQQFSDLSPVFGLVFLFKYESNHGED  60

Query  326  RL--VIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELK  499
                V       +FFA QVI+NACATQAILSILLN+ D+++G  L + K FT +FP +LK
Sbjct  61   AEPPVFASEGDGVFFAKQVISNACATQAILSILLNAQDVELGETLLEFKAFTGDFPSDLK  120

Query  500  GLAINNS  520
            GLAI+NS
Sbjct  121  GLAISNS  127



>gb|KDD74588.1| ubiquitin carboxyl-terminal hydrolase [Helicosporidium sp. ATCC 
50920]
Length=332

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 91/125 (73%), Gaps = 1/125 (1%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +W TIESDPGVFTEL+ ++ VK VQVEELYSLD   L++L+PIYGLIFL+KW        
Sbjct  16   TWATIESDPGVFTELLARLGVKNVQVEELYSLDESTLDSLKPIYGLIFLYKWESQSAQSA  75

Query  329  LVIKD-PSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
             V +D     LFFA Q + +ACATQA+LSILLNS ++D+G EL Q +EFT  F P++ GL
Sbjct  76   PVDRDYEHKGLFFAKQEVADACATQALLSILLNSAEVDVGAELQQFREFTMGFGPDMTGL  135

Query  506  AINNS  520
            AI NS
Sbjct  136  AIGNS  140



>ref|XP_004519004.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Ceratitis capitata]
Length=325

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            SWC IESDPGVFTELI+    +GVQVEE++SLD D   +L PI+GLIFLFKW  DE+   
Sbjct  7    SWCLIESDPGVFTELIRDFGCEGVQVEEIWSLDPDLFKDLEPIHGLIFLFKWVQDEETTG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             V+KD    N+FFA QVINNACATQAILSILLN    DI +GP LS+ KEF+++F P  K
Sbjct  67   TVVKDDRLDNIFFAKQVINNACATQAILSILLNCQHKDIKLGPTLSEFKEFSQSFDPFNK  126

Query  500  GLAINNS  520
            GL ++N+
Sbjct  127  GLTLSNA  133



>dbj|GAM22103.1| hypothetical protein SAMD00019534_052780 [Acytostelium subglobosum 
LB1]
Length=341

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 94/123 (76%), Gaps = 3/123 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
             WCTIESDPGVFTELIQQ+ VK VQVEELY+LD      L+PI+GLIFLFKW  D+ D R
Sbjct  6    GWCTIESDPGVFTELIQQIGVKDVQVEELYTLDSSEFLKLKPIFGLIFLFKWTKDD-DTR  64

Query  329  LVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLA  508
              +++ S  LFFA+QVI+NACATQAILSIL+NS DID+G EL+  K+FT  F   +KG A
Sbjct  65   QPVENDS--LFFANQVIHNACATQAILSILMNSKDIDVGEELNNFKQFTTGFSYTMKGEA  122

Query  509  INN  517
            I +
Sbjct  123  IGD  125



>gb|EPB88801.1| hypothetical protein HMPREF1544_04441 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=319

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI  M  KGVQVEE++SLD +   +L  +YGLIFLFKW+ ++K    
Sbjct  7    WCLIESDPGVFTELISNMGCKGVQVEEIWSLDPEFTADLGQVYGLIFLFKWQ-NKKSYAP  65

Query  332  VIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAI  511
               + + ++FFA+QVINNACATQAILSILLN  D+D+G EL   KEFT +FPP++KGLAI
Sbjct  66   PADENADHVFFANQVINNACATQAILSILLNRDDLDLGEELRNFKEFTADFPPDMKGLAI  125

Query  512  NNS  520
            +NS
Sbjct  126  SNS  128



>gb|ELU12999.1| hypothetical protein CAPTEDRAFT_3656 [Capitella teleta]
Length=344

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTE+I+   VKGVQVEEL+SLD +   NLRP++GLIFLFKW  +++    
Sbjct  8    WCLIESDPGVFTEVIKGFGVKGVQVEELWSLDSENFANLRPVHGLIFLFKWMANDEPQGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D     +FFA QVINNACATQAILSIL+N   PD+ +G  LS  KEFT+ F P  KG
Sbjct  68   IVQDSRLDKIFFAKQVINNACATQAILSILVNCKHPDVQLGDNLSSFKEFTQGFDPATKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|NP_595456.1| ubiquitin C-terminal hydrolase Uch2 [Schizosaccharomyces pombe 
972h-]
 sp|Q9UUB6.1|UBLH2_SCHPO RecName: Full=Ubiquitin carboxyl-terminal hydrolase 2 [Schizosaccharomyces 
pombe 972h-]
 emb|CAB52608.1| ubiquitin C-terminal hydrolase Uch2 [Schizosaccharomyces pombe]
Length=300

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 94/127 (74%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPD-EKD  322
            MSW TIESD GVFT+LI+ + VK V+V+ELYSLD+D+L     IYG+IFLFKW    +K 
Sbjct  1    MSWTTIESDAGVFTDLIENLGVKDVEVDELYSLDVDSLRQFPDIYGIIFLFKWNSKVDKP  60

Query  323  DRLVIKDPSPNLFFASQVINNACATQAILSILLNSPD-IDIGPELSQLKEFTKNFPPELK  499
            D  +  D   N+FFA QVINNACATQA+LS+LLN  D ID+G  LS+ K+F+K  PPELK
Sbjct  61   DGTMDYDSMDNIFFAKQVINNACATQALLSVLLNHSDEIDLGTTLSEFKDFSKTLPPELK  120

Query  500  GLAINNS  520
            G A+ NS
Sbjct  121  GEALGNS  127



>gb|ACM43511.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Scylla paramamosain]
Length=337

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 100/127 (79%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFT+L+Q+  VKGVQVEE++SLD ++ ++L+P++GLIFLFKW+ +E+   
Sbjct  8    NWCLIESDPGVFTDLVQKFGVKGVQVEEIWSLDEESFSSLKPVHGLIFLFKWQQEEQPSG  67

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLNSP--DIDIGPELSQLKEFTKNFPPELK  499
             V++D     +FFA Q+INNACATQAILS+LLN+   DI +G  LS+ +EFT+ F   +K
Sbjct  68   SVVQDNRLDKIFFAKQMINNACATQAILSVLLNTKHQDIQLGSTLSEFREFTQTFDAHMK  127

Query  500  GLAINNS  520
            GLA++NS
Sbjct  128  GLALSNS  134



>ref|XP_011195803.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Bactrocera 
cucurbitae]
Length=325

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 94/127 (74%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            SWC IESDPGVFTELI+    +GVQVEE++SLD D    L PI+GLIFLFKW  D++   
Sbjct  7    SWCLIESDPGVFTELIRDFGCEGVQVEEIWSLDRDLFKELEPIHGLIFLFKWVQDDESAG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILL--NSPDIDIGPELSQLKEFTKNFPPELK  499
             V+KD    N+FFA QVINNACATQAILSILL  N  DI +GP LS+ KEF+++F P  K
Sbjct  67   TVVKDDRLDNIFFAKQVINNACATQAILSILLNCNHGDIKLGPTLSEFKEFSQSFDPFNK  126

Query  500  GLAINNS  520
            GL ++N+
Sbjct  127  GLTLSNA  133



>dbj|BAH71060.1| ACYPI000646 [Acyrthosiphon pisum]
Length=179

 Score =   146 bits (369),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            + WC IESDPGVFTELI+++ V G QVEEL++LD    + ++P++GLIFLF+W  +++ D
Sbjct  5    VGWCLIESDPGVFTELIRELGVTGAQVEELWTLDSSLFDAIKPVHGLIFLFRWIGEDQPD  64

Query  326  RLVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPEL  496
              +++D     LFFA QVINNACATQAILS+L N   PDI++G  LS+ KEF++ F   +
Sbjct  65   GPIVRDSRIEKLFFAKQVINNACATQAILSVLFNCRHPDIELGTTLSEFKEFSQKFDANM  124

Query  497  KGLAINNS  520
            KGLA++NS
Sbjct  125  KGLALSNS  132



>dbj|BAG30795.1| similar to CG3431-PA [Papilio xuthus]
Length=322

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 98/127 (77%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFT+LI+    KGVQVEEL+++D     NL+P++GLIFLFK+  D +  +
Sbjct  6    NWCQIESDPGVFTQLIRAFGTKGVQVEELWTIDGGIFENLKPVHGLIFLFKYVQDNEPPK  65

Query  329  LVIKDPSPN-LFFASQVINNACATQAILSILLNS--PDIDIGPELSQLKEFTKNFPPELK  499
             VI D   N ++FA QVINNACATQAI+SILLN   PD+D+GPEL+QLKEF+  F P+++
Sbjct  66   PVITDDRINKIYFAKQVINNACATQAIISILLNVTIPDVDLGPELTQLKEFSMCFDPQMR  125

Query  500  GLAINNS  520
            GL ++NS
Sbjct  126  GLTLSNS  132



>ref|XP_011208915.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Bactrocera 
dorsalis]
Length=325

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            SWC IESDPGVFTELI++   +GVQVEE++SLD D    L PI+GLIFLFKW  D++   
Sbjct  7    SWCLIESDPGVFTELIREFGCEGVQVEEIWSLDRDLFKELEPIHGLIFLFKWVQDDESVG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILL--NSPDIDIGPELSQLKEFTKNFPPELK  499
             V+KD    N+FFA QVINNACATQAILSILL  N  DI++GP L++ KEF+++F P  K
Sbjct  67   TVVKDDRLDNIFFAKQVINNACATQAILSILLNCNHQDINLGPTLTEFKEFSQSFDPFNK  126

Query  500  GLAINNS  520
            GL ++N+
Sbjct  127  GLTLSNA  133



>ref|XP_003284309.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Dictyostelium 
purpureum]
 gb|EGC39163.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Dictyostelium 
purpureum]
Length=333

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 93/124 (75%), Gaps = 3/124 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
             WCTIESDPGVFTELI ++ VK +QVEE+YSLD    + L+P+ GLIFLFKW  D  DD 
Sbjct  6    GWCTIESDPGVFTELIDKIGVKDIQVEEIYSLDSSEYDRLKPVLGLIFLFKWEKD--DDN  63

Query  329  LVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLA  508
              I D + +LFFA+QVI NACATQAILS+LLN+  I++G ELS  K+F  +FPP +KG A
Sbjct  64   RQISD-NQDLFFANQVIQNACATQAILSVLLNAEGIELGEELSNFKQFVGDFPPMMKGEA  122

Query  509  INNS  520
            I NS
Sbjct  123  IGNS  126



>gb|ABA29001.1| ubiquitin c-terminal hydrolase, partial [Symbiodinium sp. C3]
Length=141

 Score =   145 bits (365),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRP--IYGLIFLFKWRPDEKDD  325
            WCTIESDPGVFT+L +++ VKGVQ EE+YSL  +A  +L    IYGLIFLFKW+  E D 
Sbjct  5    WCTIESDPGVFTQLCEEIGVKGVQFEEIYSLGPEAFADLEAEKIYGLIFLFKWQ-READP  63

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGL  505
            R  ++     +FFA QVI+NACATQAILS LLN+  +D+GP L+  KEFT    P++KGL
Sbjct  64   RPTLEASELGIFFAQQVIHNACATQAILSALLNAEKLDVGPNLTSFKEFTIGLDPQMKGL  123

Query  506  AINNS  520
            AI NS
Sbjct  124  AIGNS  128



>gb|EMS59823.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Triticum urartu]
Length=431

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  176  GVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRLVIKDPSPN  355
            GVFTEL+QQ+Q+KG+QV+ELYSLD+DALN+L+PIYGLI L+KWRP EKD+R VIKD  PN
Sbjct  114  GVFTELLQQLQLKGLQVDELYSLDLDALNDLQPIYGLIVLYKWRPPEKDERPVIKDAVPN  173

Query  356  LFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAINN  517
            LFFA+Q+IN+ACATQAI+S+LLNS  I +  +L +LKEF K+ PPELKGLAI N
Sbjct  174  LFFANQIINSACATQAIISVLLNSSGITLSEDLKKLKEFAKDMPPELKGLAIVN  227



>ref|XP_002592491.1| hypothetical protein BRAFLDRAFT_118926 [Branchiostoma floridae]
 gb|EEN48502.1| hypothetical protein BRAFLDRAFT_118926 [Branchiostoma floridae]
Length=300

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI+   VKG+QVEE++SLD +  + L+P++GLIFLFKW+ +E+    
Sbjct  7    WCLIESDPGVFTELIKGFGVKGLQVEEIWSLDPENFDKLKPVHGLIFLFKWQQEEEPSGS  66

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D    ++FFA QVINNACATQAILS+LLN   PDI++G  L+  KEF ++F   +KG
Sbjct  67   VVQDSRLDHIFFAKQVINNACATQAILSVLLNCRHPDIELGETLANFKEFVQHFDATMKG  126

Query  503  LAINNS  520
            L+++NS
Sbjct  127  LSLSNS  132



>gb|ESA16361.1| hypothetical protein GLOINDRAFT_345594 [Rhizophagus irregularis 
DAOM 181602]
Length=337

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 89/126 (71%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI+   V+G QVEE++SLD   L  L+P+YGLIFLFKW+      RL
Sbjct  7    WCLIESDPGVFTELIRAFNVQGTQVEEVWSLDDQTLEELKPVYGLIFLFKWQGGNDSSRL  66

Query  332  VIK---DPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKG  502
              +       N++FA QVINNACATQAILSILLN P ID+G EL   K+FT+ F P  KG
Sbjct  67   HPEADLSVDENVYFAKQVINNACATQAILSILLNCPTIDLGAELDNFKDFTRLFDPYDKG  126

Query  503  LAINNS  520
            LAI NS
Sbjct  127  LAITNS  132



>gb|EPX74250.1| ubiquitin carboxy terminal hydrolase Uch2 [Schizosaccharomyces 
octosporus yFS286]
Length=298

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 97/127 (76%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKW-RPDEKD  322
            MSW TIESD GVFT+LI+ + V GV+VEELY+LD + L N+  IYG+IFLFKW +PD K 
Sbjct  1    MSWTTIESDAGVFTDLIENLGVSGVEVEELYTLDEETLRNISDIYGIIFLFKWKKPDGKP  60

Query  323  DRLVIKDPSPNLFFASQVINNACATQAILSILLN-SPDIDIGPELSQLKEFTKNFPPELK  499
            D  +  +    +FF  QVINNACATQA+LS+LLN S +I++GP+L++ +EFTK  PP+LK
Sbjct  61   DGELDYESIDRIFFGQQVINNACATQALLSVLLNHSEEINLGPKLNEFREFTKLLPPDLK  120

Query  500  GLAINNS  520
            G A+ NS
Sbjct  121  GEALGNS  127



>ref|XP_638105.1| peptidase C12 family protein [Dictyostelium discoideum AX4]
 sp|Q54N38.1|UCHL5_DICDI RecName: Full=Ubiquitin carboxyl-terminal hydrolase isozyme L5; 
Short=UCH-L5; AltName: Full=Ubiquitin thioesterase L5 [Dictyostelium 
discoideum]
 gb|EAL64601.1| peptidase C12 family protein [Dictyostelium discoideum AX4]
Length=343

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
             WCTIESDPGVFTELI ++ VK +QVEELY+LD    + L+P+ GLIFLFKW  +E++  
Sbjct  6    GWCTIESDPGVFTELITKIGVKDIQVEELYTLDSSEYDRLKPVLGLIFLFKWEKEEENRT  65

Query  329  LVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLA  508
            +     + N+FFA+QVI NACATQAILS+LLNS  I++G ELS  K F  +FPP +KG A
Sbjct  66   I---SDNENIFFANQVIQNACATQAILSVLLNSEGIELGEELSNFKSFVGDFPPMMKGEA  122

Query  509  INNS  520
            I NS
Sbjct  123  IGNS  126



>gb|KFH63362.1| ubiquitin carboxyl-terminal hydrolase L5 [Mortierella verticillata 
NRRL 6337]
Length=344

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFT LI+ + V G+QVEE+YS+D + L +L+P++GLIFLFKW   +   +
Sbjct  6    NWCLIESDPGVFTGLIKGIGVSGIQVEEIYSIDKETLEDLKPVHGLIFLFKWLGHDPAAQ  65

Query  329  LVIKDP---SPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELK  499
               K P     ++FFA QVI NACATQAILSIL+NSP +DIG EL+  K F  +FP ELK
Sbjct  66   SANKAPIVYDESIFFAQQVIQNACATQAILSILMNSPAVDIGEELTNFKAFVSDFPAELK  125

Query  500  GLAINNS  520
            G AI+NS
Sbjct  126  GHAISNS  132



>ref|XP_011269403.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Camponotus 
floridanus]
 gb|EFN72646.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Camponotus 
floridanus]
Length=311

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 96/127 (76%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  VKG QVEEL+SLD +  ++L+PI+GLIFLFKW  D++   
Sbjct  7    NWCLIESDPGVFTELIKEFGVKGAQVEELWSLDDEQFDDLKPIHGLIFLFKWVQDDELSG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +++D     +FFA QVINNACATQAILS+LLN   PDI +GP L + K F ++F   ++
Sbjct  67   TIVRDHRLDKIFFAKQVINNACATQAILSVLLNCKHPDISLGPNLEEFKNFCQSFDANMR  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>ref|XP_009064786.1| hypothetical protein LOTGIDRAFT_236234 [Lottia gigantea]
 gb|ESO84586.1| hypothetical protein LOTGIDRAFT_236234 [Lottia gigantea]
Length=327

 Score =   148 bits (374),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI+    KGVQVEEL+SLD +   NL+P++GLIFLFKW PD++ D  
Sbjct  8    WCLIESDPGVFTELIRGFGCKGVQVEELWSLDPENFANLKPVHGLIFLFKWVPDKEPDGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            ++ D     +FFA QVINNACATQAI+SILLN    D+++G  L   KEF+++F P L+G
Sbjct  68   LVADSRLDKIFFAKQVINNACATQAIISILLNCSHQDVELGETLKSFKEFSQSFDPALRG  127

Query  503  LAINNS  520
            L+++NS
Sbjct  128  LSLSNS  133



>ref|XP_009017261.1| hypothetical protein HELRODRAFT_172351 [Helobdella robusta]
 gb|ESO04682.1| hypothetical protein HELRODRAFT_172351 [Helobdella robusta]
Length=319

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 92/128 (72%), Gaps = 5/128 (4%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDID--ALNNLRPIYGLIFLFKWRPDEKDD  325
            WC IESDPGVFTELI Q  V GVQVEE++SLD +  + +  RPIYGLIFLFKW+PD    
Sbjct  8    WCLIESDPGVFTELICQFGVTGVQVEEIWSLDAESFSFSRQRPIYGLIFLFKWKPDMHLQ  67

Query  326  RLVIKDPS-PNLFFASQVINNACATQAILSILLNSPD--IDIGPELSQLKEFTKNFPPEL  496
              VI+D    ++FFA QVINNACATQAILSIL N  D  ID+G  L+  K FT+ F P  
Sbjct  68   GNVIRDDRLRDIFFAKQVINNACATQAILSILFNCSDAKIDLGETLNSFKTFTRGFDPTT  127

Query  497  KGLAINNS  520
            KGLA++NS
Sbjct  128  KGLALSNS  135



>ref|XP_003705680.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Megachile rotundata]
Length=311

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKW-RPDEKDD  325
            +WC IESDPGVFTELI++  VKG QVEEL+SLD +  +NL+PI+GLIFLFKW + DE   
Sbjct  7    NWCLIESDPGVFTELIKEFGVKGAQVEELWSLDDEQFDNLKPIHGLIFLFKWVQDDEPSG  66

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +V+ +    +FFA QVINNACATQAILS+LLN    DI +GP L + K F ++F   ++
Sbjct  67   SIVLDNRLDKIFFAKQVINNACATQAILSVLLNCKHSDISLGPNLEEFKNFCQSFDANMR  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>gb|AAV31418.1| ubiquitin c-terminal hydrolase UCH37-like protein [Aphis citricidus]
Length=322

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 95/128 (74%), Gaps = 3/128 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            + WC IESDPGVFTELI+++ V G QVEEL++LD      ++P++GLIFLF+W  +++ D
Sbjct  5    VGWCLIESDPGVFTELIRELGVTGAQVEELWTLDSSLFEAIKPVHGLIFLFRWIGEDQPD  64

Query  326  RLVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPEL  496
              +++D     LFFA QVINNACATQAILS+L N   PDI++G  LS+ KEF++ F   +
Sbjct  65   GQIVRDSRIEKLFFAKQVINNACATQAILSVLFNCRHPDIELGTTLSEFKEFSQKFDANM  124

Query  497  KGLAINNS  520
            KGLA++NS
Sbjct  125  KGLALSNS  132



>ref|XP_002431967.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Pediculus 
humanus corporis]
 gb|EEB19229.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Pediculus 
humanus corporis]
Length=325

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  V G QVEEL+SLD +  + L+P++GLIFLFKW  D +   
Sbjct  7    NWCLIESDPGVFTELIREFGVTGAQVEELWSLDAEFFDELKPVHGLIFLFKWFNDTEPSG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLNS--PDIDIGPELSQLKEFTKNFPPELK  499
             +I D     +FFA QVINNACATQAILSILLN+  PDI +GP L++ K+F  +F   +K
Sbjct  67   TIIADNRLDKIFFAMQVINNACATQAILSILLNTNHPDISLGPTLTEFKDFCHSFNAHIK  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>ref|XP_011504501.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Ceratosolen 
solmsi marchali]
Length=311

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 94/127 (74%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  VKG QVEE+YSLD +   N++PI+GLIFLFKW  D++   
Sbjct  7    NWCLIESDPGVFTELIKEFGVKGAQVEEIYSLDDEQFENVKPIHGLIFLFKWVQDDEPSG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +++D     +FFA QVINNACATQAILS+LLN    DI +GP L Q+K F ++F   ++
Sbjct  67   SIVQDSRLDKIFFAKQVINNACATQAILSVLLNCKHTDISLGPNLEQVKTFCQSFDANMR  126

Query  500  GLAINNS  520
            GL ++NS
Sbjct  127  GLVLSNS  133



>ref|XP_005094091.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Aplysia californica]
Length=327

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI+    +GVQVEE++SLD ++  +L+P++GLIFLFKW P+ + D  
Sbjct  7    WCLIESDPGVFTELIKGFGCRGVQVEEIWSLDPESFESLKPVHGLIFLFKWAPNTEADGS  66

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D     +FFASQVINNACATQAILSILLN    D+++G  L+  KEF+++  P L+G
Sbjct  67   IVQDSRLEKIFFASQVINNACATQAILSILLNCTHQDLELGDTLTNFKEFSQDLDPGLRG  126

Query  503  LAINNS  520
            L+++NS
Sbjct  127  LSLSNS  132



>ref|XP_008181946.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Acyrthosiphon 
pisum]
 ref|XP_008181947.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Acyrthosiphon 
pisum]
Length=322

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 96/128 (75%), Gaps = 3/128 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            + WC IESDPGVFTELI+++ V G QVEEL++LD    + ++P++GLIFLF+W  +++ D
Sbjct  5    VGWCLIESDPGVFTELIRELGVTGAQVEELWTLDSSLFDAIKPVHGLIFLFRWIGEDQPD  64

Query  326  RLVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPEL  496
              +++D     LFFA QVINNACATQAILS+L N   PDI++G  LS+ KEF++ F   +
Sbjct  65   GPIVRDSRIEKLFFAKQVINNACATQAILSVLFNCRHPDIELGTTLSEFKEFSQKFDANM  124

Query  497  KGLAINNS  520
            KGLA++NS
Sbjct  125  KGLALSNS  132



>gb|EPY49373.1| ubiquitin carboxy terminal hydrolase Uch2 [Schizosaccharomyces 
cryophilus OY26]
Length=298

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 95/127 (75%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKW-RPDEKD  322
            MSW T+ESD GVFT+LI+ + V GV+VEELY+LD + L N   IYG+IFLFKW +PD K 
Sbjct  1    MSWTTLESDAGVFTDLIENLGVSGVEVEELYTLDEETLRNFSDIYGIIFLFKWKKPDGKP  60

Query  323  DRLVIKDPSPNLFFASQVINNACATQAILSILLN-SPDIDIGPELSQLKEFTKNFPPELK  499
            D  +  +    +FF  QVINNACATQA+LS+LLN + +ID+G +L++ +EFTK  PP+LK
Sbjct  61   DGELDYESIDRIFFGQQVINNACATQALLSVLLNHNEEIDLGSKLTEFREFTKLLPPDLK  120

Query  500  GLAINNS  520
            G A+ NS
Sbjct  121  GEALGNS  127



>gb|EHJ66626.1| hypothetical protein KGM_08817 [Danaus plexippus]
Length=322

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFT+LI++  VKGVQVEE+++ D    +NLRP++GLIFLFK+   ++    
Sbjct  7    WCLIESDPGVFTQLIKKFGVKGVQVEEMWTFDDSIFDNLRPVHGLIFLFKYLQHDEPPHP  66

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILL--NSPDIDIGPELSQLKEFTKNFPPELKG  502
            V+KD     ++FA QVINNACATQA++S+LL  N PD+ +GPEL++LKEF+ +F P ++G
Sbjct  67   VVKDNRLEKIYFAKQVINNACATQAVVSLLLNCNHPDVILGPELTKLKEFSMSFDPRMRG  126

Query  503  LAINNS  520
            L ++NS
Sbjct  127  LTLSNS  132



>ref|XP_001418005.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96298.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=303

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 92/127 (72%), Gaps = 2/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            M WC IESDPGVF EL+ ++  +GV   ELYSLD+D L    PIYGLIFLFKWR      
Sbjct  1    MDWCLIESDPGVFGELVHRIGARGVAFTELYSLDVDELRRNEPIYGLIFLFKWRGGHSSS  60

Query  326  RL-VIKDPSPNLFFASQVINNACATQAILSILLNSP-DIDIGPELSQLKEFTKNFPPELK  499
             + V ++P  +LFFASQVI+NACATQA+LS+LLN+  ++++G  L  L+EFT +F  E K
Sbjct  61   AVEVDENPPQDLFFASQVIHNACATQAVLSVLLNAEQEVELGETLQTLREFTLDFDAETK  120

Query  500  GLAINNS  520
            G++I+NS
Sbjct  121  GMSISNS  127



>ref|XP_003398753.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Bombus terrestris]
Length=311

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKW-RPDEKDD  325
            +WC IESDPGVFTELI++  V+G QVEEL+SLD +  +NL+PI+GLIFLFKW + DE   
Sbjct  7    NWCLIESDPGVFTELIKEFGVQGAQVEELWSLDDEQFDNLKPIHGLIFLFKWVQDDEPSG  66

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +V+ +    +FFA QVINNACATQAILS+LLN    DI +GP L + K F ++F   ++
Sbjct  67   SIVLDNRLDKIFFAKQVINNACATQAILSVLLNCKHSDISLGPNLEEFKNFCQSFDANMR  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>ref|XP_397252.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Apis 
mellifera]
 ref|XP_006610659.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Apis dorsata]
Length=311

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKW-RPDEKDD  325
            +WC IESDPGVFTELI++  V+G QVEEL+SLD +  +NL+PI+GLIFLFKW + DE   
Sbjct  7    NWCLIESDPGVFTELIKEFGVQGAQVEELWSLDDEQFDNLKPIHGLIFLFKWVQDDEPSG  66

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +V+ +    +FFA QVINNACATQAILS+LLN    DI +GP L + K F ++F   ++
Sbjct  67   SIVLDNRLDKIFFAKQVINNACATQAILSVLLNCKHSDISLGPNLEEFKNFCQSFDANMR  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>ref|XP_009039691.1| hypothetical protein AURANDRAFT_69917 [Aureococcus anophagefferens]
 gb|EGB05560.1| hypothetical protein AURANDRAFT_69917 [Aureococcus anophagefferens]
Length=301

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 87/127 (69%), Gaps = 3/127 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            MSWCTIESDPGVFTEL+++  V G +  ELYSLD   L    P++GLIFLFKW   EKDD
Sbjct  1    MSWCTIESDPGVFTELVEKFGVSGCEFAELYSLDDGELARHAPVFGLIFLFKW-TGEKDD  59

Query  326  R--LVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELK  499
            R  L   +  P LF+A Q++NNACATQAILS+LLN   +  G  L +LK F    P +++
Sbjct  60   RATLSFDEAPPGLFYAKQMVNNACATQAILSVLLNCEHVSRGATLDELKAFGAELPFDMR  119

Query  500  GLAINNS  520
            GLAI NS
Sbjct  120  GLAIENS  126



>ref|XP_003079348.1| Ubiquitin C-terminal hydrolase UCHL1 (ISS) [Ostreococcus tauri]
 emb|CAL54006.1| Ubiquitinyl hydrolase, UCH37 type [Ostreococcus tauri]
Length=318

 Score =   145 bits (367),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 91/128 (71%), Gaps = 3/128 (2%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            M W TIESDPGVFTEL + + V+GV  EELY+L+ D L  L PIYGLIFLFK+R D+  +
Sbjct  1    MEWTTIESDPGVFTELARAIGVRGVAFEELYTLEADELKRLEPIYGLIFLFKYRGDDGGE  60

Query  326  RLVI--KDPSPNLFFASQVINNACATQAILSILLNSPD-IDIGPELSQLKEFTKNFPPEL  496
               I  +  S  +FFA Q+I NACATQA+LS+LLN+ D +++G  LS  KEFT  F  E 
Sbjct  61   VCAIDAEAESKGVFFARQMIQNACATQAVLSVLLNADDKLELGETLSAFKEFTSEFDAET  120

Query  497  KGLAINNS  520
            KGLAI+NS
Sbjct  121  KGLAISNS  128



>ref|XP_003486108.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Bombus impatiens]
Length=311

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKW-RPDEKDD  325
            +WC IESDPGVFTELI++  V+G QVEEL+SLD +  +NL+PI+GLIFLFKW + DE   
Sbjct  7    NWCLIESDPGVFTELIKEFGVQGAQVEELWSLDDEQFDNLKPIHGLIFLFKWVQDDEPSG  66

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +V+ +    +FFA QVINNACATQAILS+LLN    D+ +GP L + K F ++F   ++
Sbjct  67   SIVLDNRLDKIFFAKQVINNACATQAILSVLLNCKHSDVSLGPNLEEFKNFCQSFDANMR  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>ref|XP_011157433.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Solenopsis 
invicta]
Length=311

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 94/127 (74%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  VKG QVEEL+SLD +  N L+PI+GLIFLFKW  D++   
Sbjct  7    NWCLIESDPGVFTELIKEFGVKGAQVEELWSLDEEQFNELKPIHGLIFLFKWVQDDELSG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +++D     +FFA QVINNACATQAILS+LLN    DI +GP L + K F ++F   ++
Sbjct  67   NIVQDNRLDKIFFAKQVINNACATQAILSVLLNCKHTDISLGPNLEEFKNFCQSFDANMR  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>gb|EPZ34815.1| Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 domain-containing 
protein [Rozella allomycis CSF55]
Length=315

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 85/124 (69%), Gaps = 0/124 (0%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
             WC IESDP VFTEL++ + VKG+QVEE+YS D+D L  L P+YGLIFLFKW    K   
Sbjct  5    GWCLIESDPAVFTELLENIGVKGLQVEEVYSFDVDTLKELEPVYGLIFLFKWEGKNKTTE  64

Query  329  LVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLA  508
                   PNLFFA+Q+INNACATQAIL+I LN  D  +  EL   K+FTK F  E KG+A
Sbjct  65   QEQLFDDPNLFFANQMINNACATQAILNICLNLDDNVLNEELLNFKQFTKEFDSETKGIA  124

Query  509  INNS  520
            I NS
Sbjct  125  IGNS  128



>ref|XP_011150268.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Harpegnathos 
saltator]
 gb|EFN77358.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Harpegnathos 
saltator]
Length=311

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 94/127 (74%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  VKG QVEEL+SLD +  +NL+PI+GLIFLFKW  D++   
Sbjct  7    NWCLIESDPGVFTELIKEFGVKGAQVEELWSLDDEQFDNLKPIHGLIFLFKWVQDDELSG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +++D     +FFA Q+INNACATQAILS+LLN    DI +GP L   K F ++F   ++
Sbjct  67   NIVQDSRLDKIFFAKQIINNACATQAILSVLLNCKHADISLGPNLEDFKNFCQSFDANMR  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>ref|XP_011311253.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Fopius 
arisanus]
Length=312

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKW-RPDEKDD  325
            +WC IESDPGVFTELI++    G QVEEL+SLD D  +NL+PI+GLIFLFKW + DE   
Sbjct  7    NWCLIESDPGVFTELIREFGATGAQVEELWSLDDDQFDNLKPIHGLIFLFKWVKDDEPAG  66

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLNS--PDIDIGPELSQLKEFTKNFPPELK  499
             LV  +    +FFA QVINNACATQAI+S+LLNS  PD+ IG  L + K F ++F   ++
Sbjct  67   TLVQDNRLEKIFFAKQVINNACATQAIVSVLLNSKHPDLTIGSNLEEFKTFCQSFDATMR  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>ref|XP_002409195.1| ubiquitin C-terminal hydrolase, putative [Ixodes scapularis]
 gb|EEC02305.1| ubiquitin C-terminal hydrolase, putative [Ixodes scapularis]
Length=327

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI+   VKGVQVEEL+SLD D+   L+P++GLIFLFKW  +E+    
Sbjct  11   WCLIESDPGVFTELIKGFGVKGVQVEELWSLDRDSFEKLKPVHGLIFLFKWYKNEEPSGS  70

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAILS+LLN   PDI +G  L   ++F ++F   +KG
Sbjct  71   VVQDNRLDKIFFAKQVINNACATQAILSVLLNVKHPDISLGETLLSFRDFCQSFDATMKG  130

Query  503  LAINNS  520
            L ++NS
Sbjct  131  LTLSNS  136



>ref|XP_011344648.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Cerapachys 
biroi]
 gb|EZA50555.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Cerapachys 
biroi]
Length=311

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  VKG QVEEL+SLD +  ++L+PI+GLIFLFKW  D++   
Sbjct  7    NWCLIESDPGVFTELIKEFGVKGAQVEELWSLDDEQFDDLKPIHGLIFLFKWVQDDELSG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +++D     +FFA QVINNACATQAILS+LLN    DI +GP L + K F ++F   ++
Sbjct  67   NIVQDSRLDKIFFAKQVINNACATQAILSVLLNCKHADISLGPNLEEFKNFCQSFDANMR  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>gb|ADD24143.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Lepeophtheirus 
salmonis]
Length=233

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI +   KGVQVEEL+SLD +   +L+P++GLIFLFK  PD     
Sbjct  5    NWCLIESDPGVFTELIHKFGTKGVQVEELWSLDKEQFVDLKPVHGLIFLFKMVPDHNPQG  64

Query  329  LVIKDPSPN-LFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             V+ D   + +FFA QVINNACATQAILS+LLN   P++++G  LS  KEF  +F   +K
Sbjct  65   TVVLDSRVDKMFFAKQVINNACATQAILSVLLNVDHPELELGTTLSNFKEFCSSFDSAMK  124

Query  500  GLAINNS  520
            GL+++NS
Sbjct  125  GLSLSNS  131



>ref|NP_001279101.1| ubiquitin carboxyl-terminal hydrolase L5 [Callorhinchus milii]
 gb|AFK11556.1| ubiquitin carboxyl-terminal hydrolase isozyme L5-like protein 
[Callorhinchus milii]
Length=329

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    KGVQVEE++SL+ +  + L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCKGVQVEEIWSLEPEHFDKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILL--NSPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D     +FFA QVINNACATQAI+S+LL  N  DI++G  L + KEF+++F   +KG
Sbjct  68   IVQDSRLEKIFFAKQVINNACATQAIISVLLNCNHSDIELGETLGEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_011068867.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Acromyrmex 
echinatior]
Length=311

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  VKG QVEEL+SLD +  N L PI+GLIFLFKW  D++   
Sbjct  7    NWCLIESDPGVFTELIKEFGVKGAQVEELWSLDDEQFNELMPIHGLIFLFKWVQDDELSG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +++D     +FFA QVINNACATQAILS+LLN    DI +GP L + K F ++F   ++
Sbjct  67   NIVQDNRLDKIFFAKQVINNACATQAILSVLLNCKHADISLGPNLEEFKNFCQSFDANMR  126

Query  500  GLAINNS  520
            GLA++NS
Sbjct  127  GLALSNS  133



>ref|XP_002939132.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Xenopus 
(Silurana) tropicalis]
Length=329

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G+QVEE++SL+ +   +L+P+ GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFEDLQPVQGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLNS--PDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+SILLN+   D+ +G  LS+ KEFT++F   +KG
Sbjct  68   VVQDSRLDTIFFAKQVINNACATQAIISILLNTTHTDVHLGETLSEFKEFTQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_010566311.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X2 [Haliaeetus leucocephalus]
Length=298

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLESENFEKLKPVHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCVHQDIHLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|XP_004358376.1| peptidase C12 family protein [Dictyostelium fasciculatum]
 gb|EGG20526.1| peptidase C12 family protein [Dictyostelium fasciculatum]
Length=349

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 88/125 (70%), Gaps = 5/125 (4%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
             WCTIESDPGVFTELI+ M VK VQVEELYSLD    + L+P+YGL+FLFKW        
Sbjct  6    GWCTIESDPGVFTELIENMGVKDVQVEELYSLDASEFSKLKPVYGLVFLFKWDGKHYSSS  65

Query  329  LVIKDPSPN--LFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKG  502
               ++P  N  LFFA QVINNACATQAILSIL+N+ DI++  EL+  K+F K   PE +G
Sbjct  66   ---QEPCDNQELFFAKQVINNACATQAILSILMNNKDIEMSDELTNFKDFCKFLMPEDRG  122

Query  503  LAINN  517
             AI N
Sbjct  123  DAIGN  127



>ref|NP_001168238.1| uncharacterized protein LOC100382000 [Zea mays]
 gb|ACN27537.1| unknown [Zea mays]
Length=322

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  266  LRPIYGLIFLFKWRPDEKDDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIG  445
            LRP+YGLIFLFKW P EKD+R V++DP+PNLFFA QVI NACATQAILS+L+N P+IDIG
Sbjct  35   LRPVYGLIFLFKWIPGEKDERPVVRDPNPNLFFAHQVITNACATQAILSVLMNRPEIDIG  94

Query  446  PELSQLKEFTKNFPPELKGLAINNS  520
            PELSQLKEFT  F P+LKGLAI+NS
Sbjct  95   PELSQLKEFTGAFTPDLKGLAISNS  119



>ref|XP_001696392.1| ubiquitin carboxyl-terminal hydrolase [Chlamydomonas reinhardtii]
 gb|EDP08369.1| ubiquitin carboxyl-terminal hydrolase [Chlamydomonas reinhardtii]
 gb|ADF43147.1| UBCH1p [Chlamydomonas reinhardtii]
Length=331

 Score =   144 bits (362),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 94/127 (74%), Gaps = 6/127 (5%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            M W TIESDPGVFTELI+ + VKGVQVEEL+SL  D L  L P++GL+FLFKW+ +    
Sbjct  1    MEWTTIESDPGVFTELIENIGVKGVQVEELWSL--DQLRELSPVFGLVFLFKWKKEPV--  56

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
            R      +  +FFA QVI+NACATQAIL+ILLN  +P +D+G EL+ L+EF  +F P +K
Sbjct  57   RPATTTDAGQVFFAKQVISNACATQAILNILLNVKAPGLDLGTELANLREFVSDFDPTMK  116

Query  500  GLAINNS  520
            GLAI+NS
Sbjct  117  GLAISNS  123



>gb|AAY86988.1| ubiquitin C-terminal hydrolase [Ictalurus punctatus]
Length=265

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC ++SDPGVFTELI+    KG QVEE++S++ +   NL+P++GLIFLFKW+P E+    
Sbjct  8    WCLMKSDPGVFTELIKGFGCKGAQVEEIWSMEPENFQNLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D     +FFA QVINNACATQAI+S+LLN   PD+ +G  L++ +EF+++F   +KG
Sbjct  68   IVQDSRLDQIFFAKQVINNACATQAIVSVLLNCFHPDMHLGETLTEFREFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_005348524.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X2 [Microtus ochrogaster]
Length=328

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ ++   L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLETIFFAKQVINNACATQAIISVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_005348523.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X1 [Microtus ochrogaster]
Length=329

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ ++   L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLETIFFAKQVINNACATQAIISVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_007608356.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X4 [Cricetulus griseus]
Length=335

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +GVQVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  14   WCLMESDPGVFTELIKGFGCRGVQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  73

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  74   VVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHRDVHLGETLSEFKEFSQSFDAAMKG  133

Query  503  LAINNS  520
            LA++NS
Sbjct  134  LALSNS  139



>ref|XP_003507104.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X1 [Cricetulus griseus]
 gb|EGV99830.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Cricetulus 
griseus]
 gb|ERE73064.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Cricetulus 
griseus]
Length=329

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +GVQVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGVQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHRDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_007645806.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X2 [Cricetulus griseus]
Length=328

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +GVQVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGVQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHRDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_001845763.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Culex quinquefasciatus]
 gb|EDS41583.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Culex quinquefasciatus]
Length=323

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 89/125 (71%), Gaps = 2/125 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI++  V+GVQVEEL+SLD +    L P++GLIFLFKW  DE    +
Sbjct  8    WCLIESDPGVFTELIREFGVEGVQVEELWSLDEERFKELDPVHGLIFLFKWVKDEPAGSI  67

Query  332  VIKDPSPNLFFASQVINNACATQAILSILLNS--PDIDIGPELSQLKEFTKNFPPELKGL  505
            V       +FFA QVINNACATQAILSILLNS   DI +G  L+  KEF  +F  + KGL
Sbjct  68   VQDSRLEKIFFAKQVINNACATQAILSILLNSKHSDIKLGSTLTDFKEFCMSFDAQNKGL  127

Query  506  AINNS  520
            A++N+
Sbjct  128  ALSNA  132



>gb|AAH89167.1| LOC733154 protein [Xenopus laevis]
Length=325

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G+QVEE++SL+ +   +L+P+ GLIFLFKW+P E+    
Sbjct  4    WCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFVDLQPVQGLIFLFKWQPGEEPAGS  63

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLNSP--DIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+SILLN+   D+ +G  LS+ KEFT++F   +KG
Sbjct  64   VVQDSRLDTIFFAKQVINNACATQAIISILLNTTHNDVHLGETLSEFKEFTQSFDAAMKG  123

Query  503  LAINNS  520
            LA++NS
Sbjct  124  LALSNS  129



>ref|XP_010566310.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X1 [Haliaeetus leucocephalus]
Length=331

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLESENFEKLKPVHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCVHQDIHLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|NP_062508.2| ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1 [Mus 
musculus]
 sp|Q9WUP7.2|UCHL5_MOUSE RecName: Full=Ubiquitin carboxyl-terminal hydrolase isozyme L5; 
Short=UCH-L5; AltName: Full=Ubiquitin C-terminal hydrolase 
UCH37; AltName: Full=Ubiquitin thioesterase L5 [Mus musculus]
 dbj|BAB27412.1| unnamed protein product [Mus musculus]
 gb|EDL39510.1| ubiquitin carboxyl-terminal esterase L5, isoform CRA_c [Mus musculus]
Length=329

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ ++   L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>pdb|3RIS|A Chain A, Crystal Structure Of The Catalytic Domain Of Uchl5, 
A Proteasome- Associated Human Deubiquitinating Enzyme, Reveals 
An Unproductive Form Of The Enzyme
 pdb|3RIS|B Chain B, Crystal Structure Of The Catalytic Domain Of Uchl5, 
A Proteasome- Associated Human Deubiquitinating Enzyme, Reveals 
An Unproductive Form Of The Enzyme
 pdb|3RIS|C Chain C, Crystal Structure Of The Catalytic Domain Of Uchl5, 
A Proteasome- Associated Human Deubiquitinating Enzyme, Reveals 
An Unproductive Form Of The Enzyme
 pdb|3RIS|D Chain D, Crystal Structure Of The Catalytic Domain Of Uchl5, 
A Proteasome- Associated Human Deubiquitinating Enzyme, Reveals 
An Unproductive Form Of The Enzyme
Length=245

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  13   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  72

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  73   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKG  132

Query  503  LAINNS  520
            LA++NS
Sbjct  133  LALSNS  138



>gb|EDL39509.1| ubiquitin carboxyl-terminal esterase L5, isoform CRA_b [Mus musculus]
Length=353

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ ++   L+P++GLIFLFKW+P E+    
Sbjct  33   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGS  92

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  93   VVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKG  152

Query  503  LAINNS  520
            LA++NS
Sbjct  153  LALSNS  158



>ref|XP_007421056.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X3 [Python bivittatus]
Length=331

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     LFFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTLFFAKQVINNACATQAIVSVLLNCTHQDIHLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|XP_005175420.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Musca 
domestica]
Length=324

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  V+G QVEE++SLD ++  +L PI+GLIFLFKW  D++   
Sbjct  6    NWCLIESDPGVFTELIKEFGVEGAQVEEIWSLDAESFKSLEPIHGLIFLFKWVQDDEPAG  65

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             V+KD    N+FFA QVINNACATQAILS+LLN    DI +G  LS  KEF + F P  K
Sbjct  66   SVVKDDRLQNIFFAKQVINNACATQAILSVLLNCKHDDIKLGDTLSNFKEFCQFFDPYNK  125

Query  500  GLAINNS  520
            GL ++N+
Sbjct  126  GLTLSNA  132



>ref|NP_001089066.1| ubiquitin carboxyl-terminal hydrolase L5 [Xenopus laevis]
 gb|AAI22496.1| LOC733154 protein [Xenopus laevis]
Length=329

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G+QVEE++SL+ +   +L+P+ GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGIQVEEIWSLEQEHFVDLQPVQGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLNSP--DIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+SILLN+   D+ +G  LS+ KEFT++F   +KG
Sbjct  68   VVQDSRLDTIFFAKQVINNACATQAIISILLNTTHNDVHLGETLSEFKEFTQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_007645807.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X3 [Cricetulus griseus]
 gb|ERE73063.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Cricetulus 
griseus]
Length=324

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +GVQVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGVQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHRDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|NP_001153338.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 2 [Mus 
musculus]
 pdb|4WLQ|A Chain A, Crystal Structure Of Much37-hrpn13 Ctd Complex
 pdb|4WLR|A Chain A, Crystal Structure Of Much37-hrpn13 Ctd-hub Complex
 gb|AAD50311.1|AF175903_1 ubiquitin C-terminal hydrolase UCH-L5 [Mus musculus]
 dbj|BAB31005.1| unnamed protein product [Mus musculus]
 gb|AAH06891.1| Ubiquitin carboxyl-terminal esterase L5 [Mus musculus]
Length=328

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ ++   L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_004578864.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X3 [Ochotona princeps]
Length=328

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ ++   L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCSHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_003387076.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5-like 
[Amphimedon queenslandica]
Length=351

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI+   V GVQVEE++SLD D L NL+P++GLIFL+KWRPD+     
Sbjct  6    WCLIESDPGVFTELIRGFGVSGVQVEEVWSLDNDILLNLKPVHGLIFLYKWRPDDNVQGS  65

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D    ++FFA Q I NACATQA+LS+LLN    D+++G  L+  KEF  +F P  +G
Sbjct  66   IVEDSRIRDIFFARQEIKNACATQAVLSVLLNVTHSDVELGSVLTDFKEFAASFSPTDRG  125

Query  503  LAINNS  520
            L++ NS
Sbjct  126  LSLTNS  131



>ref|XP_006529823.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X1 [Mus musculus]
Length=324

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ ++   L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_004578863.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X2 [Ochotona princeps]
Length=329

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ ++   L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCSHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_006250025.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X4 [Rattus norvegicus]
Length=291

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|NP_001187184.1| ubiquitin carboxy-terminal hydrolase L5 [Ictalurus punctatus]
 gb|ACI42313.1| ubiquitin carboxy-terminal hydrolase L5 [Ictalurus punctatus]
Length=329

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    KG QVEE++S++ +   NL P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFQNLEPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D     +FFA QVINNACATQAI+S+LLN   PD+ +G  L++ +EF+++F   +KG
Sbjct  68   IVQDSRLDQIFFAKQVINNACATQAIVSVLLNCSHPDMHLGETLTEFREFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_004625354.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Octodon 
degus]
Length=326

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ ++   L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_967733.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Tribolium 
castaneum]
 gb|EEZ99725.1| hypothetical protein TcasGA2_TC002490 [Tribolium castaneum]
Length=323

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI++  VKGVQVEEL+SL+ +    L+PI+GLIFLFKW  D++   
Sbjct  7    NWCLIESDPGVFTELIREFGVKGVQVEELWSLEPEQFEKLKPIHGLIFLFKWTKDDEPSG  66

Query  329  LVIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             +++D     +FFA QVI NACATQAILS+LLN    D+ +G  L++LK+F + F   +K
Sbjct  67   SIVQDSRLEKIFFAKQVIENACATQAILSVLLNCRHADLKLGHTLTELKDFCQGFDANMK  126

Query  500  GLAINNS  520
            GL I+NS
Sbjct  127  GLTISNS  133



>ref|XP_002786136.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER17932.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Perkinsus 
marinus ATCC 50983]
Length=327

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 90/128 (70%), Gaps = 5/128 (4%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALN----NLRPIYGLIFLFKWRPDE  316
             WCTIESDPGVFTEL   + VK VQ +ELYSLD D L     N+ P+YGL+FLFKW  + 
Sbjct  12   GWCTIESDPGVFTELCDDLGVKDVQFKELYSLDEDTLKLECANV-PVYGLVFLFKWDKEV  70

Query  317  KDDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPEL  496
            +D R  +  P   +F+ASQVINNACATQAILS+LLN+  +DIG  L+ L++FT  F  + 
Sbjct  71   EDKRTPLVPPPDGMFYASQVINNACATQAILSVLLNAEGLDIGEVLTNLRDFTAGFDADT  130

Query  497  KGLAINNS  520
            +G AI NS
Sbjct  131  RGWAIGNS  138



>gb|AAD31534.1|AF148447_1 ubiquitin C-terminal hydrolase UCH37 [Mus musculus]
Length=329

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFT+LI++   +G QVEE++SL+ ++   L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTKLIKRFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|NP_001006530.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Gallus gallus]
 emb|CAG31792.1| hypothetical protein RCJMB04_11d7 [Gallus gallus]
Length=297

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+PI+GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPIHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIRLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|XP_002774137.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER05953.1| ubiquitin carboxyl-terminal hydrolase isozyme L5, putative [Perkinsus 
marinus ATCC 50983]
Length=331

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 90/128 (70%), Gaps = 5/128 (4%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALN----NLRPIYGLIFLFKWRPDE  316
             WCTIESDPGVFTEL   + VK VQ +ELYSLD D L     N+ P+YGL+FLFKW  + 
Sbjct  12   GWCTIESDPGVFTELCDDLGVKDVQFKELYSLDEDTLKLECANV-PVYGLVFLFKWDKEV  70

Query  317  KDDRLVIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPEL  496
            +D R  +  P   +F+ASQVINNACATQAILS+LLN+  +DIG  L+ L++FT  F  + 
Sbjct  71   EDKRTPLVPPPDGMFYASQVINNACATQAILSVLLNAEGLDIGEVLTNLRDFTAGFDADT  130

Query  497  KGLAINNS  520
            +G AI NS
Sbjct  131  RGWAIGNS  138



>ref|XP_010769025.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Notothenia 
coriiceps]
Length=329

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    KG QVEE++S++ +  +NL+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFDNLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D     +FFA QVINNACATQAI+S+LLN    D+ +G  L++ +EF+++F P +KG
Sbjct  68   IVQDSRLDQIFFAKQVINNACATQAIVSVLLNCFHSDMLVGDTLTEFREFSQSFDPAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>gb|ACO08947.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Osmerus mordax]
Length=329

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    KG QVEE++S++ +   NL+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D    N+FFA QVINNACATQAI+S+LLN   PD+ +G  L++ +EF+ +F   +KG
Sbjct  68   IVQDSRLDNIFFAKQVINNACATQAIVSVLLNCTHPDMLLGETLTEFREFSLSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>gb|AAT02518.1| ubitquitin C-terminal hydrolase [Chlamydomonas reinhardtii]
Length=331

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 6/127 (5%)
 Frame = +2

Query  146  MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDD  325
            M W TIESDPGVFTELI+ + VKGVQVEEL+SL  D L  L P++GL+FLFKW+ +    
Sbjct  1    MEWTTIESDPGVFTELIENIGVKGVQVEELWSL--DQLRELSPVFGLVFLFKWKKEPV--  56

Query  326  RLVIKDPSPNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
            R      +  +FFA QVI+NACATQAIL+ILLN  +P +D+G EL+  +EF  +F P +K
Sbjct  57   RPATTTDAGQVFFAKQVISNACATQAILNILLNVKAPGLDLGTELANFREFVSDFDPTMK  116

Query  500  GLAINNS  520
            GLAI+NS
Sbjct  117  GLAISNS  123



>ref|XP_009086698.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X1 [Serinus canaria]
Length=331

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIHLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|XP_005533558.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X1 [Pseudopodoces humilis]
Length=331

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIHLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|NP_998249.1| ubiquitin carboxyl-terminal hydrolase isozyme L5 [Danio rerio]
 gb|AAH67545.1| Ubiquitin carboxyl-terminal hydrolase L5 [Danio rerio]
Length=329

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    KG QVEE++S++ +   NL+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D     +FFA QVINNACATQAI+S+LLN   PD+ +G  L++ KEF+ +F   +KG
Sbjct  68   IVQDSRLDQIFFAKQVINNACATQAIISVLLNCTHPDMLLGETLTEFKEFSNSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_007421055.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X2 [Python bivittatus]
Length=341

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     LFFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTLFFAKQVINNACATQAIVSVLLNCTHQDIHLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|XP_005142948.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X1 [Melopsittacus undulatus]
Length=331

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIHLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|XP_005533559.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X2 [Pseudopodoces humilis]
Length=330

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIHLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|XP_009086700.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X3 [Serinus canaria]
Length=328

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_007560636.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Poecilia 
formosa]
 ref|XP_008404891.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 [Poecilia 
reticulata]
Length=329

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    KG QVEE++S++ +   NL+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            +++D    ++FFA QVINNACATQAI+S+LLN   PD+ +G  L++ +EF+++F   +KG
Sbjct  68   IVQDSRLDHIFFAKQVINNACATQAIISVLLNCSHPDMLLGDTLTEFREFSQSFDGAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_315540.2| AGAP005540-PA [Anopheles gambiae str. PEST]
 gb|EAA11802.2| AGAP005540-PA [Anopheles gambiae str. PEST]
Length=322

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC IESDPGVFTELI++  V GVQVEEL+SLD ++  +L P++GL+FLFKW  D++    
Sbjct  8    WCLIESDPGVFTELIKEFGVDGVQVEELWSLDENSFKDLEPVHGLVFLFKWVKDDEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLNS--PDIDIGPELSQLKEFTKNFPPELKG  502
            +++D     +FFA QVINNACATQAILSILLN+  PDI +G  L+  KEF   F    KG
Sbjct  68   IVQDSRLEKIFFAKQVINNACATQAILSILLNATHPDIKLGSTLTDFKEFACTFDAYNKG  127

Query  503  LAINNS  520
            LA++N+
Sbjct  128  LALSNA  133



>ref|XP_006026558.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X2 [Alligator sinensis]
Length=330

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDIHLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|XP_005142949.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X2 [Melopsittacus undulatus]
Length=330

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIHLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|XP_004578862.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X1 [Ochotona princeps]
Length=331

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ ++   L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCSHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_006276596.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X1 [Alligator mississippiensis]
Length=331

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  10   WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  69

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  70   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDIHLGETLSEFKEFSQSFDAAMKG  129

Query  503  LAINNS  520
            LA++NS
Sbjct  130  LALSNS  135



>ref|XP_005706672.1| ubiquitin carboxyl-terminal hydrolase L5 [Galdieria sulphuraria]
 gb|EME30152.1| ubiquitin carboxyl-terminal hydrolase L5 [Galdieria sulphuraria]
Length=299

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            W TIESDP VFT+L++ + VK V+VEE+  LD   L +L P++GLIFLFKW PD+  ++ 
Sbjct  6    WNTIESDPAVFTQLLEDLGVKDVKVEEVLQLDAAFLRSLEPVHGLIFLFKWLPDQGSEQE  65

Query  332  VIKDPSPNLFFASQVINNACATQAILSILLNSPDIDIGPELSQLKEFTKNFPPELKGLAI  511
            +      +LFFA+QVI NAC TQA+LS++ N+ D+++G EL++ KEFTK+F P+ +GLA+
Sbjct  66   LSFSQDVDLFFANQVIQNACGTQALLSVVFNAKDLELGSELAEFKEFTKDFDPQTRGLAL  125

Query  512  NNS  520
            +NS
Sbjct  126  SNS  128



>gb|ACO12616.1| Ubiquitin carboxyl-terminal hydrolase isozyme L5 [Lepeophtheirus 
salmonis]
Length=314

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 3/127 (2%)
 Frame = +2

Query  149  SWCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDR  328
            +WC IESDPGVFTELI +   KGVQVEEL+SLD +   +L+P++GLIFLFK  PD     
Sbjct  5    NWCLIESDPGVFTELIHKFGTKGVQVEELWSLDKEQFVDLKPVHGLIFLFKMVPDHNPQG  64

Query  329  LVIKDPSPN-LFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELK  499
             V+ D   + +FFA QVINNACATQAILS+LLN   P++++G  LS  KEF  +F   +K
Sbjct  65   TVVLDSRVDKMFFAKQVINNACATQAILSVLLNVDHPELELGTTLSNFKEFCSSFDSAMK  124

Query  500  GLAINNS  520
            GL+++NS
Sbjct  125  GLSLSNS  131



>ref|XP_009086699.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X2 [Serinus canaria]
Length=329

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    DI +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



>ref|XP_006250022.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 
X2 [Rattus norvegicus]
 gb|EDM09603.1| rCG45997 [Rattus norvegicus]
Length=329

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = +2

Query  152  WCTIESDPGVFTELIQQMQVKGVQVEELYSLDIDALNNLRPIYGLIFLFKWRPDEKDDRL  331
            WC +ESDPGVFTELI+    +G QVEE++SL+ +    L+P++GLIFLFKW+P E+    
Sbjct  8    WCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGS  67

Query  332  VIKDPS-PNLFFASQVINNACATQAILSILLN--SPDIDIGPELSQLKEFTKNFPPELKG  502
            V++D     +FFA QVINNACATQAI+S+LLN    D+ +G  LS+ KEF+++F   +KG
Sbjct  68   VVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKG  127

Query  503  LAINNS  520
            LA++NS
Sbjct  128  LALSNS  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800