BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L10

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631150.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    135   5e-34   Nicotiana tomentosiformis
ref|XP_009791274.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    135   5e-34   Nicotiana sylvestris
ref|XP_009631151.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    134   6e-34   
ref|XP_009791275.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    134   7e-34   Nicotiana sylvestris
ref|XP_004236965.1|  PREDICTED: ubiquitin receptor RAD23c               133   2e-33   Solanum lycopersicum
ref|XP_006367045.1|  PREDICTED: ubiquitin receptor RAD23c-like          133   3e-33   
ref|XP_010317192.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    132   3e-33   Solanum lycopersicum
ref|XP_004233495.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    132   3e-33   Solanum lycopersicum
ref|XP_004233496.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    132   4e-33   Solanum lycopersicum
ref|XP_009597821.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    127   4e-33   Nicotiana tomentosiformis
gb|KDO58999.1|  hypothetical protein CISIN_1g014118mg                   129   2e-32   Citrus sinensis [apfelsine]
ref|XP_010647738.1|  PREDICTED: ubiquitin receptor RAD23c isoform X1    130   2e-32   Vitis vinifera
ref|XP_002282352.1|  PREDICTED: ubiquitin receptor RAD23c isoform X2    130   2e-32   Vitis vinifera
emb|CDP19777.1|  unnamed protein product                                130   3e-32   Coffea canephora [robusta coffee]
ref|XP_011097188.1|  PREDICTED: ubiquitin receptor RAD23c-like          130   3e-32   Sesamum indicum [beniseed]
ref|XP_011099561.1|  PREDICTED: ubiquitin receptor RAD23c-like          129   4e-32   Sesamum indicum [beniseed]
ref|XP_009607597.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    129   5e-32   Nicotiana tomentosiformis
ref|XP_009607598.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    129   5e-32   Nicotiana tomentosiformis
ref|XP_006363121.1|  PREDICTED: ubiquitin receptor RAD23c-like          129   6e-32   Solanum tuberosum [potatoes]
ref|XP_007227719.1|  hypothetical protein PRUPE_ppa007047mg             129   6e-32   Prunus persica
gb|ACJ83348.1|  unknown                                                 124   6e-32   Medicago truncatula
gb|KDO59000.1|  hypothetical protein CISIN_1g014118mg                   129   7e-32   Citrus sinensis [apfelsine]
ref|XP_008243218.1|  PREDICTED: ubiquitin receptor RAD23d-like          129   9e-32   
ref|XP_010498530.1|  PREDICTED: ubiquitin receptor RAD23c-like          129   9e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010463666.1|  PREDICTED: ubiquitin receptor RAD23c               129   1e-31   Camelina sativa [gold-of-pleasure]
emb|CDX74251.1|  BnaA03g27960D                                          128   1e-31   
ref|XP_011070815.1|  PREDICTED: ubiquitin receptor RAD23c-like          129   1e-31   
ref|XP_009134681.1|  PREDICTED: ubiquitin receptor RAD23c               128   1e-31   Brassica rapa
gb|KDO58993.1|  hypothetical protein CISIN_1g014118mg                   128   1e-31   Citrus sinensis [apfelsine]
ref|XP_004232367.1|  PREDICTED: ubiquitin receptor RAD23d               128   1e-31   
ref|XP_006482261.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    128   2e-31   Citrus sinensis [apfelsine]
ref|XP_006482260.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    128   2e-31   Citrus sinensis [apfelsine]
gb|KDO58994.1|  hypothetical protein CISIN_1g014118mg                   128   2e-31   Citrus sinensis [apfelsine]
ref|XP_008361862.1|  PREDICTED: ubiquitin receptor RAD23c-like          120   2e-31   
gb|KDO58997.1|  hypothetical protein CISIN_1g014118mg                   128   2e-31   Citrus sinensis [apfelsine]
ref|XP_009597820.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    126   2e-31   Nicotiana tomentosiformis
gb|KDO58996.1|  hypothetical protein CISIN_1g014118mg                   128   2e-31   Citrus sinensis [apfelsine]
ref|XP_007223091.1|  hypothetical protein PRUPE_ppa007032mg             127   2e-31   
gb|AII99835.1|  putative DNA repair protein RAD23-3-like protein        128   2e-31   Nicotiana tabacum [American tobacco]
ref|XP_009784661.1|  PREDICTED: ubiquitin receptor RAD23d               127   2e-31   Nicotiana sylvestris
ref|XP_006430787.1|  hypothetical protein CICLE_v10011886mg             127   2e-31   
ref|XP_006430789.1|  hypothetical protein CICLE_v10011886mg             127   2e-31   Citrus clementina [clementine]
gb|KDO58995.1|  hypothetical protein CISIN_1g014118mg                   127   3e-31   Citrus sinensis [apfelsine]
gb|EYU44643.1|  hypothetical protein MIMGU_mgv1a006427mg                128   3e-31   Erythranthe guttata [common monkey flower]
ref|XP_006430788.1|  hypothetical protein CICLE_v10011886mg             127   3e-31   Citrus clementina [clementine]
emb|CDX91998.1|  BnaC03g33000D                                          127   3e-31   
ref|XP_009781758.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    127   3e-31   Nicotiana sylvestris
gb|KFK37713.1|  hypothetical protein AALP_AA3G019400                    127   3e-31   Arabis alpina [alpine rockcress]
gb|KFK37714.1|  hypothetical protein AALP_AA3G019400                    127   3e-31   Arabis alpina [alpine rockcress]
ref|XP_009781759.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    127   4e-31   Nicotiana sylvestris
gb|ABB02636.1|  RAD23-like                                              127   4e-31   Solanum tuberosum [potatoes]
ref|NP_001274760.1|  uncharacterized protein LOC102577665               126   5e-31   Solanum tuberosum [potatoes]
gb|KDO58998.1|  hypothetical protein CISIN_1g014118mg                   127   5e-31   Citrus sinensis [apfelsine]
ref|XP_010485565.1|  PREDICTED: ubiquitin receptor RAD23c-like          127   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_004172134.1|  PREDICTED: putative DNA repair protein RAD23...    126   8e-31   
gb|ACU18469.1|  unknown                                                 121   9e-31   Glycine max [soybeans]
ref|XP_004135098.1|  PREDICTED: putative DNA repair protein RAD23...    126   1e-30   
ref|NP_974211.1|  UV excision repair protein RAD23C                     124   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223090.1|  hypothetical protein PRUPE_ppa007032mg             125   1e-30   Prunus persica
ref|XP_010525156.1|  PREDICTED: ubiquitin receptor RAD23c-like          125   1e-30   Tarenaya hassleriana [spider flower]
gb|ABD96960.1|  hypothetical protein                                    125   1e-30   Tarenaya spinosa
ref|XP_006408409.1|  hypothetical protein EUTSA_v10020817mg             125   1e-30   Eutrema salsugineum [saltwater cress]
ref|XP_008446578.1|  PREDICTED: ubiquitin receptor RAD23c-like          125   2e-30   Cucumis melo [Oriental melon]
ref|XP_007033285.1|  Rad23 UV excision repair protein family isof...    124   2e-30   
gb|EYU34397.1|  hypothetical protein MIMGU_mgv1a008220mg                125   2e-30   Erythranthe guttata [common monkey flower]
gb|KGN52072.1|  hypothetical protein Csa_5G608600                       125   2e-30   Cucumis sativus [cucumbers]
ref|XP_008781245.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    125   2e-30   
ref|XP_008781252.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    125   2e-30   Phoenix dactylifera
ref|XP_008781229.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    125   2e-30   
ref|XP_008781237.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    125   2e-30   Phoenix dactylifera
ref|NP_001240201.1|  uncharacterized protein LOC100809066               125   2e-30   Glycine max [soybeans]
ref|XP_010549930.1|  PREDICTED: ubiquitin receptor RAD23c-like          124   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_006299986.1|  hypothetical protein CARUB_v10016200mg             125   3e-30   Capsella rubella
ref|XP_010103792.1|  Putative DNA repair protein RAD23-3                124   5e-30   Morus notabilis
gb|EYU29967.1|  hypothetical protein MIMGU_mgv1a008352mg                124   5e-30   Erythranthe guttata [common monkey flower]
gb|EYU29968.1|  hypothetical protein MIMGU_mgv1a008352mg                124   5e-30   Erythranthe guttata [common monkey flower]
ref|XP_010263550.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    124   5e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010263555.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    124   5e-30   Nelumbo nucifera [Indian lotus]
ref|XP_003555895.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    123   8e-30   Glycine max [soybeans]
ref|XP_002283656.1|  PREDICTED: ubiquitin receptor RAD23c               123   8e-30   Vitis vinifera
ref|XP_006584607.1|  PREDICTED: uncharacterized protein LOC100813...    123   9e-30   
gb|KEH44233.1|  RAD23 UV excision repair family protein                 123   9e-30   Medicago truncatula
ref|XP_007033284.1|  Rad23 UV excision repair protein family isof...    124   9e-30   
ref|XP_006584608.1|  PREDICTED: uncharacterized protein LOC100813...    123   9e-30   
ref|XP_004497101.1|  PREDICTED: putative DNA repair protein RAD23...    123   9e-30   Cicer arietinum [garbanzo]
ref|NP_001242098.1|  uncharacterized protein LOC100813881               123   9e-30   
ref|XP_002516727.1|  uv excision repair protein rad23, putative         123   1e-29   Ricinus communis
ref|XP_006584604.1|  PREDICTED: uncharacterized protein LOC100813...    124   1e-29   
gb|ACU18529.1|  unknown                                                 123   1e-29   Glycine max [soybeans]
ref|XP_006584605.1|  PREDICTED: uncharacterized protein LOC100813...    123   1e-29   Glycine max [soybeans]
ref|XP_006584606.1|  PREDICTED: uncharacterized protein LOC100813...    123   1e-29   
ref|NP_001189793.1|  UV excision repair protein RAD23C                  123   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_186903.1|  UV excision repair protein RAD23C                     123   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010103794.1|  Putative DNA repair protein RAD23-4                124   1e-29   
gb|KHN15504.1|  Putative DNA repair protein RAD23-3                     122   2e-29   Glycine soja [wild soybean]
ref|XP_007215515.1|  hypothetical protein PRUPE_ppa007020mg             122   3e-29   Prunus persica
ref|XP_009356676.1|  PREDICTED: ubiquitin receptor RAD23c-like          121   3e-29   Pyrus x bretschneideri [bai li]
ref|XP_006437672.1|  hypothetical protein CICLE_v10031777mg             118   4e-29   
ref|XP_009356279.1|  PREDICTED: ubiquitin receptor RAD23d-like          121   4e-29   Pyrus x bretschneideri [bai li]
emb|CDP02781.1|  unnamed protein product                                121   4e-29   Coffea canephora [robusta coffee]
ref|XP_008390012.1|  PREDICTED: ubiquitin receptor RAD23c-like          121   4e-29   
ref|XP_008368214.1|  PREDICTED: ubiquitin receptor RAD23c-like          121   5e-29   
ref|XP_002884326.1|  hypothetical protein ARALYDRAFT_477488             121   6e-29   
ref|XP_008230399.1|  PREDICTED: ubiquitin receptor RAD23d               120   7e-29   Prunus mume [ume]
ref|XP_010265160.1|  PREDICTED: ubiquitin receptor RAD23c-like          120   7e-29   Nelumbo nucifera [Indian lotus]
ref|XP_011464118.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    120   8e-29   Fragaria vesca subsp. vesca
ref|XP_004299088.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    120   8e-29   Fragaria vesca subsp. vesca
ref|XP_006437673.1|  hypothetical protein CICLE_v10031777mg             119   9e-29   
ref|XP_003536688.1|  PREDICTED: ubiquitin receptor RAD23c               120   1e-28   Glycine max [soybeans]
gb|KHN05574.1|  Putative DNA repair protein RAD23-3                     120   1e-28   Glycine soja [wild soybean]
ref|XP_007142903.1|  hypothetical protein PHAVU_007G026600g             120   1e-28   Phaseolus vulgaris [French bean]
ref|XP_010926135.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    120   1e-28   Elaeis guineensis
ref|XP_010926134.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    120   1e-28   Elaeis guineensis
ref|XP_008775144.1|  PREDICTED: ubiquitin receptor RAD23d-like          119   2e-28   Phoenix dactylifera
ref|XP_006437674.1|  hypothetical protein CICLE_v10031777mg             119   2e-28   
ref|XP_010926132.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    120   2e-28   Elaeis guineensis
ref|XP_010926133.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    120   2e-28   Elaeis guineensis
ref|XP_010552226.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    119   2e-28   Tarenaya hassleriana [spider flower]
gb|KDP32945.1|  hypothetical protein JCGZ_12976                         119   3e-28   Jatropha curcas
ref|XP_010552232.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    119   3e-28   Tarenaya hassleriana [spider flower]
ref|XP_002529115.1|  uv excision repair protein rad23, putative         119   3e-28   Ricinus communis
ref|XP_006484457.1|  PREDICTED: ubiquitin receptor RAD23c-like          119   4e-28   Citrus sinensis [apfelsine]
ref|XP_006437675.1|  hypothetical protein CICLE_v10031777mg             118   4e-28   Citrus clementina [clementine]
ref|XP_010916168.1|  PREDICTED: ubiquitin receptor RAD23c-like          118   6e-28   Elaeis guineensis
ref|XP_011035053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    117   9e-28   Populus euphratica
ref|XP_011035048.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    117   1e-27   Populus euphratica
ref|XP_011035051.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    117   1e-27   Populus euphratica
ref|XP_011035052.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    117   1e-27   Populus euphratica
ref|XP_011035049.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    117   1e-27   Populus euphratica
ref|XP_007142901.1|  hypothetical protein PHAVU_007G026400g             117   1e-27   Phaseolus vulgaris [French bean]
ref|XP_002305813.1|  ubiquitin family protein                           117   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_008379541.1|  PREDICTED: ubiquitin receptor RAD23d-like          117   1e-27   
ref|XP_009417654.1|  PREDICTED: ubiquitin receptor RAD23d-like          116   2e-27   
gb|KJB80004.1|  hypothetical protein B456_013G076900                    116   2e-27   Gossypium raimondii
gb|KJB80005.1|  hypothetical protein B456_013G076900                    116   2e-27   Gossypium raimondii
ref|XP_006383465.1|  hypothetical protein POPTR_0005s15740g             116   3e-27   Populus trichocarpa [western balsam poplar]
ref|XP_008801156.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    115   4e-27   
ref|XP_008801154.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    115   4e-27   Phoenix dactylifera
ref|XP_008801157.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    115   4e-27   
ref|XP_008801153.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    115   4e-27   Phoenix dactylifera
gb|KJB80001.1|  hypothetical protein B456_013G076800                    114   5e-27   Gossypium raimondii
ref|XP_002315945.2|  hypothetical protein POPTR_0010s13610g             115   8e-27   
ref|XP_010907325.1|  PREDICTED: ubiquitin receptor RAD23d-like          115   9e-27   Elaeis guineensis
ref|XP_011007998.1|  PREDICTED: ubiquitin receptor RAD23d-like          114   9e-27   Populus euphratica
ref|XP_011021232.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    114   1e-26   Populus euphratica
ref|XP_010553920.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    114   1e-26   Tarenaya hassleriana [spider flower]
gb|KJB79998.1|  hypothetical protein B456_013G076800                    114   1e-26   Gossypium raimondii
ref|XP_011021231.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    114   1e-26   Populus euphratica
ref|XP_010553921.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    114   1e-26   Tarenaya hassleriana [spider flower]
gb|KJB80000.1|  hypothetical protein B456_013G076800                    114   1e-26   Gossypium raimondii
ref|XP_011021236.1|  PREDICTED: ubiquitin receptor RAD23c isoform X4    114   2e-26   Populus euphratica
emb|CAA72741.1|  RAD23, isoform I                                       114   2e-26   Daucus carota [carrots]
ref|XP_011021233.1|  PREDICTED: ubiquitin receptor RAD23c isoform X3    114   2e-26   Populus euphratica
ref|XP_011021237.1|  PREDICTED: ubiquitin receptor RAD23c isoform X5    114   2e-26   Populus euphratica
ref|XP_009399729.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    113   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399730.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    113   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846642.1|  hypothetical protein AMTR_s00156p00078120          113   3e-26   Amborella trichopoda
ref|XP_008341883.1|  PREDICTED: ubiquitin receptor RAD23d-like          113   3e-26   
ref|XP_007046250.1|  Rad23 UV excision repair protein family isof...    112   4e-26   
gb|EPS71284.1|  hypothetical protein M569_03474                         112   5e-26   Genlisea aurea
ref|XP_002312393.1|  hypothetical protein POPTR_0008s11840g             112   5e-26   
ref|XP_007046249.1|  Rad23 UV excision repair protein family isof...    112   7e-26   
ref|XP_003551850.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    112   7e-26   Glycine max [soybeans]
gb|KJB79994.1|  hypothetical protein B456_013G076500                    112   9e-26   Gossypium raimondii
gb|KJB79995.1|  hypothetical protein B456_013G076600                    111   1e-25   Gossypium raimondii
ref|XP_009391404.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    111   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004489115.1|  PREDICTED: putative DNA repair protein RAD23...    111   1e-25   Cicer arietinum [garbanzo]
ref|XP_004304134.1|  PREDICTED: ubiquitin receptor RAD23d-like          111   1e-25   Fragaria vesca subsp. vesca
ref|XP_009391405.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    111   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011022053.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    110   2e-25   Populus euphratica
gb|AFK37901.1|  unknown                                                 108   2e-25   Medicago truncatula
ref|XP_010681568.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    111   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681567.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    110   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681564.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    111   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681566.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    111   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006655985.1|  PREDICTED: ubiquitin receptor RAD23c-like          111   2e-25   Oryza brachyantha
ref|XP_010681563.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    111   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010681565.1|  PREDICTED: ubiquitin receptor RAD23c-like is...    110   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006383464.1|  ubiquitin family protein                           110   2e-25   
ref|XP_009357056.1|  PREDICTED: ubiquitin receptor RAD23d               110   3e-25   Pyrus x bretschneideri [bai li]
ref|XP_011022044.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    110   3e-25   Populus euphratica
ref|NP_001057334.1|  Os06g0264300                                       110   6e-25   
gb|EAZ00429.1|  hypothetical protein OsI_22453                          110   6e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_010440953.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    108   1e-24   Camelina sativa [gold-of-pleasure]
gb|KEH21499.1|  RAD23 UV excision repair family protein                 108   2e-24   Medicago truncatula
ref|XP_010435749.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    108   2e-24   Camelina sativa [gold-of-pleasure]
gb|AFK37577.1|  unknown                                                 108   2e-24   Lotus japonicus
ref|XP_010435751.1|  PREDICTED: ubiquitin receptor RAD23d-like is...    108   2e-24   Camelina sativa [gold-of-pleasure]
gb|KFK33251.1|  hypothetical protein AALP_AA6G350300                    108   2e-24   Arabis alpina [alpine rockcress]
ref|XP_010450905.1|  PREDICTED: ubiquitin receptor RAD23d isoform X1    107   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010450906.1|  PREDICTED: ubiquitin receptor RAD23d isoform X2    107   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003563980.1|  PREDICTED: ubiquitin receptor RAD23d-like          107   3e-24   Brachypodium distachyon [annual false brome]
ref|XP_002870839.1|  hypothetical protein ARALYDRAFT_494129             106   1e-23   
emb|CDY01661.1|  BnaC04g30910D                                          105   2e-23   
ref|XP_009139789.1|  PREDICTED: ubiquitin receptor RAD23d               105   2e-23   Brassica rapa
gb|EMS50196.1|  putative DNA repair protein RAD23                       106   3e-23   Triticum urartu
ref|XP_006283908.1|  hypothetical protein CARUB_v10005026mg             104   3e-23   Capsella rubella
emb|CDX74522.1|  BnaA04g08670D                                          104   4e-23   
ref|XP_003578094.1|  PREDICTED: probable ubiquitin receptor RAD23       104   5e-23   Brachypodium distachyon [annual false brome]
ref|XP_010692904.1|  PREDICTED: ubiquitin receptor RAD23d               104   5e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT27109.1|  Putative DNA repair protein RAD23                       104   6e-23   
emb|CDY58121.1|  BnaCnng32650D                                          103   7e-23   Brassica napus [oilseed rape]
gb|KCW86330.1|  hypothetical protein EUGRSUZ_B03019                     103   7e-23   Eucalyptus grandis [rose gum]
gb|EMS61794.1|  putative DNA repair protein RAD23                       103   7e-23   Triticum urartu
dbj|BAJ97496.1|  predicted protein                                      103   9e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98767.1|  predicted protein                                      103   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001078680.1|  ubiquitin receptor RAD23d                          102   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004956778.1|  PREDICTED: probable DNA repair protein RAD23...    103   1e-22   Setaria italica
dbj|BAC76393.1|  RAD23-like protein                                     102   1e-22   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC76395.1|  RAD23-like protein                                     102   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010044267.1|  PREDICTED: ubiquitin receptor RAD23d-like          102   2e-22   Eucalyptus grandis [rose gum]
ref|XP_004956777.1|  PREDICTED: probable DNA repair protein RAD23...    103   2e-22   
emb|CDX67404.1|  BnaA07g14440D                                          102   2e-22   
ref|XP_009125074.1|  PREDICTED: ubiquitin receptor RAD23d               102   2e-22   Brassica rapa
ref|NP_198663.1|  ubiquitin receptor RAD23d                             102   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59766.1|  unknown protein                                         102   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ07072.1|  hypothetical protein OsI_29318                          102   4e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001061854.1|  Os08g0430200                                       102   4e-22   
ref|XP_003574508.1|  PREDICTED: probable ubiquitin receptor RAD23...    100   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_010235145.1|  PREDICTED: probable ubiquitin receptor RAD23...    100   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_006405766.1|  hypothetical protein EUTSA_v10027790mg             100   2e-21   Eutrema salsugineum [saltwater cress]
ref|NP_001130219.1|  uncharacterized protein LOC100191313             98.2    2e-21   
gb|ACN40029.1|  unknown                                               99.8    2e-21   Picea sitchensis
ref|XP_004965183.1|  PREDICTED: putative DNA repair protein RAD23...  99.8    2e-21   Setaria italica
ref|XP_001763027.1|  predicted protein                                99.4    3e-21   
tpg|DAA61375.1|  TPA: hypothetical protein ZEAMMB73_350633            99.0    3e-21   
ref|XP_006427691.1|  hypothetical protein CICLE_v100258681mg          93.6    3e-21   
ref|XP_010246571.1|  PREDICTED: ubiquitin receptor RAD23b-like        98.2    6e-21   Nelumbo nucifera [Indian lotus]
ref|XP_008650775.1|  PREDICTED: uncharacterized protein LOC100191...  98.2    7e-21   
tpg|DAA61379.1|  TPA: hypothetical protein ZEAMMB73_350633            98.2    7e-21   
gb|AAB65841.1|  osRAD23                                               97.8    8e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063134.1|  Os09g0407200                                     97.8    8e-21   
ref|XP_010268454.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  97.4    1e-20   Nelumbo nucifera [Indian lotus]
emb|CDX69474.1|  BnaA10g18230D                                        97.4    1e-20   
ref|XP_010268452.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  97.4    1e-20   Nelumbo nucifera [Indian lotus]
gb|ACG32894.1|  DNA repair protein RAD23                              97.4    1e-20   Zea mays [maize]
gb|KDO46132.1|  hypothetical protein CISIN_1g0198171mg                95.1    1e-20   Citrus sinensis [apfelsine]
ref|NP_001149140.1|  LOC100282762                                     97.4    1e-20   Zea mays [maize]
ref|XP_004147454.1|  PREDICTED: putative DNA repair protein RAD23...  97.1    2e-20   Cucumis sativus [cucumbers]
gb|ACN26781.1|  unknown                                               96.3    2e-20   Zea mays [maize]
ref|XP_006646967.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  96.7    2e-20   Oryza brachyantha
ref|XP_006646966.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  96.7    2e-20   Oryza brachyantha
ref|XP_009408042.1|  PREDICTED: ubiquitin receptor RAD23b-like        96.7    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009605626.1|  PREDICTED: probable ubiquitin receptor RAD23a    92.4    2e-20   Nicotiana tomentosiformis
ref|XP_006646969.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  96.3    3e-20   Oryza brachyantha
ref|XP_006646968.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  96.3    3e-20   Oryza brachyantha
gb|KJB69954.1|  hypothetical protein B456_011G053200                  95.9    3e-20   Gossypium raimondii
gb|KJB69953.1|  hypothetical protein B456_011G053200                  95.9    3e-20   Gossypium raimondii
emb|CDX69473.1|  BnaA10g18220D                                        98.2    4e-20   
gb|KJB69952.1|  hypothetical protein B456_011G053200                  95.9    4e-20   Gossypium raimondii
gb|KHG09850.1|  Putative DNA repair RAD23-1 -like protein             95.9    4e-20   Gossypium arboreum [tree cotton]
ref|XP_010695313.1|  PREDICTED: probable ubiquitin receptor RAD23a    95.9    4e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW87601.1|  hypothetical protein ZEAMMB73_681598                  95.9    4e-20   
ref|XP_002961618.1|  hypothetical protein SELMODRAFT_77427            95.5    5e-20   
gb|KDO46130.1|  hypothetical protein CISIN_1g0198171mg                94.7    5e-20   Citrus sinensis [apfelsine]
gb|KDO46129.1|  hypothetical protein CISIN_1g0198171mg                94.7    5e-20   Citrus sinensis [apfelsine]
ref|XP_002964690.1|  hypothetical protein SELMODRAFT_82644            95.5    6e-20   
gb|ACJ84340.1|  unknown                                               91.3    6e-20   Medicago truncatula
ref|NP_001266655.1|  DNA repair protein RAD23                         95.5    7e-20   
ref|XP_008443453.1|  PREDICTED: ubiquitin receptor RAD23b-like        95.1    7e-20   Cucumis melo [Oriental melon]
gb|KDO46131.1|  hypothetical protein CISIN_1g0198171mg                94.4    7e-20   Citrus sinensis [apfelsine]
ref|NP_001142065.1|  uncharacterized protein LOC100274222             95.5    7e-20   Zea mays [maize]
ref|XP_003529480.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  95.1    8e-20   Glycine max [soybeans]
ref|NP_001240038.1|  uncharacterized protein LOC100819019             95.1    8e-20   Glycine max [soybeans]
gb|ACU20959.1|  unknown                                               95.1    8e-20   Glycine max [soybeans]
gb|EYU24565.1|  hypothetical protein MIMGU_mgv1a008731mg              94.4    1e-19   Erythranthe guttata [common monkey flower]
gb|ABY66298.1|  RAD23-like protein                                    94.4    1e-19   Brassica napus [oilseed rape]
ref|XP_006493449.1|  PREDICTED: ubiquitin receptor RAD23b-like        94.7    1e-19   Citrus sinensis [apfelsine]
ref|XP_009418051.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  94.4    1e-19   
gb|EYU24564.1|  hypothetical protein MIMGU_mgv1a008731mg              94.4    1e-19   Erythranthe guttata [common monkey flower]
ref|XP_009121516.1|  PREDICTED: ubiquitin receptor RAD23c-like        94.4    1e-19   
gb|KJB34920.1|  hypothetical protein B456_006G091100                  94.4    1e-19   Gossypium raimondii
ref|XP_009418030.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  94.4    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN31866.1|  Putative DNA repair protein RAD23-1                   94.4    1e-19   Glycine soja [wild soybean]
gb|KHG13236.1|  Putative DNA repair RAD23-1 -like protein             94.4    2e-19   Gossypium arboreum [tree cotton]
ref|XP_003543713.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  94.4    2e-19   Glycine max [soybeans]
ref|XP_008794386.1|  PREDICTED: ubiquitin receptor RAD23b-like        94.4    2e-19   Phoenix dactylifera
ref|XP_009121517.1|  PREDICTED: ubiquitin receptor RAD23c-like        94.0    2e-19   
ref|XP_010107189.1|  Putative DNA repair protein RAD23-1              94.7    2e-19   
ref|XP_007150827.1|  hypothetical protein PHAVU_005G184000g           94.0    2e-19   
gb|ACH72675.1|  RAD23                                                 94.0    2e-19   
ref|XP_011082656.1|  PREDICTED: ubiquitin receptor RAD23b-like        93.6    2e-19   
ref|XP_007024819.1|  Rad23 UV excision repair protein family isof...  93.2    2e-19   
gb|ACF83232.1|  unknown                                               91.7    2e-19   
ref|XP_007135849.1|  hypothetical protein PHAVU_010G163300g           93.6    3e-19   
gb|ABK24371.1|  unknown                                               93.6    3e-19   
ref|XP_010655132.1|  PREDICTED: ubiquitin receptor RAD23b             94.0    3e-19   
emb|CBI25247.3|  unnamed protein product                              94.0    3e-19   
ref|XP_002512770.1|  uv excision repair protein rad23, putative       93.2    3e-19   
ref|XP_007215553.1|  hypothetical protein PRUPE_ppa007284mg           93.6    3e-19   
ref|XP_008228865.1|  PREDICTED: ubiquitin receptor RAD23b-like        93.2    3e-19   
ref|XP_007024818.1|  Rad23 UV excision repair protein family isof...  93.2    4e-19   
ref|XP_010929196.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  93.2    4e-19   
ref|XP_010929195.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  93.2    4e-19   
ref|XP_010929193.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  93.2    5e-19   
ref|XP_004486595.1|  PREDICTED: putative DNA repair protein RAD23...  92.4    6e-19   
ref|XP_004486596.1|  PREDICTED: putative DNA repair protein RAD23...  92.4    6e-19   
gb|KHG13156.1|  Putative DNA repair RAD23-1 -like protein             92.4    6e-19   
ref|XP_011034604.1|  PREDICTED: ubiquitin receptor RAD23b-like        92.4    7e-19   
ref|XP_002299163.1|  DNA repair protein RAD23                         92.4    7e-19   
ref|XP_001752113.1|  predicted protein                                87.4    7e-19   
ref|NP_001149553.1|  LOC100283179                                     92.4    7e-19   
ref|XP_006368664.1|  hypothetical protein POPTR_0001s07510g           92.4    7e-19   
ref|XP_009615678.1|  PREDICTED: ubiquitin receptor RAD23b             92.4    7e-19   
gb|KJB67005.1|  hypothetical protein B456_010G170000                  92.0    8e-19   
emb|CDO98260.1|  unnamed protein product                              92.0    1e-18   
ref|XP_006845449.1|  hypothetical protein AMTR_s00019p00116110        91.7    1e-18   
ref|XP_004303217.1|  PREDICTED: ubiquitin receptor RAD23b             91.7    1e-18   
ref|XP_009365249.1|  PREDICTED: ubiquitin receptor RAD23b-like        91.7    1e-18   
ref|XP_010034057.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  91.7    1e-18   
ref|XP_010034058.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  91.7    1e-18   
ref|XP_010034056.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  91.7    1e-18   
ref|XP_003637291.1|  RAD23 protein                                    91.3    1e-18   
ref|XP_010034055.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  91.7    1e-18   
ref|XP_004235877.1|  PREDICTED: ubiquitin receptor RAD23b             91.3    2e-18   
gb|AFW66284.1|  hypothetical protein ZEAMMB73_839350                  90.9    2e-18   
ref|XP_006341431.1|  PREDICTED: ubiquitin receptor RAD23b-like        91.3    2e-18   
ref|NP_001148810.1|  LOC100282427                                     91.3    2e-18   
ref|XP_010532056.1|  PREDICTED: ubiquitin receptor RAD23b             90.9    2e-18   
ref|XP_008677244.1|  PREDICTED: LOC100282427 isoform X2               91.3    2e-18   
ref|XP_008342756.1|  PREDICTED: ubiquitin receptor RAD23b-like        91.3    2e-18   
ref|XP_009354240.1|  PREDICTED: ubiquitin receptor RAD23b-like        90.9    2e-18   
ref|XP_008381163.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  90.9    3e-18   
ref|XP_002303970.1|  DNA repair protein RAD23                         90.5    3e-18   
ref|XP_009398645.1|  PREDICTED: ubiquitin receptor RAD23b-like        90.9    3e-18   
ref|XP_006385947.1|  hypothetical protein POPTR_0003s18540g           90.5    3e-18   
ref|XP_009797065.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  90.5    3e-18   
ref|XP_009598522.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  90.5    3e-18   
ref|XP_009797063.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  90.5    3e-18   
ref|XP_009598520.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  90.5    4e-18   
ref|XP_002451657.1|  hypothetical protein SORBIDRAFT_04g005370        90.1    4e-18   
gb|EEC72612.1|  hypothetical protein OsI_06092                        90.1    4e-18   
ref|NP_001046083.1|  Os02g0179300                                     90.1    4e-18   
emb|CAC01850.1|  putative protein                                     87.0    4e-18   
ref|XP_002889262.1|  hypothetical protein ARALYDRAFT_316857           90.1    5e-18   
emb|CDY26493.1|  BnaC09g41750D                                        89.7    5e-18   
ref|NP_197113.4|  uncharacterized protein                             87.0    9e-18   
ref|XP_001775909.1|  predicted protein                                86.7    1e-17   
gb|EMS58233.1|  Putative DNA repair protein RAD23-1                   89.7    1e-17   
ref|XP_009759118.1|  PREDICTED: ubiquitin receptor RAD23b isoform X2  88.6    1e-17   
ref|XP_009759117.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1  88.6    1e-17   
ref|XP_011020549.1|  PREDICTED: ubiquitin receptor RAD23b-like        88.6    2e-17   
emb|CAA72742.1|  RAD23 protein, isoform II                            88.6    2e-17   
emb|CDY33351.1|  BnaC05g12320D                                        88.2    2e-17   
ref|XP_004137651.1|  PREDICTED: putative DNA repair protein RAD23...  88.2    2e-17   
gb|KFK25846.1|  hypothetical protein AALP_AA8G169700                  89.0    2e-17   
ref|NP_974181.1|  ubiquitin receptor RAD23b                           88.2    2e-17   
ref|XP_008462953.1|  PREDICTED: ubiquitin receptor RAD23b isoform X1  88.6    2e-17   
ref|NP_565216.2|  ubiquitin receptor RAD23b                           88.2    2e-17   
dbj|BAC76389.1|  RAD23-like protein                                   88.2    2e-17   
gb|ABG89119.1|  Rad23-3Ai                                             88.2    2e-17   
dbj|BAC76390.1|  RAD23-like protein                                   88.2    2e-17   
gb|KGN58646.1|  hypothetical protein Csa_3G710740                     88.2    2e-17   
ref|NP_850982.1|  ubiquitin receptor RAD23b                           88.2    2e-17   
ref|XP_004161413.1|  PREDICTED: putative DNA repair protein RAD23...  88.6    2e-17   
gb|AAF68123.1|AC010793_18  F20B17.8                                   87.8    3e-17   
dbj|BAK04690.1|  predicted protein                                    87.8    3e-17   
ref|XP_003622299.1|  hypothetical protein MTR_7g032690                88.2    3e-17   
ref|XP_003622298.1|  hypothetical protein MTR_7g032690                88.2    3e-17   
ref|NP_001185439.1|  ubiquitin receptor RAD23b                        87.8    3e-17   
ref|XP_002890153.1|  hypothetical protein ARALYDRAFT_312599           87.4    3e-17   
ref|XP_001780766.1|  predicted protein                                87.8    4e-17   
gb|EPS72838.1|  hypothetical protein M569_01918                       87.0    4e-17   
ref|XP_010429867.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  87.4    4e-17   
ref|XP_010429866.1|  PREDICTED: ubiquitin receptor RAD23b-like is...  87.4    4e-17   
ref|XP_006302422.1|  hypothetical protein CARUB_v10020503mg           87.0    5e-17   
gb|AAF18513.1|AC010924_26  Contains similarity to gb|Y12014 RAD23...  85.9    6e-17   
ref|XP_010417634.1|  PREDICTED: ubiquitin receptor RAD23b             87.0    6e-17   
ref|XP_006416841.1|  hypothetical protein EUTSA_v10007982mg           86.7    8e-17   
ref|XP_003570619.1|  PREDICTED: ubiquitin receptor RAD23b-like        86.7    9e-17   
ref|XP_009117771.1|  PREDICTED: probable ubiquitin receptor RAD23a    86.3    9e-17   
ref|XP_006281616.1|  hypothetical protein CARUB_v10027742mg           82.0    9e-17   
emb|CDX81753.1|  BnaC08g38480D                                        86.3    1e-16   
ref|XP_006306209.1|  hypothetical protein CARUB_v10011879mg           85.9    1e-16   
ref|NP_173070.1|  DNA repair protein RAD23A                           85.9    1e-16   
ref|XP_010497716.1|  PREDICTED: probable ubiquitin receptor RAD23a    85.9    1e-16   
ref|XP_010459157.1|  PREDICTED: probable ubiquitin receptor RAD23a    85.9    1e-16   
ref|XP_003622297.1|  hypothetical protein MTR_7g032690                87.8    1e-16   
gb|ABN05900.1|  Ubiquitin                                             87.8    2e-16   
emb|CDY26494.1|  BnaC09g41740D                                        84.7    2e-16   
gb|KHN38092.1|  Putative DNA repair protein RAD23-1                   86.3    2e-16   
ref|XP_009149056.1|  PREDICTED: probable ubiquitin receptor RAD23a    85.1    2e-16   
emb|CDY35071.1|  BnaA06g10810D                                        85.1    3e-16   
ref|XP_010472832.1|  PREDICTED: ubiquitin receptor RAD23b-like        84.7    4e-16   
gb|KFK42374.1|  hypothetical protein AALP_AA2G247700                  84.7    4e-16   
ref|XP_006389863.1|  hypothetical protein EUTSA_v10018655mg           84.0    1e-15   
ref|XP_009122868.1|  PREDICTED: ubiquitin receptor RAD23d-like        83.2    1e-15   
emb|CDY26496.1|  BnaC09g41720D                                        83.2    1e-15   
ref|XP_006603061.1|  PREDICTED: ubiquitin receptor RAD23d-like is...  81.3    5e-15   
gb|ABY66299.1|  DNA repair protein RAD23                              80.9    5e-15   
ref|XP_010485077.1|  PREDICTED: uncharacterized protein LOC104763398  82.4    6e-15   
emb|CDX67983.1|  BnaA07g20230D                                        82.0    7e-15   
ref|XP_009104513.1|  PREDICTED: ubiquitin receptor RAD23b             80.5    1e-14   
gb|KDO69966.1|  hypothetical protein CISIN_1g0163871mg                79.3    2e-14   
emb|CDX79333.1|  BnaC06g19700D                                        80.5    2e-14   
ref|XP_010446048.1|  PREDICTED: uncharacterized protein LOC104728818  80.5    3e-14   
dbj|BAC76391.1|  RAD23-like protein                                   79.3    4e-14   
gb|KDO69965.1|  hypothetical protein CISIN_1g0163871mg                79.0    4e-14   
ref|XP_002873756.1|  hypothetical protein ARALYDRAFT_326056           73.9    2e-13   
ref|XP_004951696.1|  PREDICTED: putative DNA repair protein RAD23...  76.3    4e-13   
ref|XP_004973490.1|  PREDICTED: probable DNA repair protein RAD23...  71.6    1e-12   
gb|EMT30328.1|  Putative DNA repair protein RAD23                     73.9    4e-12   
ref|XP_010476726.1|  PREDICTED: LOW QUALITY PROTEIN: probable ubi...  72.0    1e-11   
ref|XP_005646102.1|  UV excision repair protein Rad23                 72.4    1e-11   
emb|CCA21947.1|  UV excision repair protein RAD23 putative            68.2    3e-10   
ref|XP_008668010.1|  PREDICTED: LOC100283179 isoform X1               66.6    1e-09   
pdb|1P1A|A  Chain A, Nmr Structure Of Ubiquitin-Like Domain Of Hh...  62.0    1e-09   
pdb|1UEL|A  Chain A, Solution Structure Of Ubiquitin-Like Domain ...  62.0    2e-09   
gb|ACF79443.1|  unknown                                               64.7    4e-09   
ref|XP_007899245.1|  PREDICTED: UV excision repair protein RAD23 ...  64.7    5e-09   
ref|XP_006400141.1|  hypothetical protein EUTSA_v10016009mg           63.9    5e-09   
ref|XP_005989968.1|  PREDICTED: UV excision repair protein RAD23 ...  63.9    8e-09   
ref|XP_005154948.1|  PREDICTED: UV excision repair protein RAD23 ...  63.2    1e-08   
ref|XP_006088115.1|  PREDICTED: UV excision repair protein RAD23 ...  63.2    1e-08   
ref|XP_006088114.1|  PREDICTED: UV excision repair protein RAD23 ...  63.2    1e-08   
ref|XP_010755175.1|  PREDICTED: UV excision repair protein RAD23 ...  63.2    2e-08   
ref|XP_004164899.1|  PREDICTED: putative DNA repair protein RAD23...  62.8    2e-08   
ref|XP_429175.3|  PREDICTED: UV excision repair protein RAD23 hom...  62.8    2e-08   
ref|XP_007499698.1|  PREDICTED: UV excision repair protein RAD23 ...  62.8    2e-08   
ref|XP_007499697.1|  PREDICTED: UV excision repair protein RAD23 ...  62.8    2e-08   
ref|XP_008586188.1|  PREDICTED: UV excision repair protein RAD23 ...  62.8    2e-08   
emb|CCI46099.1|  unnamed protein product                              63.2    2e-08   
ref|XP_001927901.1|  PREDICTED: UV excision repair protein RAD23 ...  62.4    2e-08   
ref|XP_006882076.1|  PREDICTED: UV excision repair protein RAD23 ...  62.4    2e-08   
ref|XP_008054682.1|  PREDICTED: UV excision repair protein RAD23 ...  62.4    2e-08   
gb|ETP29927.1|  UV excision repair protein Rad23                      62.4    3e-08   
gb|ETL25740.1|  UV excision repair protein Rad23                      62.4    3e-08   
gb|ETK72284.1|  UV excision repair protein Rad23                      62.4    3e-08   
ref|XP_008914834.1|  UV excision repair protein Rad23                 62.4    3e-08   
ref|XP_004423355.1|  PREDICTED: UV excision repair protein RAD23 ...  62.4    3e-08   
gb|ETL78956.1|  UV excision repair protein Rad23                      62.4    3e-08   
gb|ETM32232.1|  UV excision repair protein Rad23                      62.4    3e-08   
gb|ETI31946.1|  UV excision repair protein Rad23                      62.4    3e-08   
gb|EMT16092.1|  Putative DNA repair protein RAD23-1                   62.4    3e-08   
ref|XP_004581217.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    3e-08   
dbj|BAE39643.1|  unnamed protein product                              62.0    3e-08   
ref|XP_005532282.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    3e-08   
ref|XP_005491419.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    3e-08   
ref|XP_005491420.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    3e-08   
ref|XP_002188381.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    3e-08   
ref|XP_011363293.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|XP_005362254.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    4e-08   
ref|XP_004677510.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    4e-08   
ref|XP_009517490.1|  hypothetical protein PHYSODRAFT_553293           62.0    4e-08   
ref|XP_010968406.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    4e-08   
ref|NP_033037.2|  UV excision repair protein RAD23 homolog B          62.0    4e-08   
ref|XP_005362253.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    4e-08   
ref|XP_007966681.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    4e-08   
gb|AAH20973.1|  RAD23B protein                                        62.0    4e-08   
gb|AAH68193.1|  Rad23b protein                                        62.0    4e-08   
ref|XP_004848222.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    4e-08   
ref|NP_001020446.1|  UV excision repair protein RAD23 homolog B       62.0    4e-08   
ref|XP_007950131.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    4e-08   
ref|XP_005076549.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    4e-08   
ref|NP_002865.1|  UV excision repair protein RAD23 homolog B isof...  62.0    4e-08   
ref|XP_004372251.1|  PREDICTED: UV excision repair protein RAD23 ...  62.0    4e-08   
dbj|BAE34014.1|  unnamed protein product                              62.0    4e-08   
gb|AAX43553.1|  RAD23-like B                                          61.6    4e-08   
ref|XP_003470962.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|NP_001248717.1|  UV excision repair protein RAD23 homolog B       61.6    4e-08   
dbj|BAE25006.1|  unnamed protein product                              61.6    4e-08   
ref|XP_004462422.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|XP_009186620.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|XP_005581182.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
gb|AAV38508.1|  RAD23 homolog B (S. cerevisiae)                       61.6    4e-08   
emb|CAA63146.1|  MHR23B                                               61.6    4e-08   
ref|XP_010977006.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|XP_003785253.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|XP_009186622.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|XP_006864754.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|NP_001271836.1|  uncharacterized protein LOC101866175             61.6    4e-08   
ref|XP_010387756.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
dbj|BAD97199.1|  UV excision repair protein RAD23 homolog B variant   61.6    4e-08   
ref|XP_006985330.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|XP_004711018.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|XP_002708173.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|XP_010334293.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  61.6    4e-08   
ref|XP_008140049.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|XP_005329791.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    4e-08   
ref|XP_004657041.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    5e-08   
ref|XP_007631606.1|  PREDICTED: LOW QUALITY PROTEIN: UV excision ...  61.6    5e-08   
ref|XP_006886977.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    5e-08   
ref|XP_008852875.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    5e-08   
ref|XP_006011153.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    5e-08   
ref|XP_006906141.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    5e-08   
dbj|BAG57014.1|  unnamed protein product                              61.6    5e-08   
ref|XP_004638157.1|  PREDICTED: UV excision repair protein RAD23 ...  61.6    5e-08   
ref|XP_010773397.1|  PREDICTED: UV excision repair protein RAD23 ...  61.2    6e-08   
ref|XP_007516225.1|  PREDICTED: UV excision repair protein RAD23 ...  61.2    7e-08   
ref|XP_003223800.1|  PREDICTED: UV excision repair protein RAD23 ...  61.2    7e-08   
ref|XP_008113503.1|  PREDICTED: UV excision repair protein RAD23 ...  61.2    7e-08   
ref|XP_005283538.1|  PREDICTED: UV excision repair protein RAD23 ...  61.2    7e-08   
ref|XP_008170117.1|  PREDICTED: UV excision repair protein RAD23 ...  61.2    7e-08   
ref|XP_010668351.1|  PREDICTED: ubiquitin receptor RAD23d-like        59.3    9e-08   
ref|XP_006640058.1|  PREDICTED: UV excision repair protein RAD23 ...  60.8    1e-07   
ref|XP_005994202.1|  PREDICTED: UV excision repair protein RAD23 ...  60.1    1e-07   
ref|XP_002907168.1|  UV excision repair protein RAD23                 60.5    1e-07   
emb|CAF91196.1|  unnamed protein product                              60.1    1e-07   
gb|KDP41924.1|  hypothetical protein JCGZ_26942                       60.5    1e-07   
ref|XP_001581428.1|  polyubiquitin                                    57.8    1e-07   



>ref|XP_009631150.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAENNF+
Sbjct  61   ENKVAENNFI  70



>ref|XP_009791274.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
sylvestris]
Length=395

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAENNF+
Sbjct  61   ENKVAENNFI  70



>ref|XP_009631151.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAENNF+
Sbjct  61   ENKVAENNFI  70



>ref|XP_009791275.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAENNF+
Sbjct  61   ENKVAENNFI  70



>ref|XP_004236965.1| PREDICTED: ubiquitin receptor RAD23c [Solanum lycopersicum]
Length=409

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE+NF+
Sbjct  61   ENKVAESNFI  70



>ref|XP_006367045.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=398

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE+NF+
Sbjct  61   ENKVAESNFI  70



>ref|XP_010317192.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Solanum lycopersicum]
Length=381

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_004233495.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Solanum lycopersicum]
Length=383

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_004233496.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Solanum lycopersicum]
Length=365

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQGKVLKDPTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_009597821.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=148

 Score =   127 bits (318),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIHQGKVLKDTATLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>gb|KDO58999.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=308

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_010647738.1| PREDICTED: ubiquitin receptor RAD23c isoform X1 [Vitis vinifera]
Length=398

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_002282352.1| PREDICTED: ubiquitin receptor RAD23c isoform X2 [Vitis vinifera]
 emb|CBI27030.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+VKPEDTVADVK +IE VQGS+VYPASQ MLIHQGKVLKDGTTL+
Sbjct  1    MKIFVKTLKGTHFEIQVKPEDTVADVKANIEAVQGSDVYPASQQMLIHQGKVLKDGTTLD  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>emb|CDP19777.1| unnamed protein product [Coffea canephora]
Length=390

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPEDTV DVKKSIET QG+ VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVTDVKKSIETAQGAEVYPASQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKV EN+F+
Sbjct  61   ENKVVENSFI  70



>ref|XP_011097188.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGS+VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSDVYPAGQQMLIHQGKVLKDETTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_011099561.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=380

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            M+IFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MRIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPASQQMLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE +FV
Sbjct  61   ENKVAEKSFV  70



>ref|XP_009607597.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
tomentosiformis]
Length=383

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_009607598.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
tomentosiformis]
Length=365

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG ++YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQDIYPAAQQMLIHQGKVLKDTTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_006363121.1| PREDICTED: ubiquitin receptor RAD23c-like [Solanum tuberosum]
Length=390

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_007227719.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
 ref|XP_008243219.1| PREDICTED: ubiquitin receptor RAD23c-like [Prunus mume]
 gb|EMJ28918.1| hypothetical protein PRUPE_ppa007047mg [Prunus persica]
Length=385

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>gb|ACJ83348.1| unknown [Medicago truncatula]
Length=159

 Score =   124 bits (311),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>gb|KDO59000.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=364

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_008243218.1| PREDICTED: ubiquitin receptor RAD23d-like [Prunus mume]
Length=384

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHF++EVKPEDTVADVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVEVKPEDTVADVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_010498530.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=420

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_010463666.1| PREDICTED: ubiquitin receptor RAD23c [Camelina sativa]
Length=422

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>emb|CDX74251.1| BnaA03g27960D [Brassica napus]
Length=401

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_011070815.1| PREDICTED: ubiquitin receptor RAD23c-like [Sesamum indicum]
Length=433

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+ QG+++YPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKTIESTQGADIYPATQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE++FV
Sbjct  61   ENKVAESSFV  70



>ref|XP_009134681.1| PREDICTED: ubiquitin receptor RAD23c [Brassica rapa]
Length=401

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>gb|KDO58993.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=398

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_004232367.1| PREDICTED: ubiquitin receptor RAD23d [Solanum lycopersicum]
 emb|CAB51544.1| RAD23 protein [Solanum lycopersicum var. cerasiforme]
Length=389

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIESVQGQDVYPAAQQMLIHQGKVLKDTTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_006482261.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Citrus 
sinensis]
Length=396

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_006482260.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Citrus 
sinensis]
Length=397

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>gb|KDO58994.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=402

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_008361862.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=83

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
             NKVAEN+FV
Sbjct  61   GNKVAENSFV  70



>gb|KDO58997.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_009597820.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nicotiana 
tomentosiformis]
Length=288

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE+VQG + YPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIESVQGQDFYPAAQQMLIHQGKVLKDTATLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>gb|KDO58996.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=403

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_007223091.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24290.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=322

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHF++ VKPEDTV+DVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>gb|AII99835.1| putative DNA repair protein RAD23-3-like protein [Nicotiana tabacum]
Length=387

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_009784661.1| PREDICTED: ubiquitin receptor RAD23d [Nicotiana sylvestris]
Length=387

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTV DVK++IE+VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVVDVKRNIESVQGQDVYPAAQQMLIHQGKVLKDSTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_006430787.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44027.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_006430789.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44029.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=401

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>gb|KDO58995.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=430

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>gb|EYU44643.1| hypothetical protein MIMGU_mgv1a006427mg [Erythranthe guttata]
Length=444

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = +2

Query  236  NMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  415
            +MKIFVKTLKGTHFEIEVKPEDTVADVKK++ETVQGS+VYPA+Q MLIHQGKVLKD TTL
Sbjct  65   SMKIFVKTLKGTHFEIEVKPEDTVADVKKNVETVQGSDVYPAAQQMLIHQGKVLKDETTL  124

Query  416  EENKVAENNFV  448
            EENKVAE +FV
Sbjct  125  EENKVAEKSFV  135



>ref|XP_006430788.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
 gb|ESR44028.1| hypothetical protein CICLE_v10011886mg [Citrus clementina]
Length=400

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>emb|CDX91998.1| BnaC03g33000D [Brassica napus]
Length=403

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQG+VLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGRVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_009781758.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>gb|KFK37713.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=425

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>gb|KFK37714.1| hypothetical protein AALP_AA3G019400 [Arabis alpina]
Length=435

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG+++YPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADLYPATKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_009781759.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nicotiana 
sylvestris]
Length=369

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IET QG  VYPA+Q MLIHQGKVLKD  TLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETAQGQAVYPAAQQMLIHQGKVLKDTATLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>gb|ABB02636.1| RAD23-like [Solanum tuberosum]
Length=384

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLIHQ KVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIHQVKVLKDPTTLD  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|NP_001274760.1| uncharacterized protein LOC102577665 [Solanum tuberosum]
 gb|ABB16981.1| unknown [Solanum tuberosum]
Length=382

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQG +VYPA+Q MLI  GKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGQDVYPAAQQMLIPPGKVLKDPTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>gb|KDO58998.1| hypothetical protein CISIN_1g014118mg [Citrus sinensis]
Length=397

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPED V+DVKK+IETVQGS+VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDKVSDVKKNIETVQGSDVYPASQQMLIHQGKVLKDVTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_010485565.1| PREDICTED: ubiquitin receptor RAD23c-like [Camelina sativa]
Length=419

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD  T+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDEKTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_004172134.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>gb|ACU18469.1| unknown [Glycine max]
Length=160

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  419  ENKVAENNFV  448
            ENKV EN F+
Sbjct  61   ENKVVENTFI  70



>ref|XP_004135098.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cucumis 
sativus]
Length=407

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|NP_974211.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73825.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=299

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_007223090.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
 gb|EMJ24289.1| hypothetical protein PRUPE_ppa007032mg [Prunus persica]
Length=385

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHF++ VKPEDTV+DVKK IET QGS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDVAVKPEDTVSDVKKQIETSQGSDVYPASQQMLIHQGKVLKDSTTLD  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_010525156.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
Length=407

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>gb|ABD96960.1| hypothetical protein [Cleome spinosa]
Length=435

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQ  +VYPA+Q MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQSPDVYPAAQQMLIHQGKVLKDETTME  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_006408409.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
 gb|ESQ49862.1| hypothetical protein EUTSA_v10020817mg [Eutrema salsugineum]
Length=416

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG HFEIEVKP+D+VADVKK+IETVQG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGIHFEIEVKPDDSVADVKKNIETVQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_008446578.1| PREDICTED: ubiquitin receptor RAD23c-like [Cucumis melo]
Length=422

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_007033285.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY04211.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=350

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIHQGKVLKDNTTLD  60

Query  419  ENKVAENNFV  448
            +NKVAEN+F+
Sbjct  61   DNKVAENSFI  70



>gb|EYU34397.1| hypothetical protein MIMGU_mgv1a008220mg [Erythranthe guttata]
Length=381

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTVADVKK+IETVQGSN+YPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVADVKKNIETVQGSNIYPAGQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
             N VAE +FV
Sbjct  61   ANNVAEKSFV  70



>gb|KGN52072.1| hypothetical protein Csa_5G608600 [Cucumis sativus]
Length=420

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEV+P DTVADVKK+IETVQG++VYPA+Q MLIHQGKVLKD +TLE
Sbjct  1    MKIFVKTLKGSHFEIEVQPADTVADVKKNIETVQGADVYPAAQQMLIHQGKVLKDSSTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_008781245.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Phoenix 
dactylifera]
Length=451

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 74/105 (70%), Gaps = 6/105 (6%)
 Frame = +2

Query  152  CLYSRVSSSPFDRN-GDPSFRK*RKI*-----RENMKIFVKTLKGTHFEIEVKPEDTVAD  313
            CL +  S  P+ R       RK R        R  MKIFVKTLKGTHFEIEVKPED VAD
Sbjct  4    CLLAAGSPQPYSRTTWREEGRKSRSFAAAAAERGEMKIFVKTLKGTHFEIEVKPEDAVAD  63

Query  314  VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFV  448
            VKK+IE VQG  VYPA Q MLIHQGK+LKD TTL++NKVAEN+F+
Sbjct  64   VKKNIEAVQGQGVYPAEQQMLIHQGKILKDDTTLQDNKVAENSFI  108



>ref|XP_008781252.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Phoenix 
dactylifera]
Length=450

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 74/105 (70%), Gaps = 6/105 (6%)
 Frame = +2

Query  152  CLYSRVSSSPFDRN-GDPSFRK*RKI*-----RENMKIFVKTLKGTHFEIEVKPEDTVAD  313
            CL +  S  P+ R       RK R        R  MKIFVKTLKGTHFEIEVKPED VAD
Sbjct  4    CLLAAGSPQPYSRTTWREEGRKSRSFAAAAAERGEMKIFVKTLKGTHFEIEVKPEDAVAD  63

Query  314  VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFV  448
            VKK+IE VQG  VYPA Q MLIHQGK+LKD TTL++NKVAEN+F+
Sbjct  64   VKKNIEAVQGQGVYPAEQQMLIHQGKILKDDTTLQDNKVAENSFI  108



>ref|XP_008781229.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=452

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 74/105 (70%), Gaps = 6/105 (6%)
 Frame = +2

Query  152  CLYSRVSSSPFDRN-GDPSFRK*RKI*-----RENMKIFVKTLKGTHFEIEVKPEDTVAD  313
            CL +  S  P+ R       RK R        R  MKIFVKTLKGTHFEIEVKPED VAD
Sbjct  4    CLLAAGSPQPYSRTTWREEGRKSRSFAAAAAERGEMKIFVKTLKGTHFEIEVKPEDAVAD  63

Query  314  VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFV  448
            VKK+IE VQG  VYPA Q MLIHQGK+LKD TTL++NKVAEN+F+
Sbjct  64   VKKNIEAVQGQGVYPAEQQMLIHQGKILKDDTTLQDNKVAENSFI  108



>ref|XP_008781237.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=451

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 74/105 (70%), Gaps = 6/105 (6%)
 Frame = +2

Query  152  CLYSRVSSSPFDRN-GDPSFRK*RKI*-----RENMKIFVKTLKGTHFEIEVKPEDTVAD  313
            CL +  S  P+ R       RK R        R  MKIFVKTLKGTHFEIEVKPED VAD
Sbjct  4    CLLAAGSPQPYSRTTWREEGRKSRSFAAAAAERGEMKIFVKTLKGTHFEIEVKPEDAVAD  63

Query  314  VKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLEENKVAENNFV  448
            VKK+IE VQG  VYPA Q MLIHQGK+LKD TTL++NKVAEN+F+
Sbjct  64   VKKNIEAVQGQGVYPAEQQMLIHQGKILKDDTTLQDNKVAENSFI  108



>ref|NP_001240201.1| uncharacterized protein LOC100809066 [Glycine max]
 gb|ACU22776.1| unknown [Glycine max]
 gb|KHN47572.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=392

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_010549930.1| PREDICTED: ubiquitin receptor RAD23c-like [Tarenaya hassleriana]
 gb|ABD96879.1| hypothetical protein [Cleome spinosa]
Length=383

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IETVQG++VYP++Q MLIHQGKVL+D TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIETVQGADVYPSAQQMLIHQGKVLRDETTME  60

Query  419  ENKVAENNFV  448
            ENKVAE +F+
Sbjct  61   ENKVAEKSFI  70



>ref|XP_006299986.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
 gb|EOA32884.1| hypothetical protein CARUB_v10016200mg [Capsella rubella]
Length=427

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI+VKTLKGTHFEIEVKPED+++DVKK+IET QG++VYPA++LMLIHQGKVLKD TT+E
Sbjct  1    MKIYVKTLKGTHFEIEVKPEDSISDVKKNIETAQGADVYPAAKLMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_010103792.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
 gb|EXB97154.1| Putative DNA repair protein RAD23-3 [Morus notabilis]
Length=421

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVCVKTLKGTHFEIEVKPEDTVADVKKNIEAVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  419  ENKVAENNFV  448
            ENKV EN+F+
Sbjct  61   ENKVVENSFI  70



>gb|EYU29967.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=376

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>gb|EYU29968.1| hypothetical protein MIMGU_mgv1a008352mg [Erythranthe guttata]
Length=375

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKP+DT+ADVKK++E  QG++VYPA+Q +LIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPDDTIADVKKTVENTQGADVYPATQQLLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_010263550.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  419  ENKVAENNFV  448
            ENKV+EN+F+
Sbjct  61   ENKVSENSFL  70



>ref|XP_010263555.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Nelumbo 
nucifera]
Length=386

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+V PEDTVADVKK+IETVQG +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIQVNPEDTVADVKKNIETVQGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  419  ENKVAENNFV  448
            ENKV+EN+F+
Sbjct  61   ENKVSENSFL  70



>ref|XP_003555895.1| PREDICTED: ubiquitin receptor RAD23c-like isoform 1 [Glycine 
max]
 gb|KHN11428.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=402

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDATTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN F+
Sbjct  61   ENKVAENTFI  70



>ref|XP_002283656.1| PREDICTED: ubiquitin receptor RAD23c [Vitis vinifera]
 emb|CBI33660.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+IE V G++VYPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIELVHGTDVYPAAQQMLIHQGKVLKDATTLD  60

Query  419  ENKVAENNFV  448
            EN+VAE++FV
Sbjct  61   ENQVAESSFV  70



>ref|XP_006584607.1| PREDICTED: uncharacterized protein LOC100813881 isoform X4 [Glycine 
max]
Length=383

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE++F+
Sbjct  61   ENKVAESSFI  70



>gb|KEH44233.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=397

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P+DT++ VKK+IETVQG +VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTISAVKKNIETVQGVDVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_007033284.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY04210.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=487

 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVKK+I+T QG ++YPA+Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKKNIDTAQGPDIYPAAQQMLIHQGKVLKDNTTLD  60

Query  419  ENKVAENNFV  448
            +NKVAEN+F+
Sbjct  61   DNKVAENSFI  70



>ref|XP_006584608.1| PREDICTED: uncharacterized protein LOC100813881 isoform X5 [Glycine 
max]
Length=382

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE++F+
Sbjct  61   ENKVAESSFI  70



>ref|XP_004497101.1| PREDICTED: putative DNA repair protein RAD23-3-like [Cicer arietinum]
Length=400

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKP+DT+++VKK+IE VQG +VYPA+Q MLIHQGKVLKDGT+LE
Sbjct  1    MKVFVKTLKGTHFEIEVKPQDTISEVKKNIENVQGVDVYPAAQQMLIHQGKVLKDGTSLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|NP_001242098.1| uncharacterized protein LOC100813881 [Glycine max]
 gb|ACU21107.1| unknown [Glycine max]
Length=400

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE++F+
Sbjct  61   ENKVAESSFI  70



>ref|XP_002516727.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF45625.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=381

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEI+VKPEDTV DVK +IE  QG++VYPASQ MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTNFEIDVKPEDTVEDVKNNIEIAQGADVYPASQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_006584604.1| PREDICTED: uncharacterized protein LOC100813881 isoform X1 [Glycine 
max]
Length=469

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE++F+
Sbjct  61   ENKVAESSFI  70



>gb|ACU18529.1| unknown [Glycine max]
Length=382

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE++F+
Sbjct  61   ENKVAESSFI  70



>ref|XP_006584605.1| PREDICTED: uncharacterized protein LOC100813881 isoform X2 [Glycine 
max]
Length=468

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE++F+
Sbjct  61   ENKVAESSFI  70



>ref|XP_006584606.1| PREDICTED: uncharacterized protein LOC100813881 isoform X3 [Glycine 
max]
Length=401

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE++F+
Sbjct  61   ENKVAESSFI  70



>ref|NP_001189793.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 gb|AEE73826.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=418

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|NP_186903.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
 sp|Q84L31.2|RD23C_ARATH RecName: Full=Ubiquitin receptor RAD23c; Short=AtRAD23c; AltName: 
Full=Putative DNA repair protein RAD23-3; AltName: Full=RAD23-like 
protein 3; Short=AtRAD23-3 [Arabidopsis thaliana]
 gb|AAF32461.1| putative RAD23 [Arabidopsis thaliana]
 gb|AAK62617.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 gb|AAM47342.1| AT3g02540/F16B3_17 [Arabidopsis thaliana]
 dbj|BAC76392.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89116.1| Rad23-1 [synthetic construct]
 gb|AEE73824.1| UV excision repair protein RAD23C [Arabidopsis thaliana]
Length=419

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_010103794.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
 gb|EXB97156.1| Putative DNA repair protein RAD23-4 [Morus notabilis]
Length=550

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  230  RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  409
            ++ MKI VKTLKGTHFEIEVKPEDTVADVKK+IE VQG++VYPASQ MLIHQGKVLKD T
Sbjct  115  KKKMKICVKTLKGTHFEIEVKPEDTVADVKKNIEVVQGADVYPASQQMLIHQGKVLKDVT  174

Query  410  TLEENKVAENNFV  448
            TLEENKV EN+F+
Sbjct  175  TLEENKVVENSFI  187



>gb|KHN15504.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=416

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P DT+++VKK+IETVQG++VYPA+Q MLIHQGKVLKDGTTLE
Sbjct  1    MKVFVKTLKGTHFEIEVNPSDTLSEVKKNIETVQGADVYPAAQQMLIHQGKVLKDGTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAE++F+
Sbjct  61   ENKVAESSFI  70



>ref|XP_007215515.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
 gb|EMJ16714.1| hypothetical protein PRUPE_ppa007020mg [Prunus persica]
Length=385

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPE+ VADVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVADVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  419  ENKVAENNFV  448
            EN+VAEN+F+
Sbjct  61   ENQVAENSFI  70



>ref|XP_009356676.1| PREDICTED: ubiquitin receptor RAD23c-like [Pyrus x bretschneideri]
Length=384

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
             NKVAEN+FV
Sbjct  61   GNKVAENSFV  70



>ref|XP_006437672.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50912.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=212

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  62   ENKVAENSFV  71



>ref|XP_009356279.1| PREDICTED: ubiquitin receptor RAD23d-like [Pyrus x bretschneideri]
Length=385

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEASKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>emb|CDP02781.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHF+IEVKP+D+VADVK+ IET+QGS+VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGTHFQIEVKPDDSVADVKRIIETIQGSDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_008390012.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=359

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HF++EVKPEDTVADVKK IE  +GS+VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGSHFDVEVKPEDTVADVKKHIEACKGSDVYPAPQQMLIHQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_008368214.1| PREDICTED: ubiquitin receptor RAD23c-like [Malus domestica]
Length=378

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHF++EVKPEDTVADVKK IE  +GS+VYPASQ MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFDLEVKPEDTVADVKKHIEACKGSDVYPASQQMLIHQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
             NKVAEN+FV
Sbjct  61   GNKVAENSFV  70



>ref|XP_002884326.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60585.1| hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVK ED+VADVKK+IETVQG++VYPA++ MLIHQGKVLKD TT+E
Sbjct  1    MKIFVKTLKGTHFEIEVKLEDSVADVKKNIETVQGADVYPAAKQMLIHQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKVAEN+F+
Sbjct  61   ENKVAENSFI  70



>ref|XP_008230399.1| PREDICTED: ubiquitin receptor RAD23d [Prunus mume]
Length=385

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPE+ V+DVKK IETVQG++VYPASQ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEEMVSDVKKIIETVQGADVYPASQQMLIHQGKVLKDTTTLE  60

Query  419  ENKVAENNFV  448
            EN+VAEN+F+
Sbjct  61   ENQVAENSFI  70



>ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera]
Length=383

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTV DVKK+IE+V G +VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVDDVKKNIESVHGPDVYPAGQQMLIHQGKVLKDATTLD  60

Query  419  ENKVAENNFV  448
            ENKV+EN+F+
Sbjct  61   ENKVSENSFL  70



>ref|XP_011464118.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=401

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            ENKV+EN+FV
Sbjct  61   ENKVSENSFV  70



>ref|XP_004299088.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=400

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEI+V+P+D+V DVKKSIET QG  VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIQVQPQDSVVDVKKSIETSQGLTVYPAAQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            ENKV+EN+FV
Sbjct  61   ENKVSENSFV  70



>ref|XP_006437673.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50913.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=300

 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  62   ENKVAENSFV  71



>ref|XP_003536688.1| PREDICTED: ubiquitin receptor RAD23c [Glycine max]
Length=408

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  419  ENKVAENNFV  448
            ENKV EN F+
Sbjct  61   ENKVVENTFI  70



>gb|KHN05574.1| Putative DNA repair protein RAD23-3 [Glycine soja]
Length=410

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV P+DTV++VKK+IETVQG++VYPA+Q MLIHQGKVL+D +TLE
Sbjct  1    MKVFVKTLKGTHFEIEVTPQDTVSEVKKNIETVQGADVYPAAQQMLIHQGKVLRDASTLE  60

Query  419  ENKVAENNFV  448
            ENKV EN F+
Sbjct  61   ENKVVENTFI  70



>ref|XP_007142903.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
 gb|ESW14897.1| hypothetical protein PHAVU_007G026600g [Phaseolus vulgaris]
Length=400

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV+P+DTV++VKKSIETVQG +VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDTVSEVKKSIETVQGVDVYPAALQMLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFV  448
            EN VAEN+F+
Sbjct  61   ENNVAENSFI  70



>ref|XP_010926135.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Elaeis 
guineensis]
Length=395

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  419  ENKVAENNFV  448
            +NKVAEN+F+
Sbjct  61   DNKVAENSFI  70



>ref|XP_010926134.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Elaeis 
guineensis]
Length=396

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  419  ENKVAENNFV  448
            +NKVAEN+F+
Sbjct  61   DNKVAENSFI  70



>ref|XP_008775144.1| PREDICTED: ubiquitin receptor RAD23d-like [Phoenix dactylifera]
Length=384

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIF+KTLKGTHFEIEVKPEDTV DVK++IE  QG +VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFIKTLKGTHFEIEVKPEDTVTDVKRNIEATQGQSVYPAEQQMLIHQGKILKDETTLQ  60

Query  419  ENKVAENNFV  448
            +NKVAEN+F+
Sbjct  61   DNKVAENSFI  70



>ref|XP_006437674.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50914.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=331

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  62   ENKVAENSFV  71



>ref|XP_010926132.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Elaeis 
guineensis]
Length=422

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  419  ENKVAENNFV  448
            +NKVAEN+F+
Sbjct  61   DNKVAENSFI  70



>ref|XP_010926133.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Elaeis 
guineensis]
Length=421

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HFEIEVKPEDTV DVKK+IE +QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSHFEIEVKPEDTVTDVKKNIEAIQGKGVYPAEQQMLIHQGKILKDDTTLQ  60

Query  419  ENKVAENNFV  448
            +NKVAEN+F+
Sbjct  61   DNKVAENSFI  70



>ref|XP_010552226.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  419  ENKVAENNFV  448
            ENK++EN F+
Sbjct  61   ENKISENGFI  70



>gb|KDP32945.1| hypothetical protein JCGZ_12976 [Jatropha curcas]
Length=382

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKP+D VADVKK+IETVQG++VYPA++ MLI+QGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPDDRVADVKKAIETVQGADVYPAAKQMLIYQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            ENKVA+N+F+
Sbjct  61   ENKVADNSFI  70



>ref|XP_010552232.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Tarenaya 
hassleriana]
Length=384

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT FEIEVKP+D V DVKK+IETVQG+NVYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKIFVKTLKGTSFEIEVKPDDKVTDVKKTIETVQGANVYPAAQQMLIHQGKVLSDETTLE  60

Query  419  ENKVAENNFV  448
            ENK++EN F+
Sbjct  61   ENKISENGFI  70



>ref|XP_002529115.1| uv excision repair protein rad23, putative [Ricinus communis]
 gb|EEF33228.1| uv excision repair protein rad23, putative [Ricinus communis]
Length=409

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT F++EVKPEDT+ADVKKSIET QG++VYPA Q MLI+QGKVLKD TT++
Sbjct  1    MKIFVKTLKGTTFDVEVKPEDTIADVKKSIETTQGADVYPAGQQMLIYQGKVLKDNTTID  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_006484457.1| PREDICTED: ubiquitin receptor RAD23c-like [Citrus sinensis]
Length=390

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  62   ENKVAENSFV  71



>ref|XP_006437675.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
 gb|ESR50915.1| hypothetical protein CICLE_v10031777mg [Citrus clementina]
Length=390

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT F++EVKPEDTV DVK  IETVQGS+VYPA+Q MLI+QGKVLKD TTLE
Sbjct  2    MKIFVKTLKGTSFDVEVKPEDTVFDVKMKIETVQGSDVYPAAQQMLIYQGKVLKDDTTLE  61

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  62   ENKVAENSFV  71



>ref|XP_010916168.1| PREDICTED: ubiquitin receptor RAD23c-like [Elaeis guineensis]
Length=384

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTVADVK++IE  QG +VYPA Q MLI+QGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVADVKRNIEATQGQSVYPAEQQMLIYQGKILKDETTLQ  60

Query  419  ENKVAENNFV  448
            ++KVAEN+FV
Sbjct  61   DSKVAENSFV  70



>ref|XP_011035053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Populus 
euphratica]
Length=373

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419  ENKVAENNF  445
            ENKV+E++F
Sbjct  61   ENKVSESSF  69



>ref|XP_011035048.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=391

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419  ENKVAENNF  445
            ENKV+E++F
Sbjct  61   ENKVSESSF  69



>ref|XP_011035051.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Populus 
euphratica]
Length=386

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419  ENKVAENNF  445
            ENKV+E++F
Sbjct  61   ENKVSESSF  69



>ref|XP_011035052.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Populus 
euphratica]
Length=385

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419  ENKVAENNF  445
            ENKV+E++F
Sbjct  61   ENKVSESSF  69



>ref|XP_011035049.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Populus 
euphratica]
Length=390

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419  ENKVAENNF  445
            ENKV+E++F
Sbjct  61   ENKVSESSF  69



>ref|XP_007142901.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
 gb|ESW14895.1| hypothetical protein PHAVU_007G026400g [Phaseolus vulgaris]
Length=402

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEV+P+D V++VKKSIE+ QG++VYPA+  MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTHFEIEVQPQDAVSEVKKSIESAQGADVYPAALQMLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFV  448
            EN VAEN+F+
Sbjct  61   ENNVAENSFI  70



>ref|XP_002305813.1| ubiquitin family protein [Populus trichocarpa]
 gb|EEE86324.1| ubiquitin family protein [Populus trichocarpa]
Length=385

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTVADVKK+IE+VQG++VYPA+Q ML++QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKKNIESVQGADVYPAAQQMLVYQGKVLKDDTTLD  60

Query  419  ENKVAENNF  445
            ENKV+E++F
Sbjct  61   ENKVSESSF  69



>ref|XP_008379541.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=387

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            +N VAEN+F+
Sbjct  61   QNNVAENSFI  70



>ref|XP_009417654.1| PREDICTED: ubiquitin receptor RAD23d-like [Musa acuminata subsp. 
malaccensis]
Length=391

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEI+VKPEDTVADVK+ IET QG  VYPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVADVKRYIETSQGKTVYPADQQMLIHQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
            ENKV+EN+F+
Sbjct  61   ENKVSENSFL  70



>gb|KJB80004.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=384

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  61   ENSVTENSFI  70



>gb|KJB80005.1| hypothetical protein B456_013G076900 [Gossypium raimondii]
Length=385

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHF IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVFVKTLKGTHFNIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  61   ENSVTENSFI  70



>ref|XP_006383465.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
 gb|ERP61262.1| hypothetical protein POPTR_0005s15740g [Populus trichocarpa]
Length=399

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
            E+KVAEN+F+
Sbjct  61   ESKVAENSFI  70



>ref|XP_008801156.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  419  ENKVAENNFV  448
            +NKV+EN+F+
Sbjct  61   DNKVSENSFI  70



>ref|XP_008801154.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Phoenix 
dactylifera]
Length=388

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  419  ENKVAENNFV  448
            +NKV+EN+F+
Sbjct  61   DNKVSENSFI  70



>ref|XP_008801157.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Phoenix 
dactylifera]
Length=367

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  419  ENKVAENNFV  448
            +NKV+EN+F+
Sbjct  61   DNKVSENSFI  70



>ref|XP_008801153.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Phoenix 
dactylifera]
Length=391

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGTHFEIEVKPEDTVA+VK+ IE+ QG +VYPA Q MLIHQGK+LKD +TL 
Sbjct  1    MKVFVKTLKGTHFEIEVKPEDTVAEVKRIIESAQGQSVYPAEQQMLIHQGKILKDDSTLN  60

Query  419  ENKVAENNFV  448
            +NKV+EN+F+
Sbjct  61   DNKVSENSFI  70



>gb|KJB80001.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=320

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  61   ENSVTENSFI  70



>ref|XP_002315945.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
 gb|EEF02116.2| hypothetical protein POPTR_0010s13610g [Populus trichocarpa]
Length=396

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_010907325.1| PREDICTED: ubiquitin receptor RAD23d-like [Elaeis guineensis]
Length=391

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTVADVK+ IE+ QG +VYP+ Q MLIHQGK+LKD TT+ 
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVADVKRIIESTQGQSVYPSEQQMLIHQGKILKDDTTMN  60

Query  419  ENKVAENNFV  448
            +NKV+ENNF+
Sbjct  61   DNKVSENNFI  70



>ref|XP_011007998.1| PREDICTED: ubiquitin receptor RAD23d-like [Populus euphratica]
Length=388

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+ F+IEVKP DTVADVKK+IET QG++VYPA Q MLI+QGKVLKD TTL 
Sbjct  1    MKIFVKTLKGSTFDIEVKPGDTVADVKKNIETAQGASVYPAEQQMLIYQGKVLKDDTTLG  60

Query  419  ENKVAENNFV  448
            ENKVAEN+FV
Sbjct  61   ENKVAENSFV  70



>ref|XP_011021232.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Populus euphratica]
Length=398

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
            E+KVAEN+F+
Sbjct  61   ESKVAENSFI  70



>ref|XP_010553920.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Tarenaya hassleriana]
Length=379

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  419  ENKVAENNFV  448
            ENK+AE  F+
Sbjct  61   ENKIAEKGFI  70



>gb|KJB79998.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
 gb|KJB79999.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=384

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  61   ENSVTENSFI  70



>ref|XP_011021231.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Populus euphratica]
Length=399

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
            E+KVAEN+F+
Sbjct  61   ESKVAENSFI  70



>ref|XP_010553921.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Tarenaya hassleriana]
Length=378

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGT FEIEVKPED V DVKK+IETVQG+NVYPA+Q +LIHQGKVL D TTLE
Sbjct  1    MKISVKTLKGTSFEIEVKPEDKVTDVKKTIETVQGANVYPAAQQILIHQGKVLNDDTTLE  60

Query  419  ENKVAENNFV  448
            ENK+AE  F+
Sbjct  61   ENKIAEKGFI  70



>gb|KJB80000.1| hypothetical protein B456_013G076800 [Gossypium raimondii]
Length=382

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPASQ MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGTDVYPASQQMLIYKGKVLKDDTTLA  60

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  61   ENSVTENSFI  70



>ref|XP_011021236.1| PREDICTED: ubiquitin receptor RAD23c isoform X4 [Populus euphratica]
Length=381

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
            E+KVAEN+F+
Sbjct  61   ESKVAENSFI  70



>emb|CAA72741.1| RAD23, isoform I [Daucus carota]
Length=382

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI+VKTLKG+ FEI+V P+D+VADVK+SIET QG+ VYPA+Q MLI+QGKVLKDGTTL 
Sbjct  1    MKIYVKTLKGSQFEIQVNPDDSVADVKRSIETAQGAAVYPAAQQMLIYQGKVLKDGTTLL  60

Query  419  ENKVAENNFV  448
            EN VAEN+F+
Sbjct  61   ENNVAENSFI  70



>ref|XP_011021233.1| PREDICTED: ubiquitin receptor RAD23c isoform X3 [Populus euphratica]
Length=382

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
            E+KVAEN+F+
Sbjct  61   ESKVAENSFI  70



>ref|XP_011021237.1| PREDICTED: ubiquitin receptor RAD23c isoform X5 [Populus euphratica]
Length=364

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEVKPEDTV +VKK+IE  QG++VYPA+Q MLI+QGKVLKD TTL+
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVEVKKNIENAQGADVYPAAQQMLIYQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
            E+KVAEN+F+
Sbjct  61   ESKVAENSFI  70



>ref|XP_009399729.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  419  ENKVAENNFV  448
            ENKV EN+F+
Sbjct  61   ENKVFENSFL  70



>ref|XP_009399730.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG++FEI+V PEDTVADVKK+IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGSNFEIDVNPEDTVADVKKNIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  419  ENKVAENNFV  448
            ENKV EN+F+
Sbjct  61   ENKVFENSFL  70



>ref|XP_006846642.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
 gb|ERN08317.1| hypothetical protein AMTR_s00156p00078120 [Amborella trichopoda]
Length=389

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKG+HFEIEV+P DTV+ VKK+IET+ G +VYPA+Q +LIHQGKVLKD TTL 
Sbjct  1    MKLFVKTLKGSHFEIEVEPSDTVSAVKKNIETIHGQDVYPAAQQLLIHQGKVLKDDTTLL  60

Query  419  ENKVAENNFV  448
            +NKVAENNF+
Sbjct  61   DNKVAENNFL  70



>ref|XP_008341883.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica]
Length=408

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+F IEVKPE+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFAIEVKPEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
             N VAEN+F+
Sbjct  61   ANNVAENSFI  70



>ref|XP_007046250.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
 gb|EOY02082.1| Rad23 UV excision repair protein family isoform 2 [Theobroma 
cacao]
Length=340

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HF++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIHKGKVLKDDTTLA  60

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  61   ENSVTENSFI  70



>gb|EPS71284.1| hypothetical protein M569_03474, partial [Genlisea aurea]
Length=389

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 60/70 (86%), Gaps = 2/70 (3%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGTHFEIEVKPEDTV+DVK  IET QG   YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDTVSDVKTIIETAQGE--YPAAQQMLIHQGKVLKDATTLE  58

Query  419  ENKVAENNFV  448
            EN VAE +FV
Sbjct  59   ENNVAEKSFV  68



>ref|XP_002312393.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
 gb|EEE89760.1| hypothetical protein POPTR_0008s11840g [Populus trichocarpa]
Length=333

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            M+IFVKTLKG+ F+IEVKPEDTVADVKK IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MRIFVKTLKGSTFDIEVKPEDTVADVKKKIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  419  ENKVAENNFV  448
            ENK+ EN+FV
Sbjct  61   ENKIVENSFV  70



>ref|XP_007046249.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
 gb|EOY02081.1| Rad23 UV excision repair protein family isoform 1 [Theobroma 
cacao]
Length=385

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG+HF++EVK ED V+DVKK+IETVQG++VYPA+Q MLIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGSHFDVEVKAEDVVSDVKKNIETVQGADVYPAAQQMLIHKGKVLKDDTTLA  60

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  61   ENSVTENSFI  70



>ref|XP_003551850.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Glycine 
max]
 gb|KHN17319.1| Putative DNA repair protein RAD23-4 [Glycine soja]
Length=375

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGTHF ++V P+DTVA VKK+IET QG++VYPA+Q MLIHQGKVL D TTLE
Sbjct  1    MKINVKTLKGTHFVLQVNPQDTVAVVKKNIETAQGADVYPAAQQMLIHQGKVLNDATTLE  60

Query  419  ENKVAENNFV  448
            ENKV ENNFV
Sbjct  61   ENKVVENNFV  70



>gb|KJB79994.1| hypothetical protein B456_013G076500 [Gossypium raimondii]
Length=384

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI++GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIYKGKVLKDDTTLA  60

Query  419  ENKVAENNFV  448
            E+ V EN+F+
Sbjct  61   ESSVTENSFI  70



>gb|KJB79995.1| hypothetical protein B456_013G076600 [Gossypium raimondii]
Length=384

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHF+IEVKPED VADVKK+IETVQG++VYPA+Q MLI +GKVLKD TTL 
Sbjct  1    MKVSVKTLKGTHFDIEVKPEDAVADVKKNIETVQGADVYPAAQQMLIFKGKVLKDDTTLA  60

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  61   ENSVNENSFI  70



>ref|XP_009391404.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=409

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  419  ENKVAENNFV  448
            ENKV E+ F+
Sbjct  61   ENKVCESTFL  70



>ref|XP_004489115.1| PREDICTED: putative DNA repair protein RAD23-4-like [Cicer arietinum]
Length=377

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGTHFEI+V  +DTV DVKK+IE VQG +VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLQDTVGDVKKNIEAVQGVDVYPAAQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            EN+VAEN+FV
Sbjct  61   ENQVAENSFV  70



>ref|XP_004304134.1| PREDICTED: ubiquitin receptor RAD23d-like [Fragaria vesca subsp. 
vesca]
Length=390

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIEV+P+  VADVK+ IE  QG++VYPAS+ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLKGTNFEIEVEPKQLVADVKQVIEKAQGADVYPASKQMLIHQGKVLKDATTLE  60

Query  419  ENKVAENNFV  448
            EN+VAEN+F+
Sbjct  61   ENQVAENSFI  70



>ref|XP_009391405.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEI+VKPEDTVA VK+ IET QG  VYPA Q MLIHQGK+LKD TTL+
Sbjct  1    MKIFVKTLKGTNFEIDVKPEDTVAAVKRYIETSQGKTVYPAEQQMLIHQGKILKDDTTLD  60

Query  419  ENKVAENNFV  448
            ENKV E+ F+
Sbjct  61   ENKVCESTFL  70



>ref|XP_011022053.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Populus 
euphratica]
Length=324

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  419  ENKVAENNFV  448
            ENK+ EN+FV
Sbjct  61   ENKIVENSFV  70



>gb|AFK37901.1| unknown [Medicago truncatula]
Length=215

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGTHFEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIHQGKVLKDETTLE  60

Query  419  ENKVAENNFV  448
            EN+VAEN+F+
Sbjct  61   ENQVAENSFI  70



>ref|XP_010681568.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X6 [Beta vulgaris 
subsp. vulgaris]
Length=354

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  64   HNKVAENSFI  73



>ref|XP_010681567.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X5 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  64   HNKVAENSFI  73



>ref|XP_010681564.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=392

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  64   HNKVAENSFI  73



>ref|XP_010681566.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X4 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  64   HNKVAENSFI  73



>ref|XP_006655985.1| PREDICTED: ubiquitin receptor RAD23c-like [Oryza brachyantha]
Length=409

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIE  PE +VA+VKK IET QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKKIIETTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  61   GNKVAENSFL  70



>ref|XP_010681563.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  64   HNKVAENSFI  73



>ref|XP_010681565.1| PREDICTED: ubiquitin receptor RAD23c-like isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI+VK LKG HF+IEVKP+DTV DVKK+IE+V+G+N++PAS  MLI+QGKVL DGTTLE
Sbjct  4    MKIYVKNLKGKHFQIEVKPQDTVLDVKKNIESVKGANLFPASHQMLIYQGKVLIDGTTLE  63

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  64   HNKVAENSFI  73



>ref|XP_006383464.1| ubiquitin family protein [Populus trichocarpa]
 gb|ERP61261.1| ubiquitin family protein [Populus trichocarpa]
Length=384

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 66/71 (93%), Gaps = 1/71 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVA-DVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTL  415
            MK+FVKTLKGT+FEIEVKPEDTV  +VKK+IE VQG++VYPA+Q MLI+QGKVLKD TTL
Sbjct  1    MKVFVKTLKGTNFEIEVKPEDTVVVEVKKNIENVQGADVYPAAQQMLIYQGKVLKDDTTL  60

Query  416  EENKVAENNFV  448
            +E+KVAEN+F+
Sbjct  61   DESKVAENSFI  71



>ref|XP_009357056.1| PREDICTED: ubiquitin receptor RAD23d [Pyrus x bretschneideri]
Length=391

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK++VKTLKGT+FEIEVK E+TVADVK  IET QG++VYPA Q MLIHQGKVLKD TTLE
Sbjct  1    MKVYVKTLKGTNFEIEVKLEETVADVKTIIETAQGADVYPAPQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            +N VAEN+F+
Sbjct  61   QNNVAENSFI  70



>ref|XP_011022044.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Populus 
euphratica]
Length=378

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKG+ F+IEV+PEDTVADVKK+IET QG  VYPA Q MLIHQ KVLKD TTL+
Sbjct  1    MKILVKTLKGSTFDIEVRPEDTVADVKKNIETAQGVAVYPAEQQMLIHQAKVLKDNTTLD  60

Query  419  ENKVAENNFV  448
            ENK+ EN+FV
Sbjct  61   ENKIVENSFV  70



>ref|NP_001057334.1| Os06g0264300 [Oryza sativa Japonica Group]
 dbj|BAD54365.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD54370.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF19248.1| Os06g0264300 [Oryza sativa Japonica Group]
 gb|EAZ36555.1| hypothetical protein OsJ_20893 [Oryza sativa Japonica Group]
 dbj|BAG88004.1| unnamed protein product [Oryza sativa Japonica Group]
Length=413

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  61   GNKVAENSFL  70



>gb|EAZ00429.1| hypothetical protein OsI_22453 [Oryza sativa Indica Group]
Length=413

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE+ QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  61   GNKVAENSFL  70



>ref|XP_010440953.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
 ref|XP_010440954.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
 ref|XP_010440955.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X3 [Camelina 
sativa]
 ref|XP_010440956.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X4 [Camelina 
sativa]
Length=377

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>gb|KEH21499.1| RAD23 UV excision repair family protein [Medicago truncatula]
Length=370

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGTHFEI+V   DTV DVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFEIQVNLHDTVGDVKKNIEGAQGAAVYPAAQQMLIHQGKVLKDETTLE  60

Query  419  ENKVAENNFV  448
            EN+VAEN+F+
Sbjct  61   ENQVAENSFI  70



>ref|XP_010435749.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X1 [Camelina 
sativa]
Length=376

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>gb|AFK37577.1| unknown [Lotus japonicus]
Length=376

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGTHF+I+V  +D+VADVKK+IE  QG+ VYPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKINVKTLKGTHFQIQVNLQDSVADVKKTIEVAQGAGVYPAAQQMLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            EN VAE++FV
Sbjct  61   ENNVAEDSFV  70



>ref|XP_010435751.1| PREDICTED: ubiquitin receptor RAD23d-like isoform X2 [Camelina 
sativa]
Length=374

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>gb|KFK33251.1| hypothetical protein AALP_AA6G350300 [Arabis alpina]
Length=392

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEVKP DTV+DVKK+IET+ G + YPA+Q MLIHQGK+L D +TLE
Sbjct  1    MKIFVKTLKGTNFEIEVKPVDTVSDVKKAIETLHGEH-YPAAQQMLIHQGKILNDASTLE  59

Query  419  ENKVAENNFV  448
            EN VAEN+F+
Sbjct  60   ENNVAENSFI  69



>ref|XP_010450905.1| PREDICTED: ubiquitin receptor RAD23d isoform X1 [Camelina sativa]
Length=381

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>ref|XP_010450906.1| PREDICTED: ubiquitin receptor RAD23d isoform X2 [Camelina sativa]
Length=379

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTL GT+FEIEVKP DTV+DVK++IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSDVKQAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>ref|XP_003563980.1| PREDICTED: ubiquitin receptor RAD23d-like [Brachypodium distachyon]
Length=413

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTLKGT+FEIE  PE +VA+VK+ IE  QG NVYPA Q MLIHQGK+LKD TTLE
Sbjct  1    MKLFVKTLKGTNFEIEASPEASVAEVKRIIEGAQGQNVYPADQQMLIHQGKILKDDTTLE  60

Query  419  ENKVAENNFV  448
             N VAEN+F+
Sbjct  61   GNNVAENSFL  70



>ref|XP_002870839.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47098.1| hypothetical protein ARALYDRAFT_494129 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTL GT+FEIEVKP DTV+DVKK+IETV+G+  YPA + MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGTNFEIEVKPADTVSDVKKAIETVKGAE-YPAVKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>emb|CDY01661.1| BnaC04g30910D [Brassica napus]
Length=378

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>ref|XP_009139789.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=378

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV P DT++D K+ IET QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIETHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>gb|EMS50196.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=610

 Score =   106 bits (265),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 52/70 (74%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+ FEIEV P D V+DVKK IET QG NVYPA Q MLI+QG VLKD TTLE
Sbjct  1    MKVSVKTLKGSKFEIEVNPADKVSDVKKLIETSQGQNVYPADQQMLIYQGSVLKDETTLE  60

Query  419  ENKVAENNFV  448
            ENKV ENNF+
Sbjct  61   ENKVVENNFL  70



>ref|XP_006283908.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
 gb|EOA16806.1| hypothetical protein CARUB_v10005026mg [Capsella rubella]
Length=385

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+FVKTL GT+FEIEVKP DTV++VKK+IETVQG+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKVFVKTLSGTNFEIEVKPADTVSEVKKAIETVQGAQ-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V E +F+
Sbjct  60   ENNVVEKSFI  69



>emb|CDX74522.1| BnaA04g08670D [Brassica napus]
Length=380

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV P DT++D K+ IE+ QG+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPADTISDTKRRIESHQGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>ref|XP_003578094.1| PREDICTED: probable ubiquitin receptor RAD23 [Brachypodium distachyon]
Length=395

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+ F+IEV P D V+DVKK IE+ QG NVYPA Q MLIHQG VLKD TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVNPADKVSDVKKLIESSQGQNVYPADQQMLIHQGTVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            E+KV ENNF+
Sbjct  61   ESKVLENNFL  70



>ref|XP_010692904.1| PREDICTED: ubiquitin receptor RAD23d [Beta vulgaris subsp. vulgaris]
Length=409

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEI+   +DTVADVKKSIE +QG+  YPA+  MLIHQGKVLKD TTL 
Sbjct  1    MKIFVKTLKGTNFEIDANIDDTVADVKKSIEKIQGAETYPANLQMLIHQGKVLKDTTTLG  60

Query  419  ENKVAENNFV  448
            EN VAEN+F+
Sbjct  61   ENNVAENSFL  70



>gb|EMT27109.1| Putative DNA repair protein RAD23 [Aegilops tauschii]
Length=423

 Score =   104 bits (259),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLE  60

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  61   ANKVAENSFL  70



>emb|CDY58121.1| BnaCnng32650D [Brassica napus]
Length=384

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>gb|KCW86330.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=320

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGT+FEIEV+P++ V DVKK IE +QG++++PASQ MLIHQGKVLKD TTL+
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIHQGKVLKDETTLD  60

Query  419  ENKVAENNFV  448
            ENK+ E +F+
Sbjct  61   ENKIVEGSFI  70



>gb|EMS61794.1| putative DNA repair protein RAD23 [Triticum urartu]
Length=424

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLE  60

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  61   ANKVAENSFL  70



>dbj|BAJ97496.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=420

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTL+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLD  60

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  61   ANKVAENSFL  70



>dbj|BAJ98767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT FEIE  PE +V +VK+ IE+ QG NVYPA QLM+I+QGK+LKD TTL+
Sbjct  1    MKLNVKTLKGTSFEIEATPESSVGEVKRIIESAQGQNVYPADQLMIIYQGKILKDDTTLD  60

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  61   ANKVAENSFL  70



>ref|NP_001078680.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 gb|AED94322.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=332

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>ref|XP_004956778.1| PREDICTED: probable DNA repair protein RAD23-like isoform X2 
[Setaria italica]
Length=394

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIHQGKVLNDETTLE  60

Query  419  ENKVAENNFV  448
            EN+V ENNF+
Sbjct  61   ENQVLENNFL  70



>dbj|BAC76393.1| RAD23-like protein [Arabidopsis thaliana]
Length=337

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTT  412
            MKIFVKTLKGTHFEIEVKPED+V DVKK+IE+VQG++VYPA++ MLIHQGKVLKD TT
Sbjct  1    MKIFVKTLKGTHFEIEVKPEDSVVDVKKNIESVQGADVYPAAKQMLIHQGKVLKDETT  58



>dbj|BAC76395.1| RAD23-like protein [Arabidopsis thaliana]
Length=343

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>ref|XP_010044267.1| PREDICTED: ubiquitin receptor RAD23d-like [Eucalyptus grandis]
 gb|KCW86329.1| hypothetical protein EUGRSUZ_B03019 [Eucalyptus grandis]
Length=401

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKGT+FEIEV+P++ V DVKK IE +QG++++PASQ MLIHQGKVLKD TTL+
Sbjct  1    MKINVKTLKGTNFEIEVEPQEAVVDVKKKIEIIQGASMFPASQQMLIHQGKVLKDETTLD  60

Query  419  ENKVAENNFV  448
            ENK+ E +F+
Sbjct  61   ENKIVEGSFI  70



>ref|XP_004956777.1| PREDICTED: probable DNA repair protein RAD23-like isoform X1 
[Setaria italica]
Length=468

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+ F+IEV+  D VADVKK IE+ QG NVYPA Q MLIHQGKVL D TTLE
Sbjct  1    MKVSVKTLKGSSFQIEVEATDKVADVKKVIESTQGQNVYPADQQMLIHQGKVLNDETTLE  60

Query  419  ENKVAENNFV  448
            EN+V ENNF+
Sbjct  61   ENQVLENNFL  70



>emb|CDX67404.1| BnaA07g14440D [Brassica napus]
Length=382

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V +N+F+
Sbjct  60   ENNVVDNSFI  69



>ref|XP_009125074.1| PREDICTED: ubiquitin receptor RAD23d [Brassica rapa]
Length=382

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 59/70 (84%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV P +T++D KK IET+ G+  YPA+Q MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLKGTNFEIEVNPAETISDTKKRIETLHGAQ-YPAAQQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V +N+F+
Sbjct  60   ENNVVDNSFI  69



>ref|NP_198663.1| ubiquitin receptor RAD23d [Arabidopsis thaliana]
 sp|Q84L30.2|RD23D_ARATH RecName: Full=Ubiquitin receptor RAD23d; Short=AtRAD23d; AltName: 
Full=Putative DNA repair protein RAD23-4; AltName: Full=RAD23-like 
protein 4; Short=AtRAD23-4 [Arabidopsis thaliana]
 dbj|BAB09359.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 gb|AAL25609.1| unknown protein [Arabidopsis thaliana]
 gb|AAL87405.1| At5g38470/At5g38470 [Arabidopsis thaliana]
 gb|AAM65106.1| DNA repair protein RAD23 homolog [Arabidopsis thaliana]
 dbj|BAC76394.1| RAD23-like protein [Arabidopsis thaliana]
 gb|ABG89117.1| Rad23-2 [synthetic construct]
 gb|AED94321.1| putative DNA repair protein RAD23-4 [Arabidopsis thaliana]
Length=378

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>gb|AAK59766.1| unknown protein [Arabidopsis thaliana]
Length=378

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTL G++FEIEVKP D V+DVK +IETV+G+  YPA++ MLIHQGKVLKD TTLE
Sbjct  1    MKIFVKTLSGSNFEIEVKPADKVSDVKTAIETVKGAE-YPAAKQMLIHQGKVLKDETTLE  59

Query  419  ENKVAENNFV  448
            EN V EN+F+
Sbjct  60   ENNVVENSFI  69



>gb|EAZ07072.1| hypothetical protein OsI_29318 [Oryza sativa Indica Group]
Length=406

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ +KTLKG+ FEI+V+P   V+DVKK IE  QG NVYPA Q MLIHQG VLK+ TTLE
Sbjct  1    MKVSIKTLKGSSFEIDVEPTSKVSDVKKLIEVTQGDNVYPADQQMLIHQGNVLKNDTTLE  60

Query  419  ENKVAENNFV  448
            ENKV ENNF+
Sbjct  61   ENKVVENNFI  70



>ref|NP_001061854.1| Os08g0430200 [Oryza sativa Japonica Group]
 dbj|BAD01169.1| putative osRAD23 [Oryza sativa Japonica Group]
 dbj|BAF23768.1| Os08g0430200 [Oryza sativa Japonica Group]
 gb|EAZ42817.1| hypothetical protein OsJ_27402 [Oryza sativa Japonica Group]
 dbj|BAG89255.1| unnamed protein product [Oryza sativa Japonica Group]
Length=406

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ +KTLKG+ FEI+V+P   V+DVKK IE  QG NVYPA Q MLIHQG VLK+ TTLE
Sbjct  1    MKVSIKTLKGSSFEIDVEPTSKVSDVKKLIEVTQGDNVYPADQQMLIHQGNVLKNDTTLE  60

Query  419  ENKVAENNFV  448
            ENKV ENNF+
Sbjct  61   ENKVVENNFI  70



>ref|XP_003574508.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X2 [Brachypodium 
distachyon]
Length=394

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ +KTLKG+ FEIEV P   V D+KK IE  QG NVYPA Q MLIHQG VLK+ TTLE
Sbjct  1    MKVSIKTLKGSSFEIEVDPTSKVVDLKKLIENTQGQNVYPADQQMLIHQGNVLKNDTTLE  60

Query  419  ENKVAENNFV  448
            ENKV ENNF+
Sbjct  61   ENKVLENNFI  70



>ref|XP_010235145.1| PREDICTED: probable ubiquitin receptor RAD23 isoform X1 [Brachypodium 
distachyon]
Length=395

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ +KTLKG+ FEIEV P   V D+KK IE  QG NVYPA Q MLIHQG VLK+ TTLE
Sbjct  1    MKVSIKTLKGSSFEIEVDPTSKVVDLKKLIENTQGQNVYPADQQMLIHQGNVLKNDTTLE  60

Query  419  ENKVAENNFV  448
            ENKV ENNF+
Sbjct  61   ENKVLENNFI  70



>ref|XP_006405766.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
 gb|ESQ47219.1| hypothetical protein EUTSA_v10027790mg [Eutrema salsugineum]
Length=389

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 57/70 (81%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT+FEIEV   DT++DVKKSIET+ G   YPA+Q MLIHQGKVLKD TTL 
Sbjct  1    MKIFVKTLKGTNFEIEVNETDTISDVKKSIETIHGEQ-YPAAQQMLIHQGKVLKDETTLA  59

Query  419  ENKVAENNFV  448
            EN V E +F+
Sbjct  60   ENNVVEKSFI  69



>ref|NP_001130219.1| uncharacterized protein LOC100191313 [Zea mays]
 gb|ACF78374.1| unknown [Zea mays]
 tpg|DAA61377.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
 tpg|DAA61378.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=225

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            EN+V ENNF+
Sbjct  61   ENQVVENNFL  70



>gb|ACN40029.1| unknown [Picea sitchensis]
Length=403

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG HF+IEV+P DTV +VKK IE VQG+  YP+ Q +LI+QGKVLKD TT+E
Sbjct  1    MKVSVKTLKGNHFDIEVQPTDTVLNVKKQIEQVQGAQTYPSEQQLLIYQGKVLKDETTIE  60

Query  419  ENKVAENNFV  448
            ENKV EN F+
Sbjct  61   ENKVTENTFL  70



>ref|XP_004965183.1| PREDICTED: putative DNA repair protein RAD23-3-like [Setaria 
italica]
Length=410

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT FEIE  PE++VA+VKK IET QG  VYPA Q MLI+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTSFEIEASPEESVAEVKKIIETTQGE-VYPADQQMLIYQGKILKDDTTLE  59

Query  419  ENKVAENNFV  448
             NKVAEN+F+
Sbjct  60   SNKVAENSFL  69



>ref|XP_001763027.1| predicted protein [Physcomitrella patens]
 gb|EDQ72232.1| predicted protein [Physcomitrella patens]
Length=370

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKG HF++EV P DTV +VK+ IE  QG   +P SQ +LIHQGKVLKD TT+E
Sbjct  1    MKISVKTLKGNHFDLEVSPADTVLNVKRQIEDSQGKESFPCSQQLLIHQGKVLKDETTME  60

Query  419  ENKVAENNFV  448
            ENKV+EN FV
Sbjct  61   ENKVSENGFV  70



>tpg|DAA61375.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=339

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            EN+V ENNF+
Sbjct  61   ENQVVENNFL  70



>ref|XP_006427691.1| hypothetical protein CICLE_v100258681mg, partial [Citrus clementina]
 gb|ESR40931.1| hypothetical protein CICLE_v100258681mg, partial [Citrus clementina]
Length=76

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFV  448
            +NKV+E+ F+
Sbjct  61   DNKVSEDGFL  70



>ref|XP_010246571.1| PREDICTED: ubiquitin receptor RAD23b-like [Nelumbo nucifera]
Length=378

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTLE
Sbjct  1    MKLTVKTLKGTHFEIRVQPGDTVMAVKKNIEDVQGKDSYPCGQQLLIHNGKVLKDETTLE  60

Query  419  ENKVAENNFV  448
            +NKV+E+ F+
Sbjct  61   QNKVSEDGFL  70



>ref|XP_008650775.1| PREDICTED: uncharacterized protein LOC100191313 isoform X1 [Zea 
mays]
 gb|ACF84200.1| unknown [Zea mays]
 gb|ACG34516.1| DNA repair protein RAD23 [Zea mays]
 tpg|DAA61376.1| TPA: DNA repair protein RAD23 [Zea mays]
Length=386

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            EN+V ENNF+
Sbjct  61   ENQVVENNFL  70



>tpg|DAA61379.1| TPA: hypothetical protein ZEAMMB73_350633 [Zea mays]
Length=382

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+ F IEV P D VADVKK IE++Q    YPA Q +LIHQGKVLKD TTLE
Sbjct  1    MKVSVKTLKGSSFHIEVDPTDKVADVKKVIESIQEQASYPADQQVLIHQGKVLKDDTTLE  60

Query  419  ENKVAENNFV  448
            EN+V ENNF+
Sbjct  61   ENQVVENNFL  70



>gb|AAB65841.1| osRAD23 [Oryza sativa Japonica Group]
Length=392

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
            ENKV EN+F+
Sbjct  61   ENKVLENSFL  70



>ref|NP_001063134.1| Os09g0407200 [Oryza sativa Japonica Group]
 sp|Q40742.2|RAD23_ORYSJ RecName: Full=Probable ubiquitin receptor RAD23; Short=OsRAD23; 
AltName: Full=Probable DNA repair protein RAD23 [Oryza sativa 
Japonica Group]
 dbj|BAD36240.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAD36295.1| putative RAD23 protein [Oryza sativa Japonica Group]
 dbj|BAF25048.1| Os09g0407200 [Oryza sativa Japonica Group]
 gb|EAZ09053.1| hypothetical protein OsI_31314 [Oryza sativa Indica Group]
 gb|EAZ44680.1| hypothetical protein OsJ_29306 [Oryza sativa Japonica Group]
Length=392

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKI VKTLKG+ F+IEV     VADVK+ IET QG ++YPA Q MLIHQGKVLKD TTL+
Sbjct  1    MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD  60

Query  419  ENKVAENNFV  448
            ENKV EN+F+
Sbjct  61   ENKVLENSFL  70



>ref|XP_010268454.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Nelumbo 
nucifera]
Length=344

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE VQG + YP  Q +LIH GKVLKD TTLE
Sbjct  1    MKLTVKTLKGTHFEIRVQPGDTIMAVKKTIEDVQGKDSYPCGQQLLIHNGKVLKDETTLE  60

Query  419  ENKVAENNFV  448
            +NKV+E+ F+
Sbjct  61   DNKVSEDGFL  70



>emb|CDX69474.1| BnaA10g18230D [Brassica napus]
Length=365

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKGT FEI+V PED+V DVKK+IETV G   YPA++ +LIH+GKVLKD TTL 
Sbjct  1    MKIFVKTLKGTRFEIQVSPEDSVGDVKKNIETVMGVTAYPAAEQVLIHKGKVLKDETTLA  60

Query  419  ENKVAENNFVG  451
             N V+E + +G
Sbjct  61   ANNVSEKSVIG  71



>ref|XP_010268452.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010268453.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Nelumbo 
nucifera]
Length=387

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE VQG + YP  Q +LIH GKVLKD TTLE
Sbjct  1    MKLTVKTLKGTHFEIRVQPGDTIMAVKKTIEDVQGKDSYPCGQQLLIHNGKVLKDETTLE  60

Query  419  ENKVAENNFV  448
            +NKV+E+ F+
Sbjct  61   DNKVSEDGFL  70



>gb|ACG32894.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEIE  P+ +VA+VK+ IET QG + YPA Q MLI+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTNFEIEASPDASVAEVKRIIETTQGQSTYPADQQMLIYQGKILKDETTLE  60

Query  419  ENKVAENNFV  448
             N VAEN+F+
Sbjct  61   SNGVAENSFL  70



>gb|KDO46132.1| hypothetical protein CISIN_1g0198171mg [Citrus sinensis]
Length=197

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DTV  VKK+IE VQG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTVMAVKKNIEDVQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFV  448
            +NKV+E+ F+
Sbjct  61   DNKVSEDGFL  70



>ref|NP_001149140.1| LOC100282762 [Zea mays]
 gb|ACG34344.1| DNA repair protein RAD23 [Zea mays]
Length=402

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEIE  P+ +VA+VK+ IET QG + YPA Q MLI+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTNFEIEASPDASVAEVKRIIETTQGQSTYPADQQMLIYQGKILKDETTLE  60

Query  419  ENKVAENNFV  448
             N VAEN+F+
Sbjct  61   SNGVAENSFL  70



>ref|XP_004147454.1| PREDICTED: putative DNA repair protein RAD23-1-like [Cucumis 
sativus]
 gb|KGN59613.1| hypothetical protein Csa_3G829030 [Cucumis sativus]
Length=374

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HF+IEV+P DTV  VKK+IE VQG + YP SQ +LIH GKVLKD TTL 
Sbjct  1    MKLTVKTLKGSHFQIEVQPTDTVLGVKKNIENVQGKDSYPCSQQLLIHNGKVLKDETTLT  60

Query  419  ENKVAENNFV  448
            ENK+ E+ F+
Sbjct  61   ENKITEDGFL  70



>gb|ACN26781.1| unknown [Zea mays]
Length=294

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEIE  P+ +VADVK+ IET QG + Y A Q MLI+QGK+LKD TTLE
Sbjct  1    MKLNVKTLKGTNFEIEASPDASVADVKRIIETTQGQSTYRADQQMLIYQGKILKDETTLE  60

Query  419  ENKVAENNFV  448
             N VAEN+F+
Sbjct  61   SNGVAENSFL  70



>ref|XP_006646967.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Oryza brachyantha]
Length=370

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD +TLE
Sbjct  1    MKLTVKTLKGTHFEIRVQPHDTIMAVKKNIEEIQGKDSYPWGQQLLIHNGKVLKDESTLE  60

Query  419  ENKVAENNFV  448
            ENKV+E+ F+
Sbjct  61   ENKVSEDGFL  70



>ref|XP_006646966.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Oryza brachyantha]
Length=371

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD +TLE
Sbjct  1    MKLTVKTLKGTHFEIRVQPHDTIMAVKKNIEEIQGKDSYPWGQQLLIHNGKVLKDESTLE  60

Query  419  ENKVAENNFV  448
            ENKV+E+ F+
Sbjct  61   ENKVSEDGFL  70



>ref|XP_009408042.1| PREDICTED: ubiquitin receptor RAD23b-like [Musa acuminata subsp. 
malaccensis]
Length=388

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGTHFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTLE
Sbjct  1    MKLTVKTLKGTHFEIRVQPNDTIMAVKKNIEQIQGKDSYPWGQQLLIHNGKVLKDETTLE  60

Query  419  ENKVAENNFV  448
            ENKV E+ F+
Sbjct  61   ENKVKEDGFL  70



>ref|XP_009605626.1| PREDICTED: probable ubiquitin receptor RAD23a [Nicotiana tomentosiformis]
Length=108

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DT+  VKK IE VQG + YP  Q +LIH GKVLKD +TL 
Sbjct  1    MKLTVKTLKGSHFEIRVQPSDTIMAVKKHIEDVQGKDNYPCGQQLLIHNGKVLKDESTLV  60

Query  419  ENKVAENNFV  448
            ENKV+E+ F+
Sbjct  61   ENKVSEDGFL  70



>ref|XP_006646969.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X2 [Oryza brachyantha]
Length=369

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD +TLE
Sbjct  1    MKLTVKTLKGTNFEIRVQPHDTIMAVKKNIEDIQGKDSYPWGQQLLIHNGKVLKDESTLE  60

Query  419  ENKVAENNFV  448
            ENKV+E+NF+
Sbjct  61   ENKVSEDNFL  70



>ref|XP_006646968.1| PREDICTED: ubiquitin receptor RAD23b-like isoform X1 [Oryza brachyantha]
Length=370

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKGT+FEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD +TLE
Sbjct  1    MKLTVKTLKGTNFEIRVQPHDTIMAVKKNIEDIQGKDSYPWGQQLLIHNGKVLKDESTLE  60

Query  419  ENKVAENNFV  448
            ENKV+E+NF+
Sbjct  61   ENKVSEDNFL  70



>gb|KJB69954.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=317

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFV  448
            ENKV+E+ F+
Sbjct  61   ENKVSEDGFL  70



>gb|KJB69953.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=330

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFV  448
            ENKV+E+ F+
Sbjct  61   ENKVSEDGFL  70



>emb|CDX69473.1| BnaA10g18220D [Brassica napus]
Length=659

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  230  RENMKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGT  409
            ++ MKIFVKTLKG  FEI+VKPED VADVKK+IETV G   YPA++  LIH+GKVLKD T
Sbjct  350  KDKMKIFVKTLKGARFEIQVKPEDLVADVKKNIETVLGVTAYPAAEQRLIHKGKVLKDET  409

Query  410  TLEENKVAENNFVG  451
            T+E N V+E + +G
Sbjct  410  TVEANNVSEKSTIG  423


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 3/71 (4%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MKIFVKTLKG  FEI+V  ED+VADVKK+IETV G     A++ MLIH+GKVL+D TT+E
Sbjct  1    MKIFVKTLKGDRFEIQVNLEDSVADVKKNIETVMGVT---AAEQMLIHKGKVLEDETTME  57

Query  419  ENKVAENNFVG  451
             N+V+E + + 
Sbjct  58   ANEVSEKSIIA  68



>gb|KJB69952.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
 gb|KJB69955.1| hypothetical protein B456_011G053200 [Gossypium raimondii]
Length=362

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  239  MKIFVKTLKGTHFEIEVKPEDTVADVKKSIETVQGSNVYPASQLMLIHQGKVLKDGTTLE  418
            MK+ VKTLKG+HFEI V+P DT+  VKK+IE +QG + YP  Q +LIH GKVLKD TTL 
Sbjct  1    MKLIVKTLKGSHFEIRVQPNDTIMAVKKNIEDIQGKDNYPCGQQLLIHNGKVLKDETTLA  60

Query  419  ENKVAENNFV  448
            ENKV+E+ F+
Sbjct  61   ENKVSEDGFL  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985