BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L09

Length=557
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006389506.1|  hypothetical protein POPTR_0022s00470g             250   5e-78   
ref|XP_006389510.1|  hypothetical protein POPTR_0022s00470g             249   5e-77   
ref|XP_006389507.1|  hypothetical protein POPTR_0022s00470g             249   7e-76   
ref|XP_011047892.1|  PREDICTED: prolycopene isomerase, chloroplas...    248   2e-75   Populus euphratica
ref|XP_011047890.1|  PREDICTED: prolycopene isomerase, chloroplas...    248   3e-75   Populus euphratica
gb|KDP42458.1|  hypothetical protein JCGZ_00255                         248   3e-75   Jatropha curcas
ref|XP_006348602.1|  PREDICTED: prolycopene isomerase 1, chloropl...    247   4e-75   
ref|XP_008218706.1|  PREDICTED: prolycopene isomerase, chloroplastic    246   9e-75   Prunus mume [ume]
ref|XP_007224403.1|  hypothetical protein PRUPE_ppa021157mg             246   1e-74   Prunus persica
ref|XP_010065273.1|  PREDICTED: prolycopene isomerase, chloroplastic    245   2e-74   Eucalyptus grandis [rose gum]
ref|XP_010927816.1|  PREDICTED: prolycopene isomerase, chloroplastic    245   2e-74   Elaeis guineensis
gb|KCW62677.1|  hypothetical protein EUGRSUZ_G00236                     245   3e-74   Eucalyptus grandis [rose gum]
ref|XP_010244946.1|  PREDICTED: prolycopene isomerase, chloroplas...    245   3e-74   Nelumbo nucifera [Indian lotus]
ref|XP_007041203.1|  FAD/NAD(P)-binding oxidoreductase domain-con...    240   1e-73   
ref|XP_008378907.1|  PREDICTED: uncharacterized protein LOC103441970    235   2e-73   
ref|XP_004238986.1|  PREDICTED: prolycopene isomerase, chloroplastic    241   5e-73   Solanum lycopersicum
ref|XP_004133717.1|  PREDICTED: prolycopene isomerase, chloroplas...    241   8e-73   
ref|XP_004163999.1|  PREDICTED: prolycopene isomerase, chloroplas...    241   8e-73   
gb|EPS67315.1|  hypothetical protein M569_07459                         236   1e-72   Genlisea aurea
ref|XP_010096434.1|  hypothetical protein L484_013117                   241   2e-72   Morus notabilis
ref|XP_006392380.1|  hypothetical protein EUTSA_v10023380mg             237   3e-72   
ref|XP_008452247.1|  PREDICTED: prolycopene isomerase, chloroplastic    239   5e-72   Cucumis melo [Oriental melon]
ref|XP_004301557.1|  PREDICTED: prolycopene isomerase, chloroplas...    239   6e-72   Fragaria vesca subsp. vesca
ref|XP_007041202.1|  FAD/NAD(P)-binding oxidoreductase domain-con...    239   1e-71   
ref|XP_008803793.1|  PREDICTED: prolycopene isomerase 1, chloropl...    235   2e-71   Phoenix dactylifera
ref|XP_006392382.1|  hypothetical protein EUTSA_v10023380mg             237   3e-71   Eutrema salsugineum [saltwater cress]
ref|XP_006392381.1|  hypothetical protein EUTSA_v10023380mg             237   3e-71   
emb|CDY39935.1|  BnaA09g15170D                                          237   3e-71   Brassica napus [oilseed rape]
ref|XP_009113353.1|  PREDICTED: prolycopene isomerase, chloroplastic    237   3e-71   Brassica rapa
gb|KJB16213.1|  hypothetical protein B456_002G218000                    236   5e-71   Gossypium raimondii
gb|KJB16214.1|  hypothetical protein B456_002G218000                    236   6e-71   Gossypium raimondii
ref|XP_009411884.1|  PREDICTED: prolycopene isomerase, chloroplastic    236   6e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803791.1|  PREDICTED: prolycopene isomerase, chloroplas...    236   1e-70   Phoenix dactylifera
ref|XP_009355336.1|  PREDICTED: prolycopene isomerase, chloroplastic    236   1e-70   Pyrus x bretschneideri [bai li]
emb|CAN60294.1|  hypothetical protein VITISV_023401                     235   2e-70   Vitis vinifera
gb|KHG20519.1|  Prolycopene isomerase, chloroplastic                    237   2e-70   Gossypium arboreum [tree cotton]
emb|CDX95296.1|  BnaC09g15740D                                          235   2e-70   
ref|XP_011087664.1|  PREDICTED: prolycopene isomerase 1, chloropl...    235   3e-70   Sesamum indicum [beniseed]
gb|EYU26464.1|  hypothetical protein MIMGU_mgv1a003523mg                234   3e-70   Erythranthe guttata [common monkey flower]
emb|CBI29695.3|  unnamed protein product                                234   5e-70   Vitis vinifera
ref|XP_010657970.1|  PREDICTED: prolycopene isomerase, chloroplas...    234   5e-70   Vitis vinifera
ref|XP_010553689.1|  PREDICTED: prolycopene isomerase, chloroplas...    234   7e-70   Tarenaya hassleriana [spider flower]
ref|NP_176088.2|  FAD/NAD(P)-binding oxidoreductase domain-contai...    233   8e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAG50743.1|AC079733_11  hypothetical protein                         233   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|EYU25617.1|  hypothetical protein MIMGU_mgv1a0217391mg               231   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_002892017.1|  hypothetical protein ARALYDRAFT_314966             231   6e-69   
gb|ACU20396.1|  unknown                                                 221   7e-69   Glycine max [soybeans]
ref|XP_010068005.1|  PREDICTED: LOW QUALITY PROTEIN: phytoene des...    220   1e-68   
ref|XP_010681073.1|  PREDICTED: prolycopene isomerase, chloroplastic    230   1e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010657971.1|  PREDICTED: prolycopene isomerase, chloroplas...    228   4e-68   Vitis vinifera
ref|XP_010470316.1|  PREDICTED: prolycopene isomerase, chloroplas...    229   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010511355.1|  PREDICTED: prolycopene isomerase, chloroplastic    229   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010414806.1|  PREDICTED: prolycopene isomerase, chloroplas...    229   5e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006302070.1|  hypothetical protein CARUB_v10020054mg             228   1e-67   
ref|XP_010553690.1|  PREDICTED: prolycopene isomerase, chloroplas...    225   3e-67   Tarenaya hassleriana [spider flower]
gb|KHN40192.1|  Prolycopene isomerase 1, chloroplastic                  222   4e-66   Glycine soja [wild soybean]
ref|XP_006652010.1|  PREDICTED: prolycopene isomerase 1, chloropl...    222   7e-66   
ref|XP_003529702.1|  PREDICTED: prolycopene isomerase, chloroplas...    222   1e-65   Glycine max [soybeans]
gb|AAT77005.1|  expressed protein                                       221   2e-65   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147881.1|  carotenoid isomerase 1                             221   4e-65   
ref|XP_008643620.1|  PREDICTED: carotenoid isomerase 1 isoform X1       221   4e-65   
gb|AFW67016.1|  hypothetical protein ZEAMMB73_444741                    221   4e-65   
gb|EAY92526.1|  hypothetical protein OsI_14265                          221   6e-65   Oryza sativa Indica Group [Indian rice]
gb|EMS50943.1|  hypothetical protein TRIUR3_05726                       215   6e-65   Triticum urartu
ref|NP_001051855.1|  Os03g0841900                                       221   6e-65   
ref|XP_007153908.1|  hypothetical protein PHAVU_003G075100g             219   1e-64   Phaseolus vulgaris [French bean]
ref|XP_002463545.1|  hypothetical protein SORBIDRAFT_01g001750          220   1e-64   Sorghum bicolor [broomcorn]
ref|XP_004981104.1|  PREDICTED: prolycopene isomerase 1, chloropl...    220   2e-64   Setaria italica
emb|CDO97627.1|  unnamed protein product                                218   1e-63   Coffea canephora [robusta coffee]
ref|XP_009789453.1|  PREDICTED: prolycopene isomerase, chloroplastic    216   2e-63   Nicotiana sylvestris
gb|AIL48302.1|  carotenoid isomerase                                    216   3e-63   Nicotiana tabacum [American tobacco]
dbj|BAJ88249.1|  predicted protein                                      216   4e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94941.1|  predicted protein                                      216   4e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009621121.1|  PREDICTED: prolycopene isomerase 1, chloropl...    215   7e-63   Nicotiana tomentosiformis
ref|XP_003559165.1|  PREDICTED: prolycopene isomerase, chloroplastic    215   1e-62   Brachypodium distachyon [annual false brome]
gb|KEH32763.1|  All-trans-retinol 13,14-reductase                       213   4e-62   Medicago truncatula
ref|XP_002526437.1|  All-trans-retinol 13,14-reductase precursor,...    212   1e-61   Ricinus communis
gb|EMT16764.1|  Putative all-trans-retinol 13,14-reductase              204   6e-61   
ref|XP_006431586.1|  hypothetical protein CICLE_v10000689mg             205   4e-59   Citrus clementina [clementine]
ref|XP_006492556.1|  PREDICTED: prolycopene isomerase, chloroplas...    205   5e-59   Citrus sinensis [apfelsine]
ref|XP_006858582.1|  hypothetical protein AMTR_s00071p00187330          204   7e-59   Amborella trichopoda
ref|XP_006492555.1|  PREDICTED: prolycopene isomerase, chloroplas...    205   7e-59   Citrus sinensis [apfelsine]
ref|XP_004499377.1|  PREDICTED: prolycopene isomerase, chloroplas...    203   1e-58   Cicer arietinum [garbanzo]
ref|XP_001759083.1|  predicted protein                                  181   3e-50   
ref|XP_002991682.1|  hypothetical protein SELMODRAFT_186234             179   8e-50   
ref|XP_002991056.1|  hypothetical protein SELMODRAFT_229587             179   1e-49   
ref|WP_041033797.1|  carotene isomerase                                 142   3e-36   Tolypothrix campylonemoides
ref|WP_015203615.1|  monooxygenase FAD-binding protein                  140   9e-36   Crinalium epipsammum
ref|XP_001695939.1|  hypothetical protein CHLREDRAFT_130438             140   1e-35   Chlamydomonas reinhardtii
ref|XP_002959487.1|  hypothetical protein VOLCADRAFT_84931              140   1e-35   Volvox carteri f. nagariensis
ref|WP_015217623.1|  monooxygenase FAD-binding protein                  138   5e-35   Anabaena cylindrica
ref|WP_006509127.1|  phytoene dehydrogenase-like oxidoreductase         137   1e-34   Xenococcus sp. PCC 7305
ref|WP_016948830.1|  carotene isomerase                                 137   2e-34   Anabaena sp. PCC 7108
ref|WP_012409194.1|  carotene isomerase                                 136   3e-34   Nostoc punctiforme
ref|WP_011614184.1|  carotene isomerase                                 136   3e-34   Trichodesmium erythraeum
ref|WP_026082529.1|  carotene isomerase                                 136   4e-34   
ref|WP_015080764.1|  carotene isomerase-like protein                    135   6e-34   Anabaena sp. 90
ref|WP_015149455.1|  phytoene dehydrogenase-like oxidoreductase         134   2e-33   Oscillatoria acuminata
ref|WP_017660356.1|  hypothetical protein                               134   2e-33   Geitlerinema sp. PCC 7105
ref|WP_015153671.1|  all-trans-retinol 13,14-reductase                  133   4e-33   Chroococcidiopsis thermalis
ref|WP_009554715.1|  phytoene dehydrogenase-like oxidoreductase         133   4e-33   Oscillatoriales cyanobacterium JSC-12
ref|XP_002505778.1|  amine oxidase                                      133   5e-33   Micromonas commoda
ref|WP_026086372.1|  carotene isomerase                                 133   5e-33   Fischerella thermalis
ref|WP_009457913.1|  carotene isomerase                                 132   5e-33   Fischerella thermalis
ref|WP_015191061.1|  All-trans-retinol 13,14-reductase                  132   7e-33   Gloeocapsa sp. PCC 7428
ref|WP_006528965.1|  phytoene dehydrogenase-like oxidoreductase         132   8e-33   Gloeocapsa sp. PCC 73106
ref|WP_035115521.1|  carotene isomerase                                 131   2e-32   
emb|CBJ27057.1|  Amine oxidase carotenoid isomerase-like protein        131   2e-32   Ectocarpus siliculosus
ref|WP_044452026.1|  carotene isomerase                                 131   2e-32   Mastigocladus laminosus
ref|WP_015139375.1|  phytoene dehydrogenase-like oxidoreductase         131   2e-32   Nostoc sp. PCC 7524
gb|KIE10162.1|  carotene isomerase                                      131   2e-32   Tolypothrix bouteillei VB521301
ref|XP_005847243.1|  hypothetical protein CHLNCDRAFT_35537              132   2e-32   Chlorella variabilis
ref|XP_001753084.1|  predicted protein                                  131   3e-32   
ref|WP_015176099.1|  FAD dependent oxidoreductase                       130   5e-32   Oscillatoria nigro-viridis
ref|WP_016865505.1|  carotene isomerase                                 130   5e-32   Fischerella muscicola
ref|WP_008179114.1|  carotene isomerase                                 130   6e-32   Moorea producens
ref|WP_016873948.1|  carotene isomerase                                 129   7e-32   Chlorogloeopsis fritschii
ref|WP_012307380.1|  carotene isomerase                                 129   8e-32   Synechococcus
ref|WP_019505392.1|  hypothetical protein                               129   8e-32   Pleurocapsa sp. PCC 7319
ref|WP_030007520.1|  carotene isomerase                                 129   9e-32   Synechococcus sp. NKBG042902
ref|XP_005644377.1|  FAD/NAD(P)-binding domain-containing protein       129   1e-31   Coccomyxa subellipsoidea C-169
ref|WP_039715953.1|  carotene isomerase                                 129   1e-31   
ref|WP_006455402.1|  carotene isomerase                                 128   2e-31   Synechococcus sp. PCC 7335
ref|WP_036481718.1|  carotene isomerase                                 127   4e-31   Myxosarcina sp. GI1
ref|WP_018397277.1|  hypothetical protein                               127   4e-31   filamentous cyanobacterium ESFC-1
ref|WP_036003690.1|  carotene isomerase                                 127   5e-31   [Leptolyngbya] sp. JSC-1
gb|KIJ84051.1|  carotene isomerase                                      127   6e-31   Scytonema tolypothrichoides VB-61278
ref|XP_005647775.1|  amine oxidase                                      127   6e-31   Coccomyxa subellipsoidea C-169
ref|WP_035984241.1|  carotene isomerase                                 126   1e-30   Leptolyngbya sp. KIOST-1
ref|WP_015172075.1|  FAD dependent oxidoreductase                       126   1e-30   Geitlerinema sp. PCC 7407
ref|WP_028951594.1|  carotene isomerase                                 125   2e-30   Synechococcus sp. CC9616
ref|WP_038543926.1|  carotene isomerase                                 125   2e-30   Synechococcus sp. KORDI-100
ref|WP_017285762.1|  hypothetical protein                               125   2e-30   Leptolyngbya boryana
ref|WP_011364848.1|  carotene isomerase                                 124   4e-30   Synechococcus sp. CC9605
ref|XP_002179244.1|  carotenoid isomerase                               125   5e-30   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_006853196.1|  carotene isomerase                                 123   2e-29   Synechococcus sp. WH 8016
ref|WP_039724644.1|  MULTISPECIES: carotene isomerase                   123   2e-29   Lyngbya confervoides
ref|WP_011619761.1|  carotene isomerase                                 122   3e-29   Synechococcus sp. CC9311
ref|WP_023065417.1|  FAD binding domain protein                         122   3e-29   Lyngbya aestuarii
ref|WP_009784423.1|  carotene isomerase                                 122   3e-29   Lyngbya sp. PCC 8106
ref|WP_011127626.1|  carotene isomerase                                 122   3e-29   Synechococcus sp. WH 8102
ref|XP_005819484.1|  hypothetical protein GUITHDRAFT_82257              122   5e-29   Guillardia theta CCMP2712
emb|CBJ28883.1|  carotenoid isomerase-like protein                      123   5e-29   Ectocarpus siliculosus
ref|WP_006170888.1|  carotene isomerase                                 121   9e-29   Synechococcus sp. WH 5701
gb|AHF64342.1|  hypothetical protein Syncc8109_1998                     120   9e-29   Synechococcus sp. WH 8109
ref|WP_023073297.1|  carotene isomerase                                 120   1e-28   Leptolyngbya sp. Heron Island J
ref|XP_003082932.1|  amine oxidase family (ISS)                         120   2e-28   
ref|WP_009790216.1|  carotene isomerase                                 119   3e-28   Synechococcus sp. BL107
ref|WP_038553836.1|  carotene isomerase                                 119   3e-28   Synechococcus sp. KORDI-52
ref|WP_011819691.1|  carotene isomerase                                 119   5e-28   Prochlorococcus marinus
gb|EKV03145.1|  phytoene dehydrogenase-like oxidoreductase              118   6e-28   Leptolyngbya sp. PCC 7375
ref|WP_012161660.1|  carotene isomerase                                 117   1e-27   Acaryochloris marina
ref|WP_012796586.1|  carotene isomerase                                 117   3e-27   Cyanothece sp. PCC 8802
ref|WP_011359569.1|  carotene isomerase                                 117   3e-27   Synechococcus sp. CC9902
ref|WP_019480309.1|  hypothetical protein                               112   6e-27   
ref|WP_015117031.1|  phytoene dehydrogenase-like oxidoreductase         115   7e-27   Rivularia sp. PCC 7116
ref|WP_011932712.1|  carotene isomerase                                 115   9e-27   Synechococcus sp. WH 7803
ref|WP_025929168.1|  hypothetical protein                               112   9e-27   
ref|WP_011317725.1|  carotene isomerase                                 115   1e-26   Trichormus variabilis
ref|WP_029976435.1|  carotene isomerase                                 108   2e-26   
ref|XP_007512741.1|  predicted protein                                  115   2e-26   Bathycoccus prasinos
ref|WP_006909672.1|  carotene isomerase                                 114   2e-26   Cyanobium sp. PCC 7001
ref|XP_002954344.1|  hypothetical protein VOLCADRAFT_64714              114   3e-26   Volvox carteri f. nagariensis
ref|XP_001697619.1|  hypothetical protein CHLREDRAFT_176572             114   3e-26   Chlamydomonas reinhardtii
ref|WP_009543600.1|  MULTISPECIES: carotene isomerase                   114   3e-26   Cyanothece
ref|WP_006631928.1|  carotene isomerase                                 114   4e-26   Microcoleus vaginatus
emb|CAK27949.1|  Carotenoid isomerase                                   113   5e-26   Synechococcus sp. RCC307
ref|WP_008277850.1|  carotene isomerase                                 113   5e-26   Cyanothece sp. CCY0110
ref|WP_025914187.1|  carotene isomerase                                 113   5e-26   
ref|WP_011817833.1|  carotene isomerase                                 113   5e-26   Prochlorococcus marinus
ref|WP_016860296.1|  carotene isomerase                                 113   5e-26   Fischerella muscicola
ref|WP_032519579.1|  carotene isomerase                                 113   5e-26   Prochlorococcus marinus
ref|WP_043736794.1|  carotene isomerase                                 113   5e-26   
ref|XP_005847333.1|  hypothetical protein CHLNCDRAFT_134505             114   6e-26   Chlorella variabilis
ref|WP_006105444.1|  carotene isomerase                                 113   6e-26   Coleofasciculus chthonoplastes
ref|WP_026098227.1|  carotene isomerase                                 113   7e-26   
ref|WP_040943151.1|  carotene isomerase                                 112   8e-26   
ref|WP_025951419.1|  hypothetical protein                               109   8e-26   
ref|WP_025960273.1|  hypothetical protein                               108   8e-26   
emb|CCQ62058.1|  Phytoene dehydrogenase and related proteins            112   9e-26   Crocosphaera watsonii WH 0401
ref|WP_007303605.1|  carotene isomerase                                 112   9e-26   Crocosphaera watsonii
ref|WP_025934797.1|  carotene isomerase                                 112   9e-26   
ref|WP_025938941.1|  carotene isomerase                                 112   9e-26   
ref|WP_025965354.1|  carotene isomerase                                 112   9e-26   
ref|WP_025924181.1|  carotene isomerase                                 112   9e-26   
ref|WP_025894017.1|  MULTISPECIES: carotene isomerase                   112   9e-26   
ref|WP_032524084.1|  carotene isomerase                                 112   1e-25   Prochlorococcus marinus
ref|WP_040939085.1|  carotene isomerase                                 112   1e-25   
ref|WP_025935673.1|  MULTISPECIES: carotene isomerase                   112   1e-25   
ref|WP_007097536.1|  carotene isomerase                                 112   1e-25   Synechococcus sp. RS9916
ref|WP_032515617.1|  carotene isomerase                                 112   1e-25   Prochlorococcus marinus
ref|WP_011375906.1|  carotene isomerase                                 112   2e-25   Prochlorococcus marinus
ref|WP_025963539.1|  hypothetical protein                               108   2e-25   
ref|WP_024546782.1|  carotene isomerase                                 112   2e-25   Synechococcus sp. NKBG15041c
ref|WP_025955214.1|  carotene isomerase                                 111   2e-25   
ref|WP_010997191.1|  carotene isomerase                                 110   2e-25   
ref|WP_025967852.1|  carotene isomerase                                 111   2e-25   
gb|AFY27319.1|  LOW QUALITY PROTEIN: phytoene dehydrogenase-like ...    111   2e-25   Cyanobium gracile PCC 6307
ref|WP_025973716.1|  carotene isomerase                                 111   2e-25   
ref|WP_011862376.1|  carotene isomerase                                 111   2e-25   Prochlorococcus marinus
ref|WP_011378159.1|  MULTISPECIES: carotene isomerase                   111   2e-25   Synechococcus
ref|WP_032521907.1|  carotene isomerase                                 111   2e-25   Prochlorococcus marinus
ref|WP_032514033.1|  carotene isomerase                                 111   3e-25   Prochlorococcus marinus
ref|WP_025931387.1|  MULTISPECIES: carotene isomerase                   111   3e-25   
ref|WP_042849829.1|  carotene isomerase                                 111   3e-25   Prochlorococcus sp. MIT 0604
ref|WP_026721179.1|  carotene isomerase                                 111   4e-25   Fischerella sp. PCC 9431
ref|WP_025891410.1|  carotene isomerase                                 111   4e-25   
ref|WP_019476228.1|  hypothetical protein                               111   4e-25   
ref|WP_015225549.1|  FAD dependent oxidoreductase                       110   4e-25   Halothece sp. PCC 7418
ref|WP_015230757.1|  phytoene dehydrogenase-like oxidoreductase         110   5e-25   Dactylococcopsis salina
ref|WP_039752734.1|  all-trans-retinol 13,14-reductase                  110   6e-25   
ref|WP_025981208.1|  carotene isomerase                                 109   7e-25   
ref|WP_035828930.1|  carotene isomerase                                 110   8e-25   
ref|WP_029638271.1|  all-trans-retinol 13,14-reductase [                110   8e-25   [Scytonema hofmanni] UTEX B 1581
ref|WP_029983354.1|  carotene isomerase                                 103   8e-25   
ref|WP_025933124.1|  carotene isomerase                                 110   8e-25   
ref|WP_025926001.1|  carotene isomerase                                 110   8e-25   
ref|WP_025942160.1|  MULTISPECIES: carotene isomerase                   110   9e-25   
ref|WP_025962208.1|  carotene isomerase                                 110   9e-25   
ref|WP_002807618.1|  carotene isomerase                                 110   9e-25   Prochlorococcus marinus
ref|WP_025929790.1|  carotene isomerase                                 110   1e-24   
ref|WP_025969653.1|  carotene isomerase                                 110   1e-24   
ref|WP_011244678.1|  carotene isomerase                                 110   1e-24   Synechococcus elongatus
ref|WP_015181722.1|  phytoene dehydrogenase-like oxidoreductase         110   1e-24   Microcoleus sp. PCC 7113
ref|WP_025939535.1|  carotene isomerase                                 109   1e-24   
ref|WP_025970611.1|  carotene isomerase                                 109   1e-24   
ref|WP_025940438.1|  carotene isomerase                                 109   1e-24   
ref|WP_025906273.1|  carotene isomerase                                 109   1e-24   
ref|WP_025974922.1|  carotene isomerase                                 109   1e-24   
ref|WP_032517458.1|  carotene isomerase                                 109   1e-24   Prochlorococcus marinus
ref|WP_032526665.1|  carotene isomerase                                 109   1e-24   Prochlorococcus marinus
ref|WP_025974462.1|  carotene isomerase                                 109   1e-24   
ref|WP_025941317.1|  carotene isomerase                                 109   1e-24   
ref|WP_025945032.1|  MULTISPECIES: carotene isomerase                   109   1e-24   
gb|EWM24677.1|  amine oxidase                                           110   1e-24   Nannochloropsis gaditana
ref|WP_025944427.1|  carotene isomerase                                 109   1e-24   
ref|WP_025967425.1|  carotene isomerase                                 109   1e-24   
ref|WP_037220472.1|  carotene isomerase                                 109   2e-24   
ref|WP_025892733.1|  carotene isomerase                                 109   2e-24   
ref|WP_025971757.1|  carotene isomerase                                 109   2e-24   
ref|WP_026723034.1|  hypothetical protein                               103   2e-24   
ref|WP_025951828.1|  carotene isomerase                                 108   2e-24   
ref|WP_025959339.1|  carotene isomerase                                 108   2e-24   
ref|WP_025922917.1|  carotene isomerase                                 108   2e-24   
ref|WP_025890441.1|  carotene isomerase                                 108   2e-24   
ref|WP_012599216.1|  carotene isomerase                                 108   2e-24   Cyanothece sp. PCC 7424
ref|WP_016874846.1|  FAD dependent oxidoreductase                       108   2e-24   Chlorogloeopsis fritschii
ref|WP_016953423.1|  FAD dependent oxidoreductase                       108   3e-24   Anabaena sp. PCC 7108
emb|CDN13493.1|  Phytoene dehydrogenase and related proteins            108   3e-24   Richelia intracellularis
gb|ABE11014.1|  bacterial-type phytoene dehydrogenase                   108   3e-24   uncultured Prochlorococcus marinus clone ASNC729
ref|WP_012007134.1|  carotene isomerase                                 108   3e-24   Prochlorococcus marinus
ref|WP_035173818.1|  carotene isomerase                                 108   3e-24   
ref|WP_025927994.1|  carotene isomerase                                 108   3e-24   
ref|WP_029553043.1|  carotene isomerase                                 108   3e-24   
ref|WP_025927346.1|  carotene isomerase                                 108   3e-24   
ref|WP_025953433.1|  carotene isomerase                                 108   3e-24   
ref|WP_025957573.1|  carotene isomerase                                 108   3e-24   
ref|WP_025940152.1|  carotene isomerase                                 108   3e-24   
ref|WP_013324499.1|  carotene isomerase                                 108   4e-24   Cyanothece sp. PCC 7822
emb|CCQ65336.1|  Phytoene dehydrogenase and related proteins            104   5e-24   Crocosphaera watsonii WH 0402
ref|XP_003063821.1|  predicted protein                                  107   7e-24   Micromonas pusilla CCMP1545
ref|WP_015133275.1|  all-trans-retinol 13,14-reductase                  107   8e-24   Leptolyngbya sp. PCC 7376
ref|WP_017310269.1|  FAD dependent oxidoreductase                       106   1e-23   Fischerella sp. PCC 9339
ref|WP_044450080.1|  all-trans-retinol 13,14-reductase                  105   1e-23   Mastigocladus laminosus
ref|WP_006098207.1|  FAD dependent oxidoreductase, putative             106   2e-23   Coleofasciculus chthonoplastes
gb|AFY47313.1|  phytoene dehydrogenase-like oxidoreductase              106   2e-23   Nostoc sp. PCC 7524
ref|WP_041555603.1|  all-trans-retinol 13,14-reductase                  106   2e-23   Nostoc sp. PCC 7524
ref|WP_010477254.1|  carotene isomerase                                 106   2e-23   Acaryochloris sp. CCMEE 5410
ref|WP_027844394.1|  carotene isomerase                                 105   3e-23   Mastigocoleus testarum
ref|WP_026735207.1|  all-trans-retinol 13,14-reductase                  105   4e-23   Fischerella sp. PCC 9605
ref|WP_007303104.1|  hypothetical protein                               105   4e-23   Crocosphaera watsonii
emb|CCQ61614.1|  Phytoene dehydrogenase and related proteins            105   4e-23   Crocosphaera watsonii WH 0401
ref|WP_021831080.1|  Phytoene dehydrogenase and related proteins        105   4e-23   Crocosphaera watsonii
ref|WP_017301038.1|  hypothetical protein                               105   4e-23   Nodosilinea nodulosa
ref|WP_041038848.1|  all-trans-retinol 13,14-reductase                  101   5e-23   
ref|WP_029981798.1|  carotene isomerase                               99.0    5e-23   
ref|WP_016862746.1|  FAD dependent oxidoreductase                       104   1e-22   Fischerella muscicola
ref|WP_009544908.1|  MULTISPECIES: All-trans-retinol 13,14-reductase    103   1e-22   Cyanothece
ref|WP_015188482.1|  All-trans-retinol 13,14-reductase                  103   2e-22   Gloeocapsa sp. PCC 7428
ref|WP_016866112.1|  FAD dependent oxidoreductase                       103   3e-22   
ref|WP_011142130.1|  hypothetical protein                               102   4e-22   
ref|WP_037218967.1|  all-trans-retinol 13,14-reductase                  102   5e-22   
ref|WP_015221742.1|  FAD dependent oxidoreductase                       102   8e-22   
ref|WP_017744016.1|  FAD dependent oxidoreductase                       102   8e-22   
ref|WP_006196994.1|  Amine oxidase                                      102   8e-22   
emb|CAE18798.1|  Bacterial-type phytoene dehydrogenase                  101   9e-22   
gb|KIE09000.1|  all-trans-retinol 13,14-reductase                       102   9e-22   
ref|WP_036930937.1|  carotene isomerase                                 101   9e-22   
ref|WP_036615676.1|  all-trans-retinol 13,14-reductase                  101   1e-21   
gb|EKQ70203.1|  phytoene dehydrogenase-like oxidoreductase              101   1e-21   
gb|KIJ84153.1|  all-trans-retinol 13,14-reductase                       101   1e-21   
gb|AFY42138.1|  All-trans-retinol 13,14-reductase                       101   1e-21   
ref|WP_044500589.1|  all-trans-retinol 13,14-reductase                  101   1e-21   
ref|WP_009457954.1|  MULTISPECIES: All-trans-retinol 13,14-reductase    101   1e-21   
ref|XP_002182606.1|  carotenoid isomerase                               101   1e-21   
ref|WP_015207239.1|  phytoene dehydrogenase-like oxidoreductase         100   2e-21   
ref|WP_015198584.1|  all-trans-retinol 13,14-reductase                  100   2e-21   
ref|WP_025913444.1|  carotene isomerase                               99.4    3e-21   
ref|XP_001422516.1|  predicted protein                                  100   5e-21   
ref|WP_017322519.1|  FAD dependent oxidoreductase                     99.8    5e-21   
ref|WP_027846963.1|  all-trans-retinol 13,14-reductase                99.4    8e-21   
ref|WP_015149712.1|  phytoene dehydrogenase-like oxidoreductase       99.0    8e-21   
ref|WP_007102094.1|  carotene isomerase                               99.0    9e-21   
ref|XP_001420815.1|  predicted protein                                99.4    1e-20   
ref|WP_015191788.1|  All-trans-retinol 13,14-reductase                99.0    1e-20   
emb|CEG02043.1|  Carotene isomerase                                   98.2    2e-20   
ref|WP_017316286.1|  FAD dependent oxidoreductase                     98.2    2e-20   
ref|XP_009037381.1|  hypothetical protein AURANDRAFT_27062            98.6    2e-20   
ref|WP_017324122.1|  hypothetical protein                             97.8    2e-20   
ref|WP_039724845.1|  MULTISPECIES: all-trans-retinol 13,14-reductase  97.4    4e-20   
ref|WP_006516696.1|  phytoene dehydrogenase-like oxidoreductase       97.1    5e-20   
ref|WP_023070190.1|  hypothetical protein                             97.1    5e-20   
ref|WP_015144373.1|  phytoene dehydrogenase-like oxidoreductase       96.7    6e-20   
ref|XP_007511861.1|  predicted protein                                97.4    7e-20   
ref|XP_002503373.1|  FAD dependent oxidoreductase                     96.7    9e-20   
ref|WP_015173667.1|  all-trans-retinol 13,14-reductase                95.9    1e-19   
ref|WP_038652950.1|  carotene isomerase                               95.5    1e-19   
ref|WP_006040907.1|  carotene isomerase                               95.1    2e-19   
ref|WP_015120009.1|  phytoene dehydrogenase-like oxidoreductase       94.7    3e-19   
ref|XP_005766808.1|  hypothetical protein EMIHUDRAFT_436908           95.5    3e-19   
ref|WP_011823850.1|  carotene isomerase                               94.0    5e-19   
ref|XP_009032646.1|  hypothetical protein AURANDRAFT_19504            94.4    5e-19   
ref|WP_036904300.1|  carotene isomerase                               94.0    5e-19   
ref|WP_011294587.1|  carotene isomerase                               94.0    5e-19   
ref|WP_013320479.1|  all-trans-retinol 13,14-reductase                93.6    7e-19   
ref|WP_015152768.1|  all-trans-retinol 13,14-reductase                93.6    8e-19   
ref|WP_011319428.1|  amine oxidase                                    93.2    9e-19   
ref|WP_039715528.1|  all-trans-retinol 13,14-reductase                92.8    1e-18   
ref|WP_019489378.1|  FAD dependent oxidoreductase                     92.4    2e-18   
ref|XP_009033945.1|  hypothetical protein AURANDRAFT_21551            92.4    2e-18   
ref|WP_036006367.1|  all-trans-retinol 13,14-reductase                92.0    3e-18   
ref|WP_011612735.1|  FAD dependent oxidoreductase                     91.7    3e-18   
ref|WP_015126724.1|  all-trans-retinol 13,14-reductase                91.7    3e-18   
gb|KCW62678.1|  hypothetical protein EUGRSUZ_G00236                   91.3    4e-18   
emb|CEF99899.1|  Carotene isomerase                                   92.0    5e-18   
ref|XP_003082335.1|  COG1233: Phytoene dehydrogenase and related ...  91.7    5e-18   
ref|XP_002507045.1|  predicted protein                                91.7    6e-18   
ref|WP_006635819.1|  All-trans-retinol 13,14-reductase                90.9    6e-18   
ref|WP_006454772.1|  FAD dependent oxidoreductase, putative           90.9    7e-18   
ref|WP_012162031.1|  carotenoid isomerase                             90.1    1e-17   
ref|WP_007356631.1|  MULTISPECIES: FAD dependent oxidoreductase       89.7    1e-17   
ref|WP_026097849.1|  all-trans-retinol 13,14-reductase                89.7    1e-17   
ref|XP_009032817.1|  hypothetical protein AURANDRAFT_1318             89.7    2e-17   
ref|WP_015179349.1|  All-trans-retinol 13,14-reductase                89.7    2e-17   
ref|WP_010473103.1|  carotenoid isomerase                             89.0    3e-17   
ref|WP_015955611.1|  FAD dependent oxidoreductase                     89.0    3e-17   
ref|XP_005830452.1|  hypothetical protein GUITHDRAFT_158041           89.0    3e-17   
ref|WP_018399614.1|  hypothetical protein                             88.2    6e-17   
ref|XP_002295888.1|  phytoene dehydrogenase, phytoene desaturase ...  88.6    6e-17   
gb|EJK57301.1|  hypothetical protein THAOC_22673                      87.8    7e-17   
ref|WP_036930311.1|  hypothetical protein                             87.8    8e-17   
ref|WP_008272507.1|  Amine oxidase                                    86.7    2e-16   
ref|WP_015227905.1|  phytoene dehydrogenase-like oxidoreductase       86.7    2e-16   
ref|WP_019477750.1|  hypothetical protein                             86.7    2e-16   
gb|AFZ44152.1|  FAD dependent oxidoreductase                          86.3    3e-16   
ref|WP_041596593.1|  all-trans-retinol 13,14-reductase                85.9    3e-16   
ref|WP_017290576.1|  hypothetical protein                             85.5    4e-16   
ref|WP_036921440.1|  carotene isomerase                               85.1    6e-16   
ref|WP_017652717.1|  FAD dependent oxidoreductase                     85.1    6e-16   
gb|EJK48337.1|  hypothetical protein THAOC_32879                      85.5    7e-16   
ref|XP_005781820.1|  hypothetical protein EMIHUDRAFT_99796            84.7    1e-15   
ref|XP_002176863.1|  CRTISO5 carotenoid isomerase 5,phytoene dehy...  84.7    1e-15   
ref|WP_015784199.1|  FAD dependent oxidoreductase                     84.3    1e-15   
ref|XP_010244947.1|  PREDICTED: prolycopene isomerase, chloroplas...  84.0    1e-15   
ref|WP_012596822.1|  FAD dependent oxidoreductase                     84.0    1e-15   
ref|XP_002294274.1|  hypothetical protein THAPSDRAFT_10233            84.3    2e-15   
emb|CEF98405.1|  Carotene isomerase                                   83.6    3e-15   
ref|XP_003054787.1|  predicted protein                                83.6    4e-15   
gb|EJK43713.1|  hypothetical protein THAOC_37812                      79.7    4e-15   
ref|XP_009039531.1|  hypothetical protein AURANDRAFT_30491            82.8    5e-15   
ref|XP_005791396.1|  hypothetical protein EMIHUDRAFT_251572           79.3    7e-15   
ref|WP_035148910.1|  all-trans-retinol 13,14-reductase                82.0    9e-15   
ref|XP_003054876.1|  predicted protein                                82.0    1e-14   
ref|XP_005768653.1|  hypothetical protein EMIHUDRAFT_76074            81.6    1e-14   
ref|XP_002288479.1|  predicted protein                                80.5    3e-14   
ref|WP_014098603.1|  phytoene dehydrogenase-like protein              80.1    3e-14   
ref|XP_005793001.1|  hypothetical protein EMIHUDRAFT_69656            80.5    3e-14   
ref|XP_002179831.1|  carotenoid isomerase                             80.1    4e-14   
gb|ABV27216.1|  carotenoid isomerase 1                                79.3    7e-14   
ref|WP_036301204.1|  hypothetical protein                             77.4    3e-13   
ref|XP_005537962.1|  similar to phytoene dehydrogenase                77.4    4e-13   
ref|XP_002288916.1|  hypothetical protein THAPSDRAFT_21847            77.0    4e-13   
ref|WP_029984999.1|  carotene isomerase                               72.4    6e-13   
ref|WP_015178680.1|  carotene isomerase                               75.9    1e-12   
ref|WP_006635024.1|  carotene isomerase                               75.9    1e-12   
gb|AGY57172.1|  FAD-binding dehydrogenase                             75.5    1e-12   
ref|WP_041244344.1|  all-trans-retinol 13,14-reductase                75.1    1e-12   
ref|WP_023493762.1|  phytoene desaturase (lycopene-forming)           75.5    2e-12   
ref|WP_026130220.1|  hypothetical protein                             75.1    2e-12   
ref|WP_035155378.1|  carotene isomerase                               75.1    2e-12   
ref|WP_017305426.1|  hypothetical protein                             72.4    2e-12   
ref|WP_006508632.1|  carotene isomerase                               74.7    2e-12   
ref|XP_003079922.1|  COG1233: Phytoene dehydrogenase and related ...  74.7    2e-12   
ref|WP_024119679.1|  phytoene dehydrogenase                           74.3    3e-12   
ref|WP_014150038.1|  all-trans-retinol 13,14-reductase                74.3    3e-12   
ref|XP_002507317.1|  predicted protein                                74.3    3e-12   
ref|WP_011174512.1|  phytoene dehydrogenase                           73.9    4e-12   
ref|XP_005716843.1|  unnamed protein product                          74.3    4e-12   
ref|WP_013560828.1|  putative oxidoreductase                          73.6    5e-12   
ref|WP_017305423.1|  carotene isomerase                               73.6    7e-12   
ref|WP_015279182.1|  phytoene dehydrogenase-like oxidoreductase       72.4    1e-11   
ref|WP_014434169.1|  putative oxidoreductase                          72.4    2e-11   
ref|WP_030006410.1|  carotene isomerase                               72.0    2e-11   
ref|WP_022605968.1|  carotene isomerase                               72.0    2e-11   
ref|WP_011130925.1|  NAD binding site                                 71.2    2e-11   
ref|WP_015173022.1|  carotene isomerase                               71.6    2e-11   
ref|WP_023065958.1|  carotene isomerase                               71.6    3e-11   
ref|WP_040939424.1|  carotene isomerase                               71.6    3e-11   
ref|WP_009786661.1|  carotene isomerase                               71.6    3e-11   
ref|WP_040944228.1|  carotene isomerase                               71.2    3e-11   
gb|EJK68037.1|  hypothetical protein THAOC_10830                      72.0    4e-11   
ref|WP_006101019.1|  carotene isomerase                               71.2    4e-11   
ref|WP_007355874.1|  MULTISPECIES: carotene isomerase                 71.2    4e-11   
ref|WP_014515436.1|  phytoene dehydrogenase                           70.9    4e-11   
ref|WP_011825050.1|  hypothetical protein                             71.2    5e-11   
ref|WP_036009072.1|  carotene isomerase                               70.5    6e-11   
ref|WP_044107480.1|  carotene isomerase                               70.5    6e-11   
gb|EKQ69299.1|  carotene isomerase                                    70.5    6e-11   
ref|WP_039754381.1|  carotene isomerase                               70.1    8e-11   
ref|WP_006620059.1|  carotene isomerase                               70.1    1e-10   
ref|WP_036910898.1|  MULTISPECIES: hypothetical protein               70.5    1e-10   
ref|XP_001635618.1|  predicted protein                                70.1    1e-10   
gb|ACA99879.1|  carotenoid cis-trans isomerase                        69.7    1e-10   
ref|WP_041443553.1|  carotene isomerase                               69.7    1e-10   
ref|WP_024545843.1|  carotene isomerase                               69.7    1e-10   
ref|XP_005784170.1|  Phytoene desaturase                              69.7    1e-10   
ref|WP_006620615.1|  MULTISPECIES: carotene isomerase                 69.3    1e-10   
gb|KIG14506.1|  Carotenoid cis-trans isomerase                        69.3    1e-10   
ref|WP_016872799.1|  carotene isomerase                               69.3    2e-10   
ref|WP_003044669.1|  phytoene dehydrogenase                           68.9    2e-10   
ref|WP_022797859.1|  phytoene dehydrogenase                           68.6    2e-10   
ref|WP_015167201.1|  carotene isomerase                               68.9    2e-10   
ref|WP_017663020.1|  carotene isomerase                               68.6    2e-10   
ref|WP_011229201.1|  phytoene dehydrogenase                           68.6    2e-10   
gb|AFY36951.1|  carotene isomerase                                    68.6    3e-10   
ref|WP_041764774.1|  carotene isomerase                               68.6    3e-10   
ref|WP_015218978.1|  carotene isomerase                               68.6    3e-10   
ref|WP_036485329.1|  carotene isomerase                               68.6    3e-10   
ref|WP_018477894.1|  hypothetical protein                             68.6    3e-10   
ref|WP_025605436.1|  amine oxidase                                    68.2    3e-10   
ref|WP_011611792.1|  carotene isomerase                               68.6    3e-10   
gb|AFZ15469.1|  carotene isomerase                                    68.2    3e-10   
ref|WP_041436536.1|  phytoene dehydrogenase                           68.2    3e-10   
ref|WP_010996225.1|  carotene isomerase                               68.2    4e-10   
ref|WP_041444444.1|  phytoene dehydrogenase                           68.2    4e-10   
ref|WP_015193360.1|  carotene isomerase                               68.2    4e-10   
ref|WP_029634629.1|  carotene isomerase [                             67.8    4e-10   
ref|WP_011319849.1|  carotene isomerase                               67.8    4e-10   
ref|XP_002294284.1|  predicted protein                                68.2    5e-10   
ref|WP_036277432.1|  all-trans-retinol 13,14-reductase                67.8    5e-10   
ref|WP_013825056.1|  fumarate reductase                               67.8    5e-10   
ref|WP_034413493.1|  hypothetical protein                             67.8    5e-10   
ref|WP_015149796.1|  carotene isomerase                               67.8    5e-10   
ref|WP_017713835.1|  carotene isomerase                               67.8    5e-10   
ref|XP_010553409.1|  PREDICTED: prolycopene isomerase, chloroplastic  67.8    5e-10   
ref|WP_035173032.1|  carotene isomerase                               67.4    6e-10   
ref|WP_041226947.1|  carotene isomerase                               67.8    6e-10   
ref|WP_025782040.1|  hypothetical protein                             65.1    6e-10   
ref|WP_034242686.1|  hypothetical protein                             67.8    6e-10   
gb|EZH73597.1|  phytoene dehydrogenase                                67.8    6e-10   
ref|WP_019502736.1|  carotene isomerase                               67.4    6e-10   
ref|WP_036616384.1|  carotene isomerase                               67.4    6e-10   
ref|WP_015144140.1|  carotene isomerase                               67.4    6e-10   
ref|WP_035092982.1|  phytoene dehydrogenase                           67.4    6e-10   
ref|WP_012594646.1|  carotene isomerase                               67.4    7e-10   
ref|WP_017287710.1|  carotene isomerase                               67.4    7e-10   
ref|WP_026733213.1|  carotene isomerase                               67.4    7e-10   
ref|WP_015166514.1|  carotene isomerase                               67.4    7e-10   
ref|WP_008225617.1|  Carotenoid cis-trans isomerase                   67.0    8e-10   
ref|WP_017655590.1|  carotene isomerase                               67.0    8e-10   
ref|XP_002290602.1|  predicted protein                                67.4    8e-10   
ref|WP_026794182.1|  MULTISPECIES: carotene isomerase                 67.0    9e-10   
ref|WP_008277263.1|  carotene isomerase                               67.0    9e-10   
ref|WP_026604435.1|  all-trans-retinol 13,14-reductase                67.0    9e-10   
ref|WP_015127868.1|  carotene isomerase                               67.0    9e-10   
ref|WP_015185266.1|  carotene isomerase                               67.0    9e-10   
ref|WP_026786441.1|  MULTISPECIES: carotene isomerase                 67.0    9e-10   
ref|WP_026102174.1|  carotene isomerase                               67.0    1e-09   
ref|WP_019475568.1|  carotene isomerase                               66.6    1e-09   
ref|WP_007659998.1|  amine oxidase                                    66.6    1e-09   
ref|WP_010874022.1|  carotene isomerase                               66.6    1e-09   
ref|WP_025667418.1|  phytoene dehydrogenase                           67.0    1e-09   
ref|WP_036917159.1|  MULTISPECIES: carotene isomerase                 66.6    1e-09   
ref|WP_028948016.1|  carotene isomerase                               66.6    1e-09   
ref|XP_008869523.1|  hypothetical protein H310_06296                  66.6    1e-09   
ref|WP_015783592.1|  carotene isomerase                               66.6    1e-09   
ref|WP_008232029.1|  Carotenoid cis-trans isomerase                   66.2    1e-09   
ref|WP_042152450.1|  carotene isomerase                               66.2    1e-09   
ref|WP_015954281.1|  carotene isomerase                               66.2    1e-09   
ref|WP_012627763.1|  carotene isomerase                               66.2    2e-09   
gb|AFZ46584.1|  carotene isomerase                                    66.2    2e-09   
ref|WP_041234529.1|  carotene isomerase                               66.2    2e-09   
emb|CDY06229.1|  BnaA09g49740D                                        66.2    2e-09   
ref|WP_034937755.1|  carotene isomerase                               65.9    2e-09   
ref|WP_027412490.1|  phytoene dehydrogenase                           66.2    2e-09   
ref|WP_013322256.1|  carotene isomerase                               65.9    2e-09   
emb|CCQ61552.1|  Carotenoid cis-trans isomerase                       65.9    2e-09   
ref|XP_007512914.1|  predicted protein                                66.2    2e-09   
ref|WP_006197483.1|  carotene isomerase                               65.9    2e-09   
gb|ELR96633.1|  carotene isomerase                                    65.9    2e-09   



>ref|XP_006389506.1| hypothetical protein POPTR_0022s00470g [Populus trichocarpa]
 gb|ERP48420.1| hypothetical protein POPTR_0022s00470g [Populus trichocarpa]
Length=397

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 133/164 (81%), Gaps = 5/164 (3%)
 Frame = +2

Query  65   FRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAG  244
            F S      ++P  +  +S      ++ S+  N Y     +PFPGKPEADVVVIGSGI G
Sbjct  15   FNSESPPTLKKPVFARTSSNAQTPSSAGSLLVNDY-----KPFPGKPEADVVVIGSGIGG  69

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            LCCAGLLARYQQDVLVLESHD PGGAAHSF+IKGYKFDSGPSLFSGFQSRGPQANPLAQV
Sbjct  70   LCCAGLLARYQQDVLVLESHDRPGGAAHSFEIKGYKFDSGPSLFSGFQSRGPQANPLAQV  129

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            LDALGESIPC  YDSWMVY+PEGEFLSRIGPTEF+KDLE YAGP
Sbjct  130  LDALGESIPCVNYDSWMVYVPEGEFLSRIGPTEFYKDLEKYAGP  173



>ref|XP_006389510.1| hypothetical protein POPTR_0022s00470g [Populus trichocarpa]
 gb|ERP48424.1| hypothetical protein POPTR_0022s00470g [Populus trichocarpa]
Length=479

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 133/164 (81%), Gaps = 5/164 (3%)
 Frame = +2

Query  65   FRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAG  244
            F S      ++P  +  +S      ++ S+  N Y     +PFPGKPEADVVVIGSGI G
Sbjct  15   FNSESPPTLKKPVFARTSSNAQTPSSAGSLLVNDY-----KPFPGKPEADVVVIGSGIGG  69

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            LCCAGLLARYQQDVLVLESHD PGGAAHSF+IKGYKFDSGPSLFSGFQSRGPQANPLAQV
Sbjct  70   LCCAGLLARYQQDVLVLESHDRPGGAAHSFEIKGYKFDSGPSLFSGFQSRGPQANPLAQV  129

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            LDALGESIPC  YDSWMVY+PEGEFLSRIGPTEF+KDLE YAGP
Sbjct  130  LDALGESIPCVNYDSWMVYVPEGEFLSRIGPTEFYKDLEKYAGP  173



>ref|XP_006389507.1| hypothetical protein POPTR_0022s00470g [Populus trichocarpa]
 ref|XP_006389508.1| hypothetical protein POPTR_0022s00470g [Populus trichocarpa]
 ref|XP_006389509.1| hypothetical protein POPTR_0022s00470g [Populus trichocarpa]
 ref|XP_006389511.1| amine oxidase family protein [Populus trichocarpa]
 gb|ERP48421.1| hypothetical protein POPTR_0022s00470g [Populus trichocarpa]
 gb|ERP48422.1| hypothetical protein POPTR_0022s00470g [Populus trichocarpa]
 gb|ERP48423.1| hypothetical protein POPTR_0022s00470g [Populus trichocarpa]
 gb|ERP48425.1| amine oxidase family protein [Populus trichocarpa]
Length=579

 Score =   249 bits (636),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 133/164 (81%), Gaps = 5/164 (3%)
 Frame = +2

Query  65   FRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAG  244
            F S      ++P  +  +S      ++ S+  N Y     +PFPGKPEADVVVIGSGI G
Sbjct  15   FNSESPPTLKKPVFARTSSNAQTPSSAGSLLVNDY-----KPFPGKPEADVVVIGSGIGG  69

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            LCCAGLLARYQQDVLVLESHD PGGAAHSF+IKGYKFDSGPSLFSGFQSRGPQANPLAQV
Sbjct  70   LCCAGLLARYQQDVLVLESHDRPGGAAHSFEIKGYKFDSGPSLFSGFQSRGPQANPLAQV  129

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            LDALGESIPC  YDSWMVY+PEGEFLSRIGPTEF+KDLE YAGP
Sbjct  130  LDALGESIPCVNYDSWMVYVPEGEFLSRIGPTEFYKDLEKYAGP  173



>ref|XP_011047892.1| PREDICTED: prolycopene isomerase, chloroplastic isoform X2 [Populus 
euphratica]
Length=579

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = +2

Query  83   NRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCAGL  262
            N    PTL     A     A S  S         +PFPGKPEADVVVIGSGI GLCCAGL
Sbjct  16   NSESPPTLKKPVFARTTSSAQSPSSVGSLLVNDYKPFPGKPEADVVVIGSGIGGLCCAGL  75

Query  263  LARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGE  442
            LARY+QDVLVLESHD PGGAAHSF+IKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGE
Sbjct  76   LARYEQDVLVLESHDRPGGAAHSFEIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGE  135

Query  443  SIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            SIPC  YDSWMVY+PEGEFLSRIGPTEF+KDLE YAGP
Sbjct  136  SIPCVNYDSWMVYVPEGEFLSRIGPTEFYKDLEKYAGP  173



>ref|XP_011047890.1| PREDICTED: prolycopene isomerase, chloroplastic isoform X1 [Populus 
euphratica]
 ref|XP_011047891.1| PREDICTED: prolycopene isomerase, chloroplastic isoform X1 [Populus 
euphratica]
Length=587

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = +2

Query  83   NRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCAGL  262
            N    PTL     A     A S  S         +PFPGKPEADVVVIGSGI GLCCAGL
Sbjct  16   NSESPPTLKKPVFARTTSSAQSPSSVGSLLVNDYKPFPGKPEADVVVIGSGIGGLCCAGL  75

Query  263  LARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGE  442
            LARY+QDVLVLESHD PGGAAHSF+IKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGE
Sbjct  76   LARYEQDVLVLESHDRPGGAAHSFEIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGE  135

Query  443  SIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            SIPC  YDSWMVY+PEGEFLSRIGPTEF+KDLE YAGP
Sbjct  136  SIPCVNYDSWMVYVPEGEFLSRIGPTEFYKDLEKYAGP  173



>gb|KDP42458.1| hypothetical protein JCGZ_00255 [Jatropha curcas]
Length=580

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 140/184 (76%), Gaps = 11/184 (6%)
 Frame = +2

Query  8    MASAGVATFLPKFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNG-YPSTSK  184
            MA +    F  ++ S  S FR S N    R T+  RNS        + +SSNG      K
Sbjct  1    MALSISPNFTAQYHSLFSSFRPSSN----RKTIVARNSN------GNELSSNGNLLVKDK  50

Query  185  QPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSG  364
              FPGKPEADVVVIGSGI GLCCAGLLARY+QDVL+LESHD+PGGAAHSF IK YKFDSG
Sbjct  51   TSFPGKPEADVVVIGSGIGGLCCAGLLARYKQDVLLLESHDLPGGAAHSFQIKDYKFDSG  110

Query  365  PSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLEN  544
            PSLFSG QSRGPQANPLAQVLDALGES PC KYDSWMVY+PEGEFLSRIGPTEF+KDLE 
Sbjct  111  PSLFSGLQSRGPQANPLAQVLDALGESPPCVKYDSWMVYVPEGEFLSRIGPTEFYKDLEK  170

Query  545  YAGP  556
            YAGP
Sbjct  171  YAGP  174



>ref|XP_006348602.1| PREDICTED: prolycopene isomerase 1, chloroplastic-like [Solanum 
tuberosum]
Length=562

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  179  SKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFD  358
            SKQP PGKPEAD+VVIGSGI GLCCAGLLARY QDVLVLESHDV GGAAHSFDIKGYKFD
Sbjct  31   SKQPVPGKPEADIVVIGSGIGGLCCAGLLARYGQDVLVLESHDVAGGAAHSFDIKGYKFD  90

Query  359  SGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
            SGPSLFSGFQSRGPQANPLAQVLDAL ESIPC  YDSWMVY+PEGEFLSRIGPTEFFKDL
Sbjct  91   SGPSLFSGFQSRGPQANPLAQVLDALDESIPCVNYDSWMVYVPEGEFLSRIGPTEFFKDL  150

Query  539  ENYAGP  556
            E YAGP
Sbjct  151  EKYAGP  156



>ref|XP_008218706.1| PREDICTED: prolycopene isomerase, chloroplastic [Prunus mume]
Length=568

 Score =   246 bits (628),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 134/157 (85%), Gaps = 5/157 (3%)
 Frame = +2

Query  80   NNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCAG  259
            N+   R ++  RNS + V  ++ +VS+       K+ FPGKPEADVVVIGSGI GLCCAG
Sbjct  20   NSSTVRNSVLARNSVSQVPSSTGAVSAK-----EKRSFPGKPEADVVVIGSGIGGLCCAG  74

Query  260  LLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALG  439
            LLARYQQDVLVLESHD+PGGAAHSFDIKG+KFDSGPSLFSGFQS+GPQANPL+QVLDALG
Sbjct  75   LLARYQQDVLVLESHDLPGGAAHSFDIKGFKFDSGPSLFSGFQSKGPQANPLSQVLDALG  134

Query  440  ESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            E+IPC  YDSWMVY+PEGEFLSRIGPTEF+KDLE YA
Sbjct  135  ETIPCASYDSWMVYLPEGEFLSRIGPTEFYKDLEKYA  171



>ref|XP_007224403.1| hypothetical protein PRUPE_ppa021157mg [Prunus persica]
 gb|EMJ25602.1| hypothetical protein PRUPE_ppa021157mg [Prunus persica]
Length=579

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 134/157 (85%), Gaps = 5/157 (3%)
 Frame = +2

Query  80   NNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCAG  259
            N+   R ++  RNS + V  ++ +VS+       K+ FPGKPEADVVVIGSGI GLCCAG
Sbjct  20   NSSTVRNSVLARNSVSQVPSSTGAVSAK-----EKRSFPGKPEADVVVIGSGIGGLCCAG  74

Query  260  LLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALG  439
            LLARYQQDVLVLESHD+PGGAAHSFDIKG+KFDSGPSLFSGFQS+GPQANPL+QVLDALG
Sbjct  75   LLARYQQDVLVLESHDLPGGAAHSFDIKGFKFDSGPSLFSGFQSKGPQANPLSQVLDALG  134

Query  440  ESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            E+IPC  YDSWMVY+PEGEFLSRIGPTEF+KDLE YA
Sbjct  135  ETIPCASYDSWMVYLPEGEFLSRIGPTEFYKDLEKYA  171



>ref|XP_010065273.1| PREDICTED: prolycopene isomerase, chloroplastic [Eucalyptus grandis]
 gb|KCW62675.1| hypothetical protein EUGRSUZ_G00236 [Eucalyptus grandis]
 gb|KCW62676.1| hypothetical protein EUGRSUZ_G00236 [Eucalyptus grandis]
Length=578

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 141/184 (77%), Gaps = 17/184 (9%)
 Frame = +2

Query  8    MASAGVATFLPKFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTS--  181
            M  A V   L ++  P+S F+   N +R+R               S+ +S++  P ++  
Sbjct  1    MVLASVQGLL-QWSPPLSPFKCVRNPKRQRAV-------------SARISTDDSPPSTQE  46

Query  182  -KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFD  358
             K+  PGKPEADVVVIGSGIAGLCCAGLLARY QDVLVLESHD PGGAAH+FDIKGYKFD
Sbjct  47   KKKSLPGKPEADVVVIGSGIAGLCCAGLLARYNQDVLVLESHDQPGGAAHAFDIKGYKFD  106

Query  359  SGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
            SGPSLFSGFQSRGPQANPLAQVLDALGES+PC  YDSWMVYIPEG+FLSRIGPTEFFKDL
Sbjct  107  SGPSLFSGFQSRGPQANPLAQVLDALGESVPCANYDSWMVYIPEGDFLSRIGPTEFFKDL  166

Query  539  ENYA  550
            E YA
Sbjct  167  EKYA  170



>ref|XP_010927816.1| PREDICTED: prolycopene isomerase, chloroplastic [Elaeis guineensis]
 ref|XP_010927817.1| PREDICTED: prolycopene isomerase, chloroplastic [Elaeis guineensis]
Length=584

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 139/186 (75%), Gaps = 13/186 (7%)
 Frame = +2

Query  8    MASAGVATFLPKFP----SPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPS  175
            MASA      P FP    SP  KFR     R RR  +  R+S   V E   +      P 
Sbjct  1    MASAFALRGFPSFPANALSPQFKFR-----RERRAAVLARSS--NVQEPRPTNVQP--PV  51

Query  176  TSKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKF  355
              K PFPGK EADVVVIGSGI GLCCAGLLARY Q+VLVLESHD+PGGAAHSF+IKGYKF
Sbjct  52   KEKNPFPGKLEADVVVIGSGIGGLCCAGLLARYGQNVLVLESHDLPGGAAHSFEIKGYKF  111

Query  356  DSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKD  535
            DSGPSLFSGFQSRGPQANPLAQVLDALGES+PC  YDSWMVYIPEGEFLSRIGPTEFFKD
Sbjct  112  DSGPSLFSGFQSRGPQANPLAQVLDALGESVPCASYDSWMVYIPEGEFLSRIGPTEFFKD  171

Query  536  LENYAG  553
            LE Y G
Sbjct  172  LEKYVG  177



>gb|KCW62677.1| hypothetical protein EUGRSUZ_G00236 [Eucalyptus grandis]
Length=587

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 141/184 (77%), Gaps = 17/184 (9%)
 Frame = +2

Query  8    MASAGVATFLPKFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTS--  181
            M  A V   L ++  P+S F+   N +R+R               S+ +S++  P ++  
Sbjct  1    MVLASVQGLL-QWSPPLSPFKCVRNPKRQRAV-------------SARISTDDSPPSTQE  46

Query  182  -KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFD  358
             K+  PGKPEADVVVIGSGIAGLCCAGLLARY QDVLVLESHD PGGAAH+FDIKGYKFD
Sbjct  47   KKKSLPGKPEADVVVIGSGIAGLCCAGLLARYNQDVLVLESHDQPGGAAHAFDIKGYKFD  106

Query  359  SGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
            SGPSLFSGFQSRGPQANPLAQVLDALGES+PC  YDSWMVYIPEG+FLSRIGPTEFFKDL
Sbjct  107  SGPSLFSGFQSRGPQANPLAQVLDALGESVPCANYDSWMVYIPEGDFLSRIGPTEFFKDL  166

Query  539  ENYA  550
            E YA
Sbjct  167  EKYA  170



>ref|XP_010244946.1| PREDICTED: prolycopene isomerase, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=578

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 124/132 (94%), Gaps = 1/132 (1%)
 Frame = +2

Query  158  SNGYPST-SKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSF  334
            SNGY S+ +K  FPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHD+PGGAAHSF
Sbjct  39   SNGYASSKAKIDFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDLPGGAAHSF  98

Query  335  DIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIG  514
            +IKGYKFDSGPSLFSGFQSRGPQANPLAQVLD+LGE++PC  YDSWMVYIPEGEFLSRIG
Sbjct  99   EIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDSLGETVPCATYDSWMVYIPEGEFLSRIG  158

Query  515  PTEFFKDLENYA  550
            PTEF KDLE +A
Sbjct  159  PTEFLKDLEKHA  170



>ref|XP_007041203.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein isoform 
2 [Theobroma cacao]
 gb|EOX97034.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein isoform 
2 [Theobroma cacao]
Length=444

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 127/153 (83%), Gaps = 6/153 (4%)
 Frame = +2

Query  95   RPTLSPRNSATGVGEASSSVSSNGYPSTS-KQPFPGKPEADVVVIGSGIAGLCCAGLLAR  271
            R TL  R+S    G      SSNG  S    +  PGKPEADVVVIGSGI GLCCAGLLAR
Sbjct  67   RRTLLARSSNDSPG-----FSSNGSVSVKPAKTVPGKPEADVVVIGSGIGGLCCAGLLAR  121

Query  272  YQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESIP  451
            Y QDVLVLESHD PGGAAHSF+IKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGES+P
Sbjct  122  YNQDVLVLESHDQPGGAAHSFEIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESVP  181

Query  452  CTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            C KYDSWMVYIPEGEFLSRIGPTEF+KDLE YA
Sbjct  182  CAKYDSWMVYIPEGEFLSRIGPTEFYKDLEKYA  214



>ref|XP_008378907.1| PREDICTED: uncharacterized protein LOC103441970 [Malus domestica]
Length=292

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 130/157 (83%), Gaps = 5/157 (3%)
 Frame = +2

Query  89   RRRPTLSPRNSATGVGEASSSVSSNGYPSTS-KQPFPGKPEADVVVIGSGIAGLCCAGLL  265
            R  P L+ R+S   VG+A SS +  G  S    + F GK EADVVVIGSGI GLCCAGLL
Sbjct  29   RNHPVLA-RSS---VGQAPSSSTGAGAASLQDNKSFSGKAEADVVVIGSGIGGLCCAGLL  84

Query  266  ARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGES  445
            ARYQQDVLVLESHD+PGGAAHSF+IKG++FDSGPSLFSGFQS+GPQANPL QVLDALGE+
Sbjct  85   ARYQQDVLVLESHDLPGGAAHSFEIKGFQFDSGPSLFSGFQSKGPQANPLGQVLDALGEA  144

Query  446  IPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            IPC  YDSWMVY+PE EFLSRIGPTEF+KDLE YA P
Sbjct  145  IPCASYDSWMVYLPEAEFLSRIGPTEFYKDLEKYASP  181



>ref|XP_004238986.1| PREDICTED: prolycopene isomerase, chloroplastic [Solanum lycopersicum]
Length=568

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  179  SKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFD  358
            SKQ   G+PEAD+VVIGSGI GLCCAGLLARY QDVLVLESHDV GGAAHSFD+KGYKFD
Sbjct  37   SKQSVSGEPEADIVVIGSGIGGLCCAGLLARYGQDVLVLESHDVAGGAAHSFDVKGYKFD  96

Query  359  SGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
            SGPSLFSGFQSRGPQANPLAQVLDALGESIPC  YDSWMVY+PEGEFLSRIGPTEFFKDL
Sbjct  97   SGPSLFSGFQSRGPQANPLAQVLDALGESIPCVNYDSWMVYVPEGEFLSRIGPTEFFKDL  156

Query  539  ENYAGP  556
            E YAGP
Sbjct  157  EKYAGP  162



>ref|XP_004133717.1| PREDICTED: prolycopene isomerase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56258.1| hypothetical protein Csa_3G110060 [Cucumis sativus]
Length=582

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 131/160 (82%), Gaps = 5/160 (3%)
 Frame = +2

Query  77   GNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCA  256
            G +  RRP  +  +S+T    + +S+S N     +   F GK EADVVVIGSGI GLCCA
Sbjct  22   GVSAHRRPIFARSSSSTQEPTSIASLSLN-----NNNGFSGKAEADVVVIGSGIGGLCCA  76

Query  257  GLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDAL  436
            GLLARY QDVLVLESHD+PGGAAHSF+IKGYKFDSGPSLFSGFQSRGPQANPLAQVLDAL
Sbjct  77   GLLARYGQDVLVLESHDLPGGAAHSFEIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDAL  136

Query  437  GESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            GES+PC  YDSWMVYIPEGEFLSRIGPTEFFKDLE YA P
Sbjct  137  GESLPCANYDSWMVYIPEGEFLSRIGPTEFFKDLETYASP  176



>ref|XP_004163999.1| PREDICTED: prolycopene isomerase, chloroplastic-like [Cucumis 
sativus]
Length=582

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 131/160 (82%), Gaps = 5/160 (3%)
 Frame = +2

Query  77   GNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCA  256
            G +  RRP  +  +S+T    + +S+S N     +   F GK EADVVVIGSGI GLCCA
Sbjct  22   GVSAHRRPIFARSSSSTQEPTSIASLSLN-----NNNGFSGKAEADVVVIGSGIGGLCCA  76

Query  257  GLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDAL  436
            GLLARY QDVLVLESHD+PGGAAHSF+IKGYKFDSGPSLFSGFQSRGPQANPLAQVLDAL
Sbjct  77   GLLARYGQDVLVLESHDLPGGAAHSFEIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDAL  136

Query  437  GESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            GES+PC  YDSWMVYIPEGEFLSRIGPTEFFKDLE YA P
Sbjct  137  GESLPCANYDSWMVYIPEGEFLSRIGPTEFFKDLETYASP  176



>gb|EPS67315.1| hypothetical protein M569_07459, partial [Genlisea aurea]
Length=392

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 133/172 (77%), Gaps = 13/172 (8%)
 Frame = +2

Query  41   KFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVV  220
            +F  P SK RS    R R P++S   S  G     S+ +SNG P       PG  EAD+V
Sbjct  13   RFVLPYSKPRS----RHRFPSVSALASDFG-----SNTTSNGSP----HGIPGSAEADIV  59

Query  221  VIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGP  400
            VIGSGI GLCC  LLARY QDVLVLESHDVPGGAAHSF+I GYKFDSGPSLFSGFQSRGP
Sbjct  60   VIGSGIGGLCCGSLLARYNQDVLVLESHDVPGGAAHSFEINGYKFDSGPSLFSGFQSRGP  119

Query  401  QANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            QANPLAQVLDALGES+PC  YDSWMV++PEGEFLSRIGPT+FFKDL+ YAGP
Sbjct  120  QANPLAQVLDALGESVPCVSYDSWMVFLPEGEFLSRIGPTDFFKDLQTYAGP  171



>ref|XP_010096434.1| hypothetical protein L484_013117 [Morus notabilis]
 gb|EXB64105.1| hypothetical protein L484_013117 [Morus notabilis]
Length=594

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 132/173 (76%), Gaps = 6/173 (3%)
 Frame = +2

Query  38   PKFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADV  217
            P + +P S F    NN   R T+  R S     +  SS  + G        FPGK EADV
Sbjct  22   PLYHNPKSSFI---NNIDGRKTVLARYSNV---QEPSSTGAVGLAVKQNDSFPGKAEADV  75

Query  218  VVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRG  397
            VVIGSGI GLCCAGLLARYQQDV+VLESHD+PGGAAHSF+IKGYKFDSGPSLFSGFQSRG
Sbjct  76   VVIGSGIGGLCCAGLLARYQQDVIVLESHDIPGGAAHSFEIKGYKFDSGPSLFSGFQSRG  135

Query  398  PQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
             QANPLAQVLDALGE IPC  YDSWMVY+PEGEFLSRIGPTEFFKDLE +A P
Sbjct  136  LQANPLAQVLDALGERIPCATYDSWMVYVPEGEFLSRIGPTEFFKDLEKHASP  188



>ref|XP_006392380.1| hypothetical protein EUTSA_v10023380mg [Eutrema salsugineum]
 gb|ESQ29666.1| hypothetical protein EUTSA_v10023380mg [Eutrema salsugineum]
Length=469

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+PF G+PEADVVVIGSGI GLCC  LLARY QDVLVLESHD+PGGAAHSF+IKGYKFDS
Sbjct  43   KKPFSGEPEADVVVIGSGIGGLCCGALLARYNQDVLVLESHDLPGGAAHSFEIKGYKFDS  102

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES+PC KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  103  GPSLFSGLQSRGPQANPLAQVLDALGESLPCAKYDSWMVYLPEGDFLSRIGPTDFFKDLE  162

Query  542  NYAGP  556
             YAGP
Sbjct  163  KYAGP  167



>ref|XP_008452247.1| PREDICTED: prolycopene isomerase, chloroplastic [Cucumis melo]
Length=582

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 143/183 (78%), Gaps = 7/183 (4%)
 Frame = +2

Query  8    MASAGVATFLPKFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQ  187
            MA    ++ LP F  P+S   + G +  RRP  +  +S+T    + +SVS N     + +
Sbjct  1    MAMDLCSSMLP-FYRPLSP-SAFGVSAYRRPIFARSSSSTQQPTSIASVSLN-----NNK  53

Query  188  PFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGP  367
             F GK EADVVVIGSGI GLCCAGLLARY QDVLVLESHD+PGGAAHSF+IKGYKFDSGP
Sbjct  54   GFSGKAEADVVVIGSGIGGLCCAGLLARYGQDVLVLESHDLPGGAAHSFEIKGYKFDSGP  113

Query  368  SLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENY  547
            SLFSGFQSRGPQANPLAQVLDALGES+PC  YDSWMVYIPEGEFLSRIGPTEFFKDLE Y
Sbjct  114  SLFSGFQSRGPQANPLAQVLDALGESLPCANYDSWMVYIPEGEFLSRIGPTEFFKDLETY  173

Query  548  AGP  556
            A P
Sbjct  174  ASP  176



>ref|XP_004301557.1| PREDICTED: prolycopene isomerase, chloroplastic isoform X1 [Fragaria 
vesca subsp. vesca]
Length=569

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 123/139 (88%), Gaps = 3/139 (2%)
 Frame = +2

Query  143  SSSVSSNGYPSTSKQ---PFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVP  313
            +S+ SSNG  S  +    PFPGK EADVVVIGSGI GLCCAGLLARYQQDVLVLESHD+P
Sbjct  23   TSATSSNGSFSLKQNKTTPFPGKAEADVVVIGSGIGGLCCAGLLARYQQDVLVLESHDLP  82

Query  314  GGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEG  493
            GGAAHSF+IKG+ FDSGPSLFSGFQS+GPQANPL QVLDALGE+IPC  YDSWMVY+PEG
Sbjct  83   GGAAHSFEIKGFHFDSGPSLFSGFQSKGPQANPLGQVLDALGETIPCANYDSWMVYLPEG  142

Query  494  EFLSRIGPTEFFKDLENYA  550
            EFLSRIGPTEFFKDLE YA
Sbjct  143  EFLSRIGPTEFFKDLEKYA  161



>ref|XP_007041202.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein isoform 
1 [Theobroma cacao]
 gb|EOX97033.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein isoform 
1 [Theobroma cacao]
Length=622

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 127/153 (83%), Gaps = 6/153 (4%)
 Frame = +2

Query  95   RPTLSPRNSATGVGEASSSVSSNGYPSTS-KQPFPGKPEADVVVIGSGIAGLCCAGLLAR  271
            R TL  R+S       S   SSNG  S    +  PGKPEADVVVIGSGI GLCCAGLLAR
Sbjct  67   RRTLLARSS-----NDSPGFSSNGSVSVKPAKTVPGKPEADVVVIGSGIGGLCCAGLLAR  121

Query  272  YQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESIP  451
            Y QDVLVLESHD PGGAAHSF+IKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGES+P
Sbjct  122  YNQDVLVLESHDQPGGAAHSFEIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESVP  181

Query  452  CTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            C KYDSWMVYIPEGEFLSRIGPTEF+KDLE YA
Sbjct  182  CAKYDSWMVYIPEGEFLSRIGPTEFYKDLEKYA  214



>ref|XP_008803793.1| PREDICTED: prolycopene isomerase 1, chloroplastic isoform X2 
[Phoenix dactylifera]
Length=488

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +2

Query  170  PSTSKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGY  349
            P   K PFPGK EADVVVIGSGI GLCCAGLLARY Q+VLVLESHD+PGGAAHSF+IKGY
Sbjct  50   PVKEKNPFPGKLEADVVVIGSGIGGLCCAGLLARYGQNVLVLESHDLPGGAAHSFEIKGY  109

Query  350  KFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFF  529
            KFDSGPSLFSGFQSRGPQANPLAQVLDALG S+PC  YDSWMVYIPEGEFLSRIGPTEF 
Sbjct  110  KFDSGPSLFSGFQSRGPQANPLAQVLDALGGSVPCASYDSWMVYIPEGEFLSRIGPTEFL  169

Query  530  KDLENYAG  553
            KDLE Y G
Sbjct  170  KDLEKYVG  177



>ref|XP_006392382.1| hypothetical protein EUTSA_v10023380mg [Eutrema salsugineum]
 gb|ESQ29668.1| hypothetical protein EUTSA_v10023380mg [Eutrema salsugineum]
Length=575

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+PF G+PEADVVVIGSGI GLCC  LLARY QDVLVLESHD+PGGAAHSF+IKGYKFDS
Sbjct  43   KKPFSGEPEADVVVIGSGIGGLCCGALLARYNQDVLVLESHDLPGGAAHSFEIKGYKFDS  102

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES+PC KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  103  GPSLFSGLQSRGPQANPLAQVLDALGESLPCAKYDSWMVYLPEGDFLSRIGPTDFFKDLE  162

Query  542  NYAGP  556
             YAGP
Sbjct  163  KYAGP  167



>ref|XP_006392381.1| hypothetical protein EUTSA_v10023380mg [Eutrema salsugineum]
 gb|ESQ29667.1| hypothetical protein EUTSA_v10023380mg [Eutrema salsugineum]
Length=573

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+PF G+PEADVVVIGSGI GLCC  LLARY QDVLVLESHD+PGGAAHSF+IKGYKFDS
Sbjct  43   KKPFSGEPEADVVVIGSGIGGLCCGALLARYNQDVLVLESHDLPGGAAHSFEIKGYKFDS  102

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES+PC KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  103  GPSLFSGLQSRGPQANPLAQVLDALGESLPCAKYDSWMVYLPEGDFLSRIGPTDFFKDLE  162

Query  542  NYAGP  556
             YAGP
Sbjct  163  KYAGP  167



>emb|CDY39935.1| BnaA09g15170D [Brassica napus]
Length=585

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+ FPG+PEADVVVIGSGI GLCC  LLARY QDVLVLESHD+PGGAAHSF+IKGYKFDS
Sbjct  53   KKSFPGEPEADVVVIGSGIGGLCCGALLARYNQDVLVLESHDLPGGAAHSFEIKGYKFDS  112

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES+PC KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  113  GPSLFSGLQSRGPQANPLAQVLDALGESLPCAKYDSWMVYLPEGDFLSRIGPTDFFKDLE  172

Query  542  NYAGP  556
             YAGP
Sbjct  173  KYAGP  177



>ref|XP_009113353.1| PREDICTED: prolycopene isomerase, chloroplastic [Brassica rapa]
Length=585

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+ FPG+PEADVVVIGSGI GLCC  LLARY QDVLVLESHD+PGGAAHSF+IKGYKFDS
Sbjct  53   KKSFPGEPEADVVVIGSGIGGLCCGALLARYNQDVLVLESHDLPGGAAHSFEIKGYKFDS  112

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES+PC KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  113  GPSLFSGLQSRGPQANPLAQVLDALGESLPCAKYDSWMVYLPEGDFLSRIGPTDFFKDLE  172

Query  542  NYAGP  556
             YAGP
Sbjct  173  KYAGP  177



>gb|KJB16213.1| hypothetical protein B456_002G218000 [Gossypium raimondii]
Length=578

 Score =   236 bits (603),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  194  PGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSL  373
            PGKPEADVVVIGSGI GLCCAGLLARY QDVLVLESHD+PGGAAHSF+IKGYKFDSGPSL
Sbjct  52   PGKPEADVVVIGSGIGGLCCAGLLARYNQDVLVLESHDLPGGAAHSFEIKGYKFDSGPSL  111

Query  374  FSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            FSGFQSRGPQANPLAQVLDALGESIPC KYDSWMVYIPE EFLSRIGPTEF KDLE YA
Sbjct  112  FSGFQSRGPQANPLAQVLDALGESIPCAKYDSWMVYIPEAEFLSRIGPTEFLKDLEKYA  170



>gb|KJB16214.1| hypothetical protein B456_002G218000 [Gossypium raimondii]
Length=579

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  194  PGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSL  373
            PGKPEADVVVIGSGI GLCCAGLLARY QDVLVLESHD+PGGAAHSF+IKGYKFDSGPSL
Sbjct  52   PGKPEADVVVIGSGIGGLCCAGLLARYNQDVLVLESHDLPGGAAHSFEIKGYKFDSGPSL  111

Query  374  FSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            FSGFQSRGPQANPLAQVLDALGESIPC KYDSWMVYIPE EFLSRIGPTEF KDLE YA
Sbjct  112  FSGFQSRGPQANPLAQVLDALGESIPCAKYDSWMVYIPEAEFLSRIGPTEFLKDLEKYA  170



>ref|XP_009411884.1| PREDICTED: prolycopene isomerase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=586

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 122/134 (91%), Gaps = 1/134 (1%)
 Frame = +2

Query  152  VSSNGYP-STSKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAH  328
            ++++G P S S+ PFPGK EADVVVIGSGI GLCCAGLLARYQQDVLVLESHD+PGGAAH
Sbjct  45   LTASGRPTSESRNPFPGKLEADVVVIGSGIGGLCCAGLLARYQQDVLVLESHDLPGGAAH  104

Query  329  SFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSR  508
            SF++KGYKFDSGPSLFSGFQSRGPQANPL+QVLDALGE +PC  YDSWMVY+PEGEFLSR
Sbjct  105  SFEVKGYKFDSGPSLFSGFQSRGPQANPLSQVLDALGEPVPCATYDSWMVYVPEGEFLSR  164

Query  509  IGPTEFFKDLENYA  550
            IGPTEF KDLE + 
Sbjct  165  IGPTEFLKDLETFV  178



>ref|XP_008803791.1| PREDICTED: prolycopene isomerase, chloroplastic isoform X1 [Phoenix 
dactylifera]
 ref|XP_008803792.1| PREDICTED: prolycopene isomerase, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=584

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +2

Query  170  PSTSKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGY  349
            P   K PFPGK EADVVVIGSGI GLCCAGLLARY Q+VLVLESHD+PGGAAHSF+IKGY
Sbjct  50   PVKEKNPFPGKLEADVVVIGSGIGGLCCAGLLARYGQNVLVLESHDLPGGAAHSFEIKGY  109

Query  350  KFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFF  529
            KFDSGPSLFSGFQSRGPQANPLAQVLDALG S+PC  YDSWMVYIPEGEFLSRIGPTEF 
Sbjct  110  KFDSGPSLFSGFQSRGPQANPLAQVLDALGGSVPCASYDSWMVYIPEGEFLSRIGPTEFL  169

Query  530  KDLENYAG  553
            KDLE Y G
Sbjct  170  KDLEKYVG  177



>ref|XP_009355336.1| PREDICTED: prolycopene isomerase, chloroplastic [Pyrus x bretschneideri]
Length=588

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 129/157 (82%), Gaps = 4/157 (3%)
 Frame = +2

Query  89   RRRPTLSPRNSATGVGEASSSVSSNGYPST-SKQPFPGKPEADVVVIGSGIAGLCCAGLL  265
            R  P +  R+S   VG+A SS +  G  S    + F GK EADVVVIGSGI GLCCAGLL
Sbjct  29   RNHPVVVARSS---VGQAPSSSTGAGAASLPDNKSFSGKAEADVVVIGSGIGGLCCAGLL  85

Query  266  ARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGES  445
            ARYQQDVLVLESHD+PGGAAHSF+IKG++FDSGPSLFSGFQS+GPQANPL QVLDALGE+
Sbjct  86   ARYQQDVLVLESHDLPGGAAHSFEIKGFQFDSGPSLFSGFQSKGPQANPLGQVLDALGEA  145

Query  446  IPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            IPC  YDSWMVY+PE EFLSRIGPTEF+KDLE YA P
Sbjct  146  IPCASYDSWMVYLPEAEFLSRIGPTEFYKDLEKYASP  182



>emb|CAN60294.1| hypothetical protein VITISV_023401 [Vitis vinifera]
Length=586

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +2

Query  143  SSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGA  322
            S  V SN   S   Q F GKPEADVVVIGSGI GLCCAGLLARYQQDVLVLESHD PGGA
Sbjct  43   SGLVDSNQMLSQLNQLFAGKPEADVVVIGSGIGGLCCAGLLARYQQDVLVLESHDRPGGA  102

Query  323  AHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFL  502
            AHSF I+ Y+FDSGPSLFSGFQSRGPQANPLAQVLDALGES+PC  Y+SWMVYIPEGEFL
Sbjct  103  AHSFKIRDYEFDSGPSLFSGFQSRGPQANPLAQVLDALGESVPCANYBSWMVYIPEGEFL  162

Query  503  SRIGPTEFFKDLENYA  550
            SRIG TEFFKDLE YA
Sbjct  163  SRIGXTEFFKDLEKYA  178



>gb|KHG20519.1| Prolycopene isomerase, chloroplastic [Gossypium arboreum]
Length=664

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/172 (75%), Positives = 136/172 (79%), Gaps = 6/172 (3%)
 Frame = +2

Query  35   LPKFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEAD  214
            LP FP    KF +S N    R   SP N +     ASSS S +  P T  +  PGKPEAD
Sbjct  91   LPLFPG--IKFPTSRNTVLARS--SPNNLSQFSSNASSSTSISVKPPT--KTVPGKPEAD  144

Query  215  VVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSR  394
            VVVIGSGI GLCCAGLLARY QDVLVLESHD+PGGAAHSF+IKGYKFDSGPSLFSGFQSR
Sbjct  145  VVVIGSGIGGLCCAGLLARYNQDVLVLESHDLPGGAAHSFEIKGYKFDSGPSLFSGFQSR  204

Query  395  GPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            GPQANPLAQVLDALGESIPC KYDSWMVYIPE EFLSRIGPTEF KDLE +A
Sbjct  205  GPQANPLAQVLDALGESIPCAKYDSWMVYIPEAEFLSRIGPTEFLKDLEKHA  256



>emb|CDX95296.1| BnaC09g15740D [Brassica napus]
Length=577

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+ FPG+PEADVVVIGSGI GLCC  LLARY QDVLVLESHD+PGGAAHSF+IKGYKFDS
Sbjct  45   KKSFPGEPEADVVVIGSGIGGLCCGALLARYNQDVLVLESHDLPGGAAHSFEIKGYKFDS  104

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES+PC KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  105  GPSLFSGLQSRGPQANPLAQVLDALGESLPCAKYDSWMVYLPEGDFLSRIGPTDFFKDLE  164

Query  542  NYAG  553
             YAG
Sbjct  165  KYAG  168



>ref|XP_011087664.1| PREDICTED: prolycopene isomerase 1, chloroplastic [Sesamum indicum]
Length=585

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 140/184 (76%), Gaps = 10/184 (5%)
 Frame = +2

Query  8    MASAGVATFLPKFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPS-TSK  184
            ++  G+ T  P F  P S F+S    +R  PT+  R S   +       SSNGYPS T  
Sbjct  5    LSGGGIGTNFPHFFQPFSSFKS----KRTTPTVLARVSNNAL-----ETSSNGYPSPTLT  55

Query  185  QPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSG  364
              FPGKPEADV++IGSGI GLCC  LLARY QDVLVLESHD PGGAAHSF+IK YKFDSG
Sbjct  56   HNFPGKPEADVIIIGSGIGGLCCGALLARYNQDVLVLESHDRPGGAAHSFEIKDYKFDSG  115

Query  365  PSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLEN  544
            PSLFSGFQSRGPQANPLAQVLDAL ES+PC  YDSWMVYIPEGEFLSRIGPT+FFKDL+ 
Sbjct  116  PSLFSGFQSRGPQANPLAQVLDALDESLPCATYDSWMVYIPEGEFLSRIGPTDFFKDLQT  175

Query  545  YAGP  556
            YAGP
Sbjct  176  YAGP  179



>gb|EYU26464.1| hypothetical protein MIMGU_mgv1a003523mg [Erythranthe guttata]
Length=580

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 136/183 (74%), Gaps = 14/183 (8%)
 Frame = +2

Query  8    MASAGVATFLPKFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQ  187
            ++  G+ +   +F  P+S F+S             R + +      S +S+NG   +S  
Sbjct  6    VSGVGIGSNFSQFLQPISIFKSKCR----------RTTTSTTTTVFSRISNNGSQPSSN-  54

Query  188  PFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGP  367
               GK EADV+VIGSGIAGLCC  LLARY QDVLVLESHDVPGGAAHSF+IK YKFDSGP
Sbjct  55   ---GKSEADVIVIGSGIAGLCCGALLARYNQDVLVLESHDVPGGAAHSFEIKDYKFDSGP  111

Query  368  SLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENY  547
            SLFSGFQSRGPQANPLAQVLDALGESIPC +YDSWMVYIPEGEFLSRIGPT+F KDL+ Y
Sbjct  112  SLFSGFQSRGPQANPLAQVLDALGESIPCKEYDSWMVYIPEGEFLSRIGPTDFLKDLQTY  171

Query  548  AGP  556
            AGP
Sbjct  172  AGP  174



>emb|CBI29695.3| unnamed protein product [Vitis vinifera]
Length=570

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +2

Query  140  ASSSVSSNGYPSTSK-QPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPG  316
            ++ SV +   PS  + +PF GKPEADVVVIGSGI GLCCAGLLARYQQDVLVLESHD PG
Sbjct  25   SNGSVPATASPSPKQYKPFQGKPEADVVVIGSGIGGLCCAGLLARYQQDVLVLESHDRPG  84

Query  317  GAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGE  496
            GAAHSF I+ Y+FDSGPSLFSGFQSRGPQANPLAQVLDALGES+PC  YDSWMVYIPEGE
Sbjct  85   GAAHSFKIRDYEFDSGPSLFSGFQSRGPQANPLAQVLDALGESVPCANYDSWMVYIPEGE  144

Query  497  FLSRIGPTEFFKDLENYA  550
            FLSRIG TEFFKDLE YA
Sbjct  145  FLSRIGATEFFKDLEKYA  162



>ref|XP_010657970.1| PREDICTED: prolycopene isomerase, chloroplastic isoform X1 [Vitis 
vinifera]
Length=570

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +2

Query  140  ASSSVSSNGYPSTSK-QPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPG  316
            ++ SV +   PS  + +PF GKPEADVVVIGSGI GLCCAGLLARYQQDVLVLESHD PG
Sbjct  25   SNGSVPATASPSPKQYKPFQGKPEADVVVIGSGIGGLCCAGLLARYQQDVLVLESHDRPG  84

Query  317  GAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGE  496
            GAAHSF I+ Y+FDSGPSLFSGFQSRGPQANPLAQVLDALGES+PC  YDSWMVYIPEGE
Sbjct  85   GAAHSFKIRDYEFDSGPSLFSGFQSRGPQANPLAQVLDALGESVPCANYDSWMVYIPEGE  144

Query  497  FLSRIGPTEFFKDLENYA  550
            FLSRIG TEFFKDLE YA
Sbjct  145  FLSRIGATEFFKDLEKYA  162



>ref|XP_010553689.1| PREDICTED: prolycopene isomerase, chloroplastic isoform X1 [Tarenaya 
hassleriana]
Length=584

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  179  SKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFD  358
            S + FPGKPEADVVVIGSGI GLCC  LLARY QDVLVLESHD+PGGAAHSF+IKGYKFD
Sbjct  53   SNKAFPGKPEADVVVIGSGIGGLCCGSLLARYNQDVLVLESHDLPGGAAHSFEIKGYKFD  112

Query  359  SGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
            SGPSLFSG QSRG QANPLAQVLDALGES+PCTKYDSW VYIPEGEFLSRIGPT+FFKDL
Sbjct  113  SGPSLFSGLQSRGLQANPLAQVLDALGESLPCTKYDSWKVYIPEGEFLSRIGPTDFFKDL  172

Query  539  ENYAG  553
            E YAG
Sbjct  173  EKYAG  177



>ref|NP_176088.2| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG29233.1|AC079732_4 hypothetical protein [Arabidopsis thaliana]
 gb|AAL38754.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91765.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33463.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis 
thaliana]
Length=574

 Score =   233 bits (595),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+PF G+PEADVVVIGSGI GLCC  LLARY QDV+VLESHD PGGAAHSF+IKGYKFDS
Sbjct  44   KEPFSGEPEADVVVIGSGIGGLCCGALLARYDQDVIVLESHDHPGGAAHSFEIKGYKFDS  103

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES PC KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  104  GPSLFSGLQSRGPQANPLAQVLDALGESFPCKKYDSWMVYLPEGDFLSRIGPTDFFKDLE  163

Query  542  NYAGP  556
             YAGP
Sbjct  164  KYAGP  168



>gb|AAG50743.1|AC079733_11 hypothetical protein [Arabidopsis thaliana]
Length=578

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+PF G+PEADVVVIGSGI GLCC  LLARY QDV+VLESHD PGGAAHSF+IKGYKFDS
Sbjct  44   KEPFSGEPEADVVVIGSGIGGLCCGALLARYDQDVIVLESHDHPGGAAHSFEIKGYKFDS  103

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES PC KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  104  GPSLFSGLQSRGPQANPLAQVLDALGESFPCKKYDSWMVYLPEGDFLSRIGPTDFFKDLE  163

Query  542  NYAGP  556
             YAGP
Sbjct  164  KYAGP  168



>gb|EYU25617.1| hypothetical protein MIMGU_mgv1a0217391mg, partial [Erythranthe 
guttata]
Length=514

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            KPEADV+VIGSGIAGLCC  LLARY QDVLVLESHDVPGGAAHSF+IK YKFDSGPSLFS
Sbjct  1    KPEADVIVIGSGIAGLCCGALLARYNQDVLVLESHDVPGGAAHSFEIKDYKFDSGPSLFS  60

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            GFQSRGPQANPLAQVLDALGESIPC +YDSWMVYIPEGEFLSRIGPT+FFKDL+ YAGP
Sbjct  61   GFQSRGPQANPLAQVLDALGESIPCEEYDSWMVYIPEGEFLSRIGPTDFFKDLQTYAGP  119



>ref|XP_002892017.1| hypothetical protein ARALYDRAFT_314966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68276.1| hypothetical protein ARALYDRAFT_314966 [Arabidopsis lyrata subsp. 
lyrata]
Length=578

 Score =   231 bits (589),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+ F G+PEADVVVIGSGI GLCC  LLARY QDV+VLESHD PGGAAHSF+IKGYKFDS
Sbjct  44   KESFSGEPEADVVVIGSGIGGLCCGALLARYDQDVIVLESHDHPGGAAHSFEIKGYKFDS  103

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES+PC KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  104  GPSLFSGLQSRGPQANPLAQVLDALGESLPCNKYDSWMVYLPEGDFLSRIGPTDFFKDLE  163

Query  542  NYAGP  556
             YAGP
Sbjct  164  KYAGP  168



>gb|ACU20396.1| unknown [Glycine max]
Length=237

 Score =   221 bits (563),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            EADVVVIGSGI GLCC  LLARY++DVLVLESHD PGGAAHSFDIKGY FDSGPSLFSG 
Sbjct  36   EADVVVIGSGIGGLCCGALLARYEEDVLVLESHDQPGGAAHSFDIKGYNFDSGPSLFSGL  95

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            QSRGPQANPLAQVLDALGES+PC  YDSWMV+IPEG+FLSRIGPTEFFKDL+ YAGP
Sbjct  96   QSRGPQANPLAQVLDALGESLPCATYDSWMVHIPEGQFLSRIGPTEFFKDLQQYAGP  152



>ref|XP_010068005.1| PREDICTED: LOW QUALITY PROTEIN: phytoene desaturase-like [Eucalyptus 
grandis]
Length=222

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  191  FPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPS  370
             PGKPEADVVVIGSGIA LCCAGLLARY QDVLVLES D PGGAA++FDIKGYKFDSGPS
Sbjct  19   MPGKPEADVVVIGSGIADLCCAGLLARYNQDVLVLESKDQPGGAAYAFDIKGYKFDSGPS  78

Query  371  LFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            LFSGFQSR PQ NPLAQVLDALGES+PC   DSWMVYIPEGEF SRIGP EFFKDLE YA
Sbjct  79   LFSGFQSRDPQVNPLAQVLDALGESVPCANCDSWMVYIPEGEFFSRIGPIEFFKDLEKYA  138



>ref|XP_010681073.1| PREDICTED: prolycopene isomerase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=578

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/121 (88%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +2

Query  191  FPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPS  370
             PG+ EADVVVIGSGI GLCCAGLLARY+QDVLVLESHD PGGAAHSF++KGYKFDSGPS
Sbjct  51   IPGRSEADVVVIGSGIGGLCCAGLLARYEQDVLVLESHDQPGGAAHSFEVKGYKFDSGPS  110

Query  371  LFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            LFSGFQSRG QANPLAQVLDALGE+IPC KYDSWMVY+PEG+FLSRIGPTEF+KDLE YA
Sbjct  111  LFSGFQSRGLQANPLAQVLDALGETIPCAKYDSWMVYVPEGDFLSRIGPTEFYKDLEKYA  170

Query  551  G  553
            G
Sbjct  171  G  171



>ref|XP_010657971.1| PREDICTED: prolycopene isomerase, chloroplastic isoform X2 [Vitis 
vinifera]
Length=531

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  197  GKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLF  376
            GKPEADVVVIGSGI GLCCAGLLARYQQDVLVLESHD PGGAAHSF I+ Y+FDSGPSLF
Sbjct  6    GKPEADVVVIGSGIGGLCCAGLLARYQQDVLVLESHDRPGGAAHSFKIRDYEFDSGPSLF  65

Query  377  SGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            SGFQSRGPQANPLAQVLDALGES+PC  YDSWMVYIPEGEFLSRIG TEFFKDLE YA
Sbjct  66   SGFQSRGPQANPLAQVLDALGESVPCANYDSWMVYIPEGEFLSRIGATEFFKDLEKYA  123



>ref|XP_010470316.1| PREDICTED: prolycopene isomerase, chloroplastic-like [Camelina 
sativa]
Length=584

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            KQ   G+ EADVVVIGSGI GLCC  LLARY QDVLVLESHD PGGAAHSFDIKGYKFDS
Sbjct  54   KQSSSGESEADVVVIGSGIGGLCCGALLARYGQDVLVLESHDQPGGAAHSFDIKGYKFDS  113

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES+PC+KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  114  GPSLFSGLQSRGPQANPLAQVLDALGESLPCSKYDSWMVYLPEGDFLSRIGPTDFFKDLE  173

Query  542  NYAGP  556
             YAGP
Sbjct  174  TYAGP  178



>ref|XP_010511355.1| PREDICTED: prolycopene isomerase, chloroplastic [Camelina sativa]
Length=583

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+ F G+ EADVVVIGSGI GLCC  LLARY QDVLVLESHD PGGAAHSF+IKGYKFDS
Sbjct  53   KESFSGESEADVVVIGSGIGGLCCGALLARYGQDVLVLESHDQPGGAAHSFEIKGYKFDS  112

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES+PC+KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  113  GPSLFSGLQSRGPQANPLAQVLDALGESLPCSKYDSWMVYLPEGDFLSRIGPTDFFKDLE  172

Query  542  NYAGP  556
             YAGP
Sbjct  173  TYAGP  177



>ref|XP_010414806.1| PREDICTED: prolycopene isomerase, chloroplastic-like [Camelina 
sativa]
Length=575

 Score =   229 bits (583),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+ F GK EADVVVIGSGI GLCC  LLARY QDVLVLESHD PGGAAHSF+IKGYKFDS
Sbjct  45   KESFSGKSEADVVVIGSGIGGLCCGALLARYGQDVLVLESHDQPGGAAHSFEIKGYKFDS  104

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES+PC+KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  105  GPSLFSGLQSRGPQANPLAQVLDALGESLPCSKYDSWMVYLPEGDFLSRIGPTDFFKDLE  164

Query  542  NYAG  553
             YAG
Sbjct  165  TYAG  168



>ref|XP_006302070.1| hypothetical protein CARUB_v10020054mg [Capsella rubella]
 gb|EOA34968.1| hypothetical protein CARUB_v10020054mg [Capsella rubella]
Length=570

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K+ F G+ EADVVVIGSGI GLCC  LLARY QDV+VLESHD PGGAAHSF+IKGYKFDS
Sbjct  40   KESFSGESEADVVVIGSGIGGLCCGALLARYGQDVVVLESHDHPGGAAHSFEIKGYKFDS  99

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSG QSRGPQANPLAQVLDALGES+PC+KYDSWMVY+PEG+FLSRIGPT+FFKDLE
Sbjct  100  GPSLFSGLQSRGPQANPLAQVLDALGESLPCSKYDSWMVYLPEGDFLSRIGPTDFFKDLE  159

Query  542  NYAGP  556
             YAGP
Sbjct  160  KYAGP  164



>ref|XP_010553690.1| PREDICTED: prolycopene isomerase, chloroplastic isoform X2 [Tarenaya 
hassleriana]
Length=529

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            KPEADVVVIGSGI GLCC  LLARY QDVLVLESHD+PGGAAHSF+IKGYKFDSGPSLFS
Sbjct  5    KPEADVVVIGSGIGGLCCGSLLARYNQDVLVLESHDLPGGAAHSFEIKGYKFDSGPSLFS  64

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            G QSRG QANPLAQVLDALGES+PCTKYDSW VYIPEGEFLSRIGPT+FFKDLE YAG
Sbjct  65   GLQSRGLQANPLAQVLDALGESLPCTKYDSWKVYIPEGEFLSRIGPTDFFKDLEKYAG  122



>gb|KHN40192.1| Prolycopene isomerase 1, chloroplastic [Glycine soja]
Length=509

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            EADVVVIGSGI GLCC  LLARY++DVLVLESHD PGGAAHSFDIKGY FDSGPSLFSG 
Sbjct  36   EADVVVIGSGIGGLCCGALLARYEEDVLVLESHDQPGGAAHSFDIKGYNFDSGPSLFSGL  95

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            QSRGPQANPLAQVLDALGES+PC  YDSWMV+IPEG+FLSRIGPTEFFKDL+ YAGP
Sbjct  96   QSRGPQANPLAQVLDALGESLPCATYDSWMVHIPEGQFLSRIGPTEFFKDLQQYAGP  152



>ref|XP_006652010.1| PREDICTED: prolycopene isomerase 1, chloroplastic-like [Oryza 
brachyantha]
Length=544

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSGI GLCCAGLLARY QDVLVLESHD PGGAAHSFDIKG+ FDSGPSLFS
Sbjct  20   RPEADVVVIGSGIGGLCCAGLLARYNQDVLVLESHDRPGGAAHSFDIKGFNFDSGPSLFS  79

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMVY+PEG+FLSRIGPT+F KDLE + G
Sbjct  80   GFQSRGPQANPLAQVLDALGESVPCASYDSWMVYVPEGQFLSRIGPTDFLKDLEAFVG  137



>ref|XP_003529702.1| PREDICTED: prolycopene isomerase, chloroplastic-like [Glycine 
max]
Length=558

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            EADVVVIGSGI GLCC  LLARY++DVLVLESHD PGGAAHSFDIKGY FDSGPSLFSG 
Sbjct  36   EADVVVIGSGIGGLCCGALLARYEEDVLVLESHDQPGGAAHSFDIKGYNFDSGPSLFSGL  95

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            QSRGPQANPLAQVLDALGES+PC  YDSWMV+IPEG+FLSRIGPTEFFKDL+ YAGP
Sbjct  96   QSRGPQANPLAQVLDALGESLPCATYDSWMVHIPEGQFLSRIGPTEFFKDLQQYAGP  152



>gb|AAT77005.1| expressed protein [Oryza sativa Japonica Group]
Length=522

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSGI GLCCAGLLARY QDVLVLESHD PGGAAHSFDIKG+ FDSGPSLFS
Sbjct  73   RPEADVVVIGSGIGGLCCAGLLARYNQDVLVLESHDRPGGAAHSFDIKGFNFDSGPSLFS  132

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMVY+PEG+FLSRIGPT+F KDL+ + G
Sbjct  133  GFQSRGPQANPLAQVLDALGESVPCASYDSWMVYVPEGQFLSRIGPTDFLKDLDEFVG  190



>ref|NP_001147881.1| carotenoid isomerase 1 [Zea mays]
 gb|ACG28998.1| carotenoid isomerase 1 [Zea mays]
Length=592

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSG+ GLCCAGLLARY QDVLVLESHD PGGAAHSFDIKG+ FDSGPSLFS
Sbjct  68   RPEADVVVIGSGLGGLCCAGLLARYGQDVLVLESHDRPGGAAHSFDIKGFNFDSGPSLFS  127

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMVY+PEG+FLSRIGPTEF KDLE + G
Sbjct  128  GFQSRGPQANPLAQVLDALGESVPCASYDSWMVYVPEGQFLSRIGPTEFLKDLEMFVG  185



>ref|XP_008643620.1| PREDICTED: carotenoid isomerase 1 isoform X1 [Zea mays]
Length=592

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSG+ GLCCAGLLARY QDVLVLESHD PGGAAHSFDIKG+ FDSGPSLFS
Sbjct  68   RPEADVVVIGSGLGGLCCAGLLARYGQDVLVLESHDRPGGAAHSFDIKGFNFDSGPSLFS  127

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMVY+PEG+FLSRIGPTEF KDLE + G
Sbjct  128  GFQSRGPQANPLAQVLDALGESVPCASYDSWMVYVPEGQFLSRIGPTEFLKDLEMFVG  185



>gb|AFW67016.1| hypothetical protein ZEAMMB73_444741 [Zea mays]
Length=604

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSG+ GLCCAGLLARY QDVLVLESHD PGGAAHSFDIKG+ FDSGPSLFS
Sbjct  80   RPEADVVVIGSGLGGLCCAGLLARYGQDVLVLESHDRPGGAAHSFDIKGFNFDSGPSLFS  139

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMVY+PEG+FLSRIGPTEF KDLE + G
Sbjct  140  GFQSRGPQANPLAQVLDALGESVPCASYDSWMVYVPEGQFLSRIGPTEFLKDLEMFVG  197



>gb|EAY92526.1| hypothetical protein OsI_14265 [Oryza sativa Indica Group]
Length=597

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSGI GLCCAGLLARY QDVLVLESHD PGGAAHSFDIKG+ FDSGPSLFS
Sbjct  73   RPEADVVVIGSGIGGLCCAGLLARYNQDVLVLESHDRPGGAAHSFDIKGFNFDSGPSLFS  132

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMVY+PEG+FLSRIGPT+F KDL+ + G
Sbjct  133  GFQSRGPQANPLAQVLDALGESVPCASYDSWMVYVPEGQFLSRIGPTDFLKDLDEFVG  190



>gb|EMS50943.1| hypothetical protein TRIUR3_05726 [Triticum urartu]
Length=359

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSG+ GLCCAGLLARY QDV+VLESHD PGGAAHSFD+KG+ FDSGPSLFS
Sbjct  63   RPEADVVVIGSGLGGLCCAGLLARYGQDVVVLESHDRPGGAAHSFDVKGFHFDSGPSLFS  122

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMV++PEG+F SRIGPT+F KDLE Y G
Sbjct  123  GFQSRGPQANPLAQVLDALGESVPCASYDSWMVHVPEGQFESRIGPTDFLKDLETYVG  180



>ref|NP_001051855.1| Os03g0841900 [Oryza sativa Japonica Group]
 gb|ABF99817.1| FAD dependent oxidoreductase family protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABF99818.1| FAD dependent oxidoreductase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13769.1| Os03g0841900 [Oryza sativa Japonica Group]
 gb|EAZ29253.1| hypothetical protein OsJ_13317 [Oryza sativa Japonica Group]
Length=597

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSGI GLCCAGLLARY QDVLVLESHD PGGAAHSFDIKG+ FDSGPSLFS
Sbjct  73   RPEADVVVIGSGIGGLCCAGLLARYNQDVLVLESHDRPGGAAHSFDIKGFNFDSGPSLFS  132

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMVY+PEG+FLSRIGPT+F KDL+ + G
Sbjct  133  GFQSRGPQANPLAQVLDALGESVPCASYDSWMVYVPEGQFLSRIGPTDFLKDLDEFVG  190



>ref|XP_007153908.1| hypothetical protein PHAVU_003G075100g [Phaseolus vulgaris]
 gb|ESW25902.1| hypothetical protein PHAVU_003G075100g [Phaseolus vulgaris]
Length=559

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            EADV+VIGSGI GLCC  LLARY++DVLV+ESHD PGGAAHSFD+KG+KFDSGPSLFSG 
Sbjct  37   EADVIVIGSGIGGLCCGALLARYEEDVLVVESHDQPGGAAHSFDVKGFKFDSGPSLFSGL  96

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            QSRGPQANPLAQVLDALGE++PC  YDSWMV+IPEG+FLSRIGPTEFFKDL+ YAGP
Sbjct  97   QSRGPQANPLAQVLDALGETLPCVTYDSWMVHIPEGQFLSRIGPTEFFKDLQQYAGP  153



>ref|XP_002463545.1| hypothetical protein SORBIDRAFT_01g001750 [Sorghum bicolor]
 gb|EER90543.1| hypothetical protein SORBIDRAFT_01g001750 [Sorghum bicolor]
Length=594

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSG+ GLCCAGLLARY QDVLVLESHD PGGAAHSFDIKG+ FDSGPSLFS
Sbjct  70   RPEADVVVIGSGLGGLCCAGLLARYGQDVLVLESHDRPGGAAHSFDIKGFSFDSGPSLFS  129

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALG+S+PC  YDSWMVY+PEG+FLSRIGPTEF KDLE + G
Sbjct  130  GFQSRGPQANPLAQVLDALGQSVPCASYDSWMVYVPEGQFLSRIGPTEFLKDLEMFVG  187



>ref|XP_004981104.1| PREDICTED: prolycopene isomerase 1, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004981105.1| PREDICTED: prolycopene isomerase 1, chloroplastic-like isoform 
X2 [Setaria italica]
 ref|XP_004981106.1| PREDICTED: prolycopene isomerase 1, chloroplastic-like isoform 
X3 [Setaria italica]
Length=599

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSG+ GLCCAGLLARY QDVLVLESHD PGGAAHSFDIKG+ FDSGPSLFS
Sbjct  75   RPEADVVVIGSGLGGLCCAGLLARYGQDVLVLESHDRPGGAAHSFDIKGFNFDSGPSLFS  134

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMV++PEG+FLSRIGPTEF KDLE + G
Sbjct  135  GFQSRGPQANPLAQVLDALGESVPCASYDSWMVHVPEGQFLSRIGPTEFLKDLETFVG  192



>emb|CDO97627.1| unnamed protein product [Coffea canephora]
Length=600

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 140/165 (85%), Gaps = 12/165 (7%)
 Frame = +2

Query  80   NNRRRRP-TLSPRNSATGVGEASSSVSSNGYPSTSK------QPFPGKPEADVVVIGSGI  238
               R+RP +L+PR+S++     S+S SSN YPS+S       +PF GK EADVVV+GSGI
Sbjct  34   KTTRKRPFSLAPRSSSS-----SNSTSSNAYPSSSTAVIDPPKPFSGKAEADVVVVGSGI  88

Query  239  AGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLA  418
             GLCCAGLLARY QDVLVLESHD+PGGAAHSF+IKGYKFDSGPSLFSGFQSRGPQANPLA
Sbjct  89   GGLCCAGLLARYGQDVLVLESHDLPGGAAHSFEIKGYKFDSGPSLFSGFQSRGPQANPLA  148

Query  419  QVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            QVLDALGESIPC  YDSWMVY+PEGEFLSRIGPTEFF+DLE +AG
Sbjct  149  QVLDALGESIPCATYDSWMVYVPEGEFLSRIGPTEFFEDLEKFAG  193



>ref|XP_009789453.1| PREDICTED: prolycopene isomerase, chloroplastic [Nicotiana sylvestris]
Length=571

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 136/169 (80%), Gaps = 12/169 (7%)
 Frame = +2

Query  50   SPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIG  229
            SP+  FRS+  +R    T+  RN          S +SNGYPS++     GKPEAD++VIG
Sbjct  9    SPLLNFRSTKRSR----TVLARNEV--------SATSNGYPSSTLTSKQGKPEADIIVIG  56

Query  230  SGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQAN  409
            SGI GLCC GLLARY QDVLVLESHDV GGAAHSFDIKGYKFDSGPSLFSGFQSRGPQAN
Sbjct  57   SGIGGLCCGGLLARYGQDVLVLESHDVAGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQAN  116

Query  410  PLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            PLAQVLDALGESIPC  YDSWMVY+PEGEFLSRIGPTEFFKDLE YAGP
Sbjct  117  PLAQVLDALGESIPCANYDSWMVYVPEGEFLSRIGPTEFFKDLEKYAGP  165



>gb|AIL48302.1| carotenoid isomerase [Nicotiana tabacum]
Length=571

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 136/169 (80%), Gaps = 12/169 (7%)
 Frame = +2

Query  50   SPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIG  229
            SP+  FRS+  +R    T+  RN          S +SNGYPS++     GKPEAD++VIG
Sbjct  9    SPLLNFRSTKRSR----TVLARNEV--------SATSNGYPSSTLTSKQGKPEADIIVIG  56

Query  230  SGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQAN  409
            SGI GLCC GLLARY QDVLVLESHDV GGAAHSFDIKGYKFDSGPSLFSGFQSRGPQAN
Sbjct  57   SGIGGLCCGGLLARYGQDVLVLESHDVAGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQAN  116

Query  410  PLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            PLAQVLDALGESIPC  YDSWMVY+PEGEFLSRIGPTEFFKDLE YAGP
Sbjct  117  PLAQVLDALGESIPCANYDSWMVYVPEGEFLSRIGPTEFFKDLEKYAGP  165



>dbj|BAJ88249.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=586

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSG+ GLCCAGLLARY QDV+VLESHD PGGAAHSFD+KG+ FDSGPSLFS
Sbjct  62   RPEADVVVIGSGLGGLCCAGLLARYGQDVVVLESHDRPGGAAHSFDVKGFHFDSGPSLFS  121

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMV++PEG+F SRIGPT+F KDLE Y G
Sbjct  122  GFQSRGPQANPLAQVLDALGESVPCASYDSWMVHVPEGQFESRIGPTDFLKDLETYVG  179



>dbj|BAJ94941.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=586

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSG+ GLCCAGLLARY QDV+VLESHD PGGAAHSFD+KG+ FDSGPSLFS
Sbjct  62   RPEADVVVIGSGLGGLCCAGLLARYGQDVVVLESHDRPGGAAHSFDVKGFHFDSGPSLFS  121

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMV++PEG+F SRIGPT+F KDLE Y G
Sbjct  122  GFQSRGPQANPLAQVLDALGESVPCASYDSWMVHVPEGQFESRIGPTDFLKDLETYVG  179



>ref|XP_009621121.1| PREDICTED: prolycopene isomerase 1, chloroplastic [Nicotiana 
tomentosiformis]
Length=571

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 137/169 (81%), Gaps = 12/169 (7%)
 Frame = +2

Query  50   SPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIG  229
            SP+  FRS+   +R R  LS RN          S +SNGYPS++     GKPEAD++VIG
Sbjct  9    SPLFNFRST---KRSRTVLS-RNEV--------SATSNGYPSSTLTSKQGKPEADIIVIG  56

Query  230  SGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQAN  409
            SGI GLCC GLLARY QDVLVLESHDV GGAAHSFDIKGYKFDSGPSLFSGFQSRGPQAN
Sbjct  57   SGIGGLCCGGLLARYGQDVLVLESHDVAGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQAN  116

Query  410  PLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            PLAQVLDALGESIPC  YDSWMVY+PEGEFLSRIGPT+FFKDLE YAGP
Sbjct  117  PLAQVLDALGESIPCANYDSWMVYVPEGEFLSRIGPTDFFKDLEKYAGP  165



>ref|XP_003559165.1| PREDICTED: prolycopene isomerase, chloroplastic [Brachypodium 
distachyon]
 ref|XP_010236012.1| PREDICTED: prolycopene isomerase, chloroplastic [Brachypodium 
distachyon]
Length=597

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 6/141 (4%)
 Frame = +2

Query  149  SVSSNGYPSTSKQP--FPG----KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDV  310
            +V+++  P+    P   PG    + EADVVVIGSG+ GLCCAGLLARY QDVLVLESHD 
Sbjct  50   AVAADEIPADPSSPVDLPGVAAERAEADVVVIGSGLGGLCCAGLLARYGQDVLVLESHDR  109

Query  311  PGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPE  490
             GGAAHSFD+KG+ FDSGPSLFSGFQSRGPQANPLAQVLDALGES+PC  YDSWMV++PE
Sbjct  110  AGGAAHSFDVKGFHFDSGPSLFSGFQSRGPQANPLAQVLDALGESVPCASYDSWMVHVPE  169

Query  491  GEFLSRIGPTEFFKDLENYAG  553
            G+FLSRIGPT+F KDLE Y G
Sbjct  170  GQFLSRIGPTDFLKDLETYVG  190



>gb|KEH32763.1| All-trans-retinol 13,14-reductase [Medicago truncatula]
Length=579

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 116/163 (71%), Gaps = 21/163 (13%)
 Frame = +2

Query  68   RSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGL  247
             S  N R R+  +  RNS+  V E                      E DV+VIGSGI GL
Sbjct  32   HSHSNGRIRKGGVVVRNSSNKVDET---------------------ETDVIVIGSGIGGL  70

Query  248  CCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVL  427
             CA LLARY+QDV+V ESHD  GGAAHSFD+KGYKFDSGPSLFSG QSRGPQANPLAQVL
Sbjct  71   SCAALLARYEQDVVVFESHDHAGGAAHSFDVKGYKFDSGPSLFSGLQSRGPQANPLAQVL  130

Query  428  DALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            DALGES+PC  YDSWMV++PE +FLSRIGPTEF KDL NYAGP
Sbjct  131  DALGESVPCATYDSWMVHVPEADFLSRIGPTEFLKDLHNYAGP  173



>ref|XP_002526437.1| All-trans-retinol 13,14-reductase precursor, putative [Ricinus 
communis]
 gb|EEF35932.1| All-trans-retinol 13,14-reductase precursor, putative [Ricinus 
communis]
Length=585

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 145/185 (78%), Gaps = 8/185 (4%)
 Frame = +2

Query  8    MASAGVATFLPKFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNG--YPSTS  181
            MA +   +F+P+ PS  S  +    N R+  T+  R+S    G AS   SSNG      S
Sbjct  1    MALSVSPSFIPQCPSLFSTSKKRSINYRK--TVMARSSN---GNASVP-SSNGTLLVDDS  54

Query  182  KQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDS  361
            K  F GK EAD++VIGSGI GLCC GLLARYQQDVLVLESHD+PGGAAHSF+IKGYKFDS
Sbjct  55   KTSFKGKAEADIIVIGSGIGGLCCGGLLARYQQDVLVLESHDLPGGAAHSFEIKGYKFDS  114

Query  362  GPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLE  541
            GPSLFSGFQSRGPQANPLAQVLDALGES+PC KYDSWMVY+PEGEFLSRIGPTEF+KDLE
Sbjct  115  GPSLFSGFQSRGPQANPLAQVLDALGESLPCVKYDSWMVYVPEGEFLSRIGPTEFYKDLE  174

Query  542  NYAGP  556
             YAGP
Sbjct  175  TYAGP  179



>gb|EMT16764.1| Putative all-trans-retinol 13,14-reductase [Aegilops tauschii]
Length=355

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +PEADVVVIGSG+ GLCCAGLLARY QDV+VLESHD PGGAAHSFD+KG+ FDSGPSLFS
Sbjct  28   RPEADVVVIGSGLGGLCCAGLLARYGQDVVVLESHDRPGGAAHSFDVKGFHFDSGPSLFS  87

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFK  532
            GFQSRGPQANPLAQVLDALGES+PC  YDSWMV++PEG+F SRIGPT+F K
Sbjct  88   GFQSRGPQANPLAQVLDALGESVPCASYDSWMVHVPEGQFESRIGPTDFLK  138



>ref|XP_006431586.1| hypothetical protein CICLE_v10000689mg [Citrus clementina]
 gb|ESR44826.1| hypothetical protein CICLE_v10000689mg [Citrus clementina]
Length=580

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 128/157 (82%), Gaps = 8/157 (5%)
 Frame = +2

Query  104  LSPRNSATGVGEASSSVSSNGYPSTS--------KQPFPGKPEADVVVIGSGIAGLCCAG  259
            L P   ++ V ++  + SSNG  ++S        K  FPGKPEAD+VVIGSGI GLCC G
Sbjct  16   LPPNFKSSTVRKSVLARSSNGQDASSRGSLLLQEKNSFPGKPEADIVVIGSGIGGLCCGG  75

Query  260  LLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALG  439
            LLARY Q+VLVLESHD PGGAAHSF IK Y+FDSGPSLFSGFQSRGPQANPLAQVLDALG
Sbjct  76   LLARYGQEVLVLESHDQPGGAAHSFKIKDYEFDSGPSLFSGFQSRGPQANPLAQVLDALG  135

Query  440  ESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            ES+PC KYDSWMVYIPEGEFLSRIGPTEF+KDLE YA
Sbjct  136  ESLPCAKYDSWMVYIPEGEFLSRIGPTEFYKDLEKYA  172



>ref|XP_006492556.1| PREDICTED: prolycopene isomerase, chloroplastic-like isoform 
X2 [Citrus sinensis]
Length=580

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 128/157 (82%), Gaps = 8/157 (5%)
 Frame = +2

Query  104  LSPRNSATGVGEASSSVSSNGYPSTS--------KQPFPGKPEADVVVIGSGIAGLCCAG  259
            L P   ++ V ++  + SSNG  ++S        K  FPGKPEAD+VVIGSGI GLCC G
Sbjct  16   LPPNFKSSTVRKSVLARSSNGQDASSRGSLLLQEKNSFPGKPEADIVVIGSGIGGLCCGG  75

Query  260  LLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALG  439
            LLARY Q+VLVLESHD PGGAAHSF IK Y+FDSGPSLFSGFQSRGPQANPLAQVLDALG
Sbjct  76   LLARYGQEVLVLESHDQPGGAAHSFKIKDYEFDSGPSLFSGFQSRGPQANPLAQVLDALG  135

Query  440  ESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            ES+PC KYDSWMVYIPEGEFLSRIGPTEF+KDLE YA
Sbjct  136  ESLPCAKYDSWMVYIPEGEFLSRIGPTEFYKDLEKYA  172



>ref|XP_006858582.1| hypothetical protein AMTR_s00071p00187330 [Amborella trichopoda]
 gb|ERN20049.1| hypothetical protein AMTR_s00071p00187330 [Amborella trichopoda]
Length=576

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 128/156 (82%), Gaps = 7/156 (4%)
 Frame = +2

Query  83   NRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCAGL  262
             RR++P L+ RN+       +  V  NG P++ +  FPGK EADVVVIGSGI GLCC GL
Sbjct  20   KRRKKPILA-RNTI------AQEVLPNGSPASLEDLFPGKKEADVVVIGSGIGGLCCGGL  72

Query  263  LARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGE  442
            LARY QDVLVLESHD PGGAAHSF++K YKFDSGPSLFSGFQSRGPQANPLAQVLDALGE
Sbjct  73   LARYGQDVLVLESHDRPGGAAHSFEVKDYKFDSGPSLFSGFQSRGPQANPLAQVLDALGE  132

Query  443  SIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            S+P   YDSWMVY+PEG+FL+RIGPTEFFKDLE YA
Sbjct  133  SVPSASYDSWMVYLPEGDFLTRIGPTEFFKDLEKYA  168



>ref|XP_006492555.1| PREDICTED: prolycopene isomerase, chloroplastic-like isoform 
X1 [Citrus sinensis]
Length=598

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 128/157 (82%), Gaps = 8/157 (5%)
 Frame = +2

Query  104  LSPRNSATGVGEASSSVSSNGYPSTS--------KQPFPGKPEADVVVIGSGIAGLCCAG  259
            L P   ++ V ++  + SSNG  ++S        K  FPGKPEAD+VVIGSGI GLCC G
Sbjct  16   LPPNFKSSTVRKSVLARSSNGQDASSRGSLLLQEKNSFPGKPEADIVVIGSGIGGLCCGG  75

Query  260  LLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALG  439
            LLARY Q+VLVLESHD PGGAAHSF IK Y+FDSGPSLFSGFQSRGPQANPLAQVLDALG
Sbjct  76   LLARYGQEVLVLESHDQPGGAAHSFKIKDYEFDSGPSLFSGFQSRGPQANPLAQVLDALG  135

Query  440  ESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
            ES+PC KYDSWMVYIPEGEFLSRIGPTEF+KDLE YA
Sbjct  136  ESLPCAKYDSWMVYIPEGEFLSRIGPTEFYKDLEKYA  172



>ref|XP_004499377.1| PREDICTED: prolycopene isomerase, chloroplastic-like [Cicer arietinum]
Length=573

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 102/119 (86%), Gaps = 1/119 (1%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKG-YKFDSGPSLF  376
            K EADV+VIGSGI GL CA LLARY+QDVLVLESHD PGGAAH FD+KG YKFDSGPSLF
Sbjct  47   KSEADVIVIGSGIGGLSCAALLARYEQDVLVLESHDHPGGAAHCFDVKGGYKFDSGPSLF  106

Query  377  SGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            SG  SRGPQANPL QVLDALGES+PC  YDSWMVY+PE +FLSRIGPTEF  DL+ Y G
Sbjct  107  SGLNSRGPQANPLGQVLDALGESVPCATYDSWMVYLPEADFLSRIGPTEFLNDLDKYGG  165



>ref|XP_001759083.1| predicted protein [Physcomitrella patens]
 gb|EDQ76152.1| predicted protein [Physcomitrella patens]
Length=609

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 124/169 (73%), Gaps = 10/169 (6%)
 Frame = +2

Query  50   SPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIG  229
            SP+ K R   +N RR   +S    A  + E +  V+          P   K EAD+V+IG
Sbjct  45   SPLRKGRRFESNARR---ISRGVVAAMIEEKAPGVAI-------PDPEAEKVEADIVIIG  94

Query  230  SGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQAN  409
            SG+ GLCC GLLARY QDVLVLESHD+PGGAAHSFDIKGY FDSGPSLFSG  SRGPQAN
Sbjct  95   SGVGGLCCGGLLARYGQDVLVLESHDIPGGAAHSFDIKGYHFDSGPSLFSGLSSRGPQAN  154

Query  410  PLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            PLAQVLDALGE + C +Y+SWMV++PEG+FLSRIGPTEF+KDL   AGP
Sbjct  155  PLAQVLDALGEPVDCVQYNSWMVHVPEGQFLSRIGPTEFYKDLLQVAGP  203



>ref|XP_002991682.1| hypothetical protein SELMODRAFT_186234 [Selaginella moellendorffii]
 gb|EFJ07253.1| hypothetical protein SELMODRAFT_186234 [Selaginella moellendorffii]
Length=546

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +2

Query  173  STSKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYK  352
            +  ++   GK  AD VVIGSGI GL C GLLARY +DV+VLESH + GGAAHSF I GY+
Sbjct  13   TIDRKGLRGKAGADYVVIGSGIGGLSCGGLLARYGEDVVVLESHTLAGGAAHSFQIGGYR  72

Query  353  FDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFK  532
            FDSGPSLFSG  S+GPQANPLAQVLDALGE + C KYDSWMV++P+G FLS IGP+ F +
Sbjct  73   FDSGPSLFSGLSSKGPQANPLAQVLDALGERVECAKYDSWMVHLPQGSFLSEIGPSHFPQ  132

Query  533  DLENYAG  553
             LE Y G
Sbjct  133  VLEKYGG  139



>ref|XP_002991056.1| hypothetical protein SELMODRAFT_229587 [Selaginella moellendorffii]
 gb|EFJ07864.1| hypothetical protein SELMODRAFT_229587 [Selaginella moellendorffii]
Length=546

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +2

Query  173  STSKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYK  352
            +  ++   GK  AD VVIGSGI GL C GLLARY +DV+VLESH + GGAAHSF + GY+
Sbjct  13   TIDRKGLRGKAGADYVVIGSGIGGLSCGGLLARYGEDVVVLESHTLAGGAAHSFQVGGYR  72

Query  353  FDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFK  532
            FDSGPSLFSG  S+GPQANPLAQVLDALGE + C KYDSWMV++P+G FLS IGP+ F +
Sbjct  73   FDSGPSLFSGLSSKGPQANPLAQVLDALGERVECAKYDSWMVHLPQGSFLSEIGPSHFPQ  132

Query  533  DLENYAG  553
             LE Y G
Sbjct  133  VLEKYGG  139



>ref|WP_041033797.1| carotene isomerase [Tolypothrix campylonemoides]
 gb|KIJ79292.1| carotene isomerase [Tolypothrix campylonemoides VB511288]
Length=517

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = +2

Query  197  GKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLF  376
            G  + DV+VIGSGI GL CA LLARY  DV V ESH +PGGAAH+F+  G+KFDSGPSL+
Sbjct  3    GDKQTDVIVIGSGIGGLSCAALLARYGFDVRVCESHSIPGGAAHAFERDGFKFDSGPSLY  62

Query  377  SGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            SG  S  P ANPL QVLDA+GE +PC  YD+W   +PEG+F + +G  +F + L+ + G
Sbjct  63   SGL-SYSPSANPLRQVLDAIGEELPCVTYDTWGCCLPEGDFDTSVGADQFCEVLKQFRG  120



>ref|WP_015203615.1| monooxygenase FAD-binding protein [Crinalium epipsammum]
 gb|AFZ13501.1| monooxygenase FAD-binding protein [Crinalium epipsammum PCC 9333]
Length=511

 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            +VVVIGSGI GL CA +LARY  DV V+ESH + GGAAH+F+  GYKFDSGPSL+SG  S
Sbjct  5    EVVVIGSGIGGLSCAAILARYGIDVTVVESHSIAGGAAHAFERNGYKFDSGPSLYSGL-S  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              P  NPL QVLDA+GE +PC  YD+W  Y+PEG+F +++G  +F + L+   G
Sbjct  64   YTPSPNPLRQVLDAIGEDLPCITYDTWDCYLPEGDFAAKVGAEQFCEVLQKLRG  117



>ref|XP_001695939.1| hypothetical protein CHLREDRAFT_130438 [Chlamydomonas reinhardtii]
 gb|EDP01276.1| predicted protein [Chlamydomonas reinhardtii]
Length=558

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E DVVVIGSGI GLCCAGLLA+Y   V V ESH + GGAAH+++  GY F+SGPSL+SG 
Sbjct  45   ETDVVVIGSGIGGLCCAGLLAKYGYKVTVCESHYIAGGAAHAWERDGYHFESGPSLYSGM  104

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
              RG +ANPL  VL ALG  +   +Y++W V +PEG FL+RIG   F + L+   GP
Sbjct  105  AGRGKEANPLGHVLQALGVELDLIRYNTWNVVVPEGTFLTRIGNDNFVEVLKQIRGP  161



>ref|XP_002959487.1| hypothetical protein VOLCADRAFT_84931 [Volvox carteri f. nagariensis]
 gb|EFJ39448.1| hypothetical protein VOLCADRAFT_84931 [Volvox carteri f. nagariensis]
Length=569

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 90/140 (64%), Gaps = 0/140 (0%)
 Frame = +2

Query  137  EASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPG  316
            +ASS+ S    P           E D+VVIGSGI GLCCAG+LA+Y   V V ESH +PG
Sbjct  28   QASSTASKPAPPRLQLTGDARSHETDIVVIGSGIGGLCCAGMLAKYGYKVTVCESHSIPG  87

Query  317  GAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGE  496
            GAAH++   G+ F+SGPSL+SG   RG +ANPL  VL ALG  +   +Y++W V +PEG 
Sbjct  88   GAAHAWVRDGFHFESGPSLYSGMAGRGKEANPLGHVLTALGVDLDLIRYNTWNVVVPEGT  147

Query  497  FLSRIGPTEFFKDLENYAGP  556
            FL+RIG   F++ L+   GP
Sbjct  148  FLTRIGNDNFYEVLKQIRGP  167



>ref|WP_015217623.1| monooxygenase FAD-binding protein [Anabaena cylindrica]
 gb|AFZ61012.1| monooxygenase FAD-binding protein [Anabaena cylindrica PCC 7122]
Length=512

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            +VVVIGSGI GL CA LLARY  DV VLESH + GGAAH+F+  GYKF+SGPSL+SG  S
Sbjct  5    EVVVIGSGIGGLSCAALLARYGIDVTVLESHSIAGGAAHAFERNGYKFESGPSLYSGL-S  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              P  NPL QVLDA+GE +PC  YD+W  Y+PEG F +++G  +F + L+   G
Sbjct  64   YTPSPNPLRQVLDAIGEDLPCVNYDTWGCYLPEGYFDAQVGADQFCEILQKLRG  117



>ref|WP_006509127.1| phytoene dehydrogenase-like oxidoreductase [Xenococcus sp. PCC 
7305]
 gb|ELS03780.1| phytoene dehydrogenase-like oxidoreductase [Xenococcus sp. PCC 
7305]
Length=513

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 82/118 (69%), Gaps = 1/118 (1%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            K   +V+VIGSGI GLCCA LLA+Y  +VLV ESH +PGGAAHSF+ KGYKFDSGPSL+S
Sbjct  2    KQSIEVIVIGSGIGGLCCAALLAKYGLNVLVCESHSIPGGAAHSFERKGYKFDSGPSLYS  61

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            G  S  P  NPL QVLDA+ E +    YD+W   +PEG+F + +G  +F   L+   G
Sbjct  62   GM-SYSPSTNPLKQVLDAIAEDVTWVNYDTWGCLLPEGDFNTVVGAEDFCTVLQRLRG  118



>ref|WP_016948830.1| carotene isomerase [Anabaena sp. PCC 7108]
Length=511

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            +VVVIGSGI GL CA LLARY  DV V+ESH + GGAAH+F+  GYKF+SGPSL+SG  S
Sbjct  5    EVVVIGSGIGGLSCAALLARYGIDVTVVESHSIAGGAAHAFERNGYKFESGPSLYSGL-S  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              P  NPL QVLDA+GE +PC  YD+W  Y+PEG F +++G  +F + L+   G
Sbjct  64   YTPSPNPLRQVLDAIGEDLPCVNYDTWGCYLPEGYFDAQVGADQFCEILQQLRG  117



>ref|WP_012409194.1| carotene isomerase [Nostoc punctiforme]
 gb|ACC81200.1| amine oxidase [Nostoc punctiforme PCC 73102]
Length=513

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            D+VVIGSGI GL CA LLARY  DV+V ESH + GGAAH F+  G+KFDSGPSL+SG  S
Sbjct  5    DIVVIGSGIGGLSCAALLARYGFDVIVCESHSIAGGAAHGFERNGFKFDSGPSLYSGL-S  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              P ANPL QVLDA+G  +PC  YD+W   +PEG+F + +G  +F + L  + G
Sbjct  64   YSPSANPLRQVLDAIGSELPCVTYDTWGCCLPEGDFDTAVGAEQFCEVLMKFCG  117



>ref|WP_011614184.1| carotene isomerase [Trichodesmium erythraeum]
 gb|ABG53890.1| FAD dependent oxidoreductase [Trichodesmium erythraeum IMS101]
Length=515

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + DV+VIGSGI GL CA LLA Y  DV+V ESH + GGAAHSF+ +G+KFDSGPSL SG 
Sbjct  3    QTDVIVIGSGIGGLSCAALLAHYGFDVVVCESHSIAGGAAHSFERQGFKFDSGPSLHSGL  62

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              R P  NPLAQVLDA+GES+PC  Y +W   +PEG F + +G  +F   L+   G
Sbjct  63   SYR-PSTNPLAQVLDAIGESVPCVTYKTWGCCLPEGNFNTSVGADQFCDVLQKLRG  117



>ref|WP_026082529.1| carotene isomerase [Mastigocladopsis repens]
Length=513

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = +2

Query  218  VVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRG  397
            ++IGSGI GL CA LLARY  DV V ESH +PGGAAH+F+  G+KFDSGPSL+SG  S  
Sbjct  1    MIIGSGIGGLSCAALLARYGFDVTVCESHSIPGGAAHAFERNGFKFDSGPSLYSGL-SYS  59

Query  398  PQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            P ANPL QVLDA+GE +PC  Y++W   +PEG+F + +GP +F + L+ + G
Sbjct  60   PSANPLRQVLDAIGEELPCVTYNTWGCCLPEGDFDTSVGPDQFCEVLKRFRG  111



>ref|WP_015080764.1| carotene isomerase-like protein [Anabaena sp. 90]
 gb|AFW95616.1| carotene isomerase-like protein [Anabaena sp. 90]
Length=511

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            +VVVIGSGI GL CA LLARY  DV V+ESH + GGAAH+F+  GYKF+SGPSL+SG  S
Sbjct  5    EVVVIGSGIGGLSCAALLARYGIDVTVVESHSIAGGAAHAFERNGYKFESGPSLYSGL-S  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              P  NPL QVLDA+GE +PC  Y++W  Y+PEG F +++G  +F + L+   G
Sbjct  64   YTPSPNPLRQVLDAIGEDLPCVNYNTWGCYLPEGYFDAQVGADQFCEILQQLRG  117



>ref|WP_015149455.1| phytoene dehydrogenase-like oxidoreductase [Oscillatoria acuminata]
 gb|AFY82822.1| phytoene dehydrogenase-like oxidoreductase [Oscillatoria acuminata 
PCC 6304]
Length=528

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = +2

Query  170  PSTSKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGY  349
            P  S  P  G+   DV+VIGSGI GLCCA LLA+Y   V V ESH + GGAAHSF   GY
Sbjct  7    PFDSVTPPSGEELTDVLVIGSGIGGLCCAALLAQYGFAVTVCESHSIAGGAAHSFSRNGY  66

Query  350  KFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFF  529
             FDSGPSL SG  S  P A+PL QVLD +GES+PC  YD+W  Y+PEGE    +G   F 
Sbjct  67   TFDSGPSLHSGL-SDSPSAHPLKQVLDIIGESVPCLTYDTWGCYLPEGELKIAVGADPFC  125

Query  530  KDLENYAG  553
            + L+   G
Sbjct  126  EVLQELRG  133



>ref|WP_017660356.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=508

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + D+VVIGSGI GL C  LLARY  DV V ESH +PGGAAHSF   G+KFDSGPSLFSG 
Sbjct  2    QTDIVVIGSGIGGLSCGALLARYGFDVTVCESHAIPGGAAHSFTRNGFKFDSGPSLFSGL  61

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
                P  NPL  VLDA+GE++PC  YD+W   +PEG+F S IG  +F   L    G
Sbjct  62   SY--PSTNPLRHVLDAIGETVPCATYDAWGCRLPEGDFKSAIGSDDFSYVLRKLRG  115



>ref|WP_015153671.1| all-trans-retinol 13,14-reductase [Chroococcidiopsis thermalis]
 gb|AFY87123.1| All-trans-retinol 13,14-reductase [Chroococcidiopsis thermalis 
PCC 7203]
Length=509

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E DV+VIGSGI GL CA +LARY  DV+V ES+  PGGAAH F+  G+KFDSGPSL+SG 
Sbjct  2    ETDVIVIGSGIGGLSCAAILARYGFDVVVCESYSTPGGAAHGFERNGFKFDSGPSLYSGL  61

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P  NPL QVLDA+GE +PC  YD+W   +PEG+F + +G  +F   L    G
Sbjct  62   -SYSPSPNPLRQVLDAIGEDLPCVNYDTWGCCLPEGDFDTTVGADQFCDVLARLRG  116



>ref|WP_009554715.1| phytoene dehydrogenase-like oxidoreductase [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ70262.1| phytoene dehydrogenase-like oxidoreductase [Oscillatoriales cyanobacterium 
JSC-12]
Length=515

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSGI GLCCA LLA+Y   V+V ESH +PGGAAHSF   G+ FDSGPSL+SG  S
Sbjct  8    DVVIIGSGIGGLCCAALLAQYGFRVIVCESHSIPGGAAHSFKRNGFIFDSGPSLYSGL-S  66

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              P  NPL QVLD +G ++PC  YD W   +PEG+F + +G  +F + LE   G
Sbjct  67   YSPSPNPLRQVLDIVGAALPCVTYDVWNCCLPEGDFKTSVGADQFCEILERLRG  120



>ref|XP_002505778.1| amine oxidase [Micromonas sp. RCC299]
 gb|ACO67036.1| amine oxidase [Micromonas sp. RCC299]
Length=545

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + +VVVIG+GI GLC   LLA+Y + V V+E+HDVPGGAAHS+   G+ F+SGPSL+SG 
Sbjct  13   DTEVVVIGAGIGGLCAGALLAKYGKKVTVVEAHDVPGGAAHSWHRDGFTFESGPSLYSGM  72

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENY  547
             SR P  NP  QVL AL E + C  Y++WM ++PEG FL+ +G  +F   LE Y
Sbjct  73   -SRWPTTNPCGQVLHALDEPLECVYYNTWMCHLPEGSFLTEVGNDQFIDVLEKY  125



>ref|WP_026086372.1| carotene isomerase [Fischerella thermalis]
Length=515

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
            AD+VVIGSGI GL CA LLARY  DV+V ESH + GGAAH+F+  G+KFDSGPSL+SG  
Sbjct  4    ADIVVIGSGIGGLSCAALLARYGFDVIVCESHSIAGGAAHAFERHGFKFDSGPSLYSGL-  62

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            S  P ANPL QVLDA+ E +    YD+W   +PEG+F + +G  +FF+ L    G
Sbjct  63   SYKPSANPLRQVLDAIAEDLTWVTYDTWGCCLPEGDFDTTVGDDQFFEVLSQLRG  117



>ref|WP_009457913.1| carotene isomerase [Fischerella sp. JSC-11]
 gb|EHC11560.1| All-trans-retinol 13,14-reductase [Fischerella sp. JSC-11]
Length=515

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
            AD+VVIGSGI GL CA LLARY  DV+V ESH + GGAAH+F+  G+KFDSGPSL+SG  
Sbjct  4    ADIVVIGSGIGGLSCAALLARYGFDVIVCESHSIAGGAAHAFERHGFKFDSGPSLYSGL-  62

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            S  P ANPL QVLDA+ E +    YD+W   +PEG+F + +G  +FF+ L    G
Sbjct  63   SYKPSANPLRQVLDAIAEDLTWVTYDTWGCCLPEGDFDTTVGDDQFFEVLSQLRG  117



>ref|WP_015191061.1| All-trans-retinol 13,14-reductase [Gloeocapsa sp. PCC 7428]
 gb|AFZ33194.1| All-trans-retinol 13,14-reductase [Gloeocapsa sp. PCC 7428]
Length=519

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + DV+VIGSGI GL CA LLARY   V V ESH +PGGAAH+F+ +G+KFDSGPSL+SG 
Sbjct  8    DTDVIVIGSGIGGLSCAALLARYGFAVTVCESHSIPGGAAHAFERQGFKFDSGPSLYSGL  67

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P  NPL QVLDA+ E +PC  YD+W   +PEG+F + +G  +F + L    G
Sbjct  68   -SYSPSPNPLRQVLDAIAEELPCANYDTWGCCLPEGDFDTTVGAEQFCEVLARLRG  122



>ref|WP_006528965.1| phytoene dehydrogenase-like oxidoreductase [Gloeocapsa sp. PCC 
73106]
 gb|ELR98164.1| phytoene dehydrogenase-like oxidoreductase [Gloeocapsa sp. PCC 
73106]
Length=510

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSG+ GLCC  LLARY   V V ESH +PGGAAHSF+  G+KFDSGPSL+SG  S
Sbjct  5    DVVIIGSGVGGLCCGALLARYGYGVTVCESHSLPGGAAHSFERNGFKFDSGPSLYSGL-S  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              P ANPL QVLDA+GE +    Y+SW  Y+PEG F + +G  +F + L    G
Sbjct  64   YSPSANPLRQVLDAIGEDLNWVNYNSWGCYLPEGNFDAEVGSKQFEEVLLKLRG  117



>ref|WP_035115521.1| carotene isomerase, partial [Fischerella sp. PCC 9339]
Length=511

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
             ADVVVIGSGI GL CA LLARY  DV+V ESH + GGAAH+F+  G+KFDSGPSL+SG 
Sbjct  3    NADVVVIGSGIGGLSCAALLARYGFDVIVCESHAIAGGAAHTFERHGFKFDSGPSLYSGL  62

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P ANPL QVLDA+ E +    YD+W  ++PEG F + +G  +F + L    G
Sbjct  63   -SYTPSANPLRQVLDAIAEDVDWVTYDTWGCWLPEGNFDTTVGADQFCEVLSRLRG  117



>emb|CBJ27057.1| Amine oxidase carotenoid isomerase-like protein [Ectocarpus siliculosus]
Length=538

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 99/184 (54%), Gaps = 11/184 (6%)
 Frame = +2

Query  5    SMASAGVATFLPKFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSK  184
            ++  A V  F    P P+    +  +N R R   + R      GE  +    N       
Sbjct  15   TLWWAAVDAFFAPTPRPLVGLEAQDDNTRIRTLTTDRR-----GERITRTRCNAAAVGGA  69

Query  185  QPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSG  364
            +      EA+VVVIGSGIAGLC A LL+ Y + V+V ESH  PGG AH F   GYKFDSG
Sbjct  70   EE-----EAEVVVIGSGIAGLCTAALLSSYGKKVVVCESHTQPGGCAHGFHRSGYKFDSG  124

Query  365  PSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLEN  544
            PSLFSG  S  P  NPL  VL+A+GE +    YD+W V +P+G F + +GP  F + +  
Sbjct  125  PSLFSGM-SISPTPNPLKHVLNAIGEDVEWLTYDTWGVSLPQGYFDNAVGPEPFRETISR  183

Query  545  YAGP  556
            + GP
Sbjct  184  FGGP  187



>ref|WP_044452026.1| carotene isomerase [Mastigocladus laminosus]
 gb|KIY10657.1| carotene isomerase [Mastigocladus laminosus UU774]
Length=519

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
             ADVVVIGSGI GL CA LLARY  DV+V ESH + GGAAH+F+  G+KFDSGPSL+SG 
Sbjct  3    NADVVVIGSGIGGLSCAALLARYGFDVIVCESHAIAGGAAHTFERHGFKFDSGPSLYSGL  62

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P ANPL QVLDA+ E +    YD+W  ++PEG F + +G  +F + L    G
Sbjct  63   -SYTPSANPLRQVLDAIAEDVDWVTYDTWGCWLPEGNFDTTVGADQFCEVLSRLRG  117



>ref|WP_015139375.1| phytoene dehydrogenase-like oxidoreductase [Nostoc sp. PCC 7524]
 gb|AFY48940.1| phytoene dehydrogenase-like oxidoreductase [Nostoc sp. PCC 7524]
Length=510

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DV+VIGSGI GL CA LLARY  +V V ESH + GGAAHSF+ +G+KFDSGPSL+SG  S
Sbjct  3    DVIVIGSGIGGLSCAALLARYGLEVTVCESHSIAGGAAHSFERQGFKFDSGPSLYSGL-S  61

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              P  NPL QVLDA+G  +PC  YD+W   +PEG+F + +G  +F + L    G
Sbjct  62   YSPSVNPLRQVLDAIGVDLPCVNYDTWGCCLPEGDFDTSVGGDQFCEVLARLRG  115



>gb|KIE10162.1| carotene isomerase [Tolypothrix bouteillei VB521301]
Length=525

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E DV+VIGSGI GL CA LLA+Y  DV+V ESH +PGGAAHSF+  GYKFDSGPSL+SG 
Sbjct  6    ETDVIVIGSGIGGLSCASLLAKYGFDVVVCESHSIPGGAAHSFERNGYKFDSGPSLYSGL  65

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P +NPL QVL+A+GE++    YD+W   +PEG+F + +G  +F + L    G
Sbjct  66   -SYNPSSNPLKQVLNAIGENLNFVTYDTWGCCLPEGDFDTSVGGEQFCEVLLRLRG  120



>ref|XP_005847243.1| hypothetical protein CHLNCDRAFT_35537 [Chlorella variabilis]
 gb|EFN55141.1| hypothetical protein CHLNCDRAFT_35537 [Chlorella variabilis]
Length=608

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 82/126 (65%), Gaps = 6/126 (5%)
 Frame = +2

Query  197  GKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKG------YKFD  358
            G  E DVVVIGSGI GL CAGLLA+Y   V+V ESHDVPGGAAH++ ++       Y F+
Sbjct  85   GAEEVDVVVIGSGIGGLSCAGLLAKYGLKVVVCESHDVPGGAAHTWTVRAPGGEGLYHFE  144

Query  359  SGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
            SGPSL+S    RG  ANPLA VL AL E +    Y +W V +PEG FL+ +G ++F   L
Sbjct  145  SGPSLYSDMAGRGRGANPLAHVLQALDEPLDLLPYRTWNVVLPEGSFLTEVGASQFCDVL  204

Query  539  ENYAGP  556
            E   GP
Sbjct  205  EQVRGP  210



>ref|XP_001753084.1| predicted protein [Physcomitrella patens]
 gb|EDQ82125.1| predicted protein [Physcomitrella patens]
Length=609

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 97/153 (63%), Gaps = 9/153 (6%)
 Frame = +2

Query  41   KFPSPVSKFRSSGNNRRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVV  220
            KFP  +S  R    NR   P L  R + +G     +++S++G  S      P  P+ DVV
Sbjct  42   KFPQ-LSTSRRERRNRHCCPRLI-RAAVSG-----NAISTSG-ASRKLSDTPEIPKTDVV  93

Query  221  VIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGP  400
            VIG+GI GLCCA LLA+Y   V+V ESHD+ GGA H+F+ +G++FDSGPS  +G   + P
Sbjct  94   VIGAGIGGLCCAALLAKYGYKVVVCESHDIAGGAGHAFERQGFQFDSGPSFHAGLSIK-P  152

Query  401  QANPLAQVLDALGESIPCTKYDSWMVYIPEGEF  499
              NPL QVLDA+GE + C +Y +W+ Y+PEG F
Sbjct  153  SINPLKQVLDAIGEKVECVQYKNWIGYLPEGTF  185



>ref|WP_015176099.1| FAD dependent oxidoreductase [Oscillatoria nigro-viridis]
 gb|AFZ06804.1| FAD dependent oxidoreductase [Oscillatoria nigro-viridis PCC 
7112]
Length=519

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 82/116 (71%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + +++V GSGI GL CA +LARY  DV+V ESH + GGAAH F+  G++FDSGPSL+SG 
Sbjct  8    DTEIIVAGSGIGGLTCAAMLARYGFDVVVCESHSIAGGAAHGFERDGFRFDSGPSLYSGL  67

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P ANPL QVLDA+GE +PC  YD+W   +PEG+F + +G ++F + L    G
Sbjct  68   -SYSPSANPLRQVLDAIGEKLPCITYDTWGCCLPEGDFDTSVGASQFGEVLAQLRG  122



>ref|WP_016865505.1| carotene isomerase [Fischerella muscicola]
Length=515

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
            ADVVVIGSGI GL CA LLARY  DV+V ESH + GGAAH+F+  G+KFDSGPSL+SG  
Sbjct  4    ADVVVIGSGIGGLSCAALLARYGFDVIVYESHSIAGGAAHAFERHGFKFDSGPSLYSGL-  62

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            S  P ANPL QVLDA+ E +    YD+W   +PEG+F + +G  +F + L    G
Sbjct  63   SYKPSANPLRQVLDAIAEDLTWVTYDTWGCCLPEGDFDTTVGADQFCEVLSQLRG  117



>ref|WP_008179114.1| carotene isomerase [Moorea producens]
 gb|EGJ34925.1| phytoene dehydrogenase family protein [Moorea producens 3L]
Length=513

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E D+VVIGSGI GLCCA LLARY  +V V ESH +PGGAAH+F+  G+KFDSGPSL+SG 
Sbjct  4    ETDIVVIGSGIGGLCCASLLARYGFNVTVCESHSIPGGAAHAFERNGFKFDSGPSLYSGL  63

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P +NPL Q+LDA+GE +    Y +W   +PEG+F + +G  +F + L    G
Sbjct  64   -SYSPSSNPLRQLLDAIGEDLSWETYKTWGCRLPEGDFDTSVGADQFCEVLARLRG  118



>ref|WP_016873948.1| carotene isomerase [Chlorogloeopsis fritschii]
Length=516

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVVVIGSGI GL CA +LARY  DV V ESH +PGGAAH F+  G+KFDSGPSL+SG  S
Sbjct  8    DVVVIGSGIGGLSCAAILARYGFDVTVCESHSLPGGAAHGFERNGFKFDSGPSLYSGL-S  66

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              P ANPL QVLDA+ E I    YD+W   +PEG+F +++G  +F + L +  G
Sbjct  67   YKPSANPLRQVLDAITEDIAWATYDTWGCCLPEGDFDTKVGADQFCEVLAHLRG  120



>ref|WP_012307380.1| carotene isomerase [Synechococcus sp. PCC 7002]
 gb|ACA99757.1| FAD dependent oxidoreductase [Synechococcus sp. PCC 7002]
Length=513

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            +V+VIGSGI GLCCAGLLARY  DVLVLESH + GGAAHSF  +GY FDSGPSL+SG  S
Sbjct  6    EVIVIGSGIGGLCCAGLLARYGYDVLVLESHAIAGGAAHSFTRQGYHFDSGPSLYSGL-S  64

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
              P  NPL QVLD L E      YD+W V++PEG F + +G   F + L
Sbjct  65   YSPSPNPLRQVLDLLEEDCQWLTYDAWGVHLPEGYFRAAVGADGFCEML  113



>ref|WP_019505392.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=510

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            K  ADVV+IGSG+ GLCCA LLA+Y   V+V ESH +PGGAAHSF+  GYKFDSGPSL+S
Sbjct  4    KQSADVVIIGSGVGGLCCAALLAKYGYRVIVCESHSIPGGAAHSFERDGYKFDSGPSLYS  63

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            G  S  P  NPL QVLD + E +    YD W   +PEG+F + +G   F + L    G
Sbjct  64   GLSS-SPSNNPLRQVLDLIEEDVEWINYDVWGCRLPEGDFNAFVGADHFCEILSKLRG  120



>ref|WP_030007520.1| carotene isomerase [Synechococcus sp. NKBG042902]
Length=513

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            +V+VIGSGI GLCCAGLLARY  DVLVLESH + GGAAHSF  +GY FDSGPSL+SG  S
Sbjct  6    EVIVIGSGIGGLCCAGLLARYGYDVLVLESHAIAGGAAHSFTRQGYHFDSGPSLYSGL-S  64

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
              P  NPL QVLD L E      YD+W V++PEG F + +G   F + L
Sbjct  65   YSPSPNPLRQVLDLLEEDCQWLTYDAWGVHLPEGYFRAAVGADGFCEML  113



>ref|XP_005644377.1| FAD/NAD(P)-binding domain-containing protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19833.1| FAD/NAD(P)-binding domain-containing protein [Coccomyxa subellipsoidea 
C-169]
Length=581

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 96/153 (63%), Gaps = 4/153 (3%)
 Frame = +2

Query  86   RRRRPTLSPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCAGLL  265
            +RR+ +   + SA  + EA+++    G      Q      + +VV+IGSG+ GLCCA +L
Sbjct  40   QRRKSSAYCKASARTLDEAATT----GALGPESQQRSRSHKTEVVIIGSGLGGLCCAAML  95

Query  266  ARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGES  445
            A+Y   V V ESH +PGGAAH++   GY F+SGPSL+SG  +RG  ANP+A VL A+ E 
Sbjct  96   AKYGVKVTVCESHSIPGGAAHAWVQDGYHFESGPSLYSGMAARGRAANPIAHVLQAIDEP  155

Query  446  IPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLEN  544
            +    Y+ W V +PEG+F++++G +EF   L+ 
Sbjct  156  LDLLTYNKWNVLLPEGDFMTKVGGSEFEDVLQQ  188



>ref|WP_039715953.1| carotene isomerase [Scytonema millei]
 gb|KIF18429.1| carotene isomerase [Scytonema millei VB511283]
Length=508

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + DV+VIGSGI GL CA  LARY  DV+V ES+  PGGAAH F+  G++FDSGPSL+SG 
Sbjct  2    KTDVIVIGSGIGGLSCAATLARYGFDVVVCESYSTPGGAAHGFERNGFQFDSGPSLYSGL  61

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P  NPL QVLDA+GE +PC  YD+W   +PEG+F + +G  +F   L    G
Sbjct  62   -SYSPSPNPLRQVLDAIGEDLPCVNYDTWGCCLPEGDFDTTVGADQFCDVLARLRG  116



>ref|WP_006455402.1| carotene isomerase [Synechococcus sp. PCC 7335]
 gb|EDX85648.1| FAD dependent oxidoreductase, putative [Synechococcus sp. PCC 
7335]
Length=513

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 1/115 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSGI GLCCA LLA Y + V V ESH + GGAAH F+  G++FDSGPSL+SG  S
Sbjct  7    DVVIIGSGIGGLCCAALLAHYGKKVTVCESHTLIGGAAHGFERDGHRFDSGPSLYSGL-S  65

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
              P  NPL QVLD +GE I    YD+W   +PEG+F + +G  +F + L+   GP
Sbjct  66   ESPSPNPLRQVLDIIGEDIAWANYDTWGCRLPEGDFDTSVGADQFCEVLQRLRGP  120



>ref|WP_036481718.1| carotene isomerase [Myxosarcina sp. GI1]
Length=514

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
            ADVV+IGSG+ GLCC  LLA+Y   V+V ESH + GGAAHSF+  GYKFDSGPSL+SG  
Sbjct  7    ADVVIIGSGVGGLCCGALLAKYGFKVIVCESHAIAGGAAHSFERDGYKFDSGPSLYSGM-  65

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            SR P  NPL QVLD L E I    YD W   +PE +F + IG   F + L    G
Sbjct  66   SRSPSNNPLRQVLDVLDEDIEWVNYDVWGCRLPEADFDAYIGANHFTETLAKLRG  120



>ref|WP_018397277.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=515

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
            ++V+VIGSGI GLC A LLA+   +V + ESH +PGGAAH F+ +G+KFDSGPSL+SG  
Sbjct  7    SEVIVIGSGIGGLCSAALLAQAGLEVTLCESHSIPGGAAHGFERQGFKFDSGPSLYSGL-  65

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            S  P  NPL QVLD LGE +PC  YD+W   +PEG+F + +G  +F   L    GP
Sbjct  66   SYSPSPNPLRQVLDLLGEDLPCVNYDTWGCCLPEGDFKTAVGGDQFCDVLAELRGP  121



>ref|WP_036003690.1| carotene isomerase [Leptolyngbya sp. JSC-1]
Length=511

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 2/116 (2%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + DV+VIGSGI GL CA LLA+Y   V V ESH + GGAAH F+  G+KFDSGPSL+SG 
Sbjct  2    QTDVIVIGSGIGGLSCAALLAQYGFKVTVCESHSIAGGAAHGFEQNGFKFDSGPSLYSGL  61

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P  NPL QVLDA+GE +PC  Y +W   +PEG+F + +G  +F   L+   G
Sbjct  62   SS--PSPNPLRQVLDAIGEEVPCLTYKTWGCRLPEGDFDTSVGADQFCDVLQRLRG  115



>gb|KIJ84051.1| carotene isomerase [Scytonema tolypothrichoides VB-61278]
Length=516

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 86/119 (72%), Gaps = 1/119 (1%)
 Frame = +2

Query  197  GKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLF  376
            G+ E D ++IGSGI GL CA LLARY  DV V ESH +PGGAAH+F+  G+KFDSGPSL+
Sbjct  3    GQKETDFIIIGSGIGGLSCAALLARYGFDVTVCESHSIPGGAAHAFERDGFKFDSGPSLY  62

Query  377  SGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            SG  S  P ANPL QVLDA+GE +PC  YD+W  Y+PEG F + +G  +F + L+ + G
Sbjct  63   SGL-SYSPSANPLKQVLDAIGEELPCVTYDTWGCYLPEGYFDTSVGADQFCEVLKQFRG  120



>ref|XP_005647775.1| amine oxidase [Coccomyxa subellipsoidea C-169]
 gb|EIE23231.1| amine oxidase [Coccomyxa subellipsoidea C-169]
Length=541

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 85/144 (59%), Gaps = 6/144 (4%)
 Frame = +2

Query  143  SSSVSSNGYPST-SKQPFPGKPE----ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHD  307
            S  +SS G   T +KQP P   +     D V+IGSGI GLCCA LLA+Y   V V ESH 
Sbjct  21   SKMLSSLGLKDTYAKQPTPSGRDRSHTTDYVIIGSGIGGLCCAALLAKYGYSVTVCESHY  80

Query  308  VPGGAAHSFDIKGYKFDSGPSLFSGFQSR-GPQANPLAQVLDALGESIPCTKYDSWMVYI  484
              GGAAHSF+++GY+FD+GPS F+G     G   NPL QVLDA+GES+ C  YD W+ Y 
Sbjct  81   HAGGAAHSFEVQGYQFDAGPSFFAGLSGEAGGSPNPLKQVLDAVGESVECAVYDRWVTYT  140

Query  485  PEGEFLSRIGPTEFFKDLENYAGP  556
            PE  F +      +   +    GP
Sbjct  141  PEATFQTVCNAERYAATILEQGGP  164



>ref|WP_035984241.1| carotene isomerase [Leptolyngbya sp. KIOST-1]
Length=514

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 78/115 (68%), Gaps = 3/115 (3%)
 Frame = +2

Query  215  VVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSR  394
            ++VIGSGI GLCC  LLARY   V V ESH +PGGAAH F+ +GY FDSGPSL+SG   R
Sbjct  7    MLVIGSGIGGLCCGALLARYGYRVTVCESHTIPGGAAHGFERQGYTFDSGPSLYSGMSYR  66

Query  395  GPQANPLAQVLDALGE--SIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            G   NPL  VLDA+GE  SI    YD+W V IPEG+F + IG  +F + L+   G
Sbjct  67   G-STNPLHHVLDAIGEGDSITWANYDTWGVRIPEGDFDTTIGNDQFAEVLQTLRG  120



>ref|WP_015172075.1| FAD dependent oxidoreductase [Geitlerinema sp. PCC 7407]
 gb|AFY66509.1| FAD dependent oxidoreductase [Geitlerinema sp. PCC 7407]
Length=512

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E DV+VIGSGI GLCC  LLARY  +V V ESH + GGAAH F+ +G++FDSGPSL+SG 
Sbjct  3    ETDVIVIGSGIGGLCCGALLARYGFEVTVCESHSLAGGAAHGFEREGFRFDSGPSLYSGL  62

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P  NPL QVLDAL E +    YD+W   +PEG+F + +G  +F + L    G
Sbjct  63   -SYSPSPNPLRQVLDALDEDLAWITYDTWGCCLPEGDFETSVGADQFCEVLRRLRG  117



>ref|WP_028951594.1| carotene isomerase [Synechococcus sp. CC9616]
Length=510

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + DVVVIGSGI GLCCAGL AR  ++VLVLE+H  PGGAAH F+  GY+F+SGPSL+SG 
Sbjct  4    KVDVVVIGSGIGGLCCAGLCARAGKEVLVLEAHSQPGGAAHGFERDGYQFESGPSLWSGL  63

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
             S  P  NPLAQ+L AL + +P  +Y  W V +PEG+    +G  +F   + +  GP
Sbjct  64   -SGWPTTNPLAQILRALDQPLPVIRYSDWDVLLPEGQLRVGVGSQDFEAVVRDLRGP  119



>ref|WP_038543926.1| carotene isomerase [Synechococcus sp. KORDI-100]
 gb|AII42923.1| carotene isomerase [Synechococcus sp. KORDI-100]
Length=510

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 80/117 (68%), Gaps = 1/117 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + DVVVIGSGI GLCCAGL AR  ++VLVLE+H  PGGAAH F+  GY+F+SGPSL+SG 
Sbjct  4    KVDVVVIGSGIGGLCCAGLCARAGKEVLVLEAHSQPGGAAHGFERNGYQFESGPSLWSGL  63

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
             S  P  NPLAQ+L AL + +P  +Y  W V +PEG+    +G  +F   + +  GP
Sbjct  64   -SGWPTTNPLAQILRALDQPLPVIRYSDWDVLLPEGQLRVGVGSHDFEAVVRDLRGP  119



>ref|WP_017285762.1| hypothetical protein [Leptolyngbya boryana]
Length=508

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 1/115 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
             D +VIGSGI GL CAG+LA+Y  DVLV ESH + GG AHSF+  G+KFDSGPSL+SG  
Sbjct  11   VDAIVIGSGIGGLSCAGILAKYGYDVLVCESHAIAGGTAHSFERNGFKFDSGPSLYSGM-  69

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            S  P  NPL QVLDA+ E I    YD+W   +PEG F +++G  +F + L+   G
Sbjct  70   SYSPSPNPLRQVLDAIDEDIEWLNYDTWGCCLPEGAFDTQVGAEQFCEVLQQLRG  124



>ref|WP_011364848.1| carotene isomerase [Synechococcus sp. CC9605]
 gb|ABB35639.1| conserved hypothetical protein [Synechococcus sp. CC9605]
Length=511

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            + + DV+VIGSGI GLC AGL AR  ++VLVLE+H  PGGAAH F  +GY F+SGPSL+S
Sbjct  3    RSDVDVLVIGSGIGGLCAAGLCARAGREVLVLEAHHQPGGAAHGFQRQGYHFESGPSLWS  62

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            G   R P +NPLAQVL ALG+S+    Y SW V +PEG+    +G  +F   + +  GP
Sbjct  63   GL-GRWPSSNPLAQVLRALGQSVEVIPYRSWDVLLPEGDLRIAVGHDDFEAVVRSLRGP  120



>ref|XP_002179244.1| carotenoid isomerase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49067.1| carotenoid isomerase [Phaeodactylum tricornutum CCAP 1055/1]
Length=598

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 91/152 (60%), Gaps = 14/152 (9%)
 Frame = +2

Query  107  SPRNSATGVGEASSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDV  286
            + R+  T +  A SSV SN  P           EADVVVIGSG+AGL CA LLA   + V
Sbjct  34   TTRHQFTRIYAAVSSVPSNSIPD----------EADVVVIGSGLAGLSCAALLAHCGKRV  83

Query  287  LVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF-QSRGPQANPLAQVLDALGESIPCTKY  463
            +VLESHD PGGAAH ++ +G+ F+SGPSL+SGF   R P  NPL  +    GE      Y
Sbjct  84   VVLESHDAPGGAAHGWERRGFHFESGPSLYSGFAMERSP--NPLKNIFQITGEDCEWITY  141

Query  464  DSWMVYIPEG-EFLSRIGPTEFFKDLENYAGP  556
            D W   +P+G +F ++IGP EF   LE+  GP
Sbjct  142  DRWGTVMPDGTKFAAKIGPEEFQDVLESQGGP  173



>ref|WP_006853196.1| carotene isomerase [Synechococcus sp. WH 8016]
 gb|EHA64013.1| amine oxidase [Synechococcus sp. WH 8016]
Length=510

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
            A+V+VIGSGI GLCCAGL AR  +DVLVLE+H  PGGAAH F+ +GY F+SGPSL+SG  
Sbjct  5    AEVIVIGSGIGGLCCAGLTARAGKDVLVLEAHRQPGGAAHGFERQGYHFESGPSLWSGL-  63

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            SR P +NPL Q+L AL + +    Y  W V  PEG     +G   F + +E   GP
Sbjct  64   SRWPSSNPLTQILRALDQPLDVVSYKDWDVLFPEGHLRVGVGGDGFERVVERLRGP  119



>ref|WP_039724644.1| MULTISPECIES: carotene isomerase [Oscillatoriophycideae]
 gb|KIF20488.1| carotene isomerase [Aphanocapsa montana BDHKU210001]
 gb|KIF42298.1| carotene isomerase [Lyngbya confervoides BDU141951]
Length=512

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + DVVVIGSGI GL CA LLARY  DV+V ESH +PGGAAH F+  G+ FDSGPSL+SG 
Sbjct  2    KTDVVVIGSGIGGLSCAALLARYGLDVVVCESHTIPGGAAHGFERDGFTFDSGPSLYSGL  61

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              R P  NPL  V DA+GE+     YD+W   +PEG F +++G  +F + L    G
Sbjct  62   SYR-PSHNPLRHVFDAIGEAPEWHTYDTWGCCLPEGTFDTQVGADQFCEVLGELRG  116



>ref|WP_011619761.1| carotene isomerase [Synechococcus sp. CC9311]
 gb|ABI46929.1| carotenoid isomerase, putative [Synechococcus sp. CC9311]
Length=510

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
            A+V+VIGSGI GLCCAGL AR  ++VLVLE+H  PGGAAH F+  GY F+SGPSL+SG  
Sbjct  5    AEVIVIGSGIGGLCCAGLTARAGKEVLVLEAHSQPGGAAHGFERHGYHFESGPSLWSGL-  63

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            SR P +NPLAQ+L AL + +    Y  W V  PEG     +G   F + +E   GP
Sbjct  64   SRWPSSNPLAQILRALDQPLDVLTYKDWDVLFPEGHLRVGVGGDGFERVVERLRGP  119



>ref|WP_023065417.1| FAD binding domain protein [Lyngbya aestuarii]
 gb|ERT08375.1| FAD binding domain protein [Lyngbya aestuarii BL J]
Length=522

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 77/125 (62%), Gaps = 1/125 (1%)
 Frame = +2

Query  179  SKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFD  358
            S Q  P     +VVVIGSGI GL CA +LARY   V V ESH +PGGAAH F+  GY FD
Sbjct  2    SDQTSPQTQNTEVVVIGSGIGGLSCAAILARYGFAVTVCESHTIPGGAAHGFERSGYIFD  61

Query  359  SGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
            SGPSL+SG  S  P  NPL QVLDA+GE I    Y+ W   +PEG+F + +G  +F   L
Sbjct  62   SGPSLYSGM-SYSPSTNPLKQVLDAIGEEISWKTYNVWGCRLPEGDFDTSVGADQFCDVL  120

Query  539  ENYAG  553
                G
Sbjct  121  MRLRG  125



>ref|WP_009784423.1| carotene isomerase [Lyngbya sp. PCC 8106]
 gb|EAW36931.1| Amine oxidase [Lyngbya sp. PCC 8106]
Length=522

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 77/125 (62%), Gaps = 1/125 (1%)
 Frame = +2

Query  179  SKQPFPGKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFD  358
            S Q  P     +VVVIGSGI GL CA +LARY   V V ESH +PGGAAH F+  GY FD
Sbjct  2    SDQTSPQTQNTEVVVIGSGIGGLSCAAILARYGFAVTVCESHTIPGGAAHGFERDGYIFD  61

Query  359  SGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
            SGPSL+SG  S  P  NPL QVLDA+GE I    Y+ W   +PEG+F + +G  +F   L
Sbjct  62   SGPSLYSGM-SYSPSTNPLKQVLDAIGEDISWKTYNVWGCRLPEGDFDTSVGADQFCDVL  120

Query  539  ENYAG  553
                G
Sbjct  121  MRLRG  125



>ref|WP_011127626.1| carotene isomerase [Synechococcus sp. WH 8102]
 emb|CAE07276.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
Length=510

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            K   DVVVIGSGI GLCCA L AR  ++VLVLE+H  PGGAAH F  +GY+F+SGPSL+S
Sbjct  2    KDRVDVVVIGSGIGGLCCAALCARAGREVLVLEAHTQPGGAAHGFQRQGYQFESGPSLWS  61

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            G  +R P  NPLAQ+L AL + +    Y+SW V +PEGE    +G   F + + +  G
Sbjct  62   GL-ARWPSGNPLAQILRALDQPLKVIPYNSWDVLLPEGELRIPVGAAGFEQVVRDLRG  118



>ref|XP_005819484.1| hypothetical protein GUITHDRAFT_82257 [Guillardia theta CCMP2712]
 gb|EKX32504.1| hypothetical protein GUITHDRAFT_82257 [Guillardia theta CCMP2712]
Length=532

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 82/122 (67%), Gaps = 11/122 (9%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKG----YKFDSGPSLFS  379
            DV+++GSG+AGL CA +L++Y   V VLESH   GGAAHSF++KG    YKFDSGPSL+S
Sbjct  2    DVIIVGSGVAGLSCAAVLSKYGYKVRVLESHAHAGGAAHSFEMKGKSGTYKFDSGPSLYS  61

Query  380  GF-------QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
            G        +S+    NPL QVLD +GE + C +YD+W V +PEG+F + +G   F +DL
Sbjct  62   GLSVDEKTMKSQQRCVNPLKQVLDLVGEQVDCVRYDTWGVCLPEGDFPATVGAEPFAEDL  121

Query  539  EN  544
              
Sbjct  122  RR  123



>emb|CBJ28883.1| carotenoid isomerase-like protein [Ectocarpus siliculosus]
Length=657

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 73/112 (65%), Gaps = 3/112 (3%)
 Frame = +2

Query  224  IGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQ  403
            IG+GI GL CA LLA+Y  DV V ESH +PGG AHSF+  GYKFDSGPS+FSGF   GP 
Sbjct  131  IGAGIGGLTCAALLAQYGLDVTVCESHTIPGGCAHSFERDGYKFDSGPSIFSGFT--GPV  188

Query  404  ANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKD-LENYAGP  556
             NPL QVL+ L E +PC +YD W    P G F   +GP  F  D L+   GP
Sbjct  189  PNPLKQVLNVLEEELPCIRYDGWGNLTPSGYFKFDLGPDSFRDDVLKRLGGP  240



>ref|WP_006170888.1| carotene isomerase [Synechococcus sp. WH 5701]
 gb|EAQ74061.1| carotene isomerase [Synechococcus sp. WH 5701]
Length=519

 Score =   121 bits (303),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            D+VVIGSG+ GL CAGL A +  DV+VLE+HD  GGAAH F+ +G++F+SGPSL+SG   
Sbjct  9    DLVVIGSGLGGLSCAGLAALHGLDVVVLEAHDRAGGAAHGFERRGFQFESGPSLWSGL-G  67

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            R P +NPLAQVL ALGE++P   Y  W + +PEG     +GP  F   +    G
Sbjct  68   RWPSSNPLAQVLRALGETVPVATYPDWGLLLPEGSLRIGVGPEPFIATVRELRG  121



>gb|AHF64342.1| hypothetical protein Syncc8109_1998 [Synechococcus sp. WH 8109]
Length=511

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            + + DV+VIGSGI GLC AGL AR  ++VLVLE+H  PGGAAH F  +GY F+SGPSL+S
Sbjct  3    RSDVDVLVIGSGIGGLCAAGLCARAGREVLVLEAHYQPGGAAHGFQRQGYHFESGPSLWS  62

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            G   R P +NPLAQVL ALG+++    Y SW V +PEG+    +G  +F   + +  GP
Sbjct  63   GL-GRWPSSNPLAQVLRALGQTLEVIPYRSWDVLLPEGDLRIAVGHDDFEAVVCSLRGP  120



>ref|WP_023073297.1| carotene isomerase [Leptolyngbya sp. Heron Island J]
 gb|ESA35799.1| carotene isomerase [Leptolyngbya sp. Heron Island J]
Length=515

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
              ++VVIGSGI GLCCA LLARY  DV+V ESH + GGAAH F+  G+ FDSGPSL+SG 
Sbjct  3    RTEIVVIGSGIGGLCCAALLARYGYDVVVCESHGIAGGAAHGFNRGGFFFDSGPSLYSGL  62

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P  NPL QVLDA+ E +    Y++W   +PEG+F + +G  +F   L+   G
Sbjct  63   -SYSPSPNPLRQVLDAIEEDVSWLNYNTWGCCLPEGDFNTTVGAEQFCGVLQTLRG  117



>ref|XP_003082932.1| amine oxidase family (ISS) [Ostreococcus tauri]
Length=567

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
            +DVVVIG+GI GL  A ++A+    V VLESH+VPGGAAH++   GY F+SGPSL+SG  
Sbjct  43   SDVVVIGAGIGGLSAAAIVAKCGMSVTVLESHNVPGGAAHAWARDGYTFESGPSLYSGLG  102

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYA  550
               P  NP  Q+L A+ E + C +Y++WM ++PEG F++ +G  +F + L  Y 
Sbjct  103  D-WPTTNPCGQILHAVDEKVECVRYNTWMCHLPEGTFVTEVGNDQFLECLRTYV  155



>ref|WP_009790216.1| carotene isomerase [Synechococcus sp. BL107]
 gb|EAU72177.1| hypothetical protein BL107_15255 [Synechococcus sp. BL107]
Length=510

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            K   DV+VIGSGI GLCCAGL A+  +DVLVLE+H  PGGAAH F  +GY  +SGPSL+S
Sbjct  2    KDSVDVLVIGSGIGGLCCAGLCAKAGRDVLVLEAHHQPGGAAHGFQRQGYHLESGPSLWS  61

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            G   R P  NPLAQVL AL +S+    Y +W V +PEG+    +G   F   +    GP
Sbjct  62   GL-GRWPSNNPLAQVLRALNQSLEIVPYSTWDVLLPEGDLSVAVGNDGFEAVVGQLRGP  119



>ref|WP_038553836.1| carotene isomerase [Synechococcus sp. KORDI-52]
 gb|AII48846.1| carotene isomerase [Synechococcus sp. KORDI-52]
Length=511

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            + + DV+VIGSGI GLC AGL AR  ++VLVLE+H  PGGAAH F  +GY F+SGPSL+S
Sbjct  3    RSDVDVLVIGSGIGGLCAAGLCARAGREVLVLEAHHHPGGAAHGFQRQGYHFESGPSLWS  62

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            G   + P +NPL QVL ALG+++    Y +W V +PEG+    +G  +F   + +  GP
Sbjct  63   GL-GQWPSSNPLTQVLRALGQTVEVIPYRTWDVLLPEGDLRIAVGHDDFEAVVRSLRGP  120



>ref|WP_011819691.1| carotene isomerase [Prochlorococcus marinus]
 gb|ABM71583.1| Bacterial-type phytoene dehydrogenase [Prochlorococcus marinus 
str. MIT 9515]
Length=509

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF++KGYKF+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALAGKRVLICEAHSQPGGVAHSFNLKGYKFESGPSLWSGL-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEF  526
            R P  NPL Q+L  + E +   KY  W+V +PEG F   +G   F
Sbjct  64   RWPTTNPLGQILRLIDEKVELIKYQGWLVNVPEGNFNLEVGEEPF  108



>gb|EKV03145.1| phytoene dehydrogenase-like oxidoreductase [Leptolyngbya sp. 
PCC 7375]
Length=515

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
              ++VVIGSGI GLC A LL RY  DV+V ESH + GGAAH F+  G+ FDSGPSL+SG 
Sbjct  3    RTEIVVIGSGIGGLCUAALLGRYGYDVIVCESHSIAGGAAHGFERGGFLFDSGPSLYSGL  62

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P  NPL QVLDA+GE      YD+W   +PEG+F + +G  +F   L+   G
Sbjct  63   -SYSPSPNPLRQVLDAIGEDANWLNYDTWGCCLPEGDFDTTVGSDQFCDVLQQLRG  117



>ref|WP_012161660.1| carotene isomerase [Acaryochloris marina]
 gb|ABW26103.1| carotenoid isomerase, putative [Acaryochloris marina MBIC11017]
Length=514

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DV++IGSG  GL C  LLA+Y   VLV ESH +PGGAAH F  +GY FDSGPSLFSG  S
Sbjct  8    DVIIIGSGTGGLSCGALLAQYGLKVLVCESHTLPGGAAHGFQRQGYTFDSGPSLFSGL-S  66

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              P  NPL QVLDA+GE +    Y +W   +PEG F + +G  +F + +    G
Sbjct  67   FSPSPNPLRQVLDAIGEDLEWATYGTWGCCLPEGNFFTSVGADQFCEVVRELRG  120



>ref|WP_012796586.1| carotene isomerase [Cyanothece sp. PCC 8802]
 gb|ACV03349.1| FAD dependent oxidoreductase [Cyanothece sp. PCC 8802]
Length=512

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E D ++IGSGI GL CA LLARY   V V ESH +PGGAAHSF+  G+ FDSGPSL+SG 
Sbjct  2    ETDFIIIGSGIGGLSCAALLARYGHSVTVCESHSIPGGAAHSFERSGFVFDSGPSLYSGL  61

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P ANPL QVLD LGE +PC  YD+W   +PEG+F + +G  +F   L    G
Sbjct  62   -SYSPSANPLKQVLDILGEPLPCVTYDTWGCCLPEGDFKTTVGADQFCDVLMQLRG  116



>ref|WP_011359569.1| carotene isomerase [Synechococcus sp. CC9902]
 gb|ABB25729.1| conserved hypothetical protein [Synechococcus sp. CC9902]
Length=510

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            K   DV+VIGSGI GLCCAGL A+  +DVLVLE+H   GGAAH F  +GY  +SGPSL+S
Sbjct  2    KDSVDVLVIGSGIGGLCCAGLCAKSGRDVLVLEAHQQLGGAAHGFQRQGYHLESGPSLWS  61

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEF  526
            G   R P  NPLAQVL ALG+++    Y +W V +PEG+    +G   F
Sbjct  62   GL-GRWPSNNPLAQVLRALGQTLEVVPYSAWDVLLPEGDLSVAVGNDGF  109



>ref|WP_019480309.1| hypothetical protein, partial [Prochlorococcus sp. W11]
Length=200

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSG+ GLCC  LLA   + VL+ ESH  PGG AH+F   GYKF+SGPSL++G +S
Sbjct  5    DVVIIGSGVGGLCCGSLLASRGKKVLICESHSQPGGVAHTFTRNGYKFESGPSLWNGLES  64

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
                 +PL Q+L  L E I   KY  W V +PE EF   +G + F K ++   G
Sbjct  65   IS-NTSPLGQILYLLDEQIEVKKYKGWKVIVPEAEFDLEVGDSPFRKKIQELRG  117



>ref|WP_015117031.1| phytoene dehydrogenase-like oxidoreductase [Rivularia sp. PCC 
7116]
 gb|AFY53453.1| phytoene dehydrogenase-like oxidoreductase [Rivularia sp. PCC 
7116]
Length=507

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +2

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            L CAGLLARY   V V ESH +PGGAAHSF  KGYKFDSGPSL+SG  S  P  NPL QV
Sbjct  13   LSCAGLLARYGCKVTVCESHSIPGGAAHSFSYKGYKFDSGPSLYSGL-SYSPSNNPLRQV  71

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            LDA+GE      YD+W  ++PEG+F + +G  +F + L    G
Sbjct  72   LDAIGEDCEWANYDTWGCFLPEGDFNTSVGAEQFCEVLLRLRG  114



>ref|WP_011932712.1| carotene isomerase [Synechococcus sp. WH 7803]
 emb|CAK23230.1| Carotenoid isomerase [Synechococcus sp. WH 7803]
Length=511

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 72/116 (62%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + +V+VIGSGI GLCCA L AR   +VLVLE+H  PGGAAH F  +GY F+SGPSL+SG 
Sbjct  4    KTEVIVIGSGIGGLCCAALCARAGHEVLVLEAHGAPGGAAHGFQRQGYHFESGPSLWSGL  63

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              R P  NPLAQ+L AL E I    Y  W V  PEG     +G   F + ++   G
Sbjct  64   -GRWPSNNPLAQILRALDEPIEVMSYRDWDVLFPEGHLRIGVGADGFEQVVQQLRG  118



>ref|WP_025929168.1| hypothetical protein, partial [Prochlorococcus sp. scB243_496A2]
Length=226

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKTVLICEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F K ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKKTIKTLRG  117



>ref|WP_011317725.1| carotene isomerase [Anabaena variabilis]
 gb|ABA20495.1| Amine oxidase [Anabaena variabilis ATCC 29413]
Length=512

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 70/103 (68%), Gaps = 1/103 (1%)
 Frame = +2

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            L CA LLARY  DV V ESH +PGGAAH F+ +G+KFDSGPSL+SG  S  P  NPL QV
Sbjct  16   LSCAALLARYGFDVTVCESHSIPGGAAHGFERQGFKFDSGPSLYSGL-SYSPSVNPLRQV  74

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            LDA+G  +PC  YD+W   +PEG+F + +G  +F + L    G
Sbjct  75   LDAVGVDLPCVTYDTWGCCLPEGDFDAAVGAEQFCEVLGRLRG  117



>ref|WP_029976435.1| carotene isomerase, partial [Prochlorococcus sp. scB241_528N17]
Length=138

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|XP_007512741.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17341.1| predicted protein [Bathycoccus prasinos]
Length=591

 Score =   115 bits (288),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSGI GL  A LLA+Y   V  +ESH+  GGAAH +   G+ F+SGPSL++G  S
Sbjct  55   DVVIIGSGIGGLSAAALLAKYDLKVCCVESHEHAGGAAHEWKRDGFTFESGPSLYTGL-S  113

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENY  547
            + P +NPL Q+L A+ E + C +Y++W V+ PE  F++ +G  +F + LE Y
Sbjct  114  QFPTSNPLGQILHAIDEPLKCIRYNTWKVHFPEATFVTEVGNDQFIECLEKY  165



>ref|WP_006909672.1| carotene isomerase [Cyanobium sp. PCC 7001]
 gb|EDY37771.1| carotene isomerase [Cyanobium sp. PCC 7001]
Length=521

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            D++V+GSG+ GLC A + AR+   VLVLE+H   GGAAH F+ +GY+F+SGPSL+SG   
Sbjct  11   DLLVVGSGLGGLCAAAIAARHGLGVLVLEAHTSAGGAAHGFEREGYRFESGPSLWSGL-G  69

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            R P +NPLAQVL A+GES+P   Y  W + +PEG+    +G   F   +    G
Sbjct  70   RWPSSNPLAQVLRAVGESVPVATYHEWGLLLPEGDLRVGVGLDPFLAVVRELRG  123



>ref|XP_002954344.1| hypothetical protein VOLCADRAFT_64714 [Volvox carteri f. nagariensis]
 gb|EFJ44494.1| hypothetical protein VOLCADRAFT_64714 [Volvox carteri f. nagariensis]
Length=543

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E D VVIGSGI GLCCA LLA+Y   V V ESH + GGAAHSF++ GYKFD+GPS F G 
Sbjct  15   ETDFVVIGSGIGGLCCAALLAKYGYKVTVCESHYLAGGAAHSFEVAGYKFDAGPSFFLGI  74

Query  386  QSRGP----QANPLAQVLDALGESIPCTKYDSWMVYIPEG  493
               GP      NPL QVLDA+GE +   +YD W+VY P G
Sbjct  75   G--GPPGDGSPNPLKQVLDAVGERVESKQYDRWIVYPPPG  112



>ref|XP_001697619.1| hypothetical protein CHLREDRAFT_176572 [Chlamydomonas reinhardtii]
 gb|EDP00013.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=566

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 68/100 (68%), Gaps = 6/100 (6%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E D VVIGSGI GLCCA LLA+Y   V V ESH + GGAAHSF + GY+FD+GPS F G 
Sbjct  82   ETDYVVIGSGIGGLCCAALLAKYGYRVTVCESHYLAGGAAHSFSVGGYRFDAGPSFFLGI  141

Query  386  QSRGP----QANPLAQVLDALGESIPCTKYDSWMVYIPEG  493
               GP      NPL QVLDA+GES+   KYD W+VY P G
Sbjct  142  G--GPPGDGSPNPLKQVLDAVGESVETKKYDRWVVYPPGG  179



>ref|WP_009543600.1| MULTISPECIES: carotene isomerase [Cyanothece]
 gb|ACB53690.1| hypothetical protein cce_4342 [Cyanothece sp. ATCC 51142]
Length=512

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 66/103 (64%), Gaps = 1/103 (1%)
 Frame = +2

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            L CA LLA Y  DV V ESH + GGAAHSF   G+ FDSGPSL+SG  S  P  NPL QV
Sbjct  16   LSCAALLAHYGLDVTVCESHSIAGGAAHSFQRDGFIFDSGPSLYSGL-SYSPSPNPLKQV  74

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            LDA+GE +PC  YD+W  Y+PEG F + +G  +F   L    G
Sbjct  75   LDAIGEPLPCINYDTWGCYLPEGNFNTSVGADQFCDILRQLRG  117



>ref|WP_006631928.1| carotene isomerase [Microcoleus vaginatus]
 gb|EGK89243.1| FAD dependent oxidoreductase [Microcoleus vaginatus FGP-2]
Length=525

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = +2

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            L CA +LARY  +V+V ESH + GGAAH F+  G+ FDSGPSL+SG  S  P ANPL QV
Sbjct  21   LTCAAMLARYGFEVVVCESHSIAGGAAHGFERDGFSFDSGPSLYSGL-SYSPSANPLRQV  79

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            LDA+GE +PC  YD+W   +PEG+F + +G ++F + L    G
Sbjct  80   LDAIGEKLPCITYDTWGCCLPEGDFDTSVGASQFAEVLAQLRG  122



>emb|CAK27949.1| Carotenoid isomerase [Synechococcus sp. RCC307]
Length=524

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = +2

Query  215  VVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSR  394
            V+VIGSGI GLCCAGLLAR  ++V+VLE+H  PGGAAH F  K Y ++SGPSL+SG   R
Sbjct  22   VIVIGSGIGGLCCAGLLARGGKEVVVLEAHSKPGGAAHGFG-KTYHYESGPSLWSGL-GR  79

Query  395  GPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             P +NPLAQ+L ALG+ +   +Y  W V  PEG     +G  +F   ++   G
Sbjct  80   WPSSNPLAQILRALGQELEVIEYRDWDVLFPEGHLRIGVGNADFEAVVQQLRG  132



>ref|WP_008277850.1| carotene isomerase [Cyanothece sp. CCY0110]
 gb|EAZ89046.1| Amine oxidase [Cyanothece sp. CCY0110]
Length=513

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +2

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            L CA LLA Y  DV V ESH + GGAAHSF+  G+ FDSGPSL+SG  S  P  NPL QV
Sbjct  16   LSCAALLAHYGLDVTVCESHTIAGGAAHSFERDGFIFDSGPSLYSGL-SYSPSPNPLKQV  74

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            LDA+ E +PC  YD+W  Y+PEG+F + +G  +F   L++  G
Sbjct  75   LDAIDEPLPCINYDTWGCYLPEGDFNTSVGADQFCDVLKHLRG  117



>ref|WP_025914187.1| carotene isomerase [Prochlorococcus sp. scB245a_520K10]
Length=509

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSGI GLCC  +LA   + VL+ E+H+ PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIIGSGIGGLCCGSILALSGKKVLICEAHNQPGGVAHSFKKKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>ref|WP_011817833.1| carotene isomerase [Prochlorococcus marinus]
 gb|ABM69659.1| Bacterial-type phytoene dehydrogenase [Prochlorococcus marinus 
str. AS9601]
Length=509

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSGI GLCC  +LA   + VL+ E+H+ PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIIGSGIGGLCCGSILALKGKKVLICEAHNQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_016860296.1| carotene isomerase [Fischerella muscicola]
Length=518

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
            ADVVVIGSGI GL CA LLARY  DV+V ESH + GGAAH+F+  G+KFDSGPSL+SG  
Sbjct  4    ADVVVIGSGIGGLSCAALLARYGFDVIVCESHAIAGGAAHAFERHGFKFDSGPSLYSGL-  62

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            S  P ANPL QVLDA+ E +    YD+W  ++PEG+F + +G  +F + L    G
Sbjct  63   SYTPSANPLRQVLDAIAEDVTWVTYDTWGCWLPEGDFDTTVGSDQFCEVLSKLRG  117



>ref|WP_032519579.1| carotene isomerase [Prochlorococcus marinus]
 gb|KGG08208.1| Phytoene dehydrogenase [Prochlorococcus marinus str. SB]
Length=509

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIIGSGIGGLCCGSILALSGKTVLICEAHTQPGGVAHSFQRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            R P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   RWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_043736794.1| carotene isomerase [Synechococcus sp. RCC307]
Length=509

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 2/113 (2%)
 Frame = +2

Query  215  VVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSR  394
            V+VIGSGI GLCCAGLLAR  ++V+VLE+H  PGGAAH F  K Y ++SGPSL+SG   R
Sbjct  7    VIVIGSGIGGLCCAGLLARGGKEVVVLEAHSKPGGAAHGFG-KTYHYESGPSLWSGL-GR  64

Query  395  GPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             P +NPLAQ+L ALG+ +   +Y  W V  PEG     +G  +F   ++   G
Sbjct  65   WPSSNPLAQILRALGQELEVIEYRDWDVLFPEGHLRIGVGNADFEAVVQQLRG  117



>ref|XP_005847333.1| hypothetical protein CHLNCDRAFT_134505 [Chlorella variabilis]
 gb|EFN55231.1| hypothetical protein CHLNCDRAFT_134505 [Chlorella variabilis]
Length=572

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 68/102 (67%), Gaps = 4/102 (4%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E DVVVIGSGI GLC A LLARY   V V ESH   GGAAH F+ +GY FD+GPS ++G 
Sbjct  45   ETDVVVIGSGIGGLCAAALLARYGYRVTVCESHYHAGGAAHGFEAQGYSFDAGPSFYAGL  104

Query  386  QS-RGPQANPLAQVLDALGESIPCTKYDS---WMVYIPEGEF  499
                G   NPL QVLDA+GES+ C +Y     W+VY P+G F
Sbjct  105  SGPPGASTNPLKQVLDAVGESVECAQYKQARRWVVYTPDGSF  146



>ref|WP_006105444.1| carotene isomerase [Coleofasciculus chthonoplastes]
 gb|EDX71735.1| FAD dependent oxidoreductase, putative [Coleofasciculus chthonoplastes 
PCC 7420]
Length=514

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +2

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            L CA +L+RY  +V V ESH +PGGAAHSF   GY FDSGPSL+SG  S  P  NPL QV
Sbjct  16   LSCAAMLSRYGLNVTVCESHSIPGGAAHSFIRNGYTFDSGPSLYSGL-SYSPSPNPLRQV  74

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            LDA+GE +PC  YD+W   +PEG+F + +G ++F   L    G
Sbjct  75   LDAIGEELPCLTYDTWGCCLPEGDFDTSVGASQFADVLAKLRG  117



>ref|WP_026098227.1| carotene isomerase [Oscillatoria sp. PCC 10802]
Length=519

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVVVIG+GI GL CA LLARY  +V+  ESH   GGAAH+F+  GY FDSGPSL+SG  S
Sbjct  9    DVVVIGTGIGGLSCAALLARYGLEVIACESHSAAGGAAHAFERNGYIFDSGPSLYSGL-S  67

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              P +NPL  VLDA+GE +PC  YD+W  ++PEG F + +G  +F + LE   G
Sbjct  68   YCPSSNPLRHVLDAIGEKVPCATYDTWGCWLPEGNFSTAVGADQFCEVLERLRG  121



>ref|WP_040943151.1| carotene isomerase [Prochloron didemni]
Length=514

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E D++VIGSGI GL CA LLARY   V+V ESH +PGGAAH+F+ +G+ FDSGPSL+SG 
Sbjct  3    EVDIIVIGSGIGGLSCAALLARYGFKVMVCESHSIPGGAAHAFERQGFTFDSGPSLYSGL  62

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P  NPL QVLDAL   IP   YD+W  ++PEG F + +G  +F + LE   G
Sbjct  63   -STSPSNNPLRQVLDALEVDIPWVTYDTWGCHLPEGHFDTTVGAEQFCEVLERLRG  117



>ref|WP_025951419.1| hypothetical protein, partial [Prochlorococcus sp. scB243_495N4]
Length=218

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEKPFKRTIKTLRG  117



>ref|WP_025960273.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_519E23]
Length=183

 Score =   108 bits (270),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGPILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>emb|CCQ62058.1| Phytoene dehydrogenase and related proteins [Crocosphaera watsonii 
WH 0401]
Length=512

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 67/103 (65%), Gaps = 1/103 (1%)
 Frame = +2

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            L CA LLA Y  +V V ESH + GGAAHSF   G+ FDSGPSL+SG  S  P  NPL QV
Sbjct  16   LSCAALLAHYGLEVTVCESHSIAGGAAHSFQRDGFIFDSGPSLYSGL-SYSPSPNPLKQV  74

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            LDA+GE +PC  YD+W  Y+PEG F + +G  +F   L+   G
Sbjct  75   LDAIGEPLPCINYDTWGCYLPEGNFNTSVGVDQFCDILQQLQG  117



>ref|WP_007303605.1| carotene isomerase [Crocosphaera watsonii]
 gb|EAM53307.1| amine oxidase family [Crocosphaera watsonii WH 8501]
 gb|EHJ14773.1| Phytoene dehydrogenase and related protein [Crocosphaera watsonii 
WH 0003]
 emb|CCQ51111.1| Phytoene dehydrogenase and related proteins [Crocosphaera watsonii 
WH 8502]
 emb|CCQ57084.1| Phytoene dehydrogenase and related proteins [Crocosphaera watsonii 
WH 0005]
Length=512

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 67/103 (65%), Gaps = 1/103 (1%)
 Frame = +2

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            L CA LLA Y  +V V ESH + GGAAHSF   G+ FDSGPSL+SG  S  P  NPL QV
Sbjct  16   LSCAALLAHYGLEVTVCESHSIAGGAAHSFQRDGFIFDSGPSLYSGL-SYSPSPNPLKQV  74

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            LDA+GE +PC  YD+W  Y+PEG F + +G  +F   L+   G
Sbjct  75   LDAIGEPLPCINYDTWGCYLPEGNFNTSVGVDQFCDILQQLQG  117



>ref|WP_025934797.1| carotene isomerase [Prochlorococcus sp. scB245a_518A17]
Length=509

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKTVLICEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F K ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKKTIKTLRG  117



>ref|WP_025938941.1| carotene isomerase [Prochlorococcus sp. scB245a_518A6]
Length=509

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKTVLICEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F K ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKKTIKTLRG  117



>ref|WP_025965354.1| carotene isomerase [Prochlorococcus sp. scB243_496M6]
Length=509

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKTVLICEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F K ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKKTIKTLRG  117



>ref|WP_025924181.1| carotene isomerase [Prochlorococcus sp. scB243_495L20]
Length=509

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKTVLICEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F K ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKKTIKTLRG  117



>ref|WP_025894017.1| MULTISPECIES: carotene isomerase [Prochlorococcus]
Length=509

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKTVLICEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F K ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKKTIKTLRG  117



>ref|WP_032524084.1| carotene isomerase [Prochlorococcus marinus]
 gb|KGF88582.1| Phytoene dehydrogenase [Prochlorococcus marinus str. GP2]
Length=509

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKTVLMCEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F+  +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFILDVGEEPFKQTIKTLRG  117



>ref|WP_040939085.1| carotene isomerase [Prochloron didemni]
Length=514

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E D++VIGSGI GL CA LLARY   V+V ESH +PGGAAH+F+ +G+ FDSGPSL+SG 
Sbjct  3    EVDIIVIGSGIGGLSCAALLARYGFKVMVCESHSIPGGAAHAFERQGFTFDSGPSLYSGL  62

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P  NPL QVLDAL   IP   YD+W  ++PEG F + +G  +F + LE   G
Sbjct  63   -STSPSNNPLRQVLDALEVDIPWVTYDTWGCHLPEGHFDTTVGAEQFCEVLERLRG  117



>ref|WP_025935673.1| MULTISPECIES: carotene isomerase [Prochlorococcus]
Length=509

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKTVLICEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F K ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKKTIKTLRG  117



>ref|WP_007097536.1| carotene isomerase [Synechococcus sp. RS9916]
 gb|EAU73428.1| hypothetical protein RS9916_27994 [Synechococcus sp. RS9916]
Length=511

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 70/116 (60%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
              DVVVIGSGI GLCC  L AR   +VLVLE+H  PGGAAH F   GY F+SGPSL+SG 
Sbjct  5    HCDVVVIGSGIGGLCCGALTARAGHEVLVLEAHQQPGGAAHGFRRGGYHFESGPSLWSGL  64

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
              R P  NPLAQ+L AL + +    Y  W V  PEG+    +G T F   ++   G
Sbjct  65   -GRWPTNNPLAQILRALDQPLDLISYRDWDVLFPEGDLRIGVGSTGFEAVVQQLRG  119



>ref|WP_032515617.1| carotene isomerase [Prochlorococcus marinus]
 gb|KGG01793.1| Phytoene dehydrogenase [Prochlorococcus marinus str. MIT 9314]
Length=509

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKTVLICEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F K ++   G
Sbjct  64   KWPTNNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKKTIKTLRG  117



>ref|WP_011375906.1| carotene isomerase [Prochlorococcus marinus]
 gb|ABB49406.1| phytoene dehydrogenase [Prochlorococcus marinus str. MIT 9312]
 gb|KGG00823.1| Phytoene dehydrogenase [Prochlorococcus marinus str. MIT 9311]
Length=509

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSGI GLCC  +L+   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIIGSGIGGLCCGSILSLSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E I   +Y  W V +PEG F   +G   F + ++N  G
Sbjct  64   KWPTTNPLGQILKLLDEEIELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKNLRG  117



>ref|WP_025963539.1| hypothetical protein, partial [Prochlorococcus sp. scB245a_520F22]
Length=192

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F   ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKHTIKTLRG  117



>ref|WP_024546782.1| carotene isomerase [Synechococcus sp. NKBG15041c]
Length=513

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +2

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            LCCAGLLAR   DVLVLESH + GGAAHSF  +GY FDSGPSL+SG  S  P  NPL QV
Sbjct  17   LCCAGLLARSGYDVLVLESHAIAGGAAHSFTRQGYHFDSGPSLYSGL-SYSPSPNPLRQV  75

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDL  538
            LD L E  P   YD+W V++PEG F + +G   F + L
Sbjct  76   LDLLEEDCPWLTYDAWGVHLPEGYFRAAVGGDGFCEML  113



>ref|WP_025955214.1| carotene isomerase [Prochlorococcus sp. scB243_498I20]
Length=509

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIIGSGIGGLCCGSILALSGKKVLICEAHTQPGGVAHSFKRKGYAFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_010997191.1| carotene isomerase [Nostoc sp. PCC 7120]
 dbj|BAB74739.1| all3040 [Nostoc sp. PCC 7120]
Length=380

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +2

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            L CA LLARY  DV V ESH +PGGAAH F+ +G+KFDSGPSL+SG  S  P  NPL QV
Sbjct  16   LSCAALLARYGFDVTVCESHSIPGGAAHGFERQGFKFDSGPSLYSGL-SYSPSVNPLRQV  74

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            LDA+G  +P   YD+W   +PEG+F + +G  +F + L    G
Sbjct  75   LDAVGVDLPWVTYDTWGCCLPEGDFDAAVGAEQFCEVLGRLRG  117



>ref|WP_025967852.1| carotene isomerase [Prochlorococcus sp. scB245a_518I6]
Length=509

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIIGSGIGGLCCGSILALSGKKVLICEAHTQPGGVAHSFKRKGYVFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>gb|AFY27319.1| LOW QUALITY PROTEIN: phytoene dehydrogenase-like oxidoreductase 
[Cyanobium gracile PCC 6307]
Length=513

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
            +D++V+GSG+ GLC   + AR+  +VLVLE+H  PGGAAH F    ++F+SGPSL+SG  
Sbjct  2    SDLIVVGSGLGGLCAGAIAARHGLEVLVLEAHTTPGGAAHGFRRGPFQFESGPSLWSGL-  60

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
             R P  NPLAQVL A+GE++P   Y  W + +PEG     +G   F   L    GP
Sbjct  61   GRWPSTNPLAQVLRAVGETLPVATYRDWGLLLPEGALRVGVGQGPFLALLRELRGP  116



>ref|WP_025973716.1| carotene isomerase [Prochlorococcus sp. scB241_529B19]
Length=509

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCCA +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCASILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEKPFKRTIKTLRG  117



>ref|WP_011862376.1| carotene isomerase [Prochlorococcus marinus]
 gb|ABO16993.1| Bacterial-type phytoene dehydrogenase [Prochlorococcus marinus 
str. MIT 9301]
Length=509

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHTRPGGVAHSFQRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWRVIVPEGNFNLNVGEEPFKQTIKTLRG  117



>ref|WP_011378159.1| MULTISPECIES: carotene isomerase [Synechococcus]
 gb|ABB57753.1| carotene isomerase [Synechococcus elongatus PCC 7942]
 gb|AJD57759.1| carotene isomerase [Synechococcus sp. UTEX 2973]
Length=516

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +   D++VIGSG+ GLCC  L ARY  +VLVLE+HD PGGAAH F+ +G+ F+SGPSL+S
Sbjct  5    RESVDLIVIGSGLGGLCCGALAARYGLEVLVLEAHDRPGGAAHGFERRGFHFESGPSLWS  64

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            G  SR P  NPLAQVL A+GE +P   Y  W V +PEG F   +G  +F K +    GP
Sbjct  65   GL-SRWPSTNPLAQVLRAIGEEVPVLTYREWGVLLPEGTFQIGVGNADFLKTVTALRGP  122



>ref|WP_032521907.1| carotene isomerase [Prochlorococcus marinus]
 gb|KGF96366.1| Phytoene dehydrogenase [Prochlorococcus marinus str. MIT 9201]
Length=509

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG  S
Sbjct  5    DVVIIGSGIGGLCCGSILALSGKKVLICEAHTQPGGVAHSFTRHGYTFESGPSLWSGI-S  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_032514033.1| carotene isomerase [Prochlorococcus marinus]
 gb|KGF90239.1| Phytoene dehydrogenase [Prochlorococcus marinus str. MIT 9107]
 gb|KGF91264.1| Phytoene dehydrogenase [Prochlorococcus marinus str. MIT 9116]
 gb|KGF94822.1| Phytoene dehydrogenase [Prochlorococcus marinus str. MIT 9123]
Length=509

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_025931387.1| MULTISPECIES: carotene isomerase [Prochlorococcus]
Length=509

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_042849829.1| carotene isomerase [Prochlorococcus sp. MIT 0604]
 gb|AIQ94414.1| Phytoene dehydrogenase [Prochlorococcus sp. MIT 0604]
Length=509

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHTQPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_026721179.1| carotene isomerase [Fischerella sp. PCC 9431]
Length=512

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
            ADVVVIGSGI GL CA LLARY  DV+V ESH + GGAAH+F+  G+KFDSGPSL+SG  
Sbjct  4    ADVVVIGSGIGGLSCAALLARYGFDVIVCESHAIAGGAAHAFERDGFKFDSGPSLYSGL-  62

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            S  P ANPL QVLDA+ E +    YD+W   +PEG+F + +G  +F + L    G
Sbjct  63   SYTPSANPLRQVLDAIAEDLNWVTYDTWGCCLPEGDFDTTVGADQFCEVLSRLRG  117



>ref|WP_025891410.1| carotene isomerase [Prochlorococcus sp. scB241_526K3]
Length=509

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++ + G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEKPFKRTIKTFRG  117



>ref|WP_019476228.1| hypothetical protein [Prochlorococcus sp. W4]
Length=508

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV+IGSGI GLCC  LL    + VL+ ESH  PGG AH+F   GYKF+SGPSL++G +S
Sbjct  5    DVVIIGSGIGGLCCGSLLTSQGKKVLICESHTQPGGVAHTFTRNGYKFESGPSLWNGLES  64

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
                 +PL Q+L  L E I   KY  W V +PE +F   +G + F K ++   G
Sbjct  65   IS-NTSPLGQILYLLDEQIEVKKYKGWKVMVPEADFNLEVGDSPFRKKIQELRG  117



>ref|WP_015225549.1| FAD dependent oxidoreductase [Halothece sp. PCC 7418]
 gb|AFZ43673.1| FAD dependent oxidoreductase [Halothece sp. PCC 7418]
Length=510

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 69/103 (67%), Gaps = 2/103 (2%)
 Frame = +2

Query  245  LCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQV  424
            L  A LLARY   V V ESH + GGAAH+F+ +GY FDSGPSL+SG  S  P  NPL QV
Sbjct  16   LSAAALLARYGYQVTVCESHTIAGGAAHAFERQGYIFDSGPSLYSGLSS--PSPNPLRQV  73

Query  425  LDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            L+A+GE +PC +YD+W  ++PEG+F + +G  +F   L    G
Sbjct  74   LEAIGEQVPCVQYDTWGCWLPEGQFDTSVGADQFCDVLRELRG  116



>ref|WP_015230757.1| phytoene dehydrogenase-like oxidoreductase [Dactylococcopsis 
salina]
 gb|AFZ51780.1| phytoene dehydrogenase-like oxidoreductase [Dactylococcopsis 
salina PCC 8305]
Length=516

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 76/116 (66%), Gaps = 2/116 (2%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + DV++IGSGI GLC   LLARY   V V ESH +PGGAAH F+  GY FDSGPSL+SG 
Sbjct  4    DRDVIIIGSGIGGLCAGALLARYGFQVTVCESHTIPGGAAHGFERDGYLFDSGPSLYSGL  63

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             +  P ANPL QVLDA+ E + C  YD+W  ++PEG F   +G  +F + L    G
Sbjct  64   SA--PSANPLRQVLDAIEEEVTCINYDTWGCWLPEGNFNMAVGAEQFCQVLRELRG  117



>ref|WP_039752734.1| all-trans-retinol 13,14-reductase [Hassallia byssoidea]
 gb|KIF29114.1| all-trans-retinol 13,14-reductase [Hassallia byssoidea VB512170]
Length=501

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            + DV+VIGSGI GLC AGLLARY + V+V ESH + GGAAHSF  + ++FDSGPS + G 
Sbjct  3    DCDVIVIGSGIGGLCAAGLLARYGKRVIVCESHTIAGGAAHSFRRRKFEFDSGPSFYCGL  62

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVY-IPEGEF  499
             +     NPL QVLD LGES+ C  YD    Y +PEG F
Sbjct  63   -TDAQSLNPLKQVLDVLGESLLCVSYDPLGHYHLPEGTF  100



>ref|WP_025981208.1| carotene isomerase, partial [Prochlorococcus sp. scB245a_521B10]
Length=422

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + +    G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIRTLRG  117



>ref|WP_035828930.1| carotene isomerase [Cyanobium sp. CACIAM 14]
 gb|KEF43255.1| carotene isomerase [Cyanobium sp. CACIAM 14]
Length=514

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            D++V+GSG+ GLC   + AR+  +VLVLE H  PGGAAH F    + F+SGPSL+SG   
Sbjct  4    DLIVVGSGLGGLCAGAIAARHGLEVLVLEGHTTPGGAAHGFRRGPFHFESGPSLWSGL-G  62

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            R P +NPLAQVL A+GE++P   Y  W + +PEG     +G   F   L +  G
Sbjct  63   RWPSSNPLAQVLRAVGETVPVATYRDWGLLLPEGNLRVGVGQEPFLALLRDLRG  116



>ref|WP_029638271.1| all-trans-retinol 13,14-reductase [[Scytonema hofmanni] UTEX 
B 1581]
Length=505

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = +2

Query  209  ADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQ  388
             DV+VIGSGI GLC AGLLARY + V+V ESH + GGAAHSF  + ++FDSGPS + G  
Sbjct  4    CDVIVIGSGIGGLCAAGLLARYGKRVIVCESHTIAGGAAHSFRRRKFEFDSGPSFYCGL-  62

Query  389  SRGPQANPLAQVLDALGESIPCTKYDSWMVY-IPEGEFLSRIGPTEFFKDLEN  544
            +     NPL QVLD LGES+ C  YD    Y +PEG F        +  ++E 
Sbjct  63   TDAQSLNPLKQVLDVLGESLSCVSYDPLGHYHLPEGTFAVYGNIERYLHEVEK  115



>ref|WP_029983354.1| carotene isomerase, partial [Prochlorococcus sp. scB243_498F21]
Length=111

 Score =   103 bits (258),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = +2

Query  218  VVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQSRG  397
            +++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   + 
Sbjct  1    MIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-GKW  59

Query  398  PQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  60   PTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  111



>ref|WP_025933124.1| carotene isomerase [Prochlorococcus sp. scB243_498A3]
Length=509

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y SW V +PEG F   +G   F   ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKSWKVIVPEGNFNLDVGEEPFKHTIKTLRG  117



>ref|WP_025926001.1| carotene isomerase [Prochlorococcus sp. scB241_528J8]
Length=509

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF  KGY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLMCEAHSHPGGVAHSFKRKGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWKVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_025942160.1| MULTISPECIES: carotene isomerase [Prochlorococcus]
Length=509

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>ref|WP_025962208.1| carotene isomerase [Prochlorococcus sp. scB245a_521K15]
Length=509

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>ref|WP_002807618.1| carotene isomerase [Prochlorococcus marinus]
 gb|EEE40725.1| bacterial-type phytoene dehydrogenase [Prochlorococcus marinus 
str. MIT 9202]
Length=509

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>ref|WP_025929790.1| carotene isomerase [Prochlorococcus sp. scB241_528O2]
Length=509

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AH+F   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHTQPGGVAHNFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            R P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   RWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_025969653.1| carotene isomerase [Prochlorococcus sp. scB245a_520E22]
Length=509

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>ref|WP_011244678.1| carotene isomerase [Synechococcus elongatus]
 dbj|BAD80558.1| carotene isomerase [Synechococcus elongatus PCC 6301]
Length=516

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +2

Query  200  KPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFS  379
            +   D++VIGSG+ GLCC  L ARY  +VLVL++HD PGGAAH F+ +G+ F+SGPSL+S
Sbjct  5    RESVDLIVIGSGLGGLCCGALAARYGLEVLVLKAHDRPGGAAHGFERRGFHFESGPSLWS  64

Query  380  GFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAGP  556
            G  SR P  NPLAQVL A+GE +P   Y  W V +PEG F   +G  +F K +    GP
Sbjct  65   GL-SRWPSTNPLAQVLRAIGEEVPVLTYREWGVLLPEGTFQIGVGNADFLKTVTALRGP  122



>ref|WP_015181722.1| phytoene dehydrogenase-like oxidoreductase [Microcoleus sp. PCC 
7113]
 gb|AFZ17567.1| phytoene dehydrogenase-like oxidoreductase [Microcoleus sp. PCC 
7113]
Length=518

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DV+VIGSGI GL CA LLARY + VLV ESH + GGAAHSF  +G++FDSGPS + G   
Sbjct  11   DVIVIGSGIGGLTCASLLARYGKRVLVCESHAIAGGAAHSFKRRGFEFDSGPSFYCGLSD  70

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVY-IPEGEF  499
            + P  NPL QVLD LGES+    YD    Y  PE  F
Sbjct  71   QRPSLNPLRQVLDVLGESLQVVSYDPLGYYHFPEETF  107



>ref|WP_025939535.1| carotene isomerase [Prochlorococcus sp. scB245a_520B18]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEKPFKRTIKTLRG  117



>ref|WP_025970611.1| carotene isomerase [Prochlorococcus sp. scB245a_521M10]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEKPFKRTIKTLRG  117



>ref|WP_025940438.1| carotene isomerase [Prochlorococcus sp. scB245a_518K17]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEKPFKRTIKTLRG  117



>ref|WP_025906273.1| carotene isomerase [Prochlorococcus sp. scB245a_519B7]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_025974922.1| carotene isomerase [Prochlorococcus sp. scB241_529O19]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEKPFKRTIKTLRG  117



>ref|WP_032517458.1| carotene isomerase [Prochlorococcus marinus]
 gb|KGG03931.1| Phytoene dehydrogenase [Prochlorococcus marinus str. MIT 9321]
 gb|KGG05739.1| Phytoene dehydrogenase [Prochlorococcus marinus str. MIT 9322]
 gb|KGG07806.1| Phytoene dehydrogenase [Prochlorococcus marinus str. MIT 9401]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_032526665.1| carotene isomerase [Prochlorococcus marinus]
 gb|KGF97288.1| Phytoene dehydrogenase [Prochlorococcus marinus str. MIT 9302]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 70/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +L+   + VL+ E+H  PGG AHSF  +GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILSLSGKKVLICEAHSRPGGVAHSFKRRGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F K ++   G
Sbjct  64   KWPTTNPLGQILRLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKKIIKTLRG  117



>ref|WP_025974462.1| carotene isomerase [Prochlorococcus sp. scB241_529J16]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>ref|WP_025941317.1| carotene isomerase [Prochlorococcus sp. scB245a_518O7]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>ref|WP_025945032.1| MULTISPECIES: carotene isomerase [Prochlorococcus]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + +    G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIRTLRG  117



>gb|EWM24677.1| amine oxidase [Nannochloropsis gaditana]
Length=582

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 80/138 (58%), Gaps = 4/138 (3%)
 Frame = +2

Query  143  SSSVSSNGYPSTSKQPFPGKPEADVVVIGSGIAGLCCAGLL-ARYQQDVLVLESHDVPGG  319
            SS  +S   PS  K       E DVVVIGSGI GL CA L  A Y  DV V+ESH   GG
Sbjct  53   SSLFASTTAPSRLKDTL--IEEHDVVVIGSGIGGLSCASLCSATYGLDVAVVESHYHCGG  110

Query  320  AAHSFDIKGYKFDSGPSLFSGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEF  499
            AAH+F+I G+ FDSGPSLFSG  S+    NPL  V  A+ E +    Y++W V +P G F
Sbjct  111  AAHAFEIDGFIFDSGPSLFSGL-SQDASPNPLLHVFQAIDEKVDWLTYNTWGVCLPYGNF  169

Query  500  LSRIGPTEFFKDLENYAG  553
             + IGP  F   L+ Y G
Sbjct  170  AATIGPEPFRDILKTYGG  187



>ref|WP_025944427.1| carotene isomerase [Prochlorococcus sp. scB241_529C4]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>ref|WP_025967425.1| carotene isomerase [Prochlorococcus sp. scB243_498P3]
Length=509

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGRKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEKPFKRTIKTLRG  117



>ref|WP_037220472.1| carotene isomerase [Richelia intracellularis]
Length=513

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +2

Query  197  GKPEADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLF  376
            G  E DVVVIGSGI GL CA LLARY  DV+V ESH +PGGAAH F+  G+KFDSGPSL 
Sbjct  2    GVIETDVVVIGSGIGGLSCASLLARYGFDVIVCESHSIPGGAAHGFERNGFKFDSGPSL-  60

Query  377  SGFQSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
                S  P +NPL QVLDA+GE +    YD+W   +PEG+F + +G  +F + L+   G
Sbjct  61   YSGLSSSPSSNPLRQVLDAIGEDVQWATYDTWGCCLPEGDFHTSVGADQFCQVLQRLRG  119



>ref|WP_025892733.1| carotene isomerase [Prochlorococcus sp. scB241_527N11]
Length=509

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHIQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>ref|WP_025971757.1| carotene isomerase [Prochlorococcus sp. scB241_527L22]
Length=509

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKQTIKTLRG  117



>ref|WP_026723034.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=126

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DV+VIGSGI GLC A LLARY + V+V ESH + GGAAH+F  +G++FDSGPS + G   
Sbjct  16   DVIVIGSGIGGLCAAALLARYGKRVIVCESHTIAGGAAHNFRRRGFEFDSGPSFYCGLTD  75

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVY-IPEGEF  499
                 NPL QVLDA+GES+   +YD    Y  PEG  
Sbjct  76   I-QSLNPLKQVLDAIGESVAAIRYDPLGHYHFPEGTL  111



>ref|WP_025951828.1| carotene isomerase [Prochlorococcus sp. scB243_497I20]
Length=509

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFKRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NP+ Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPIGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>ref|WP_025959339.1| carotene isomerase [Prochlorococcus sp. scB241_527I9]
Length=509

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLISEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEKPFKRTIKTLRG  117



>ref|WP_025922917.1| carotene isomerase [Prochlorococcus sp. scB243_495D8]
Length=509

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALTGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F   ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKHTIKTLRG  117



>ref|WP_025890441.1| carotene isomerase [Prochlorococcus sp. scB241_526N9]
Length=509

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLLCEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F + ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKRTIKTLRG  117



>ref|WP_012599216.1| carotene isomerase [Cyanothece sp. PCC 7424]
 gb|ACK70273.1| FAD dependent oxidoreductase [Cyanothece sp. PCC 7424]
Length=512

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E D+++IGSGI GL CA LLA+Y   V V ESH +PGGAAHSF  KGY FDSGPSL+SG 
Sbjct  2    ETDIIIIGSGIGGLSCASLLAKYGFQVTVCESHSIPGGAAHSFQYKGYHFDSGPSLYSGL  61

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P  NPL QVLDA+ E +    YD+W   +PEG F + +G  +F + LE   G
Sbjct  62   -SYSPSPNPLKQVLDAIEEDLSWVTYDTWGCCLPEGNFDTSVGADQFCQVLETLRG  116



>ref|WP_016874846.1| FAD dependent oxidoreductase [Chlorogloeopsis fritschii]
Length=517

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            ++DV+VIGSGI GLC AGLLARY + V+V ESH +PGGAAH+F  +G++FDSGPS +   
Sbjct  3    DSDVIVIGSGIGGLCAAGLLARYGKRVIVCESHTIPGGAAHNFRRRGFEFDSGPSFYCDL  62

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVY-IPEGEFLSRIGPTEFFKD  535
             +     NPL QVLD LGES+   +YD    Y  PEG F +    TE ++ 
Sbjct  63   -TDAQSLNPLKQVLDVLGESLEAIRYDPLGHYHFPEGTF-AVYSNTELYRQ  111



>ref|WP_016953423.1| FAD dependent oxidoreductase [Anabaena sp. PCC 7108]
Length=500

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 67/97 (69%), Gaps = 2/97 (2%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            D++VIGSGI GLC AGLLARY + V+V ESH +PGGAAHSF  +G++FDSGPS + G  +
Sbjct  5    DILVIGSGIGGLCAAGLLARYGKRVIVCESHTIPGGAAHSFKRRGFEFDSGPSFYCGL-N  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVY-IPEGEF  499
                 NPL QVLD LGES+    YD    Y  PEG F
Sbjct  64   ESQSLNPLKQVLDVLGESLQVIPYDPLGHYHFPEGTF  100



>emb|CDN13493.1| Phytoene dehydrogenase and related proteins [Richelia intracellularis]
Length=511

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +2

Query  206  EADVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGF  385
            E DVVVIGSGI GL CA LLARY  DV+V ESH +PGGAAH F+  G+KFDSGPS     
Sbjct  3    ETDVVVIGSGIGGLSCASLLARYGFDVIVCESHSIPGGAAHGFERNGFKFDSGPS-LYSG  61

Query  386  QSRGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
             S  P +NPL QVLDA+GE +    YD+W   +PEG+F + +G  +F + L+   G
Sbjct  62   LSSSPSSNPLRQVLDAIGEDVQWATYDTWGCCLPEGDFHTSVGADQFCQVLQRLRG  117



>gb|ABE11014.1| bacterial-type phytoene dehydrogenase [uncultured Prochlorococcus 
marinus clone ASNC729]
Length=509

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 68/114 (60%), Gaps = 1/114 (1%)
 Frame = +2

Query  212  DVVVIGSGIAGLCCAGLLARYQQDVLVLESHDVPGGAAHSFDIKGYKFDSGPSLFSGFQS  391
            DVV++GSGI GLCC  +LA   + VL+ E+H  PGG AHSF   GY F+SGPSL+SG   
Sbjct  5    DVVIVGSGIGGLCCGSILALSGKKVLICEAHSQPGGVAHSFRRNGYTFESGPSLWSGI-G  63

Query  392  RGPQANPLAQVLDALGESIPCTKYDSWMVYIPEGEFLSRIGPTEFFKDLENYAG  553
            + P  NPL Q+L  L E +   +Y  W V +PEG F   +G   F   ++   G
Sbjct  64   KWPTTNPLGQILKLLDEEVELFQYKGWQVIVPEGNFNLDVGEEPFKHTIKTLRG  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800