BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L08

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAF46302.1|  cysteine proteinase precursor                          278   2e-89   Ipomoea nil [qian niu]
gb|AAQ81938.1|  cysteine proteinase precursor                           263   1e-83   Ipomoea batatas [batate]
emb|CDP07452.1|  unnamed protein product                                263   2e-83   Coffea canephora [robusta coffee]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like            261   8e-83   Nicotiana tomentosiformis
gb|AAK07731.1|  CPR2-like cysteine proteinase                           258   1e-81   Nicotiana tabacum [American tobacco]
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                    258   2e-81   Nicotiana tabacum [American tobacco]
dbj|BAG16515.1|  putative cysteine proteinase                           257   5e-81   Capsicum chinense [bonnet pepper]
gb|KJB29613.1|  hypothetical protein B456_005G110200                    251   7e-81   Gossypium raimondii
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                    256   1e-80   Nicotiana tabacum [American tobacco]
gb|AAZ32411.1|  cysteine proteinase glycinain type                      254   2e-80   Nicotiana benthamiana
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like            254   3e-80   Nicotiana sylvestris
gb|KJB29612.1|  hypothetical protein B456_005G110200                    251   7e-80   Gossypium raimondii
gb|KJB29611.1|  hypothetical protein B456_005G110200                    252   5e-79   Gossypium raimondii
ref|XP_007017672.1|  Papain family cysteine protease                    252   7e-79   
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg                251   9e-79   Erythranthe guttata [common monkey flower]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like            250   2e-78   Sesamum indicum [beniseed]
gb|AIB06025.1|  CP3                                                     249   3e-78   Hevea brasiliensis [jebe]
dbj|BAJ53178.1|  JHL18I08.12                                            249   4e-78   Jatropha curcas
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          249   7e-78   Nelumbo nucifera [Indian lotus]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg                249   7e-78   Erythranthe guttata [common monkey flower]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like            248   9e-78   Brassica rapa
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like            248   1e-77   Populus euphratica
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g             248   2e-77   
gb|KDO84721.1|  hypothetical protein CISIN_1g017548mg                   245   2e-77   Citrus sinensis [apfelsine]
gb|KHG15062.1|  Cysteinease RD19a -like protein                         247   2e-77   Gossypium arboreum [tree cotton]
emb|CDP20652.1|  unnamed protein product                                247   3e-77   Coffea canephora [robusta coffee]
gb|ABK96580.1|  unknown                                                 247   4e-77   Populus trichocarpa x Populus deltoides
ref|XP_002510469.1|  cysteine protease, putative                        246   6e-77   Ricinus communis
gb|ABK94801.1|  unknown                                                 246   8e-77   Populus trichocarpa [western balsam poplar]
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg             246   1e-76   Citrus clementina [clementine]
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                   245   1e-76   Citrus sinensis [apfelsine]
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like            245   1e-76   Citrus sinensis [apfelsine]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     245   2e-76   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     245   2e-76   Ipomoea batatas [batate]
emb|CDY34441.1|  BnaC01g21920D                                          245   2e-76   Brassica napus [oilseed rape]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          245   2e-76   Sesamum indicum [beniseed]
dbj|BAD10859.1|  cysteine protease                                      244   4e-76   Tripolium pannonicum [sea starwort]
ref|XP_007042077.1|  Papain family cysteine protease                    243   3e-75   
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like          241   5e-75   Nelumbo nucifera [Indian lotus]
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A                 241   6e-75   
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    240   1e-74   Ipomoea batatas [batate]
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor                 240   1e-74   Solanum melongena [aubergine]
gb|KJB58164.1|  hypothetical protein B456_009G197400                    240   2e-74   Gossypium raimondii
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    240   2e-74   Sesamum indicum [beniseed]
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A                 239   3e-74   Malus domestica [apple tree]
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like          239   4e-74   Nicotiana sylvestris
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         239   4e-74   Jatropha curcas
gb|EPS65881.1|  cysteine proteinase                                     238   5e-74   Genlisea aurea
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A                 238   1e-73   Pyrus x bretschneideri [bai li]
ref|XP_010105270.1|  Cysteine proteinase 15A                            237   2e-73   Morus notabilis
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    237   3e-73   Ipomoea batatas [batate]
emb|CAA78403.1|  pre-pro-cysteine proteinase                            236   3e-73   Solanum lycopersicum
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like          236   5e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          236   5e-73   Nicotiana tomentosiformis
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg             236   6e-73   Capsella rubella
gb|KJB79049.1|  hypothetical protein B456_013G033800                    231   6e-73   Gossypium raimondii
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like          236   6e-73   Eucalyptus grandis [rose gum]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    236   6e-73   Ipomoea batatas [batate]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494       236   9e-73   Fragaria vesca subsp. vesca
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494       235   1e-72   Tarenaya hassleriana [spider flower]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a               236   1e-72   Pyrus x bretschneideri [bai li]
gb|AIB06024.1|  CP2                                                     236   1e-72   Hevea brasiliensis [jebe]
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like          236   1e-72   Cucumis sativus [cucumbers]
gb|KJB79048.1|  hypothetical protein B456_013G033800                    232   1e-72   Gossypium raimondii
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg             235   1e-72   Prunus persica
gb|KJB79050.1|  hypothetical protein B456_013G033800                    232   1e-72   Gossypium raimondii
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like            235   2e-72   Fragaria vesca subsp. vesca
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like            235   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a               235   2e-72   Tarenaya hassleriana [spider flower]
ref|XP_003606999.1|  Cysteine proteinase                                229   2e-72   
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a               234   2e-72   Prunus mume [ume]
ref|XP_010436538.1|  PREDICTED: cysteine proteinase 15A-like            229   3e-72   
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like            234   3e-72   Camelina sativa [gold-of-pleasure]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142             234   4e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a               234   4e-72   
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like          234   5e-72   
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I               234   5e-72   Cucumis sativus [cucumbers]
gb|KJB79047.1|  hypothetical protein B456_013G033800                    233   1e-71   Gossypium raimondii
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a               233   1e-71   Vitis vinifera
gb|ACM80348.1|  cysteine proteinase                                     233   1e-71   Solanum lycopersicum
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               233   1e-71   Solanum lycopersicum
gb|KHN25410.1|  Cysteine proteinase RD19a                               232   2e-71   Glycine soja [wild soybean]
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          232   2e-71   Glycine max [soybeans]
emb|CAE54306.1|  putative papain-like cysteine proteinase               232   2e-71   Gossypium hirsutum [American cotton]
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          231   3e-71   Cicer arietinum [garbanzo]
ref|XP_003606998.1|  Cysteine proteinase                                231   3e-71   Medicago truncatula
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like            232   3e-71   Solanum tuberosum [potatoes]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like          231   5e-71   Camelina sativa [gold-of-pleasure]
gb|AAO11786.1|  pre-pro cysteine proteinase                             230   8e-71   Vicia faba [broad bean]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          230   8e-71   Solanum tuberosum [potatoes]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    231   9e-71   
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg                231   9e-71   Erythranthe guttata [common monkey flower]
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 230   1e-70   Vitis vinifera
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            230   1e-70   Glycine max [soybeans]
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g             230   1e-70   
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg             230   2e-70   Eutrema salsugineum [saltwater cress]
ref|NP_001267989.1|  cysteine protease precursor                        230   2e-70   Vitis vinifera
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     229   2e-70   Glycine max [soybeans]
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg             229   2e-70   Prunus persica
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like          229   2e-70   Populus euphratica
gb|KJB07487.1|  hypothetical protein B456_001G026600                    230   2e-70   Gossypium raimondii
ref|NP_567489.1|  papain family cysteine protease                       229   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAB67878.1|  pre-pro-cysteine proteinase                             229   3e-70   Vicia faba [broad bean]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830          229   3e-70   Sorghum bicolor [broomcorn]
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like          229   3e-70   Cucumis melo [Oriental melon]
ref|XP_007160703.1|  hypothetical protein PHAVU_001G009900g             226   4e-70   Phaseolus vulgaris [French bean]
gb|ABQ10201.1|  cysteine protease Cp3                                   228   4e-70   Actinidia deliciosa [Chinese gooseberry]
gb|AAK27969.1|AF242373_1  cysteine protease                             228   5e-70   Ipomoea batatas [batate]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like            228   6e-70   Prunus mume [ume]
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             228   7e-70   Phaseolus vulgaris [French bean]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200               228   8e-70   Arabis alpina [alpine rockcress]
emb|CAB17075.1|  cysteine proteinase precursor                          228   9e-70   Phaseolus vulgaris [French bean]
gb|KHN22211.1|  Cysteine proteinase 15A                                 228   1e-69   Glycine soja [wild soybean]
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g             227   2e-69   Phaseolus vulgaris [French bean]
ref|XP_002305451.2|  cysteine proteinase A494 precursor                 227   3e-69   
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like          227   3e-69   Cucumis melo [Oriental melon]
gb|AAN60308.1|  unknown                                                 221   4e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KHG15253.1|  Cysteinease RD19a -like protein                         226   4e-69   Gossypium arboreum [tree cotton]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A                 226   4e-69   Vitis vinifera
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like            226   4e-69   Populus euphratica
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like          226   5e-69   Eucalyptus grandis [rose gum]
gb|KHN45894.1|  Cysteine proteinase RD19a                               224   3e-68   Glycine soja [wild soybean]
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a               224   3e-68   Vitis vinifera
dbj|BAF03553.1|  cysteine proteinase CP2                                224   3e-68   Phaseolus vulgaris [French bean]
emb|CDY09707.1|  BnaC07g33540D                                          224   4e-68   Brassica napus [oilseed rape]
gb|AEQ94105.1|  putative drought-inducible cysteine proteinase          218   5e-68   Elaeis guineensis
gb|ACF86683.1|  unknown                                                 223   7e-68   Zea mays [maize]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like          225   8e-68   
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like          225   9e-68   
gb|ACK57563.1|  cysteine protease-like protein                          223   9e-68   Arachis hypogaea [goober]
ref|NP_568052.1|  cysteine proteinase RD19a                             223   1e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CAA82995.1|  cysteine proteinase                                    222   1e-67   Vicia sativa [spring vetch]
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg             223   1e-67   Eutrema salsugineum [saltwater cress]
gb|AAM65162.1|  cysteine proteinase RD19A                               222   1e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                  222   1e-67   Phaseolus vulgaris [French bean]
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor     222   1e-67   Cicer arietinum [garbanzo]
gb|KHG24064.1|  Cysteinease RD19a -like protein                         222   1e-67   Gossypium arboreum [tree cotton]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494       222   2e-67   Eucalyptus grandis [rose gum]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210          222   2e-67   
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677             222   2e-67   
gb|ABK92536.1|  unknown                                                 222   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like            221   2e-67   Glycine max [soybeans]
gb|ACX54787.2|  cysteine protease                                       221   2e-67   Arachis diogoi
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 221   3e-67   
gb|AFK47617.1|  unknown                                                 218   3e-67   Medicago truncatula
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g             221   3e-67   Phaseolus vulgaris [French bean]
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like          221   3e-67   Cucumis sativus [cucumbers]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               221   4e-67   Populus euphratica
gb|KJB32561.1|  hypothetical protein B456_005G247000                    221   4e-67   Gossypium raimondii
gb|AAX19661.1|  cysteine proteinase                                     221   4e-67   Populus tomentosa [Chinese white poplar]
gb|ACI04578.1|  cysteine protease-like protein                          220   4e-67   Robinia pseudoacacia [black locust]
gb|AEQ94152.1|  drought-inducible cysteine proteinase                   217   6e-67   Elaeis guineensis
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg             220   7e-67   Capsella rubella
gb|EPS70818.1|  cysteine proteinase                                     220   8e-67   Genlisea aurea
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          220   8e-67   Glycine max [soybeans]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                    220   8e-67   Zea mays [maize]
emb|CDY41960.1|  BnaA01g05320D                                          220   1e-66   Brassica napus [oilseed rape]
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like              220   1e-66   Setaria italica
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                    220   1e-66   Arabis alpina [alpine rockcress]
dbj|BAA92495.1|  cysteine protease                                      219   1e-66   Vigna mungo [urad dal]
gb|ABF46642.1|  papain-like cysteine proteinase                         219   2e-66   Pachysandra terminalis
ref|XP_003589348.1|  Cysteine proteinase                                219   2e-66   Medicago truncatula
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...    219   3e-66   Pisum sativum [garden pea]
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like          218   4e-66   Cucumis melo [Oriental melon]
emb|CDX90537.1|  BnaA03g42440D                                          218   4e-66   
dbj|BAF98584.1|  CM0216.500.nc                                          218   5e-66   Lotus japonicus
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2         218   5e-66   Lotus japonicus
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a               218   8e-66   Brassica rapa
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                   218   8e-66   Citrus sinensis [apfelsine]
emb|CDY71205.1|  BnaCnng71840D                                          217   1e-65   Brassica napus [oilseed rape]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like          217   1e-65   Citrus sinensis [apfelsine]
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1         216   2e-65   Lotus japonicus
ref|XP_002512963.1|  cysteine protease, putative                        217   2e-65   Ricinus communis
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like              216   2e-65   Elaeis guineensis
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A                 216   4e-65   
dbj|BAC41322.1|  hypothetical protein                                   215   5e-65   Lotus japonicus
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like          215   6e-65   Camelina sativa [gold-of-pleasure]
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease       215   7e-65   Brassica oleracea
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like          215   7e-65   Brassica rapa
emb|CDY15894.1|  BnaA04g12170D                                          215   9e-65   Brassica napus [oilseed rape]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494       214   1e-64   Brassica rapa
ref|NP_001046828.1|  Os02g0469600                                       214   2e-64   
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like              214   2e-64   Brachypodium distachyon [annual false brome]
gb|KHN39817.1|  Cysteine proteinase RD19a                               213   2e-64   Glycine soja [wild soybean]
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a               214   2e-64   Camelina sativa [gold-of-pleasure]
ref|NP_565512.1|  Papain family cysteine protease                       214   2e-64   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43619.1|  putative cysteine proteinase                           213   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a               214   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg             214   3e-64   Citrus clementina [clementine]
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like          214   3e-64   Brassica rapa
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008             213   4e-64   Arabidopsis lyrata subsp. lyrata
dbj|BAF98585.1|  CM0216.510.nc                                          213   5e-64   Lotus japonicus
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like              213   7e-64   Elaeis guineensis
gb|AJA74415.1|  cysteine protease                                       211   3e-63   Cicer arietinum [garbanzo]
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like              211   3e-63   Phoenix dactylifera
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor                 211   3e-63   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like              211   6e-63   Setaria italica
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a               211   7e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg             208   3e-62   Eutrema salsugineum [saltwater cress]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              207   7e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like              206   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAQ00101.1|  papain-like cysteine proteinase                        205   8e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT16425.1|  Cysteine proteinase 1                                   204   2e-60   
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor            204   3e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT10192.1|  Cysteine proteinase 1                                   203   4e-60   
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like              202   5e-60   Phoenix dactylifera
emb|CDP08018.1|  unnamed protein product                                196   4e-59   Coffea canephora [robusta coffee]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like              201   4e-59   Brachypodium distachyon [annual false brome]
gb|AAW21813.1|  cysteine protease                                       199   2e-58   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          197   5e-58   Pyrus x bretschneideri [bai li]
emb|CDX99593.1|  BnaC04g33500D                                          194   5e-57   
emb|CAD40319.2|  OSJNBb0054B09.3                                        195   6e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like              194   6e-57   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA52403.1|  putative thiol protease                                193   7e-57   Arabidopsis thaliana [mouse-ear cress]
gb|EMS64962.1|  Cysteine proteinase 1                                   187   7e-55   Triticum urartu
ref|XP_003607110.1|  Cysteine proteinase                                187   1e-54   Medicago truncatula
gb|AES89347.2|  papain family cysteine protease                         186   5e-54   Medicago truncatula
ref|XP_003607150.1|  Cysteine proteinase                                186   6e-54   
gb|KEH30505.1|  papain family cysteine protease                         185   1e-53   Medicago truncatula
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494       183   2e-52   Brassica rapa
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583             182   2e-52   
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like              182   4e-52   
gb|ABK24688.1|  unknown                                                 180   3e-51   Picea sitchensis
gb|ABK21238.1|  unknown                                                 180   3e-51   Picea sitchensis
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274              178   1e-50   
gb|ACN40679.1|  unknown                                                 177   3e-50   Picea sitchensis
gb|EMS53996.1|  Cysteine proteinase 1                                   166   9e-46   Triticum urartu
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911             163   8e-45   
emb|CAB41090.1|  cysteine proteinase precursor-like protein             162   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAB16996.1|  thiol protease isoform B                                161   2e-44   Glycine max [soybeans]
ref|NP_567010.5|  Papain family cysteine protease                       162   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|ABK24153.1|  unknown                                                 162   3e-44   Picea sitchensis
ref|XP_002978562.1|  hypothetical protein SELMODRAFT_109056             159   2e-43   
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                    159   4e-43   Arabis alpina [alpine rockcress]
gb|EEE60725.1|  hypothetical protein OsJ_14236                          158   4e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002970484.1|  hypothetical protein SELMODRAFT_93661              157   6e-43   
gb|AAR92156.1|  putative cysteine protease 3                            155   1e-42   Iris x hollandica [Dutch iris]
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg             157   2e-42   Prunus persica
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A                 157   2e-42   Prunus mume [ume]
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A                 157   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_001781954.1|  predicted protein                                  156   2e-42   
emb|CDX73424.1|  BnaC08g25790D                                          156   4e-42   
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg             156   4e-42   Eutrema salsugineum [saltwater cress]
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg             155   5e-42   Capsella rubella
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A                 155   5e-42   Cucumis melo [Oriental melon]
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494       155   5e-42   Brassica rapa
emb|CDY56961.1|  BnaA09g55030D                                          154   3e-41   Brassica napus [oilseed rape]
ref|XP_001761980.1|  predicted protein                                  154   3e-41   
ref|XP_007010012.1|  Papain family cysteine protease                    154   3e-41   
gb|AAN57719.1|  cysteine proteinase precursor                           146   6e-41   Solanum melongena [aubergine]
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like            152   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A                 152   2e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001236888.1|  cysteine proteinase precursor                      152   2e-40   Glycine max [soybeans]
gb|KJB60399.1|  hypothetical protein B456_009G303700                    145   3e-40   Gossypium raimondii
gb|KEH43476.1|  papain family cysteine protease                         151   3e-40   Medicago truncatula
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494       151   3e-40   Elaeis guineensis
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like            150   5e-40   Cicer arietinum [garbanzo]
emb|CAB17077.1|  cysteine proteinase precursor                          150   6e-40   Phaseolus vulgaris [French bean]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like          147   9e-40   Pyrus x bretschneideri [bai li]
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A                 149   1e-39   Vitis vinifera
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g             150   2e-39   Phaseolus vulgaris [French bean]
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800          148   2e-39   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like            148   4e-39   Solanum tuberosum [potatoes]
gb|KJB73490.1|  hypothetical protein B456_011G235500                    148   4e-39   Gossypium raimondii
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                   147   6e-39   Eucalyptus grandis [rose gum]
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A                 147   7e-39   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A                 147   8e-39   Solanum lycopersicum
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg             147   1e-38   Citrus clementina [clementine]
emb|CAN64491.1|  hypothetical protein VITISV_015725                     145   1e-38   Vitis vinifera
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like            147   2e-38   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like            147   2e-38   
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A                 146   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494       146   2e-38   Phoenix dactylifera
gb|KHG08355.1|  Cysteinease 1                                           146   2e-38   Gossypium arboreum [tree cotton]
gb|KDP30486.1|  hypothetical protein JCGZ_16165                         145   7e-38   Jatropha curcas
emb|CAB16316.1|  cysteine proteinase precursor                          145   7e-38   Vicia sativa [spring vetch]
ref|XP_002533377.1|  cysteine protease, putative                        145   8e-38   Ricinus communis
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A                 144   2e-37   Nicotiana sylvestris
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg                142   5e-37   Erythranthe guttata [common monkey flower]
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g             140   1e-36   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A                 141   2e-36   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A                 141   2e-36   
ref|XP_010103534.1|  putative cysteine proteinase A494                  140   4e-36   
gb|EPS63354.1|  hypothetical protein M569_11429                         139   9e-36   
gb|ADE76932.1|  unknown                                                 139   1e-35   
emb|CDO99795.1|  unnamed protein product                                139   2e-35   
gb|AEQ54770.1|  cysteine proteinase CP1                                 138   2e-35   
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A                 137   6e-35   
emb|CDY13816.1|  BnaA09g43180D                                          132   5e-34   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33           134   6e-34   
gb|EAY93546.1|  hypothetical protein OsI_15336                          133   8e-34   
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270          131   8e-33   
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like              131   9e-33   
tpg|DAA40800.1|  TPA: putative cysteine protease family protein         130   3e-32   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A                 129   6e-32   
gb|EEE67161.1|  hypothetical protein OsJ_24244                          127   1e-31   
ref|NP_001059639.1|  Os07g0480900                                       127   4e-31   
dbj|BAK03623.1|  predicted protein                                      123   4e-31   
gb|EEC82027.1|  hypothetical protein OsI_25996                          129   5e-31   
emb|CAQ00102.1|  papain-like cysteine proteinase                        125   9e-31   
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660               123   3e-30   
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                   122   1e-29   
emb|CAF92720.1|  unnamed protein product                                117   1e-29   
emb|CCC48260.1|  cysteine peptidase precursor, fragment                 118   2e-29   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956             121   2e-29   
ref|XP_003970181.1|  PREDICTED: cathepsin F-like                        120   1e-28   
emb|CCD21595.1|  hypothetical protein, conserved in T. vivax            118   1e-28   
gb|ACN56478.1|  cathepsin F                                             119   4e-28   
gb|ACC86111.1|  cathepsin F                                             119   5e-28   
emb|CCC48263.1|  cysteine peptidase precursor, fragment                 116   5e-28   
emb|CCD15484.1|  unnamed protein product                                118   6e-28   
emb|CCD12272.1|  unnamed protein product                                118   7e-28   
emb|CCC48256.1|  cysteine peptidase precursor                           117   1e-27   
emb|CCC48258.1|  cysteine peptidase precursor                           117   1e-27   
emb|CCC48259.1|  cysteine peptidase precursor, fragment                 117   1e-27   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site               117   1e-27   
ref|XP_010597319.1|  PREDICTED: cathepsin F                             117   1e-27   
emb|CCD14732.1|  unnamed protein product                                117   1e-27   
emb|CCD11889.1|  unnamed protein product                                117   1e-27   
emb|CAA81061.1|  cysteine proteinase                                    117   1e-27   
emb|CCD11724.1|  unnamed protein product                                117   1e-27   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                        117   2e-27   
ref|XP_007568468.1|  PREDICTED: cathepsin W                             117   2e-27   
emb|CCD21670.1|  cysteine peptidase (CP), putative                      116   2e-27   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                        117   2e-27   
gb|AAA18215.1|  cysteine protease precursor                             117   2e-27   
ref|XP_005811173.1|  PREDICTED: cathepsin F-like                        116   3e-27   
ref|XP_007171073.1|  PREDICTED: cathepsin F isoform X1                  115   3e-27   
ref|XP_007445075.1|  PREDICTED: cathepsin F-like                        115   3e-27   
emb|CCC48265.1|  cysteine peptidase precursor, fragment                 115   3e-27   
emb|CCC48262.1|  cysteine peptidase, Clan CA, family C1,Cathepsin...    115   4e-27   
gb|AID54677.1|  cathepsin L                                             115   4e-27   
ref|XP_005305555.1|  PREDICTED: cathepsin F                             115   4e-27   
gb|AAB01769.1|  cysteine proteinase homolog                             115   4e-27   
ref|XP_005916689.1|  PREDICTED: cathepsin F-like                        115   5e-27   
ref|XP_005699988.1|  PREDICTED: cathepsin F isoform X3                  114   5e-27   
ref|XP_004618609.1|  PREDICTED: cathepsin F                             115   6e-27   
ref|XP_003451852.1|  PREDICTED: cathepsin F-like                        115   6e-27   
ref|XP_002674919.1|  predicted protein                                  114   7e-27   
ref|XP_004563245.1|  PREDICTED: cathepsin F-like                        115   9e-27   
emb|CDQ83896.1|  unnamed protein product                                114   9e-27   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...    117   9e-27   
ref|XP_008418047.1|  PREDICTED: cathepsin F-like                        115   9e-27   
gb|AAC37213.1|  cysteine proteinase                                     115   1e-26   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...    117   1e-26   
ref|XP_002672864.1|  predicted protein                                  114   1e-26   
ref|XP_007942912.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        114   1e-26   
ref|XP_005654721.1|  PREDICTED: cathepsin F-like isoform X2             114   2e-26   
gb|EKC42097.1|  Cathepsin F                                             116   2e-26   
ref|NP_001106423.1|  cathepsin F precursor                              114   2e-26   
emb|CDW75439.1|  cathepsin l                                            113   2e-26   
ref|XP_006129733.1|  PREDICTED: cathepsin F-like                        113   2e-26   
ref|XP_005699986.1|  PREDICTED: cathepsin F isoform X1                  113   2e-26   
emb|CCD20093.1|  cysteine peptidase precursor                           114   2e-26   
ref|XP_007115106.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        114   3e-26   
gb|ELK24293.1|  Cathepsin F                                             113   3e-26   
ref|XP_820178.1|  cruzipain precursor                                   109   3e-26   
gb|AFA34858.1|  cathepsin L-like protein                                113   3e-26   
ref|XP_003122543.2|  PREDICTED: cathepsin F isoform X1                  114   3e-26   
ref|XP_003774144.1|  PREDICTED: cathepsin F                             113   4e-26   
ref|XP_006771750.1|  PREDICTED: cathepsin F                             113   4e-26   
ref|XP_005699987.1|  PREDICTED: cathepsin F isoform X2                  112   4e-26   
ref|XP_005968922.1|  PREDICTED: cathepsin F                             112   4e-26   
gb|AAY81946.1|  cysteine protease 8                                     112   5e-26   
gb|EKG02025.1|  cysteine peptidase, putative,cysteine peptidase, ...    112   5e-26   
gb|AIC36736.1|  cathepsin F                                             112   6e-26   
ref|XP_005631485.1|  PREDICTED: cathepsin F isoform X1                  112   6e-26   
ref|XP_004019753.1|  PREDICTED: cathepsin F isoform 1                   112   6e-26   
ref|XP_008707386.1|  PREDICTED: cathepsin F                             112   6e-26   
emb|CCD16236.1|  unnamed protein product                                112   7e-26   
ref|XP_533219.4|  PREDICTED: cathepsin F isoform X2                     112   7e-26   
ref|XP_004019754.1|  PREDICTED: cathepsin F isoform 2                   112   7e-26   
ref|XP_006044418.1|  PREDICTED: cathepsin F isoform X1                  112   7e-26   
ref|XP_005903598.1|  PREDICTED: cathepsin F isoform X1                  112   7e-26   
ref|XP_006044419.1|  PREDICTED: cathepsin F isoform X2                  112   8e-26   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904    115   8e-26   
ref|XP_005864349.1|  PREDICTED: cathepsin F                             112   8e-26   
gb|ACN10907.1|  Cathepsin F precursor                                   112   9e-26   
ref|XP_004278023.1|  PREDICTED: cathepsin F isoform 2                   112   9e-26   
ref|NP_001068884.1|  cathepsin F precursor                              112   9e-26   
ref|XP_003798388.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        112   9e-26   
ref|XP_006782128.1|  PREDICTED: cathepsin F-like                        112   1e-25   
gb|ABQ23965.1|  cathepsin F                                             110   1e-25   
ref|XP_006179549.1|  PREDICTED: cathepsin F                             111   1e-25   
dbj|BAC75923.1|  cysteine protease-1                                    112   1e-25   
gb|AAM44058.1|AF510740_1  cathepsin L1                                  110   1e-25   
ref|XP_008577225.1|  PREDICTED: cathepsin F                             112   1e-25   
ref|XP_004278022.1|  PREDICTED: cathepsin F isoform 1                   112   2e-25   
ref|XP_006210811.1|  PREDICTED: cathepsin F                             111   2e-25   
ref|XP_007092117.1|  PREDICTED: cathepsin F                             111   2e-25   
ref|XP_004656783.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        111   2e-25   
ref|XP_004317592.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        112   2e-25   
emb|CCD16903.1|  unnamed protein product                                111   2e-25   
emb|CCD15016.1|  unnamed protein product                                110   2e-25   
emb|CDW82799.1|  cathepsin l                                            110   2e-25   
ref|XP_007461994.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        111   2e-25   
gb|EKF27064.1|  cysteine peptidase                                      108   2e-25   
ref|XP_007518834.1|  PREDICTED: cathepsin F                             111   2e-25   
ref|XP_803044.1|  cysteine peptidase                                    111   2e-25   
ref|XP_004383745.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        111   2e-25   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708       113   2e-25   
ref|XP_004759498.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        111   2e-25   
gb|AAA30270.1|  cysteine proteinase                                     108   3e-25   
ref|XP_010754224.1|  PREDICTED: cathepsin F                             111   3e-25   
gb|EKG00105.1|  cysteine peptidase, putative,cysteine peptidase, ...    110   3e-25   
ref|XP_005598385.1|  PREDICTED: cathepsin F                             110   3e-25   
emb|CCD13687.1|  unnamed protein product                                111   3e-25   
ref|XP_010954979.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        111   3e-25   
gb|AAB41118.1|  cruzipain                                               110   3e-25   
ref|XP_011367226.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        111   3e-25   
ref|XP_007171074.1|  PREDICTED: cathepsin F isoform X2                  110   3e-25   
dbj|BAF81994.1|  cysteine proteinase                                    110   4e-25   
ref|XP_004437729.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        110   4e-25   
ref|XP_006101673.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        110   4e-25   
ref|NP_001133678.1|  Cathepsin F precursor                              110   4e-25   
emb|CCD77197.1|  cathepsin F (C01 family)                               110   4e-25   
emb|CCD77198.1|  cathepsin F (C01 family)                               110   4e-25   
ref|XP_002682087.1|  predicted protein                                  109   5e-25   
ref|XP_006937669.1|  PREDICTED: cathepsin F                             110   5e-25   
sp|Q26534.1|CATL_SCHMA  RecName: Full=Cathepsin L; AltName: Full=...    109   5e-25   
ref|XP_821954.1|  cysteine peptidase                                    109   5e-25   
ref|XP_008531628.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        110   6e-25   
gb|EFA83712.1|  cysteine proteinase 1                                   110   6e-25   
ref|XP_001032875.1|  Papain family cysteine protease containing p...    109   6e-25   
gb|ELK13294.1|  Cathepsin F                                             110   6e-25   
emb|CBK21708.2|  unnamed protein product                                108   7e-25   
emb|CCD12886.1|  unnamed protein product                                109   8e-25   
ref|XP_006911111.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        110   8e-25   
emb|CCD14094.1|  unnamed protein product                                108   8e-25   
ref|XP_008271777.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        109   9e-25   
emb|CBH11597.1|  cysteine peptidase precursor, (fragment)               106   9e-25   
ref|XP_010765827.1|  PREDICTED: cathepsin W                             110   1e-24   
ref|XP_010896687.1|  PREDICTED: cathepsin F                             109   1e-24   
emb|CCD11901.1|  unnamed protein product                                108   1e-24   
gb|KFO28364.1|  Cathepsin F                                             108   1e-24   
emb|CCD11596.1|  unnamed protein product                                108   1e-24   
gb|AAF75546.1|  cruzipain                                               109   1e-24   
emb|CBH11594.1|  cysteine peptidase precursor, (fragment)               106   1e-24   
pdb|4PI4|A  Chain A, Crystal Structure Analysis Of Cruzain Bound ...    108   1e-24   
ref|XP_003057227.1|  predicted protein                                  108   1e-24   
gb|ABV22436.1|  cysteine proteinase                                     108   1e-24   
ref|XP_008048262.1|  PREDICTED: cathepsin F                             108   1e-24   
gb|AAP06190.1|  similar to GenBank Accession Number U07345 prepro...    108   1e-24   
ref|XP_004243707.1|  PREDICTED: cysteine proteinase 3-like              108   1e-24   
ref|XP_820174.1|  cysteine peptidase                                    108   1e-24   
emb|CCD14279.1|  unnamed protein product                                108   2e-24   
ref|XP_010634471.1|  PREDICTED: cathepsin F                             108   2e-24   
emb|CCD11725.1|  unnamed protein product                                108   2e-24   
gb|AFA34856.1|  cathepsin L-like protein                                108   2e-24   
ref|XP_009614399.1|  PREDICTED: cysteine proteinase 3                   108   2e-24   
ref|XP_004713618.1|  PREDICTED: cathepsin F                             107   2e-24   
emb|CCD15012.1|  unnamed protein product                                108   2e-24   
gb|KGB33519.1|  Cathepsin L                                             107   2e-24   
emb|CCD17026.1|  unnamed protein product                                108   2e-24   
ref|XP_007575743.1|  PREDICTED: cathepsin L1-like                       107   2e-24   
ref|XP_006893341.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        108   2e-24   
gb|KDR17524.1|  Putative cysteine proteinase                            111   2e-24   
ref|XP_009162112.1|  hypothetical protein T265_12432                    110   2e-24   
ref|XP_002505924.1|  cysteine endopeptidase                             107   2e-24   
ref|XP_004393930.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        108   2e-24   
ref|XP_009774827.1|  PREDICTED: cysteine proteinase 3                   107   2e-24   
emb|CCD77199.1|  cathepsin F (C01 family)                               108   2e-24   
gb|ABW71226.1|  cysteine protease                                       107   3e-24   
gb|AAB41119.1|  cruzipain                                               108   3e-24   
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    107   3e-24   
ref|XP_006171430.1|  PREDICTED: cathepsin F                             108   3e-24   
ref|XP_818578.1|  cysteine peptidase                                    108   3e-24   
gb|KHG18408.1|  Cysteinease RD21a -like protein                         107   3e-24   
ref|XP_008888488.1|  cathepsin CPL                                      107   3e-24   
gb|AAF21462.1|U69121_1  cysteine proteinase PWCP2                       106   3e-24   
gb|KFG34456.1|  cathepsin CPL                                           107   3e-24   
gb|AFA34855.1|  cathepsin L-like protein                                108   3e-24   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        108   4e-24   
ref|XP_008417611.1|  PREDICTED: cathepsin L1-like                       107   4e-24   
ref|XP_805951.1|  cysteine peptidase                                    107   4e-24   
gb|AAG35357.1|AF314929_1  cruzipain                                     107   4e-24   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...    107   4e-24   
gb|AFM37363.1|  cathepsin F1                                            107   4e-24   
ref|XP_004596891.1|  PREDICTED: cathepsin F                             107   4e-24   
gb|AAD24589.1|AF139913_1  cysteine protease                             107   4e-24   
gb|AAL96762.1|AC104496_8  Tcc1l8.8                                      108   4e-24   
gb|AAW25775.1|  SJCHGC00511 protein                                     107   4e-24   
ref|XP_008145119.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        108   4e-24   
sp|P25779.1|CYSP_TRYCR  RecName: Full=Cruzipain; AltName: Full=Cr...    107   4e-24   
gb|AAH04054.2|  Ctsf protein                                            106   4e-24   
gb|AAC78839.1|  cathepsin F                                             106   4e-24   
emb|CDQ79130.1|  unnamed protein product                                107   4e-24   
ref|XP_818579.1|  cruzipain precursor                                   107   4e-24   
gb|AAG35358.1|AF314930_1  cruzipain                                     107   5e-24   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...    107   5e-24   
emb|CAE47501.1|  cathepsin L-like proteinase                            106   5e-24   
gb|AAC78838.1|  cathepsin F                                             106   5e-24   
pir||T46294  hypothetical protein DKFZp434F0610.1 - human (fragment)    106   5e-24
ref|XP_004695908.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        107   5e-24   
emb|CAG46481.1|  CTSF                                                   106   5e-24   
ref|XP_004463677.1|  PREDICTED: cathepsin F                             106   5e-24   
ref|XP_010028205.1|  PREDICTED: cysteine proteinase COT44-like          106   6e-24   
ref|XP_001781010.1|  predicted protein                                  107   6e-24   
gb|AAZ32410.1|  cysteine proteinase aleuran type                        106   6e-24   
ref|XP_005384447.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F        107   7e-24   



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 161/183 (88%), Gaps = 5/183 (3%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDRF L SLLI+ L +A  VRAD   EDPLIRQVVS  DG+DD LLNADHHF+LFKSK+G
Sbjct  1    MDRFSLLSLLILALTAACVVRAD---EDPLIRQVVS--DGEDDALLNADHHFTLFKSKYG  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            KSY T+EEHDYR SVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTF G+ KS +
Sbjct  56   KSYATQEEHDYRLSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFLGIRKSSS  115

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
             K K++LPADA+ A ILPT +LP+DFDWRD+GAVTGVK+QGSCGSCWSFSTTGALEGA+F
Sbjct  116  GKRKLKLPADAHAAEILPTSDLPSDFDWRDYGAVTGVKDQGSCGSCWSFSTTGALEGANF  175

Query  560  LAT  568
            LAT
Sbjct  176  LAT  178



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 156/185 (84%), Gaps = 7/185 (4%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDRF L SLLI  L +A  VRAD   EDPLIRQVVS  DG+DD LLNADHHF+LFKSK+G
Sbjct  1    MDRFSLPSLLIHALTAACVVRAD---EDPLIRQVVS--DGEDDALLNADHHFTLFKSKYG  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVH--KS  373
            KSY T+EEHDYR SVFKANLRRAKRHQ+LDPSAVHGVTKFSDLTPKEFRRT+ G+    S
Sbjct  56   KSYATQEEHDYRLSVFKANLRRAKRHQMLDPSAVHGVTKFSDLTPKEFRRTYLGIRKSSS  115

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
              +KLK++LPADA+ A ILPT +LP DF+WRD+GAVTGVK+QG CGSCWSFSTTG LEG 
Sbjct  116  SKQKLKLKLPADAHAAEILPTSDLPFDFEWRDYGAVTGVKDQGLCGSCWSFSTTGTLEGT  175

Query  554  HFLAT  568
            +FLAT
Sbjct  176  NFLAT  180



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 141/162 (87%), Gaps = 3/162 (2%)
 Frame = +2

Query  83   ADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLR  262
            A    +DPLIRQVV+ +  D DPLLNADHHFSLFK+K+GK+Y T+EEHD+RFSVFKANLR
Sbjct  30   ASIIQDDPLIRQVVTSDGDDADPLLNADHHFSLFKTKYGKTYSTQEEHDHRFSVFKANLR  89

Query  263  RAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDN  442
            RAKRHQLLDPSAVHGVTKFSDLTP EFRR   G++K    K ++RLPADANKAPILPT +
Sbjct  90   RAKRHQLLDPSAVHGVTKFSDLTPSEFRRNHLGLNK---HKRRLRLPADANKAPILPTTD  146

Query  443  LPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            LP DFDWRDHGAVT VK+QGSCGSCWSFSTTGALEGAH+LAT
Sbjct  147  LPADFDWRDHGAVTPVKDQGSCGSCWSFSTTGALEGAHYLAT  188



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   261 bits (667),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 147/183 (80%), Gaps = 12/183 (7%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            M+R FL SLL   L S++     FS EDPLIRQVVSE D  D  LLNA+HHFSLFKSKFG
Sbjct  1    MERLFLLSLLAFVLFSSAIA---FSDEDPLIRQVVSETD--DSHLLNAEHHFSLFKSKFG  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K Y +EEEHD+RF VFKANLRRA+RHQLLDPSA HG+TKFSDLTP EFRRT+ G+HK + 
Sbjct  56   KIYASEEEHDHRFKVFKANLRRARRHQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKP  115

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
            K        +A KAPILPT +LP DFDWRDHGAVTGVKNQGSCGSCWSFSTTGA+EGAHF
Sbjct  116  K-------LNAEKAPILPTSDLPADFDWRDHGAVTGVKNQGSCGSCWSFSTTGAVEGAHF  168

Query  560  LAT  568
            LAT
Sbjct  169  LAT  171



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 146/183 (80%), Gaps = 12/183 (7%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            M+R FL SLL   L S++     FS EDPLIRQVVSE D  D  LLNA+HHFSLFKSKFG
Sbjct  1    MERLFLLSLLAFVLFSSAIA---FSDEDPLIRQVVSETD--DSHLLNAEHHFSLFKSKFG  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K Y +EEEHD+RF VFKAN RRA+RHQLLDPSA HG+TKFSDLTP EFRRT+ G+HK + 
Sbjct  56   KIYASEEEHDHRFKVFKANRRRARRHQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKP  115

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
            K        +A KAPILPT +LP DFDWRDHGAVTGVKNQGSCGSCWSFSTTGA+EGAHF
Sbjct  116  K-------LNAEKAPILPTSDLPADFDWRDHGAVTGVKNQGSCGSCWSFSTTGAVEGAHF  168

Query  560  LAT  568
            LAT
Sbjct  169  LAT  171



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 145/183 (79%), Gaps = 10/183 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR FL SL    L S++     F  EDPLIRQVVSE + DD  LLNA+HHFSLFKSKFG
Sbjct  1    MDRLFLLSLPRFALFSSAIA---FPDEDPLIRQVVSETETDDSHLLNAEHHFSLFKSKFG  57

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K Y +EEEHD+RF VFKANLRRA+ +QLLDPSA HG+TKFSDLTP EFRRT+ G+HK + 
Sbjct  58   KIYASEEEHDHRFKVFKANLRRARLNQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKP  117

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
            K        +A KAPILPT +LP D+DWRDHGAVTGVKNQGSCGSCWSFSTTGA+EGAHF
Sbjct  118  K-------VNAEKAPILPTSDLPADYDWRDHGAVTGVKNQGSCGSCWSFSTTGAVEGAHF  170

Query  560  LAT  568
            LAT
Sbjct  171  LAT  173



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score =   257 bits (656),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 145/183 (79%), Gaps = 9/183 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR FL SLL+  + S+S     FS EDPLIRQV SE D +++ LLNA+HHFSLFKSKFG
Sbjct  1    MDRLFLLSLLVFTIFSSSAFA--FSDEDPLIRQVTSESDDNNNHLLNAEHHFSLFKSKFG  58

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K Y T+EEHD+R  VFKANLRRA+RHQLLDP+A HG+TKFSDLTP EFRRT+ G+HK + 
Sbjct  59   KIYATQEEHDHRLKVFKANLRRARRHQLLDPTAEHGITKFSDLTPSEFRRTYLGLHKPKP  118

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
            K           KAPILPT +LP DFDWR+ GAVTGVKNQGSCGSCWSFSTTGA+EGAHF
Sbjct  119  K-------LSTTKAPILPTSDLPEDFDWREKGAVTGVKNQGSCGSCWSFSTTGAVEGAHF  171

Query  560  LAT  568
            LAT
Sbjct  172  LAT  174



>gb|KJB29613.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=207

 Score =   251 bits (641),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 149/186 (80%), Gaps = 10/186 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSE---EDGDDDPLLNADHHFSLFKS  190
            MDRF L  LL+  + +++ V    S  DPLIRQVVS+   E+  DD LLNA+HHF+LFKS
Sbjct  1    MDRFSLLFLLLSSVVASAVVFDVNSDGDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKS  60

Query  191  KFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHK  370
            K+GK+Y ++EEHDYR  VFKANLRRAKRHQLLDPSAVHGVTKFSDLTP EFRR + G+  
Sbjct  61   KYGKTYASQEEHDYRLGVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPSEFRRQYLGLK-  119

Query  371  SRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEG  550
                   ++LPADA KAPILPTDNLP DFDWRDHGAVTGVK+QGSCGSCWSFS TGALEG
Sbjct  120  ------PLKLPADAQKAPILPTDNLPDDFDWRDHGAVTGVKDQGSCGSCWSFSATGALEG  173

Query  551  AHFLAT  568
            AH+LAT
Sbjct  174  AHYLAT  179



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 146/183 (80%), Gaps = 12/183 (7%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            M+R FL SLL   L S++     FS EDPLIRQVVSE D  D  LLNA+HHFSLFKSKFG
Sbjct  1    MERLFLLSLLAFVLFSSAIA---FSDEDPLIRQVVSETD--DSHLLNAEHHFSLFKSKFG  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K Y +EEEHD+RF VFKANLRRA+ +QLLDPSA HG+TKFSDLTP EFRRT+ G+HK + 
Sbjct  56   KIYASEEEHDHRFKVFKANLRRARLNQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKP  115

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
            K        +A KAPILPT +LP DFDWRDHGAVTGVKNQGSCGSCWSFSTTGA+EGAHF
Sbjct  116  K-------LNAEKAPILPTSDLPADFDWRDHGAVTGVKNQGSCGSCWSFSTTGAVEGAHF  168

Query  560  LAT  568
            LAT
Sbjct  169  LAT  171



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 136/160 (85%), Gaps = 7/160 (4%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRA  268
            FS EDPLIRQVVSE + DD  LLNA+HHFSLFKSKFGK Y +EEEHD+RF VFKANLRRA
Sbjct  21   FSDEDPLIRQVVSETETDDSHLLNAEHHFSLFKSKFGKIYASEEEHDHRFKVFKANLRRA  80

Query  269  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLP  448
            +RHQLLDPSA HG+TKFSDLTP EFRRT+ G+HK + K        +A KAPILPT +LP
Sbjct  81   RRHQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKPK-------LNAEKAPILPTSDLP  133

Query  449  TDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             D+DWRDHGAVTGVKNQGSCGSCWSFSTTGA+EGAHFLAT
Sbjct  134  ADYDWRDHGAVTGVKNQGSCGSCWSFSTTGAVEGAHFLAT  173



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score =   254 bits (650),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 136/160 (85%), Gaps = 7/160 (4%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRA  268
            FS EDPLIRQVVSE + DD  LLNA+HHFSLFKSKFGK Y +EEEHD+RF VFKANLRRA
Sbjct  21   FSDEDPLIRQVVSETETDDSHLLNAEHHFSLFKSKFGKIYASEEEHDHRFKVFKANLRRA  80

Query  269  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLP  448
            +RHQLLDPSA HG+TKFSDLTP EFRRT+ G+HK + K        +A KAPILPT +LP
Sbjct  81   RRHQLLDPSAEHGITKFSDLTPSEFRRTYLGLHKPKPK-------LNAEKAPILPTSDLP  133

Query  449  TDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             D+DWRDHGAVTGVKNQGSCGSCWSFSTTGA+EGAHFLAT
Sbjct  134  ADYDWRDHGAVTGVKNQGSCGSCWSFSTTGAVEGAHFLAT  173



>gb|KJB29612.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=301

 Score =   251 bits (642),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 149/186 (80%), Gaps = 10/186 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSE---EDGDDDPLLNADHHFSLFKS  190
            MDRF L  LL+  + +++ V    S  DPLIRQVVS+   E+  DD LLNA+HHF+LFKS
Sbjct  1    MDRFSLLFLLLSSVVASAVVFDVNSDGDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKS  60

Query  191  KFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHK  370
            K+GK+Y ++EEHDYR  VFKANLRRAKRHQLLDPSAVHGVTKFSDLTP EFRR + G+  
Sbjct  61   KYGKTYASQEEHDYRLGVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPSEFRRQYLGLK-  119

Query  371  SRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEG  550
                   ++LPADA KAPILPTDNLP DFDWRDHGAVTGVK+QGSCGSCWSFS TGALEG
Sbjct  120  ------PLKLPADAQKAPILPTDNLPDDFDWRDHGAVTGVKDQGSCGSCWSFSATGALEG  173

Query  551  AHFLAT  568
            AH+LAT
Sbjct  174  AHYLAT  179



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 149/186 (80%), Gaps = 10/186 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSE---EDGDDDPLLNADHHFSLFKS  190
            MDRF L  LL+  + +++ V    S  DPLIRQVVS+   E+  DD LLNA+HHF+LFKS
Sbjct  1    MDRFSLLFLLLSSVVASAVVFDVNSDGDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKS  60

Query  191  KFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHK  370
            K+GK+Y ++EEHDYR  VFKANLRRAKRHQLLDPSAVHGVTKFSDLTP EFRR + G+  
Sbjct  61   KYGKTYASQEEHDYRLGVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPSEFRRQYLGLK-  119

Query  371  SRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEG  550
                   ++LPADA KAPILPTDNLP DFDWRDHGAVTGVK+QGSCGSCWSFS TGALEG
Sbjct  120  ------PLKLPADAQKAPILPTDNLPDDFDWRDHGAVTGVKDQGSCGSCWSFSATGALEG  173

Query  551  AHFLAT  568
            AH+LAT
Sbjct  174  AHYLAT  179



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score =   252 bits (644),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 137/159 (86%), Gaps = 9/159 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDD--DPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAK  271
            +DPLIRQVVS   G+D  D LLNA+HHF+LFKSK+GK+Y T+EEHDYR  VFKANLRRAK
Sbjct  59   DDPLIRQVVSNGAGEDSDDHLLNAEHHFTLFKSKYGKTYATQEEHDYRLGVFKANLRRAK  118

Query  272  RHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPT  451
            RHQLLDP+AVHGVTKFSDLTP EFRR F G+         ++LPADA KAPILPT++LPT
Sbjct  119  RHQLLDPTAVHGVTKFSDLTPSEFRRQFLGLR-------PLKLPADAQKAPILPTNDLPT  171

Query  452  DFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DFDWRDHGAVTGVK+QGSCGSCWSFSTTGALEGAH+L+T
Sbjct  172  DFDWRDHGAVTGVKDQGSCGSCWSFSTTGALEGAHYLST  210



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score =   251 bits (641),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 139/161 (86%), Gaps = 5/161 (3%)
 Frame = +2

Query  86   DFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRR  265
            D   +DPLIRQVVS+     D LL+ADHHFSLFK+K+GKSY T+EEHDYRFSVFKANLRR
Sbjct  27   DTVTDDPLIRQVVSDGADAVDQLLHADHHFSLFKTKYGKSYATQEEHDYRFSVFKANLRR  86

Query  266  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNL  445
            +KRHQ+LDPSAVHGVTKFSDLTP+EF +++ G+   R KKLK  LP D NKA +LPT++L
Sbjct  87   SKRHQILDPSAVHGVTKFSDLTPEEFEKSYLGL---RQKKLK--LPVDENKAAVLPTEDL  141

Query  446  PTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            PTDFDWRDHGAVT VK+QGSCGSCWSFSTTGALEGAH+LAT
Sbjct  142  PTDFDWRDHGAVTAVKDQGSCGSCWSFSTTGALEGAHYLAT  182



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 140/158 (89%), Gaps = 5/158 (3%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            ++DPLIRQVVS+     D LL+A+HHFSLFK+K+GK+YDT+EEHDYRFSVFK+NLRRAKR
Sbjct  29   SDDPLIRQVVSDSVEAVDQLLHAEHHFSLFKAKYGKTYDTQEEHDYRFSVFKSNLRRAKR  88

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            +QLLDPSAVHGVT+FSDLTP EF +++ G+HK R     ++LP DA+KAP LPT+NLPTD
Sbjct  89   NQLLDPSAVHGVTRFSDLTPDEFEKSYLGLHKRR-----LKLPVDAHKAPDLPTNNLPTD  143

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRDHGAVT VK+QGSCGSCWSFSTTG+LEGAH+LAT
Sbjct  144  FDWRDHGAVTAVKDQGSCGSCWSFSTTGSLEGAHYLAT  181



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 150/186 (81%), Gaps = 14/186 (8%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASF---VRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKS  190
            M+RF L SLLI  L S++F   V  D   EDPLIRQVV E     D LLNA+HHF+ FKS
Sbjct  1    MERFCLLSLLICTLFSSTFAATVSPD-EVEDPLIRQVVPEAV---DHLLNAEHHFTTFKS  56

Query  191  KFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHK  370
            KFGK+Y T+EEHD+RF VFKANLRRA++HQ++DPSAVHGVTKFSDLTP+EFRR + G+  
Sbjct  57   KFGKNYATQEEHDHRFKVFKANLRRARKHQMMDPSAVHGVTKFSDLTPREFRRQYLGLK-  115

Query  371  SRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEG  550
                  ++RLPADA++APILPT++LP+DFDWRD GAVT VK+QG+CGSCWSFS TGALEG
Sbjct  116  ------RLRLPADAHEAPILPTNDLPSDFDWRDKGAVTNVKDQGACGSCWSFSATGALEG  169

Query  551  AHFLAT  568
            AHFL+T
Sbjct  170  AHFLST  175



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 145/185 (78%), Gaps = 11/185 (6%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAE--DPLIRQVVSEEDGDDDPLLNADHHFSLFKSK  193
            M+R  L S L+  L S +        E  DPLIRQVV   DGD D LLNA+HHF+ FK+K
Sbjct  1    MERRCLISFLVYALLSFTIASTTSPDELDDPLIRQVVP--DGDQDHLLNAEHHFTTFKAK  58

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            FGK+Y T+EEHDYRF +FKANLRRA++HQ++DP+AVHGVT FSDLTP+EFRR + G+   
Sbjct  59   FGKTYATQEEHDYRFKLFKANLRRARKHQMMDPTAVHGVTMFSDLTPREFRRQYLGLR--  116

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                 ++RLPADA++APILPT++LPTDFDWRDHGAVT VKNQGSCGSCWSFS  GALEGA
Sbjct  117  -----RLRLPADAHEAPILPTNDLPTDFDWRDHGAVTNVKNQGSCGSCWSFSAAGALEGA  171

Query  554  HFLAT  568
            HFLAT
Sbjct  172  HFLAT  176



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   249 bits (635),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 141/180 (78%), Gaps = 10/180 (6%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
             FL S LI   A AS V  D  +EDPLIRQVVS+   DDD LLNA+HHF+ FK KFGKSY
Sbjct  10   IFLLSSLIFAAAIASLVSPDDESEDPLIRQVVSD---DDDLLLNAEHHFNNFKRKFGKSY  66

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             T EEH YR  VFKANLRRA+RHQ LDPSAVHGVT+FSDLTP EFRR++ G+        
Sbjct  67   ATPEEHAYRLGVFKANLRRARRHQKLDPSAVHGVTQFSDLTPAEFRRSYLGLK-------  119

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             ++LP DA+ APILPT++LPTDFDWRDHGA+  VKNQGSCGSCWSFST+GALEGA+FLAT
Sbjct  120  PLKLPVDAHNAPILPTNDLPTDFDWRDHGAIAAVKNQGSCGSCWSFSTSGALEGANFLAT  179



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score =   249 bits (635),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 149/185 (81%), Gaps = 13/185 (7%)
 Frame = +2

Query  35   LFSLLIIGLASASFVRADFS----AEDPLIRQVVSEEDG---DDDPLLNADHHFSLFKSK  193
            L SLLI  L  +SF   D S    ++D LIRQVV   +G   D++ LLNADHHF+ FK K
Sbjct  10   LSSLLIATLFRSSFAGDDVSGGAQSDDLLIRQVVDHGEGGAVDENSLLNADHHFAAFKRK  69

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            FGK+Y T+EEHDYRFSVF+AN+RRA RHQ +DPSAVHGVT+FSDLTP+EFR+ F GV++ 
Sbjct  70   FGKAYATQEEHDYRFSVFEANMRRAVRHQKIDPSAVHGVTQFSDLTPREFRQQFLGVNR-  128

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                 ++RLP+DA KAPILPT++LPTDFDWRDHGAVT VKNQG+CGSCWSFSTTGALEGA
Sbjct  129  -----RLRLPSDAQKAPILPTNDLPTDFDWRDHGAVTEVKNQGTCGSCWSFSTTGALEGA  183

Query  554  HFLAT  568
            +FLAT
Sbjct  184  NFLAT  188



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score =   248 bits (634),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 146/184 (79%), Gaps = 9/184 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASA-SFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKF  196
            M+R   F L+  GL  A +    + S ++P+IRQVV EE+  D+ LLNA+HHFSLFKSK+
Sbjct  1    MNRVIFFLLVAAGLLVAITGEVVEDSFDNPIIRQVVPEEN--DEQLLNAEHHFSLFKSKY  58

Query  197  GKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSR  376
             K+Y T+ EHD+RF VFKANLRRA+RHQLLDPSAVHGVT+FSDLTPKEFRR + G+    
Sbjct  59   QKTYATQAEHDHRFRVFKANLRRARRHQLLDPSAVHGVTQFSDLTPKEFRRKYLGL----  114

Query  377  AKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAH  556
              K K+RLP DA KAPILPT +LPTDFDWRD GAVT VKNQGSCGSCWSFS TGALEGAH
Sbjct  115  --KRKLRLPNDAQKAPILPTSDLPTDFDWRDKGAVTPVKNQGSCGSCWSFSATGALEGAH  172

Query  557  FLAT  568
            FLAT
Sbjct  173  FLAT  176



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 137/157 (87%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +DPLIRQVVS  DG+DD LLNA+HHF+ FKSKFGK+Y T+EEHDYRF VFKANLRRAK+H
Sbjct  29   DDPLIRQVVS--DGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKH  85

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q++DP+A HGVTKFSDLTPKEFRR F G+      K +++LP DANKAPILPT +LPTDF
Sbjct  86   QMIDPTAAHGVTKFSDLTPKEFRRQFLGL------KRRLQLPTDANKAPILPTTDLPTDF  139

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVT VK+QGSCGSCWSFS TGALEGAH+LAT
Sbjct  140  DWRDHGAVTEVKDQGSCGSCWSFSATGALEGAHYLAT  176



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +DPLIRQVVS  DG+DD LLNA+HHF+ FKSKFGK+Y T+EEHDYRF VFKANLRRAK+H
Sbjct  29   DDPLIRQVVS--DGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKH  85

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q++DP+A HG+TKFSDLTPKEFRR F G+      K  +RLP DANKAPILPT +LPTD+
Sbjct  86   QMIDPTAAHGITKFSDLTPKEFRRQFLGL------KRWLRLPTDANKAPILPTTDLPTDY  139

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVT VK+QGSCGSCWSFS TGALEGAH+LAT
Sbjct  140  DWRDHGAVTEVKDQGSCGSCWSFSATGALEGAHYLAT  176



>gb|KDO84721.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=300

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 7/158 (4%)
 Frame = +2

Query  98   EDPLIRQVV-SEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            +D +IRQVV S+ +  +D LLNA+HHFSLFKSKF K+Y T+EEHDYRF VFKANLRRAKR
Sbjct  27   DDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKR  86

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
             QLLDP+AVHGVTKFSDLTP EFRR F G+++      ++RLPADA KAPILPT++LPTD
Sbjct  87   RQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNR------RLRLPADAQKAPILPTNDLPTD  140

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRDHGAVTGVK+QG+CGSCWSFS TGALEGAHFL+T
Sbjct  141  FDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLST  178



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 136/162 (84%), Gaps = 10/162 (6%)
 Frame = +2

Query  92   SAEDPLIRQVVSE---EDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLR  262
            S +DPLIRQVVS+   E+  DD LLNA+HHF+LFKSK+GK+Y ++EEHDYR  VFKANLR
Sbjct  25   SDDDPLIRQVVSDGGVEEDSDDHLLNAEHHFTLFKSKYGKTYASQEEHDYRLGVFKANLR  84

Query  263  RAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDN  442
            RAKRHQ+LDPSAVHGVTKFSDLTP EFRR + G+         ++LPADA KAPILPTDN
Sbjct  85   RAKRHQVLDPSAVHGVTKFSDLTPSEFRRQYLGLK-------PLKLPADAQKAPILPTDN  137

Query  443  LPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            LP DFDWRDH AVTGVK+QGSCGSCWSFS TGALEGAH+LAT
Sbjct  138  LPDDFDWRDHDAVTGVKDQGSCGSCWSFSATGALEGAHYLAT  179



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 143/180 (79%), Gaps = 12/180 (7%)
 Frame = +2

Query  35   LFSLLIIGLASASFVRAD--FSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
            +F L +   +SA F   D   S ++PLIRQVV    GD+D LL ADHHFSLFK KFGKSY
Sbjct  13   VFFLAVATASSAIFEERDDVVSNDNPLIRQVV----GDNDHLLTADHHFSLFKKKFGKSY  68

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             ++EEHDYRF+VFKAN+RRA RHQ LDPSAVHGVTKFSDLTP EFRR F G+      + 
Sbjct  69   ASKEEHDYRFAVFKANMRRALRHQKLDPSAVHGVTKFSDLTPAEFRRNFLGL------RP  122

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +++ PA ANKAPILPTDNLPTDFDWR+HGAVT VKNQGSCGSCWSFS TGALEGA+FLAT
Sbjct  123  RLKFPAHANKAPILPTDNLPTDFDWREHGAVTPVKNQGSCGSCWSFSATGALEGANFLAT  182



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score =   247 bits (630),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +DPLI QVVS  DG+DD LLNA+HHF+ FKSKFGK+Y T+EEHDYRF VFKANLRRAK+H
Sbjct  29   DDPLIIQVVS--DGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKH  85

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q++DP+A HGVTKFSDLTPKEFRR F G+      K ++RLP DANKAPILPT +LPTD+
Sbjct  86   QMIDPTAAHGVTKFSDLTPKEFRRQFLGL------KRRLRLPTDANKAPILPTTDLPTDY  139

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVT VK+QGSCGSCWSFS TGALEGAH+LAT
Sbjct  140  DWRDHGAVTEVKDQGSCGSCWSFSATGALEGAHYLAT  176



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   246 bits (628),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 144/185 (78%), Gaps = 12/185 (6%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAE--DPLIRQVVSEEDGDDDPLLNADHHFSLFKSK  193
            M+R    SL++    S+S +    S E  DPLIRQVV + +   D LL+A HHF+ FK+K
Sbjct  1    MERSCFLSLIVFAFLSSSILFTATSDELDDPLIRQVVPDVE---DYLLSAQHHFTAFKAK  57

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            FGK+Y T+EEHDYRF VFKANLRRA++HQL+DPSAVHGVTKFSDLTP+EFRR + G+   
Sbjct  58   FGKNYATQEEHDYRFKVFKANLRRAQKHQLMDPSAVHGVTKFSDLTPREFRRQYLGLK--  115

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                 K+RLPADA++APILPTD +P DFDWRDHGAVT VKNQGSCGSCWSFS  GALEGA
Sbjct  116  -----KLRLPADAHEAPILPTDGIPEDFDWRDHGAVTNVKNQGSCGSCWSFSAAGALEGA  170

Query  554  HFLAT  568
            HFLAT
Sbjct  171  HFLAT  175



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score =   246 bits (628),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +DPLI QVVS  DG+DD LLNA+HHF+ FKSKFGK+Y T+EEHDYRF VFKANLRRAK+H
Sbjct  29   DDPLIIQVVS--DGEDD-LLNAEHHFTSFKSKFGKTYATQEEHDYRFGVFKANLRRAKKH  85

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q++DP+A HGVTKFSDLTPKEFRR F G+      K ++RLP DANKAPILPT +LPTD+
Sbjct  86   QMIDPTAAHGVTKFSDLTPKEFRRQFLGL------KRRLRLPTDANKAPILPTTDLPTDY  139

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVT VK+QGSCGSCWSFS TGALEGAH+LAT
Sbjct  140  DWRDHGAVTEVKDQGSCGSCWSFSATGALEGAHYLAT  176



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 137/159 (86%), Gaps = 7/159 (4%)
 Frame = +2

Query  95   AEDPLIRQVV-SEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAK  271
             +D +IRQVV S+ +  +D LLNA+HHFSLFKSKF K+Y T+EEHDYRF VFKANLRRAK
Sbjct  26   GDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAK  85

Query  272  RHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPT  451
            R QLLDP+AVHGVTKFSDLTP EFRR F G+++      ++RLPADA KAPILPT++LPT
Sbjct  86   RRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNR------RLRLPADAQKAPILPTNDLPT  139

Query  452  DFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DFDWRDHGAVTGVK+QG+CGSCWSFS TGALEGAHFL+T
Sbjct  140  DFDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLST  178



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 7/158 (4%)
 Frame = +2

Query  98   EDPLIRQVV-SEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            +D +IRQVV S+ +  +D LLNA+HHFSLFKSKF K+Y T+EEHDYRF VFKANLRRAKR
Sbjct  27   DDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKR  86

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
             QLLDP+AVHGVTKFSDLTP EFRR F G+++      ++RLPADA KAPILPT++LPTD
Sbjct  87   RQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNR------RLRLPADAQKAPILPTNDLPTD  140

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRDHGAVTGVK+QG+CGSCWSFS TGALEGAHFL+T
Sbjct  141  FDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLST  178



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 7/158 (4%)
 Frame = +2

Query  98   EDPLIRQVV-SEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            +D +IRQVV S+ +  +D LLNA+HHFSLFKSKF K+Y T+EEHDYRF VFKANLRRAKR
Sbjct  27   DDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKR  86

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
             QLLDP+AVHGVTKFSDLTP EFRR F G+++      ++RLPADA KAPILPT++LPTD
Sbjct  87   RQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNR------RLRLPADAQKAPILPTNDLPTD  140

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRDHGAVTGVK+QG+CGSCWSFS TGALEGAHFL+T
Sbjct  141  FDWRDHGAVTGVKDQGACGSCWSFSATGALEGAHFLST  178



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 146/183 (80%), Gaps = 13/183 (7%)
 Frame = +2

Query  32   FLFSLLIIG--LASASFVRA--DFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            F FSLL +   LA+ S V A  D   +D LIRQVV + DGD   LLNADHHF++FK +FG
Sbjct  3    FRFSLLFLCTLLATTSLVFAAEDDDGDDVLIRQVVGDGDGD---LLNADHHFTVFKRRFG  59

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K+Y ++EEHDYR SVFKAN+RRAKRHQ LDP+AVHGVT+FSDLTP EFRR F G+++   
Sbjct  60   KAYASDEEHDYRLSVFKANMRRAKRHQELDPAAVHGVTQFSDLTPTEFRRKFLGLNR---  116

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
               +++ PADA  APILPTD LP+DFDWRDHGAVT VKNQG+CGSCWSFSTTGALEGA+F
Sbjct  117  ---RLKFPADAKTAPILPTDELPSDFDWRDHGAVTPVKNQGTCGSCWSFSTTGALEGANF  173

Query  560  LAT  568
            LAT
Sbjct  174  LAT  176



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 146/183 (80%), Gaps = 13/183 (7%)
 Frame = +2

Query  32   FLFSLLIIG--LASASFVRA--DFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            F FSLL +   LA+ S V A  D   +D LIRQVV + DGD   LLNADHHF++FK +FG
Sbjct  3    FRFSLLFLCTLLATTSLVFAAEDDDGDDILIRQVVGDGDGD---LLNADHHFTVFKRRFG  59

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K+Y ++EEHDYR SVFKAN+RRAKRHQ LDP+AVHGVT+FSDLTP EFRR F G+++   
Sbjct  60   KAYASDEEHDYRLSVFKANMRRAKRHQELDPAAVHGVTQFSDLTPTEFRRKFLGLNR---  116

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
               +++ PADA  APILPTD LP+DFDWRDHGAVT VKNQG+CGSCWSFSTTGALEGA+F
Sbjct  117  ---RLKFPADAKTAPILPTDELPSDFDWRDHGAVTPVKNQGTCGSCWSFSTTGALEGANF  173

Query  560  LAT  568
            LAT
Sbjct  174  LAT  176



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 136/159 (86%), Gaps = 8/159 (5%)
 Frame = +2

Query  92   SAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAK  271
            S ++P+IRQVV EE+  D+ LLNA+HHFSLFKSK+ K+Y T+ EHD+RF VFKANLRRA+
Sbjct  26   SFDNPIIRQVVPEEN--DEQLLNAEHHFSLFKSKYDKTYATQAEHDHRFRVFKANLRRAR  83

Query  272  RHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPT  451
            RHQLLDPSAVHGVT+FSDLTPKEFRR + G+      K K+RLP+DA KAPILPT +LPT
Sbjct  84   RHQLLDPSAVHGVTQFSDLTPKEFRRKYLGL------KRKLRLPSDAQKAPILPTSDLPT  137

Query  452  DFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DFDWRD GAVT VKNQGSCGSCWSFS TGALEGAHFLAT
Sbjct  138  DFDWRDQGAVTRVKNQGSCGSCWSFSATGALEGAHFLAT  176



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 144/177 (81%), Gaps = 16/177 (9%)
 Frame = +2

Query  68   ASFVRADFSAEDP------LIRQVVSEEDG----DDDPLLNADHHFSLFKSKFGKSYDTE  217
            A+  R  F+AED       LIRQVV   DG    D++ L+NADHHF++FK KFGK Y T+
Sbjct  18   ATSFRYSFAAEDVAGNDDLLIRQVVDHGDGGGAVDENSLVNADHHFTIFKRKFGKVYATQ  77

Query  218  EEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIR  397
            EEHDYRFSVFKANLRRA+RHQ LDP+AVHGVT+FSDLTP+EFRR F G+++      ++R
Sbjct  78   EEHDYRFSVFKANLRRARRHQKLDPAAVHGVTQFSDLTPREFRRQFLGLNR------RLR  131

Query  398  LPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            LP+DA+KAPILPT++LP DFDWRDHGAVT VKNQGSCGSCWSFSTTGALEGA+FLAT
Sbjct  132  LPSDAHKAPILPTNDLPMDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGANFLAT  188



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 137/166 (83%), Gaps = 10/166 (6%)
 Frame = +2

Query  77   VRADFSAEDPLIRQVVS--EEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFK  250
            V AD S  DPLIRQVV   E + + DPLL+ +HHF LFK+KFG++YDTEEEH+YR +VFK
Sbjct  18   VTADSS--DPLIRQVVQNDETEIESDPLLDPEHHFKLFKNKFGRTYDTEEEHEYRLTVFK  75

Query  251  ANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPIL  430
            +NLRRAKRHQ+LDP+A HGVTKFSDLTP EFR+ + G+      K K++LPADANKAPIL
Sbjct  76   SNLRRAKRHQVLDPTAKHGVTKFSDLTPSEFRKKYLGL------KSKLKLPADANKAPIL  129

Query  431  PTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            PT NLP DFDWRD GAVT VKNQGSCGSCWSFSTTGALEG+HFL T
Sbjct  130  PTSNLPQDFDWRDKGAVTPVKNQGSCGSCWSFSTTGALEGSHFLQT  175



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 138/180 (77%), Gaps = 7/180 (4%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
            F +FSL  + + S     A+ S  DPLIRQV   +DG +  LL A+HHFSLFKS+F KSY
Sbjct  32   FVIFSLCFVCVISTETFSAEGSEVDPLIRQVTDGQDGAEPQLLTAEHHFSLFKSRFKKSY  91

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             ++EEHDYRF VF+ NLRRA RHQ LDPSA HGVT+FSDLTP+EFRRT+ G+        
Sbjct  92   GSQEEHDYRFKVFQDNLRRAARHQKLDPSASHGVTQFSDLTPREFRRTYLGLR-------  144

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ++RLP DA +APILPTDNLP DFDW + GAVT VKNQGSCGSCWSFSTTGALEGA+FLAT
Sbjct  145  RLRLPKDATEAPILPTDNLPEDFDWSEKGAVTPVKNQGSCGSCWSFSTTGALEGANFLAT  204



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 146/188 (78%), Gaps = 15/188 (8%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSA-----EDPLIRQVVSEEDGDDDPLLNADHHFSLF  184
            MDRFFL  LL++  +       D +      ED LIRQVV+    DDD L+NA+HHF+ F
Sbjct  1    MDRFFLSVLLLLLSSLILASATDSTVSSNEPEDLLIRQVVAH---DDDLLMNAEHHFTNF  57

Query  185  KSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGV  364
            KSKFGKSY T EEH YR  VFKANLRRA+RHQ LDPSAVHG+T+FSDLTP EFRRT+ G+
Sbjct  58   KSKFGKSYATREEHAYRLGVFKANLRRARRHQKLDPSAVHGITQFSDLTPAEFRRTYLGL  117

Query  365  HKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGAL  544
                    ++R+PADA+KAPILPT++LPTDFDWRDHGAVT VKNQGSCGSCWSFSTTGAL
Sbjct  118  K-------RLRIPADAHKAPILPTNDLPTDFDWRDHGAVTAVKNQGSCGSCWSFSTTGAL  170

Query  545  EGAHFLAT  568
            EGA+FLAT
Sbjct  171  EGANFLAT  178



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 142/183 (78%), Gaps = 12/183 (7%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR FL S L   L S++     FS +DPLIRQVVS    DD+ +LNA+HHFSLFK+KFG
Sbjct  1    MDRLFLLSFLAFALFSSAIA---FSDDDPLIRQVVS--GNDDNHMLNAEHHFSLFKAKFG  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K Y ++EEHD+R  VFKANL RAKRHQLLDPSA HG+T+FSDLTP EFRRT+ G++K R 
Sbjct  56   KIYASQEEHDHRLKVFKANLHRAKRHQLLDPSAEHGITQFSDLTPSEFRRTYLGLNKPRP  115

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
                     +A KAPILPT +LP+DFDWR+ GAVT VKNQGSCGSCWSFSTTGA+EGAHF
Sbjct  116  N-------LNAEKAPILPTKDLPSDFDWREKGAVTDVKNQGSCGSCWSFSTTGAVEGAHF  168

Query  560  LAT  568
            LAT
Sbjct  169  LAT  171



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 138/169 (82%), Gaps = 9/169 (5%)
 Frame = +2

Query  62   ASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFS  241
            A+ S V A+   +D LIRQVV + DGD   LLNADHHF++FK +FGK+Y ++EEHDYR S
Sbjct  15   ATTSLVFAEDDGDDILIRQVVGDGDGD---LLNADHHFAVFKRRFGKAYASDEEHDYRLS  71

Query  242  VFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKA  421
            VFKAN+RRAKRHQ LDP+AVHGVT+FSDLTP EFRR F G+++      +++ PADA  A
Sbjct  72   VFKANMRRAKRHQQLDPAAVHGVTQFSDLTPTEFRRKFLGLNR------RLKFPADAKTA  125

Query  422  PILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            PILPTD LP+DFDWRD GAVT VKNQG+CGSCWSFSTTGALEGA+FLAT
Sbjct  126  PILPTDELPSDFDWRDRGAVTPVKNQGTCGSCWSFSTTGALEGANFLAT  174



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 134/160 (84%), Gaps = 9/160 (6%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRA  268
            FS +DPLIRQVVSE D  D+ +LNA+HHFSLFKSK+GK Y ++EEHD+R  VFKANLRRA
Sbjct  21   FSDDDPLIRQVVSETD--DNHMLNAEHHFSLFKSKYGKIYASQEEHDHRLKVFKANLRRA  78

Query  269  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLP  448
            +RHQLLDP+A HG+T+FSDLTP EFRRT+ G+HK R K        +A KAPILPT +LP
Sbjct  79   RRHQLLDPTAEHGITQFSDLTPSEFRRTYLGLHKPRPK-------LNAQKAPILPTSDLP  131

Query  449  TDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             DFDWR+ GAVTGVKNQGSCGSCWSFSTTGA+EGAHFLAT
Sbjct  132  EDFDWREKGAVTGVKNQGSCGSCWSFSTTGAVEGAHFLAT  171



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 133/163 (82%), Gaps = 10/163 (6%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDD---PLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANL  259
             S + PLIRQV S+   ++D    LLNA+HHF+LFKSKFGK+Y T+EEHDYR  VFKAN+
Sbjct  24   ISNDGPLIRQVASDGVAEEDFVDQLLNAEHHFTLFKSKFGKTYATKEEHDYRLGVFKANM  83

Query  260  RRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTD  439
            RRAKRHQLLDP+A HGVTKFSDLTP EFRR F G+         ++LPADA KAPILPTD
Sbjct  84   RRAKRHQLLDPTAFHGVTKFSDLTPSEFRRQFLGLK-------PLKLPADAQKAPILPTD  136

Query  440  NLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +LP DFDWRD GAVTGVK+QGSCGSCWSFSTTGALEGAH+LAT
Sbjct  137  DLPDDFDWRDQGAVTGVKDQGSCGSCWSFSTTGALEGAHYLAT  179



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 145/187 (78%), Gaps = 14/187 (7%)
 Frame = +2

Query  29   FFLFSLLI-----IGLASASFVRADFSAEDPLIRQVVSEEDG---DDDPLLNADHHFSLF  184
             FL SLLI       +A A+       ++DPLIRQVV   D    D++ LLNAD+HF++F
Sbjct  8    LFLSSLLIATSFGCSIADANVAEGVVGSDDPLIRQVVDHGDDEVVDENSLLNADYHFAIF  67

Query  185  KSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGV  364
            K KFGKSY ++EEHDYRFSVFKANL  A+RHQ LDPSAVHGVT+FSDLTP+EFR  F G+
Sbjct  68   KRKFGKSYASQEEHDYRFSVFKANLHLARRHQKLDPSAVHGVTQFSDLTPREFRHQFLGI  127

Query  365  HKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGAL  544
            ++      ++RLP+ ANKAPILPT++LPTDFD RDHGAVT VKNQGSCGSCWSFSTTGAL
Sbjct  128  NR------RLRLPSHANKAPILPTNDLPTDFDXRDHGAVTPVKNQGSCGSCWSFSTTGAL  181

Query  545  EGAHFLA  565
            EGA+FLA
Sbjct  182  EGANFLA  188



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 131/156 (84%), Gaps = 8/156 (5%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            DPLI+QVVSE D  DD LL+A+ HFS FK+ FGK+Y T+EEHDYRF VFKANLRRAKRHQ
Sbjct  28   DPLIQQVVSESD--DDQLLHAERHFSSFKATFGKTYATQEEHDYRFGVFKANLRRAKRHQ  85

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
             LDP+AVHGVTKFSDLTPKEFRR F G+      K ++RLPADANKAPILPT +LP DFD
Sbjct  86   ALDPTAVHGVTKFSDLTPKEFRRNFLGL------KRRLRLPADANKAPILPTGDLPADFD  139

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WRD GAVT VK+QGSCGSCW+FS TGALEGAH+L T
Sbjct  140  WRDKGAVTPVKDQGSCGSCWAFSATGALEGAHYLET  175



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score =   239 bits (610),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +D LIRQVV +   DDD LLNADHHF++FK +FGK+Y ++EEH YRFSVFKANLRRA RH
Sbjct  33   DDILIRQVVGD---DDDHLLNADHHFTIFKRRFGKTYASDEEHHYRFSVFKANLRRAMRH  89

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDPSAVHGVT+FSDLTP EFRR F GV++      ++RLP+DANKAPILPT++LP+ F
Sbjct  90   QKLDPSAVHGVTQFSDLTPAEFRRNFLGVNR------RLRLPSDANKAPILPTEDLPSGF  143

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVT VKNQGSCGSCWSFSTTGALEGA +L+T
Sbjct  144  DWRDHGAVTSVKNQGSCGSCWSFSTTGALEGATYLST  180



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   239 bits (610),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 141/180 (78%), Gaps = 8/180 (4%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
            F +FSLLI+    A  + +  + EDPLIRQVV +  G+   +L+A+HHFSLFK KFGKSY
Sbjct  8    FSIFSLLIVSAVIAETLTSSETVEDPLIRQVVDDGRGEAH-VLSAEHHFSLFKKKFGKSY  66

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             ++EEH+YRF VF+ANLRRA RHQ LDPSA HGVT+FSDLTP EF++ F G+        
Sbjct  67   ASQEEHNYRFKVFQANLRRAARHQKLDPSASHGVTQFSDLTPAEFKKQFLGLR-------  119

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             +RLP DA++APILPT++LP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGAHFL+T
Sbjct  120  SLRLPKDAHQAPILPTNDLPEDFDWREKGAVTNVKNQGSCGSCWSFSTTGALEGAHFLST  179



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 134/156 (86%), Gaps = 6/156 (4%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            DPLIRQVV   + + D LLNADHHFSLFKSK+GKSY T+EEHD RFSVFKANLRRAK+ Q
Sbjct  1    DPLIRQVVDGVE-EIDLLLNADHHFSLFKSKYGKSYATQEEHDRRFSVFKANLRRAKKRQ  59

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
            LLDPSAVHG+TKFSDLTP EF++TF G+H  R     ++LP+DANKAP+LPT++LP +FD
Sbjct  60   LLDPSAVHGITKFSDLTPAEFKKTFLGLHTKR-----VKLPSDANKAPVLPTNDLPENFD  114

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WR+ GAVT VK+QGSCGSCW+FSTTGALEGA FL+T
Sbjct  115  WREKGAVTAVKDQGSCGSCWTFSTTGALEGATFLST  150



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 131/156 (84%), Gaps = 8/156 (5%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            DPLI+QVVSE D  DD LL+A+ HFS FK+ FGK+Y T+EE+DYRF VFKANLRRAKRHQ
Sbjct  29   DPLIQQVVSESD--DDQLLHAERHFSSFKATFGKAYATQEEYDYRFGVFKANLRRAKRHQ  86

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
             LDP+AVHGVTKFSDLTPKEFRR F G+      K ++RLPADANKAPILPT +LP DFD
Sbjct  87   ALDPTAVHGVTKFSDLTPKEFRRNFLGL------KRRLRLPADANKAPILPTSDLPADFD  140

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WRD GAVT VK+QGSCGSCW+FS TGALEGAH+L T
Sbjct  141  WRDKGAVTPVKDQGSCGSCWAFSATGALEGAHYLET  176



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 135/167 (81%), Gaps = 10/167 (6%)
 Frame = +2

Query  68   ASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVF  247
            AS V    + +D LIRQVVS     DD LL+A+HHFS FK++FGK+Y+TEEEHDYRF VF
Sbjct  20   ASTVAPKETDDDLLIRQVVS---AGDDQLLSAEHHFSSFKARFGKAYETEEEHDYRFEVF  76

Query  248  KANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPI  427
            KANLRRAK HQ LDP+AVHGVTKFSDLTP EFR+ F G+        ++RLPAD  KAPI
Sbjct  77   KANLRRAKTHQKLDPNAVHGVTKFSDLTPGEFRKKFLGLK-------RLRLPADTQKAPI  129

Query  428  LPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            LPT++LP DFDWRDHGAVT VK+QGSCGSCWSFSTTGALEGAHFLAT
Sbjct  130  LPTNDLPADFDWRDHGAVTLVKDQGSCGSCWSFSTTGALEGAHFLAT  176



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 143/183 (78%), Gaps = 13/183 (7%)
 Frame = +2

Query  32   FLFSLLIIG--LASASFVRA--DFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            F FSLL +   LA+ S V A  D   +D LIRQVV + DGD   LLNADHHF++FK +FG
Sbjct  3    FRFSLLFLCTLLATTSLVFAAEDDDGDDILIRQVVGDGDGD---LLNADHHFTVFKRRFG  59

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K+Y ++EEHDYR SVFKAN+RRAKRHQ LDP+AVHGVT+FSD TP EFRR F G+++   
Sbjct  60   KAYASDEEHDYRLSVFKANMRRAKRHQELDPAAVHGVTQFSDSTPTEFRRKFLGLNR---  116

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
               +++ PADA  APILPTD LP+DFDWRD GAVT VKNQG+CG CWSFSTTGALEGA+F
Sbjct  117  ---RLKFPADAKTAPILPTDELPSDFDWRDRGAVTPVKNQGTCGLCWSFSTTGALEGANF  173

Query  560  LAT  568
            LAT
Sbjct  174  LAT  176



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score =   236 bits (603),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 140/181 (77%), Gaps = 12/181 (7%)
 Frame = +2

Query  26   RFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKS  205
            R FL S L   L S++     FS +DPLIRQVVS    DD+ +LNA+HHFSLFK+KFGK 
Sbjct  1    RLFLLSFLAFALFSSAIA---FSDDDPLIRQVVS--GNDDNHMLNAEHHFSLFKAKFGKI  55

Query  206  YDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKK  385
            Y ++EEHD+R  VFKANL RAKRHQLLDPSA HG+T+FSDLTP EFRRT+ G++K R   
Sbjct  56   YASQEEHDHRLKVFKANLHRAKRHQLLDPSAEHGITQFSDLTPSEFRRTYLGLNKPRPN-  114

Query  386  LKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLA  565
                   +A KAPILPT +LP+DFDWR+ GAVT VKNQGSCGSCWSFSTTGA+EGAHFLA
Sbjct  115  ------LNAEKAPILPTKDLPSDFDWREKGAVTDVKNQGSCGSCWSFSTTGAVEGAHFLA  168

Query  566  T  568
            T
Sbjct  169  T  169



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 142/182 (78%), Gaps = 8/182 (4%)
 Frame = +2

Query  38   FSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGD-----DDPLLNADHHFSLFKSKFGK  202
            FSLL   L     + +  + +D LIRQV +E+        +D LLNADHHFSLFKSKF K
Sbjct  5    FSLLTFSLFIILSLSSAIADDDLLIRQVTTEDSSSSSSSPNDLLLNADHHFSLFKSKFNK  64

Query  203  SYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAK  382
             Y ++EEHD RFS+FKANLRRA RHQ LDPSAVHGVTKFSDLTP+EFR+ + G++     
Sbjct  65   IYSSKEEHDNRFSIFKANLRRASRHQTLDPSAVHGVTKFSDLTPREFRQKYLGLN---GG  121

Query  383  KLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFL  562
            K K++LP+DANKAP+LPTD+LP DFDWR+HGAVT VK+QG CGSCWSFSTTGALEGA++L
Sbjct  122  KRKLKLPSDANKAPVLPTDSLPEDFDWREHGAVTEVKDQGQCGSCWSFSTTGALEGANYL  181

Query  563  AT  568
            AT
Sbjct  182  AT  183



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 143/182 (79%), Gaps = 12/182 (7%)
 Frame = +2

Query  29   FFLFSLLIIG--LASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGK  202
             FLFSL +    L SA+    +   +  LIRQV+     DDD LLN DHHF++FK +FGK
Sbjct  8    IFLFSLFLTTSFLVSANGY-INGGDDGILIRQVIGN---DDDHLLNVDHHFTIFKKRFGK  63

Query  203  SYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAK  382
            +Y ++EEH YR SVFKANLRRA RHQ LDPSAVHGVT+FSDLTP EFRR F GV++    
Sbjct  64   TYASDEEHHYRLSVFKANLRRAMRHQKLDPSAVHGVTQFSDLTPAEFRRKFLGVNR----  119

Query  383  KLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFL  562
              ++RLP+DANKAP+LPT++LP+DFDWRDHGAVT VKNQGSCGSCWSFSTTGALEGA++L
Sbjct  120  --RLRLPSDANKAPVLPTEDLPSDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGANYL  177

Query  563  AT  568
            +T
Sbjct  178  ST  179



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 137/183 (75%), Gaps = 10/183 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR   F L+   L + S    D    D  IRQVV EE+   D LLNA HHFSLFKSK+ 
Sbjct  1    MDRVVFFFLIAAALLAVSLGSGD--GFDNPIRQVVPEEN---DELLNAAHHFSLFKSKYE  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K+Y T++EHD+RF VFKANLRRAKR+QLLDPSAVHGVT+FSDLTPKEFRR F G+     
Sbjct  56   KTYATQDEHDHRFRVFKANLRRAKRNQLLDPSAVHGVTQFSDLTPKEFRRQFLGL-----  110

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
            K+ K RLP D   APILPT +LPTDFDWR+ GAVT VKNQG CGSCWSFS TGALEGAHF
Sbjct  111  KRQKFRLPTDTEIAPILPTTDLPTDFDWREQGAVTPVKNQGLCGSCWSFSATGALEGAHF  170

Query  560  LAT  568
            LAT
Sbjct  171  LAT  173



>gb|KJB79049.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
 gb|KJB79051.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=211

 Score =   231 bits (589),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 133/180 (74%), Gaps = 7/180 (4%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
            F +FS  I+G+       A+    DPLI QV    +G +  LL A+HHFSLFK +F KSY
Sbjct  10   FVIFSFFIVGVICTETFSAEGFEVDPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSY  69

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             +++EHDYRF +F+ NLRRA RHQ LDPSA HGVT+FSDLTP EFR+ + G+        
Sbjct  70   GSQKEHDYRFKIFQVNLRRAARHQNLDPSATHGVTQFSDLTPGEFRKAYLGLR-------  122

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ++RLP DA +APILPTDNLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGA+FLAT
Sbjct  123  RLRLPKDATEAPILPTDNLPQDFDWREKGAVTPVKNQGSCGSCWSFSTTGALEGANFLAT  182



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 129/158 (82%), Gaps = 8/158 (5%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
             EDPLIRQVVS   GDDD  L A+ HF  FK +FGK+Y T EEHDYR  VFKANLRRA+ 
Sbjct  29   GEDPLIRQVVSS-GGDDDLALGAERHFVDFKLRFGKAYATPEEHDYRLGVFKANLRRARL  87

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            HQ LDPSAVHGVTKFSDLTP+EFRR F G+ +       +RLP DANKAP+LPTD+LPT+
Sbjct  88   HQKLDPSAVHGVTKFSDLTPEEFRRQFLGLKR-------LRLPTDANKAPVLPTDDLPTE  140

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRD GAVTGVK+QG+CGSCWSFSTTGALEGAHFLAT
Sbjct  141  FDWRDRGAVTGVKDQGACGSCWSFSTTGALEGAHFLAT  178



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 142/182 (78%), Gaps = 13/182 (7%)
 Frame = +2

Query  32   FLFSLLIIG--LASASFV-RADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGK  202
            F FSLL +   LA+   V  A+   +D LIRQVV    GD   LLNADHHF++FK +FGK
Sbjct  3    FRFSLLFLCTLLATTYLVFAAEDDGDDILIRQVV----GDGGDLLNADHHFTVFKRRFGK  58

Query  203  SYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAK  382
             Y ++EEHDYR SVFKAN+RRAK+HQ LDP+AVHGVT+FSDLTP EFRR F G+++    
Sbjct  59   VYASDEEHDYRLSVFKANMRRAKQHQELDPAAVHGVTQFSDLTPTEFRRKFLGLNR----  114

Query  383  KLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFL  562
              +++ PADA  APILPTD LP+DFDWRDHGAVT VKNQG+CGSCWSFSTTGALEGA+FL
Sbjct  115  --RLKFPADAKTAPILPTDELPSDFDWRDHGAVTPVKNQGTCGSCWSFSTTGALEGANFL  172

Query  563  AT  568
            AT
Sbjct  173  AT  174



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score =   236 bits (601),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 133/175 (76%), Gaps = 21/175 (12%)
 Frame = +2

Query  80   RADFSAEDPLIRQVVSEEDGDDDP------------LLNADHHFSLFKSKFGKSYDTEEE  223
            RAD    DPLIRQVV  + GD+ P            +L A+HHFSLFK KFGKSY ++EE
Sbjct  19   RADVDVSDPLIRQVV--DGGDESPHHHHHHDHDGEAMLGAEHHFSLFKRKFGKSYASQEE  76

Query  224  HDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLP  403
            HDYRFSVFK N+RRAKRHQ LDP+A HGVT+FSDLTP EFR++  G+         ++LP
Sbjct  77   HDYRFSVFKTNMRRAKRHQRLDPTAQHGVTRFSDLTPAEFRKSHLGLR-------GLKLP  129

Query  404  ADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ADAN APILPT+NLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGAHFLAT
Sbjct  130  ADANTAPILPTENLPEDFDWRERGAVTEVKNQGSCGSCWSFSTTGALEGAHFLAT  184



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 138/184 (75%), Gaps = 10/184 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFS-AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKF  196
            MDR F+FS+ ++ L       +D S  ED LIRQVV E       +L+++ HFSLFK KF
Sbjct  1    MDRTFVFSVFVLFLFVVISSASDASDGEDILIRQVVDETK---PKVLSSEDHFSLFKRKF  57

Query  197  GKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSR  376
            GK Y + EEHDYRFSVF+ANL RAKRHQ LDPSA HGVT+FSDLTP EFRR F GV    
Sbjct  58   GKVYGSREEHDYRFSVFRANLLRAKRHQKLDPSAQHGVTQFSDLTPSEFRRRFLGV----  113

Query  377  AKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAH  556
              K   +LP DAN+APILPTD LP DFDWRDHGAVT VKNQGSCGSCWSFSTTGALEGAH
Sbjct  114  --KGGFKLPKDANQAPILPTDKLPEDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGAH  171

Query  557  FLAT  568
            FL+T
Sbjct  172  FLST  175



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 136/185 (74%), Gaps = 25/185 (14%)
 Frame = +2

Query  38   FSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPL--------LNADHHFSLFKSK  193
            FSLLI+        RA   + DPLIRQVV   DG D+          L A+HHFSLFK K
Sbjct  11   FSLLIVS-------RAQLDSTDPLIRQVV---DGGDESHHHHDHDHALGAEHHFSLFKHK  60

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            FGKSY ++EEHDYRF VFKANLRRA RHQ LDPSA HGVT+FSD+TP EFR++  G+   
Sbjct  61   FGKSYASKEEHDYRFDVFKANLRRAARHQRLDPSAQHGVTRFSDMTPAEFRKSQLGLRG-  119

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                  ++LP DA KAPILPT+NLP DFDWR+HGAVT VKNQGSCGSCWSFSTTGALEGA
Sbjct  120  ------LKLPEDATKAPILPTENLPEDFDWREHGAVTAVKNQGSCGSCWSFSTTGALEGA  173

Query  554  HFLAT  568
            HFLAT
Sbjct  174  HFLAT  178



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 139/185 (75%), Gaps = 16/185 (9%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDP-----LLNADHHFSLFKSK  193
            + LFSLL +    A  + +    EDPLIRQVV   DG D+      LL+ +HHFSLFKSK
Sbjct  7    YVLFSLLFVSAVVAETLTSS-GREDPLIRQVV---DGQDESSTSPHLLSEEHHFSLFKSK  62

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            F KSY +++EHDYRF VFKANLRRA RHQ LDP+A HGVT+FSDLTP EFRR F G+   
Sbjct  63   FKKSYTSQQEHDYRFKVFKANLRRAARHQKLDPTASHGVTQFSDLTPAEFRRQFLGLR--  120

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                 ++RLP DAN+APILPT+ LP DFDWR+ GAV+ VKNQGSCGSCWSFSTTGALEGA
Sbjct  121  -----RLRLPKDANQAPILPTNELPDDFDWREKGAVSPVKNQGSCGSCWSFSTTGALEGA  175

Query  554  HFLAT  568
            HFLAT
Sbjct  176  HFLAT  180



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 143/188 (76%), Gaps = 15/188 (8%)
 Frame = +2

Query  35   LFSLLII-GLASASFVRADF----SAEDPLIRQVV-----SEEDGDDDPLLNADHHFSLF  184
             FSL+++  L +AS + ++     S  D +IRQVV     +E    DD LL ADHHFS+F
Sbjct  4    CFSLIVVLSLLAASAIGSEVISGESDGDFIIRQVVDDGGVNEGSNGDDLLLGADHHFSVF  63

Query  185  KSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGV  364
            K KFGKSY ++EEHD+RF VFKANL+RA+RHQ LDPSA HGVT+FSDLTP EFRR+F G+
Sbjct  64   KQKFGKSYASKEEHDHRFRVFKANLKRAQRHQALDPSATHGVTQFSDLTPSEFRRSFLGL  123

Query  365  HKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGAL  544
               R     + LPADANKAPILPTD LPTDFDWRD GAV+ VKNQGSCGSCWSFS TGAL
Sbjct  124  RSRR-----LGLPADANKAPILPTDGLPTDFDWRDKGAVSEVKNQGSCGSCWSFSATGAL  178

Query  545  EGAHFLAT  568
            EGA+FLAT
Sbjct  179  EGANFLAT  186



>gb|KJB79048.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=263

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 133/180 (74%), Gaps = 7/180 (4%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
            F +FS  I+G+       A+    DPLI QV    +G +  LL A+HHFSLFK +F KSY
Sbjct  10   FVIFSFFIVGVICTETFSAEGFEVDPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSY  69

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             +++EHDYRF +F+ NLRRA RHQ LDPSA HGVT+FSDLTP EFR+ + G+        
Sbjct  70   GSQKEHDYRFKIFQVNLRRAARHQNLDPSATHGVTQFSDLTPGEFRKAYLGLR-------  122

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ++RLP DA +APILPTDNLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGA+FLAT
Sbjct  123  RLRLPKDATEAPILPTDNLPQDFDWREKGAVTPVKNQGSCGSCWSFSTTGALEGANFLAT  182



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 131/166 (79%), Gaps = 12/166 (7%)
 Frame = +2

Query  80   RADFSAEDPLIRQVVSEEDGDD---DPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFK  250
            RA     DPLIRQVV  + GDD   D  L A+HHFSLFK +FGKSY ++EEHDYRF VFK
Sbjct  18   RAQSDGADPLIRQVV--DGGDDHQHDHRLGAEHHFSLFKHQFGKSYASQEEHDYRFEVFK  75

Query  251  ANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPIL  430
            ANLRRA RHQ+LDPSA HGVT+FSD+TP EFR++  G+         +RLP+DA KAPIL
Sbjct  76   ANLRRAARHQMLDPSAQHGVTRFSDMTPAEFRKSQLGLRG-------LRLPSDATKAPIL  128

Query  431  PTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            PT+NLP DFDWRD GAVT VKNQGSCGSCWSFSTTGALEGAHFLAT
Sbjct  129  PTENLPEDFDWRDRGAVTAVKNQGSCGSCWSFSTTGALEGAHFLAT  174



>gb|KJB79050.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=285

 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 133/180 (74%), Gaps = 7/180 (4%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
            F +FS  I+G+       A+    DPLI QV    +G +  LL A+HHFSLFK +F KSY
Sbjct  10   FVIFSFFIVGVICTETFSAEGFEVDPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSY  69

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             +++EHDYRF +F+ NLRRA RHQ LDPSA HGVT+FSDLTP EFR+ + G+        
Sbjct  70   GSQKEHDYRFKIFQVNLRRAARHQNLDPSATHGVTQFSDLTPGEFRKAYLGLR-------  122

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ++RLP DA +APILPTDNLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGA+FLAT
Sbjct  123  RLRLPKDATEAPILPTDNLPQDFDWREKGAVTPVKNQGSCGSCWSFSTTGALEGANFLAT  182



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 6/158 (4%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            A DPLIRQVV     +DD LL+A+ HFS FK+ FGKSY ++EEHDYRF VFKANLRRAKR
Sbjct  25   AGDPLIRQVVPGA-AEDDELLHAERHFSNFKATFGKSYASQEEHDYRFGVFKANLRRAKR  83

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            HQ LDP+AVHGVTKFSDLTPKEFRR F G+     KK ++RLPADANKAPILPT++LPT+
Sbjct  84   HQGLDPTAVHGVTKFSDLTPKEFRRNFLGL-----KKRRLRLPADANKAPILPTNDLPTE  138

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWR+ GAVT VK+QG+CGSCWSFS  GALEGAH+L T
Sbjct  139  FDWREKGAVTPVKDQGACGSCWSFSAAGALEGAHYLTT  176



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 141/183 (77%), Gaps = 10/183 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR  +FS LI     A  + +   +++P IRQVV EE+   D LLNA+HHFSLFKSK+ 
Sbjct  1    MDRV-VFSFLIAAALLAVSLGSGEGSDNP-IRQVVPEEN---DELLNAEHHFSLFKSKYQ  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K+Y T+EEHD+R  VFKANLRRA+R+QLLDPSAVHGVT+FSDLTPKEFRR F G+     
Sbjct  56   KTYATQEEHDHRLRVFKANLRRARRNQLLDPSAVHGVTQFSDLTPKEFRRQFLGL-----  110

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
            K+ K RLP D   APILPT +LPT+FDWR+ GAVT VKNQG CGSCWSFS TGALEGAHF
Sbjct  111  KRRKFRLPTDTETAPILPTTDLPTEFDWREQGAVTPVKNQGMCGSCWSFSATGALEGAHF  170

Query  560  LAT  568
            LAT
Sbjct  171  LAT  173



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 143/193 (74%), Gaps = 24/193 (12%)
 Frame = +2

Query  20   MDRFFLF----------SLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADH  169
            MDRF             S  I+ +AS   + A F   D  IRQVV E     D LL+A+H
Sbjct  1    MDRFIFSLSLSLSLSLTSYPIVSVASPGEIDAGF---DNPIRQVVPE-----DHLLHAEH  52

Query  170  HFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRR  349
            HFSLFKSK+ KSY T+EEHDYRF +FKANLRR++RHQ+LDPSAVHGVTKFSDLTPKEFRR
Sbjct  53   HFSLFKSKYSKSYATQEEHDYRFRIFKANLRRSRRHQVLDPSAVHGVTKFSDLTPKEFRR  112

Query  350  TFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFS  529
             F G+      K ++RLPADA +A ILPT++LPT+FDWRDHGAV  VK+QGSCGSCWSFS
Sbjct  113  QFLGL------KRRLRLPADAQQAQILPTNDLPTEFDWRDHGAVAPVKDQGSCGSCWSFS  166

Query  530  TTGALEGAHFLAT  568
             TGALEGAHFL+T
Sbjct  167  ATGALEGAHFLST  179



>ref|XP_003606999.1| Cysteine proteinase [Medicago truncatula]
Length=210

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 135/183 (74%), Gaps = 11/183 (6%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MD   L   +++ + S S        EDP+IRQVV EE       L A+HHF+LFK KFG
Sbjct  1    MDHRTLLLFVVLFIFSVSAFSTPDEGEDPIIRQVVDEEGVR----LGAEHHFNLFKHKFG  56

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K Y +++EHDYRF +FK+NL RAKRHQL+DPSAVHGVT+FSDLTP+EFR++  G+     
Sbjct  57   KVYSSKDEHDYRFKIFKSNLNRAKRHQLMDPSAVHGVTRFSDLTPREFRKSVLGLR----  112

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
                + LP DAN APILPTDNLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGAHF
Sbjct  113  ---GVGLPKDANAAPILPTDNLPKDFDWREKGAVTAVKNQGSCGSCWSFSTTGALEGAHF  169

Query  560  LAT  568
            L+T
Sbjct  170  LST  172



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 131/166 (79%), Gaps = 12/166 (7%)
 Frame = +2

Query  80   RADFSAEDPLIRQVVSEEDGDD---DPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFK  250
            RA   + DPLIRQVV  + GDD   D  L A+HHFSLFK +FGKSY ++EEHDYRF VFK
Sbjct  18   RAQSDSADPLIRQVV--DGGDDHQHDHRLGAEHHFSLFKHQFGKSYASQEEHDYRFEVFK  75

Query  251  ANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPIL  430
            ANLRRA RHQ LDPSA HGVT+FSD+TP EFR++  G+         +RLPADA KAPIL
Sbjct  76   ANLRRAARHQRLDPSAQHGVTRFSDMTPAEFRKSQLGLRG-------LRLPADATKAPIL  128

Query  431  PTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            PT+NLP DFDWRD GAVT VKNQGSCGSCWSFSTTGALEGAHFLAT
Sbjct  129  PTENLPEDFDWRDRGAVTAVKNQGSCGSCWSFSTTGALEGAHFLAT  174



>ref|XP_010436538.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=227

 Score =   229 bits (585),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 135/183 (74%), Gaps = 10/183 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR   F L+   L + S    +    D  IRQVV EE+   D LLNA+HHFSLFKSK+ 
Sbjct  1    MDRVVFFFLIAAALLAVSLGSGE--GLDNPIRQVVPEEN---DELLNAEHHFSLFKSKYQ  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K+Y T++EHD+R  VFKANLRRA+R+QLLDPSAVHGVT+FSDLTPKEF R   G+     
Sbjct  56   KTYATQQEHDHRLRVFKANLRRARRNQLLDPSAVHGVTQFSDLTPKEFSRQLMGL-----  110

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
            K+ K RLP D   APILPT +LPT+FDWR+ GAVT VKNQG CGSCWSFS TGALEGAHF
Sbjct  111  KRRKFRLPTDTETAPILPTTDLPTEFDWREQGAVTPVKNQGMCGSCWSFSATGALEGAHF  170

Query  560  LAT  568
            LAT
Sbjct  171  LAT  173



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 137/183 (75%), Gaps = 10/183 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR   F L+   L + S    +    D  IRQVV EE+   D LLNA+HHFSLFKSK+ 
Sbjct  1    MDRVVFFFLIAAALLAVSLGSGE--GLDNPIRQVVPEEN---DELLNAEHHFSLFKSKYQ  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K+Y T++EHD+R  VFKANLRRA+R+QLLDPSAVHGVT+FSDLTPKEFRR F G+     
Sbjct  56   KTYATQQEHDHRLRVFKANLRRARRNQLLDPSAVHGVTQFSDLTPKEFRRQFLGL-----  110

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
            K+ K RLP D   APILPT +LPT+FDWR+ GAVT VKNQG CGSCWSFS TGALEGAHF
Sbjct  111  KRRKFRLPTDTETAPILPTTDLPTEFDWREQGAVTPVKNQGMCGSCWSFSATGALEGAHF  170

Query  560  LAT  568
            LAT
Sbjct  171  LAT  173



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 140/189 (74%), Gaps = 14/189 (7%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAE------DPLIRQVVSEEDGDDDPLLNADHHFSL  181
            MDR   F L+   L + S   A  S E      +P IRQVV EE+  D+ LLNA+HHFSL
Sbjct  1    MDRVVFFFLIAATLLAVSLGSAVISGEVNYGFVNP-IRQVVPEEN--DEHLLNAEHHFSL  57

Query  182  FKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHG  361
            FKSK+ K+Y T+EEHD+RF VFKANLRRA+R+QLLDPSAVHGVT+FSDLTPKEFRR F G
Sbjct  58   FKSKYEKTYATQEEHDHRFRVFKANLRRARRNQLLDPSAVHGVTQFSDLTPKEFRRKFLG  117

Query  362  VHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGA  541
            +     K+   RLP D   APILPT +LPT+FDWR+ GAVT VKNQG CGSCWSFS  GA
Sbjct  118  L-----KRRGFRLPTDTQTAPILPTSDLPTEFDWREQGAVTPVKNQGMCGSCWSFSAIGA  172

Query  542  LEGAHFLAT  568
            LEGAHFLAT
Sbjct  173  LEGAHFLAT  181



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 137/185 (74%), Gaps = 25/185 (14%)
 Frame = +2

Query  38   FSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDP--------LLNADHHFSLFKSK  193
            FSLLI+        RA   + DPLIRQVV   DG D+         +L A+HHFSLFK K
Sbjct  11   FSLLIVS-------RAQSDSADPLIRQVV---DGGDESHHDHDHDHVLGAEHHFSLFKHK  60

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            +GKSY ++EEHDYRF VFKANLRRA RHQ LDPSA HGVT+FSD+TP EFR++  G+   
Sbjct  61   YGKSYASKEEHDYRFDVFKANLRRAARHQRLDPSAQHGVTRFSDMTPAEFRKSQLGLR--  118

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                  ++LP DA KAPILPT+NLP DFDWR+HGAVT VKNQGSCGSCWSFSTTGALEGA
Sbjct  119  -----GLKLPEDATKAPILPTENLPEDFDWREHGAVTAVKNQGSCGSCWSFSTTGALEGA  173

Query  554  HFLAT  568
            HFLAT
Sbjct  174  HFLAT  178



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score =   234 bits (597),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 143/191 (75%), Gaps = 14/191 (7%)
 Frame = +2

Query  20   MDR-FFLFSLLII---GLASASFVRADFSAE---DPLIRQVVSEEDGD-DDPLLNADHHF  175
            MDR FFLF+++      L S+  + +  S E   DPLIRQVV E DGD +   L A+HHF
Sbjct  1    MDRNFFLFAVITAVTATLCSSEPLVSQHSVEHDGDPLIRQVV-ENDGDFNHHALGAEHHF  59

Query  176  SLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTF  355
            SLFK +FGKSY TEEEHD RF +FKAN+RRA+RHQ  DPSA+HGVT+FSDLTP EFR+ F
Sbjct  60   SLFKRRFGKSYATEEEHDRRFKIFKANMRRAERHQSFDPSAIHGVTQFSDLTPFEFRKAF  119

Query  356  HGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTT  535
             G+   R     +RLP D N APILPT+NLP DFDWR HG VT VKNQGSCGSCWSFSTT
Sbjct  120  LGLRGHR-----LRLPVDTNAAPILPTENLPIDFDWRQHGGVTRVKNQGSCGSCWSFSTT  174

Query  536  GALEGAHFLAT  568
            GALEGA+FLAT
Sbjct  175  GALEGANFLAT  185



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score =   234 bits (597),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 143/191 (75%), Gaps = 14/191 (7%)
 Frame = +2

Query  20   MDR-FFLFSLLII---GLASASFVRADFSAE---DPLIRQVVSEEDGD-DDPLLNADHHF  175
            MDR FFLF+++      L S+  + +  S E   DPLIRQVV E DGD +   L A+HHF
Sbjct  1    MDRNFFLFAVITAVTATLCSSEPLVSQHSVEHDGDPLIRQVV-ENDGDFNHHALGAEHHF  59

Query  176  SLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTF  355
            SLFK +FGKSY TEEEHD RF +FKAN+RRA+RHQ  DPSA+HGVT+FSDLTP EFR+ F
Sbjct  60   SLFKRRFGKSYATEEEHDRRFKIFKANMRRAERHQSFDPSAIHGVTQFSDLTPFEFRKAF  119

Query  356  HGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTT  535
             G+   R     +RLP D N APILPT+NLP DFDWR HG VT VKNQGSCGSCWSFSTT
Sbjct  120  LGLRGHR-----LRLPVDTNAAPILPTENLPIDFDWRQHGGVTRVKNQGSCGSCWSFSTT  174

Query  536  GALEGAHFLAT  568
            GALEGA+FLAT
Sbjct  175  GALEGANFLAT  185



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 133/180 (74%), Gaps = 7/180 (4%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
            F +FS  I+G+       A+    DPLI QV    +G +  LL A+HHFSLFK +F KSY
Sbjct  10   FVIFSFFIVGVICTETFSAEGFEVDPLIEQVTDGHEGAEPQLLTAEHHFSLFKKRFKKSY  69

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             +++EHDYRF +F+ NLRRA RHQ LDPSA HGVT+FSDLTP EFR+ + G+        
Sbjct  70   GSQKEHDYRFKIFQVNLRRAARHQNLDPSATHGVTQFSDLTPGEFRKAYLGLR-------  122

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ++RLP DA +APILPTDNLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGA+FLAT
Sbjct  123  RLRLPKDATEAPILPTDNLPQDFDWREKGAVTPVKNQGSCGSCWSFSTTGALEGANFLAT  182



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 128/154 (83%), Gaps = 11/154 (7%)
 Frame = +2

Query  107  LIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLL  286
            LIRQVV E  GDD  LL+A+H F LFK+KFGK+Y T EEHDYRFSVF+ANLRRA+RHQLL
Sbjct  34   LIRQVVPE--GDD--LLSAEHQFGLFKAKFGKTYSTVEEHDYRFSVFEANLRRARRHQLL  89

Query  287  DPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWR  466
            DPSAVHGVT+FSDLTP EFRR + G+         +RLPADA KAPILPT++LPTDFDWR
Sbjct  90   DPSAVHGVTRFSDLTPDEFRRDYLGLK-------PLRLPADAQKAPILPTNDLPTDFDWR  142

Query  467  DHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DHGAVT VK+QGSCGSCWSFS  GALEGAHFL T
Sbjct  143  DHGAVTPVKDQGSCGSCWSFSAIGALEGAHFLTT  176



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 144/185 (78%), Gaps = 13/185 (7%)
 Frame = +2

Query  26   RFFLFSLLIIGLASASFVRADFSA----EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSK  193
            RF L  +L I L ++  +  +       +D LIRQVV +ED     +LNA+HHF+LFK +
Sbjct  4    RFSLVFVLSILLTTSFLLAVNGEIKGGDDDILIRQVVGDED---HHMLNAEHHFTLFKKR  60

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            FGK+Y ++EEH YRFSVFKANLRRA RHQ LDPSAVHGVT+FSD+TP EF + F GV++ 
Sbjct  61   FGKTYASDEEHHYRFSVFKANLRRAMRHQKLDPSAVHGVTQFSDMTPDEFSQKFLGVNR-  119

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                 ++R P+DANKAPILPT++LP+DFDWR+HGAVT VKNQGSCGSCWSFSTTGALEGA
Sbjct  120  -----RLRFPSDANKAPILPTEDLPSDFDWREHGAVTPVKNQGSCGSCWSFSTTGALEGA  174

Query  554  HFLAT  568
            +FLAT
Sbjct  175  NFLAT  179



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 144/185 (78%), Gaps = 13/185 (7%)
 Frame = +2

Query  26   RFFLFSLLIIGLASASFVRADFSA----EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSK  193
            RF L  +L I L ++  +  +       +D LIRQVV +ED     +LNA+HHF+LFK +
Sbjct  4    RFSLVFVLSILLTTSFLLAVNGEIKGGDDDILIRQVVGDED---HHMLNAEHHFTLFKKR  60

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            FGK+Y ++EEH YRFSVFKANLRRA RHQ LDPSAVHGVT+FSD+TP EF + F GV++ 
Sbjct  61   FGKTYASDEEHHYRFSVFKANLRRAMRHQKLDPSAVHGVTQFSDMTPDEFSQKFLGVNR-  119

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                 ++R P+DANKAPILPT++LP+DFDWR+HGAVT VKNQGSCGSCWSFSTTGALEGA
Sbjct  120  -----RLRFPSDANKAPILPTEDLPSDFDWREHGAVTPVKNQGSCGSCWSFSTTGALEGA  174

Query  554  HFLAT  568
            +FLAT
Sbjct  175  NFLAT  179



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 136/177 (77%), Gaps = 15/177 (8%)
 Frame = +2

Query  38   FSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTE  217
            FSL+   ++++S    D   E+PLI QVV   DG D   L A+HHF  FK +FGK+YD+E
Sbjct  13   FSLVFAAVSASS----DGGNEEPLIMQVV---DGGD-VRLGAEHHFLEFKRRFGKAYDSE  64

Query  218  EEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIR  397
            +EHDYR+ VFKAN+RRA+RHQ LDPSA HGVT+FSDLTP EFR    G+         +R
Sbjct  65   DEHDYRYKVFKANMRRARRHQSLDPSAAHGVTRFSDLTPSEFRNKVLGLRG-------VR  117

Query  398  LPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            LP DANKAPILPTDNLP+DFDWRDHGAVT VKNQGSCGSCWSFSTTGALEGAHFL+T
Sbjct  118  LPLDANKAPILPTDNLPSDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGAHFLST  174



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 136/177 (77%), Gaps = 15/177 (8%)
 Frame = +2

Query  38   FSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTE  217
            FSL+   ++++S    D   E+PLI QVV   DG D   L A+HHF  FK +FGK+YD+E
Sbjct  13   FSLVFAAVSASS----DGGNEEPLIMQVV---DGGD-VRLGAEHHFLEFKRRFGKAYDSE  64

Query  218  EEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIR  397
            +EHDYR+ VFKAN+RRA+RHQ LDPSA HGVT+FSDLTP EFR    G+         +R
Sbjct  65   DEHDYRYKVFKANMRRARRHQSLDPSAAHGVTRFSDLTPSEFRNKVLGLRG-------VR  117

Query  398  LPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            LP DANKAPILPTDNLP+DFDWRDHGAVT VKNQGSCGSCWSFSTTGALEGAHFL+T
Sbjct  118  LPLDANKAPILPTDNLPSDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGAHFLST  174



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 133/180 (74%), Gaps = 7/180 (4%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
            F +FS  I+G+       A+    DPLI QV    +G +  LL A+HH+SLFK +F KSY
Sbjct  10   FVIFSFFIVGVICTETFSAEGFEVDPLIEQVTDGHEGAEPQLLTAEHHYSLFKKRFKKSY  69

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             +++EHDYRF +F+ NLRRA RHQ LDPSA HGVT+FSDLTP EFR+ + G+        
Sbjct  70   GSQKEHDYRFKIFQVNLRRAARHQNLDPSATHGVTQFSDLTPGEFRKAYLGLR-------  122

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ++RLP DA +APILPTDNLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGA+FLAT
Sbjct  123  RLRLPKDATEAPILPTDNLPQDFDWREKGAVTPVKNQGSCGSCWSFSTTGALEGANFLAT  182



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 130/168 (77%), Gaps = 11/168 (7%)
 Frame = +2

Query  65   SASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSV  244
            S +   ++   EDPLIRQVV     D    L A+HHF  FK +FGK Y T++EHDYRF+V
Sbjct  16   SVTVFSSETVEEDPLIRQVVD----DGGVRLGAEHHFIEFKHRFGKVYSTKDEHDYRFNV  71

Query  245  FKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAP  424
            FKAN+RRAKRHQL+DPSAVHGVT+FSDLTP+EFR +  G+         +RLP+DAN AP
Sbjct  72   FKANMRRAKRHQLMDPSAVHGVTRFSDLTPREFRNSVLGLRG-------LRLPSDANTAP  124

Query  425  ILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ILPTDNLP DFDWRD GAVT VKNQGSCGSCWSFSTTGALEGAHFL+T
Sbjct  125  ILPTDNLPADFDWRDRGAVTSVKNQGSCGSCWSFSTTGALEGAHFLST  172



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 135/183 (74%), Gaps = 11/183 (6%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MD   L   +++ + S S        EDP+IRQVV EE       L A+HHF+LFK KFG
Sbjct  1    MDHRTLLLFVVLFIFSVSAFSTPDEGEDPIIRQVVDEEG----VRLGAEHHFNLFKHKFG  56

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K Y +++EHDYRF +FK+NL RAKRHQL+DPSAVHGVT+FSDLTP+EFR++  G+     
Sbjct  57   KVYSSKDEHDYRFKIFKSNLNRAKRHQLMDPSAVHGVTRFSDLTPREFRKSVLGLR----  112

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
                + LP DAN APILPTDNLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGAHF
Sbjct  113  ---GVGLPKDANAAPILPTDNLPKDFDWREKGAVTAVKNQGSCGSCWSFSTTGALEGAHF  169

Query  560  LAT  568
            L+T
Sbjct  170  LST  172



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 131/160 (82%), Gaps = 9/160 (6%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRA  268
            FS +DPLIRQVVSE D  D+ +LNA+HHFSLFK KFGK Y ++EEHD+R  VFKANLRRA
Sbjct  34   FSDDDPLIRQVVSEND--DNHMLNAEHHFSLFKVKFGKIYASQEEHDHRLKVFKANLRRA  91

Query  269  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLP  448
            +RHQLLDPSA HG+T+FSDLTP EFRRT+ G++K R          +A KAPILPT +LP
Sbjct  92   RRHQLLDPSAEHGITQFSDLTPSEFRRTYLGLNKPRPN-------LNAEKAPILPTTDLP  144

Query  449  TDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             DFDWR+ GAVT VKNQGSCGSCWSFSTTGA+EGAHFLAT
Sbjct  145  ADFDWREKGAVTDVKNQGSCGSCWSFSTTGAVEGAHFLAT  184



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 136/183 (74%), Gaps = 10/183 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR  LF L+   L + S    +    D  IRQVV EE+ +   LLNA+HHFSLFKSK+ 
Sbjct  1    MDRVVLFFLIAAALLAVSLGSGE--GFDNPIRQVVPEENHE---LLNAEHHFSLFKSKYQ  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K+Y T+EEHD+R  VFKANLRRA+R+QLLDPSAVHGVT+FSDLTPKEF R   G+     
Sbjct  56   KTYATQEEHDHRLRVFKANLRRARRNQLLDPSAVHGVTQFSDLTPKEFSRQLMGL-----  110

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
            K+ K RLP D   APILPT +LPT+FDWR+ GAVT VKNQG CGSCWSFS TGALEGAHF
Sbjct  111  KRRKFRLPTDTETAPILPTTDLPTEFDWREQGAVTPVKNQGMCGSCWSFSATGALEGAHF  170

Query  560  LAT  568
            LAT
Sbjct  171  LAT  173



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score =   230 bits (587),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 141/183 (77%), Gaps = 10/183 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR F+F++++   A A+    D + +D +IRQVV   D ++D LLNA+HHF+ FKSKF 
Sbjct  1    MDRRFIFAIVLFA-AVATSSTDDTNTDDFIIRQVV---DNEEDHLLNAEHHFTSFKSKFS  56

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            KSY T+EEHDYRF VFK+NL +AK HQ LDP+A HG+TKFSDLT  EFRR F G+ K   
Sbjct  57   KSYSTKEEHDYRFGVFKSNLIKAKLHQKLDPTAEHGITKFSDLTASEFRRQFLGLKK---  113

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
               ++RLPA A KAPILPT NLP DFDWR+ GAVT VK+QGSCGSCW+FSTTGALEGAH+
Sbjct  114  ---RLRLPAHAQKAPILPTTNLPEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGAHY  170

Query  560  LAT  568
            LAT
Sbjct  171  LAT  173



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   230 bits (587),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +D  IRQVV +   DD  +LNADHHF+LFK +FGK+Y ++EEH YRFSVFKANLRRA  H
Sbjct  32   DDIFIRQVVGD---DDHHMLNADHHFTLFKKRFGKTYASDEEHHYRFSVFKANLRRAMSH  88

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDPSAVHGVT+FSDLTP EF + F GV++      ++R P+DANKAPILPT++LP+DF
Sbjct  89   QKLDPSAVHGVTQFSDLTPDEFSQKFLGVNR------RLRFPSDANKAPILPTEDLPSDF  142

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWR+HGAVT VKNQGSCGSCWSFSTTGALEGA+FLAT
Sbjct  143  DWREHGAVTPVKNQGSCGSCWSFSTTGALEGANFLAT  179



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score =   231 bits (588),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 141/189 (75%), Gaps = 14/189 (7%)
 Frame = +2

Query  20   MDR-FFLFSLLII---GLASASFVRADFSAE---DPLIRQVVSEEDGD-DDPLLNADHHF  175
            MDR FFLF+++      L S+  + +  S E   DPLIRQVV E DGD +   L A+HHF
Sbjct  1    MDRNFFLFAVITAVTATLCSSEPLVSQHSVEHDGDPLIRQVV-ENDGDFNHHALGAEHHF  59

Query  176  SLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTF  355
            SLFK +FGKSY TEEEHD RF +FKAN+RRA+RHQ  DPSA+HGVT+FSDLTP EFR+ F
Sbjct  60   SLFKRRFGKSYATEEEHDRRFKIFKANMRRAERHQSFDPSAIHGVTQFSDLTPFEFRKAF  119

Query  356  HGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTT  535
             G+   R     +RLP D N APILPT+NLP DFDWR HG VT VKNQGSCGSCWSFSTT
Sbjct  120  LGLRGHR-----LRLPVDTNAAPILPTENLPIDFDWRQHGGVTRVKNQGSCGSCWSFSTT  174

Query  536  GALEGAHFL  562
            GALEGA+FL
Sbjct  175  GALEGANFL  183



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score =   231 bits (588),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 141/189 (75%), Gaps = 15/189 (8%)
 Frame = +2

Query  29   FFLFSLLIIG------LASASFVRADFSAEDPLIRQVV---SEEDGDDDPLLNADHHFSL  181
              L S L+I       +A A        ++D +IRQVV    +E   ++ LLNADHHF++
Sbjct  7    ILLLSFLLIATSFRCSIADADVNEGAVGSDDLVIRQVVDHGEDEVVGENSLLNADHHFAI  66

Query  182  FKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHG  361
            FK KFGK+Y  + EHDYR SVFKAN+RRA +HQ +DPSAVHGVT+FSDLTP+EFR  F G
Sbjct  67   FKRKFGKTYTDKAEHDYRLSVFKANMRRAVQHQKIDPSAVHGVTQFSDLTPREFRSRFLG  126

Query  362  VHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGA  541
            V++      ++RLP+DA+KAPILPT++LP DFDWRD GAVT VKNQGSCGSCWSFSTTGA
Sbjct  127  VNR------RLRLPSDAHKAPILPTNDLPADFDWRDRGAVTAVKNQGSCGSCWSFSTTGA  180

Query  542  LEGAHFLAT  568
            LEGA+FLAT
Sbjct  181  LEGANFLAT  189



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 132/158 (84%), Gaps = 11/158 (7%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            +ED LI QVVS  DGDD  LLNA++ F+ FK+KFGK+Y T EEHD+RF+VFKANLRRAKR
Sbjct  34   SEDLLIHQVVS--DGDD--LLNAEYQFAEFKTKFGKTYATAEEHDHRFNVFKANLRRAKR  89

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            HQLLDPSA HGVT+FSDLTP+EFR+ + G+        +++LPADA KAPILPT +LPTD
Sbjct  90   HQLLDPSAEHGVTQFSDLTPREFRQNYLGLK-------RLQLPADAQKAPILPTKDLPTD  142

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRDHGAVT VK+QG CGSCWSFST GALEGAHFLAT
Sbjct  143  FDWRDHGAVTAVKDQGYCGSCWSFSTIGALEGAHFLAT  180



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 134/180 (74%), Gaps = 10/180 (6%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
               F LL+   A A+  R D   ++ LIRQVV   D +D  LLNA+HHFS FK+KF K+Y
Sbjct  6    ILFFGLLLFSAAVATVERID-DEDNLLIRQVVP--DAEDHHLLNAEHHFSAFKTKFAKTY  62

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             T+EEHD+RF +FK NL RAK HQ LDPSAVHGVT+FSDLTP EFR  F G+        
Sbjct  63   ATQEEHDHRFRIFKNNLLRAKSHQKLDPSAVHGVTRFSDLTPSEFRGQFLGLKP------  116

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             +RLP+DA KAPILPT +LPTDFDWRDHGAVTGVKNQGSCGSCWSFS  GALEGAHFL+T
Sbjct  117  -LRLPSDAQKAPILPTSDLPTDFDWRDHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLST  175



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 132/157 (84%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +DPLIRQVVSE    +D LLNA+HHF+ FKSKFGK+Y T+EEHDYRFSVFKANL RAK+H
Sbjct  29   DDPLIRQVVSE---GEDHLLNAEHHFTTFKSKFGKNYATQEEHDYRFSVFKANLLRAKKH  85

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q++DP+A HGVTKFSDLTPKEFRR           K ++RLP DANKAPILPT +LPTDF
Sbjct  86   QIMDPTAAHGVTKFSDLTPKEFRRQ------LLGLKRRLRLPTDANKAPILPTGDLPTDF  139

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVT VK+QGSCGSCWSFS TGALEGAH+LAT
Sbjct  140  DWRDHGAVTSVKDQGSCGSCWSFSATGALEGAHYLAT  176



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 130/162 (80%), Gaps = 9/162 (6%)
 Frame = +2

Query  83   ADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLR  262
             D S ++P IRQVV EE   D+ LL A+HHF+LFKSK+ K+Y T+EEHD+RF VFKANLR
Sbjct  23   VDLSFDNP-IRQVVPEES--DEQLLTAEHHFALFKSKYEKTYATQEEHDHRFRVFKANLR  79

Query  263  RAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDN  442
            RAKRHQ LDP+AVHGVT+FSDLTPKEFRR + G+      K + RLP D  +APILPT +
Sbjct  80   RAKRHQALDPTAVHGVTQFSDLTPKEFRRKYLGL------KRRFRLPTDTQQAPILPTSD  133

Query  443  LPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            LPTDFDWR+ GAVT VKNQG CGSCWSFS TGALEGAHFLAT
Sbjct  134  LPTDFDWREQGAVTPVKNQGMCGSCWSFSATGALEGAHFLAT  175



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 137/173 (79%), Gaps = 12/173 (7%)
 Frame = +2

Query  65   SASFVRADFSAEDPLIRQVVSE----EDGDDDPLLNADHH-FSLFKSKFGKSYDTEEEHD  229
            ++S + +  S +D +IRQVV E    E G+++ LL ADHH FS+FK +FGKSY ++EEHD
Sbjct  21   TSSELHSGGSDDDIIIRQVVPELGDVEGGEEENLLTADHHHFSIFKRRFGKSYASQEEHD  80

Query  230  YRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPAD  409
            YRF VFKANLRRA+RHQ LDPSA HGVT+FSDLTP EFR T+ G+         ++LP D
Sbjct  81   YRFKVFKANLRRARRHQQLDPSATHGVTQFSDLTPAEFRGTYLGLRP-------LKLPHD  133

Query  410  ANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            A KAPILPT++LP DFDWRDHGAVT VKNQGSCGSCWSFSTTGALEGA+FLAT
Sbjct  134  AQKAPILPTNDLPEDFDWRDHGAVTAVKNQGSCGSCWSFSTTGALEGANFLAT  186



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 128/157 (82%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +D LIRQVV   D +D  LLNA+HHFS FK+KFGK+Y T+EEHD+RF +FK NL RAK H
Sbjct  28   DDLLIRQVVP--DAEDHHLLNAEHHFSAFKTKFGKTYATQEEHDHRFRIFKNNLLRAKSH  85

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDPSAVHGVT+FSDLTP EFRR F G+         +RLP+DA KAPILPT++LPTDF
Sbjct  86   QKLDPSAVHGVTRFSDLTPAEFRRQFLGLK-------PLRLPSDAQKAPILPTNDLPTDF  138

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWR+HGAVTGVKNQGSCGSCWSFS  GALEGAHFL+T
Sbjct  139  DWREHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLST  175



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 130/156 (83%), Gaps = 9/156 (6%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            DPLI+QVV E   +D+ LL+A+ HFS FK+ FGK+Y T+EEHDYRF VFKANLRRAKRHQ
Sbjct  31   DPLIQQVVPE--ANDNLLLHAERHFSSFKATFGKTYATQEEHDYRFGVFKANLRRAKRHQ  88

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
             LDP+AVHGVTKFSDLTP EFRR F G+        ++RLP+DANKAPILPT++LPTDFD
Sbjct  89   GLDPTAVHGVTKFSDLTPSEFRRNFLGLK-------RLRLPSDANKAPILPTNDLPTDFD  141

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WRD GAVT VK+QGSCGSCW+FS TGALEGAH+L T
Sbjct  142  WRDKGAVTPVKDQGSCGSCWAFSATGALEGAHYLQT  177



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 132/168 (79%), Gaps = 9/168 (5%)
 Frame = +2

Query  71   SFVRAD-FSAEDPLIRQVVSEEDGDDDPLLNAD-HHFSLFKSKFGKSYDTEEEHDYRFSV  244
            S V+AD  + +DPLIR+VV  +D     LL+A+ HHFSLFKSKF KSY ++EEHDYRFSV
Sbjct  17   SAVQADALNGDDPLIREVVDGQDASSSNLLSAEQHHFSLFKSKFKKSYGSQEEHDYRFSV  76

Query  245  FKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAP  424
            FKANLRRA RHQ LDP+A HGVT+FSDLTP EFR+   G+        ++RLP DAN+AP
Sbjct  77   FKANLRRAARHQALDPTASHGVTQFSDLTPAEFRKQVLGLR-------RLRLPKDANEAP  129

Query  425  ILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ILPT +LP DFDWRD GAV  VKNQGSCGSCWSFS TGALEGAHFLAT
Sbjct  130  ILPTSDLPEDFDWRDKGAVGPVKNQGSCGSCWSFSATGALEGAHFLAT  177



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 135/183 (74%), Gaps = 9/183 (5%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDP---LLNADHHFSLFKSKFG  199
            F +   L +G   A    A  S  DPLIRQV    D   +P   L  A+HHFSLFK++F 
Sbjct  10   FIVSHFLFVGFILAQTFSAVASEVDPLIRQVTDVHDDGTEPQQLLTAAEHHFSLFKARFN  69

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            KSY ++ EHDYRF VF++NLRRA RHQ LDPSA HGVT+FSDLTP EFR+ F G+++   
Sbjct  70   KSYGSKAEHDYRFKVFRSNLRRAARHQKLDPSATHGVTQFSDLTPGEFRKRFLGLNR---  126

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
               ++RLP DAN+APILPTDNLP DFDWR+ GAVT VKNQG+CGSCWSFSTTGALEGA+F
Sbjct  127  ---RLRLPKDANQAPILPTDNLPEDFDWREKGAVTAVKNQGTCGSCWSFSTTGALEGANF  183

Query  560  LAT  568
            LAT
Sbjct  184  LAT  186



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 138/189 (73%), Gaps = 14/189 (7%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAE------DPLIRQVVSEEDGDDDPLLNADHHFSL  181
            MDR   F L+   L + S      S E      +P IRQVV EE+  D+ LLNA+HHF+L
Sbjct  1    MDRVVFFFLIAATLLAGSLGSTVISGEVTDGFVNP-IRQVVPEEN--DEQLLNAEHHFTL  57

Query  182  FKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHG  361
            FKSK+ K+Y T+ EHD+RF VFKANLRRA+R+QLLDPSAVHGVT+FSDLTPKEFRR F G
Sbjct  58   FKSKYEKTYATQVEHDHRFRVFKANLRRARRNQLLDPSAVHGVTQFSDLTPKEFRRKFLG  117

Query  362  VHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGA  541
            +     K+   RLP D   APILPT +LPT+FDWR+ GAVT VKNQG CGSCWSFS  GA
Sbjct  118  L-----KRRGFRLPTDTQTAPILPTSDLPTEFDWREQGAVTPVKNQGMCGSCWSFSAIGA  172

Query  542  LEGAHFLAT  568
            LEGAHFLAT
Sbjct  173  LEGAHFLAT  181



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 141/183 (77%), Gaps = 10/183 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR F+F++++   A A+    + + +D +IRQVV   D ++D LLNA+HHF+ FKSKF 
Sbjct  1    MDRRFIFAIVLFA-AVATSSTDNTNTDDFIIRQVV---DNEEDHLLNAEHHFTSFKSKFS  56

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            KSY T+EEHDYRF VFK+NL +AK HQ LDP+A HG+TKFSDLT  EFRR F G+ K   
Sbjct  57   KSYSTKEEHDYRFGVFKSNLIKAKLHQKLDPTAEHGITKFSDLTASEFRRQFLGLKK---  113

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
               ++RLPA A KAPILPT NLP DFDWR+ GAVT VK+QGSCGSCW+FSTTGALEGAH+
Sbjct  114  ---RLRLPAHAQKAPILPTTNLPEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGAHY  170

Query  560  LAT  568
            LAT
Sbjct  171  LAT  173



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 127/158 (80%), Gaps = 4/158 (3%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPL-LNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            EDPLIRQVV    GDD+ L LNA+ HF  F  +FGKSY   EEH YR S+FKANLRRA+R
Sbjct  24   EDPLIRQVVP--GGDDNELELNAESHFLSFVQRFGKSYKDAEEHAYRLSIFKANLRRARR  81

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            HQLLDPSA HGVTKFSDLTP EFRRT+ G+ KSR   L+  L   AN+AP+LPTD LP D
Sbjct  82   HQLLDPSAEHGVTKFSDLTPAEFRRTYLGLRKSRRALLR-ELGKSANEAPVLPTDGLPDD  140

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRDHGAVT VKNQGSCGSCWSFST+GALEGAH+LAT
Sbjct  141  FDWRDHGAVTPVKNQGSCGSCWSFSTSGALEGAHYLAT  178



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 139/188 (74%), Gaps = 15/188 (8%)
 Frame = +2

Query  35   LFSLLIIG--LASASFVRADFSAE---DPLIRQVVSE-----EDGDDDPLLNADHHFSLF  184
             FSL+I    LA+++  +   S E   D +IRQVV +         DD LL A+HHFS+F
Sbjct  4    CFSLIIALSLLAASAIGKEVISGESDGDFIIRQVVDDGGVNGASNGDDLLLGAEHHFSVF  63

Query  185  KSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGV  364
            K KFGKSY ++EEHD+RF VFKANL+RA+RHQ LDPSA HGVT+FSDLTP EFRR+F G+
Sbjct  64   KQKFGKSYASKEEHDHRFRVFKANLKRAQRHQALDPSATHGVTQFSDLTPSEFRRSFLGL  123

Query  365  HKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGAL  544
               R     + LP DANKAPILPTD LP DFDWRD GAVT VKNQGSCGSCWSFS TGAL
Sbjct  124  RSRR-----LGLPEDANKAPILPTDGLPADFDWRDKGAVTEVKNQGSCGSCWSFSATGAL  178

Query  545  EGAHFLAT  568
            EGA+FLAT
Sbjct  179  EGANFLAT  186



>ref|XP_007160703.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32697.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=292

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 128/158 (81%), Gaps = 8/158 (5%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            A+D LIRQVV E + +D  LLNA+HHFS FK+KFGK+Y T+EEHD+RF VFK+N+RRA+ 
Sbjct  26   ADDILIRQVVPEGEVEDH-LLNAEHHFSTFKAKFGKTYATKEEHDHRFGVFKSNMRRARL  84

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            H  LDPSAVHGVTKFSDLTP EF R F G+         +RLPA A KAPILPT+NLP D
Sbjct  85   HAQLDPSAVHGVTKFSDLTPAEFHRKFLGLK-------PLRLPAHAQKAPILPTNNLPKD  137

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRD GAVT VK+QGSCGSCWSFSTTGALEGAHFLAT
Sbjct  138  FDWRDKGAVTNVKDQGSCGSCWSFSTTGALEGAHFLAT  175



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 133/170 (78%), Gaps = 14/170 (8%)
 Frame = +2

Query  59   LASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRF  238
            LA+AS   +D   ED +I+Q+V     D D  L+ADHHF LFK +FGKSY T+E+HDYRF
Sbjct  19   LAAASGKSSD--GEDLVIQQIV-----DGDHPLSADHHFRLFKRRFGKSYATQEDHDYRF  71

Query  239  SVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANK  418
            SVFK NLRRA+ HQ LDPSAVHGVT+FSDLTP EFRR   G+        ++R PADANK
Sbjct  72   SVFKTNLRRARHHQRLDPSAVHGVTQFSDLTPAEFRRNHLGLK-------RLRFPADANK  124

Query  419  APILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            APILPT++LP DFDWRDHGAV  VKNQGSCGSCWSFSTTGALEGA+FLAT
Sbjct  125  APILPTEDLPADFDWRDHGAVASVKNQGSCGSCWSFSTTGALEGANFLAT  174



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 140/182 (77%), Gaps = 13/182 (7%)
 Frame = +2

Query  32   FLFSLLIIG--LASASFV-RADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGK  202
            F FSLL +   LA+   V  A+   +D LIRQVV    GD   LLNADHHF++FK +FGK
Sbjct  3    FRFSLLFLCTLLATTYLVFAAEDDGDDILIRQVV----GDGGDLLNADHHFTVFKRRFGK  58

Query  203  SYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAK  382
             Y ++EEHDYR S FKAN+RRAK+HQ LDP+AVHGVT+FSDLTP EFRR F G+++    
Sbjct  59   VYASDEEHDYRLSEFKANMRRAKQHQELDPAAVHGVTQFSDLTPTEFRRKFLGLNR----  114

Query  383  KLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFL  562
              +++ PADA  APILPTD LP+DFDWRDHGAVT VKNQG+CGSC SFSTTGALEGA+FL
Sbjct  115  --RLKFPADAKTAPILPTDELPSDFDWRDHGAVTPVKNQGTCGSCCSFSTTGALEGANFL  172

Query  563  AT  568
            AT
Sbjct  173  AT  174



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score =   228 bits (582),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 129/156 (83%), Gaps = 9/156 (6%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            DPLI QVV E   +D+ LL+A+ HFS FK+ FG++Y T+EEHDYRF VFKANLRRAKRHQ
Sbjct  30   DPLIEQVVPE--ANDNLLLHAERHFSSFKATFGRTYATQEEHDYRFGVFKANLRRAKRHQ  87

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
             LDP+AVHGVTKFSDLTP EFRR F G+        ++RLP+DANKAPILPT++LPTDFD
Sbjct  88   GLDPTAVHGVTKFSDLTPSEFRRNFLGLK-------RLRLPSDANKAPILPTNDLPTDFD  140

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WRD GAVT VK+QGSCGSCW+FS TGALEGAH+L T
Sbjct  141  WRDKGAVTPVKDQGSCGSCWAFSATGALEGAHYLET  176



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   228 bits (581),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 125/158 (79%), Gaps = 13/158 (8%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
             ED +IRQVV      D   L A+ HF  FKS+FGK+Y T EEHDYRF+VFKANLRRA+R
Sbjct  26   GEDSMIRQVV------DGVRLGAEEHFLEFKSRFGKAYATPEEHDYRFTVFKANLRRARR  79

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            HQ LDPSAVHGVT+FSDLTP EFR    G+         +RLP+DANKAPILPTD++P+D
Sbjct  80   HQSLDPSAVHGVTRFSDLTPSEFRNKVLGLRG-------VRLPSDANKAPILPTDDIPSD  132

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRDHGAVT VKNQGSCGSCWSFSTTGALEGAHFLAT
Sbjct  133  FDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGAHFLAT  170



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 140/188 (74%), Gaps = 13/188 (7%)
 Frame = +2

Query  20   MDR---FFLFSLLIIGLASAS--FVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLF  184
            MDR   FFL +   + + S     V  D   ++P IRQVV E   +D+ +LNA+ HF+LF
Sbjct  1    MDRVVFFFLIAATSLAVISGEEVTVVVDGGLDNP-IRQVVPELK-NDEQILNAELHFTLF  58

Query  185  KSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGV  364
            KSK+ K+Y T+EEHDYRF VF+ANLRRAKR+QLLDPSAVHGVT+FSDLTPKEFRR++ G+
Sbjct  59   KSKYEKTYATQEEHDYRFRVFEANLRRAKRNQLLDPSAVHGVTQFSDLTPKEFRRSYLGL  118

Query  365  HKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGAL  544
             +        RLP D  +APILPT  LPTDFDWR+ GAVT VKNQG CGSCWSFS TGAL
Sbjct  119  KRG------FRLPTDTKEAPILPTSELPTDFDWREQGAVTPVKNQGMCGSCWSFSATGAL  172

Query  545  EGAHFLAT  568
            EGAHFLAT
Sbjct  173  EGAHFLAT  180



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score =   228 bits (580),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 128/158 (81%), Gaps = 8/158 (5%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            A+D LIRQVV E + +D  LLNA+HHFS FKSKFGK+Y T+EEHD+RF VFK+N+RRA+ 
Sbjct  26   ADDILIRQVVPEGEVEDH-LLNAEHHFSTFKSKFGKTYATKEEHDHRFGVFKSNMRRARL  84

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            H  LDPSAVHGVTKFSDLTP EF R F G+         +RLPA A KAPILPT+NLP D
Sbjct  85   HAQLDPSAVHGVTKFSDLTPAEFHRKFLGLK-------PLRLPAHAQKAPILPTNNLPKD  137

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRD GAVT VK+QGSCGSCWSFSTTGALEGAHFLAT
Sbjct  138  FDWRDKGAVTNVKDQGSCGSCWSFSTTGALEGAHFLAT  175



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 127/157 (81%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +D LIRQVV   D +D  LLNA+HHFS FK+KFGK+Y T+EEHD+RF +FK NL RAK H
Sbjct  28   DDLLIRQVVP--DAEDHHLLNAEHHFSAFKTKFGKTYATQEEHDHRFRIFKNNLLRAKSH  85

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDPSAVHGVT+FSDL P EFRR F G+         +RLP+DA KAPILPT++LPTDF
Sbjct  86   QKLDPSAVHGVTRFSDLNPAEFRRQFLGLK-------PLRLPSDAQKAPILPTNDLPTDF  138

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWR+HGAVTGVKNQGSCGSCWSFS  GALEGAHFL+T
Sbjct  139  DWREHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLST  175



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 128/158 (81%), Gaps = 8/158 (5%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            A+D LIRQVV E + +D  LLNA+HHFS FK+KFGK+Y T+EEHD+RF VFK+N+RRA+ 
Sbjct  26   ADDILIRQVVPEGEVEDH-LLNAEHHFSTFKAKFGKTYATKEEHDHRFGVFKSNMRRARL  84

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            H  LDPSAVHGVTKFSDLTP EF R F G+         +RLPA A KAPILPT+NLP D
Sbjct  85   HAQLDPSAVHGVTKFSDLTPAEFHRKFLGLK-------PLRLPAHAQKAPILPTNNLPKD  137

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRD GAVT VK+QGSCGSCWSFSTTGALEGAHFLAT
Sbjct  138  FDWRDKGAVTNVKDQGSCGSCWSFSTTGALEGAHFLAT  175



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 127/161 (79%), Gaps = 8/161 (5%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNAD-HHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRR  265
             + +DPLIR+VV  +D     LL+A+ HHFSLFKSKF KSY ++EEHDYRFSVFKANLRR
Sbjct  24   LNGDDPLIREVVDGQDASSSNLLSAEQHHFSLFKSKFKKSYGSQEEHDYRFSVFKANLRR  83

Query  266  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNL  445
            A RHQ LDP+A HGVT+FSDLTP EFR+   G+        ++RLP DAN+APILPT +L
Sbjct  84   AARHQELDPTASHGVTQFSDLTPAEFRKQVLGLR-------RLRLPKDANEAPILPTSDL  136

Query  446  PTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            P DFDWRD GAV  +KNQGSCGSCWSFS TGALEGAHFLAT
Sbjct  137  PEDFDWRDKGAVGPIKNQGSCGSCWSFSATGALEGAHFLAT  177



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 139/188 (74%), Gaps = 17/188 (9%)
 Frame = +2

Query  29   FFLFSLLIIG-------LASASFVRADFSAEDPLIRQVVSEEDGD-DDPLLNADHHFSLF  184
            FFLF+++          L S   V+ D    DP IRQVV E+DGD +   L A+HHFSLF
Sbjct  5    FFLFAVITAATLCLSESLTSPHSVQHD---RDPFIRQVV-EDDGDFNRHALGAEHHFSLF  60

Query  185  KSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGV  364
            K +FGKSY TEEEHD RF +FKAN+RRA+RHQ  DPSA+HG+T+FSDLTP EFR+ F G+
Sbjct  61   KRRFGKSYATEEEHDRRFKIFKANMRRAERHQSFDPSAIHGITQFSDLTPFEFRKAFLGL  120

Query  365  HKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGAL  544
               R     +RLP D N APILPT+NLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGA+
Sbjct  121  RGHR-----LRLPVDTNAAPILPTENLPIDFDWRERGAVTRVKNQGSCGSCWSFSTTGAI  175

Query  545  EGAHFLAT  568
            EGA+FLAT
Sbjct  176  EGANFLAT  183



>gb|AAN60308.1| unknown [Arabidopsis thaliana]
Length=193

 Score =   221 bits (562),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 134/189 (71%), Gaps = 19/189 (10%)
 Frame = +2

Query  20   MDRF------FLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSL  181
            MDR       F+ S  I+ ++S+     D    D +IRQVV    G +  +L ++ HFSL
Sbjct  1    MDRLKLYFSVFVLSFFIVLVSSSDVNDGD----DLVIRQVVG---GAEPQVLTSEDHFSL  53

Query  182  FKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHG  361
            FK KFGK Y + EEHDYRFSVFKANLRRA+RHQ LDPSA HGVT+FSDLT  EFR+   G
Sbjct  54   FKRKFGKVYASNEEHDYRFSVFKANLRRARRHQKLDPSATHGVTQFSDLTRSEFRKKHLG  113

Query  362  VHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGA  541
            V          +LP DANKAPILPT+NLP DFDWRDHGAVT VKNQGSCGSCWSFS TGA
Sbjct  114  VRSG------FKLPKDANKAPILPTENLPEDFDWRDHGAVTPVKNQGSCGSCWSFSATGA  167

Query  542  LEGAHFLAT  568
            LEGA+FLAT
Sbjct  168  LEGANFLAT  176



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 126/164 (77%), Gaps = 11/164 (7%)
 Frame = +2

Query  89   FSAE----DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKAN  256
            FSAE    DPLI QV    +G +  LL A HHFSLFK +F KSY ++EEHDYRF +F+ N
Sbjct  26   FSAEGFEVDPLIEQVTDGHEGAEPQLLTAKHHFSLFKKRFKKSYGSQEEHDYRFKIFQVN  85

Query  257  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPT  436
            LRRA RHQ LDPSA HGVT+FSDLTP EFR+ + G+        ++RLP DA +APILPT
Sbjct  86   LRRAARHQKLDPSATHGVTQFSDLTPGEFRKAYLGLR-------RLRLPKDATEAPILPT  138

Query  437  DNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DNLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGA+FLAT
Sbjct  139  DNLPQDFDWREKGAVTPVKNQGSCGSCWSFSTTGALEGANFLAT  182



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 128/157 (82%), Gaps = 11/157 (7%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +D LIRQVVS    + D LL+A+HHF+ FK++F K+Y T EEHDYRFS+FKANLRRAKR+
Sbjct  31   DDLLIRQVVS----NSDDLLSAEHHFAAFKARFRKTYATAEEHDYRFSIFKANLRRAKRN  86

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            QLLDPSAVHGVT+FSDLTP EFR+ + G+         +R P D  +APILPT++LPTDF
Sbjct  87   QLLDPSAVHGVTRFSDLTPAEFRQNYLGLK-------PLRFPIDTQQAPILPTNDLPTDF  139

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVT VK+QG CGSCWSFSTTGALEGAHFLAT
Sbjct  140  DWRDHGAVTAVKDQGECGSCWSFSTTGALEGAHFLAT  176



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +DPLIRQVVS  DG+D  LLNA+HHF+ FKSKFGK+Y T+EEHD+RFSVFK NL  AK+H
Sbjct  29   DDPLIRQVVS--DGEDH-LLNAEHHFTTFKSKFGKNYATQEEHDFRFSVFKDNLLLAKKH  85

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q++DP+A HGVTKFSDLTP++  R F G+      K ++RLP DANKAPILPT +LPT+F
Sbjct  86   QMMDPTAAHGVTKFSDLTPRDSPRQFLGL------KRRLRLPTDANKAPILPTGDLPTNF  139

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRD GAVT VK+QGSCGSCWSFS TGALEGAH+LAT
Sbjct  140  DWRDQGAVTKVKDQGSCGSCWSFSATGALEGAHYLAT  176



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 128/157 (82%), Gaps = 8/157 (5%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADH-HFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            D LIRQVV     D D L   DH HFSLFK++FGKSY ++EEHD+RF+VF+ANL RA+RH
Sbjct  27   DALIRQVVDGAAADGD-LSTEDHRHFSLFKTRFGKSYASQEEHDHRFAVFRANLHRARRH  85

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDPSAVHGVT+FSDLTP EFRR+  G+      +  +RLP DAN+AP+LPTD+LP DF
Sbjct  86   QELDPSAVHGVTRFSDLTPSEFRRSHLGI------RGGLRLPKDANEAPLLPTDDLPEDF  139

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVTGVKNQGSCGSCWSFS TGALEGAH+LAT
Sbjct  140  DWRDHGAVTGVKNQGSCGSCWSFSATGALEGAHYLAT  176



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 130/169 (77%), Gaps = 10/169 (6%)
 Frame = +2

Query  62   ASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFS  241
            A A+  R D   ++ LIRQVV   D +D  LLNA+HHFS FK+KF K+Y T+EEHD+RF 
Sbjct  17   AVATVERID-DEDNLLIRQVVP--DAEDHHLLNAEHHFSAFKTKFAKTYATQEEHDHRFR  73

Query  242  VFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKA  421
            +FK NL RAK HQ LDPSAVHGVT+FSDLTP EFR  F G+         +RLP+DA KA
Sbjct  74   IFKNNLLRAKSHQKLDPSAVHGVTRFSDLTPAEFRGQFLGLKP-------LRLPSDAQKA  126

Query  422  PILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            PILPT +LPTDFDWRDHGAVTGVKNQGSCGSCWSFS  GALEGAHFL+T
Sbjct  127  PILPTSDLPTDFDWRDHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLST  175



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 132/170 (78%), Gaps = 15/170 (9%)
 Frame = +2

Query  59   LASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRF  238
            ++ ASF  +D    + +IRQV S  D      LNA+ HF  FK++F K+Y T EEHDYRF
Sbjct  22   VSEASFDESD----NLMIRQVESHVDD----FLNAERHFEKFKARFQKTYATPEEHDYRF  73

Query  239  SVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANK  418
            +VFKANLRRAKRHQLLDPSAVHGVT+FSDLTP EFRR + G++        +R PADA +
Sbjct  74   NVFKANLRRAKRHQLLDPSAVHGVTQFSDLTPAEFRRDYLGLN-------PLRFPADAQQ  126

Query  419  APILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            APILPTDNLPTDFDWR++GAVT VKNQG+CGSCWSFST GALEGAHFLAT
Sbjct  127  APILPTDNLPTDFDWRENGAVTPVKNQGNCGSCWSFSTIGALEGAHFLAT  176



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 125/154 (81%), Gaps = 8/154 (5%)
 Frame = +2

Query  107  LIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLL  286
            LIRQVV E + +D  LLNA+HHFS FK+KFGK+Y T+EEHD+RF VFK+N+RRA+ H  L
Sbjct  30   LIRQVVPEGEVEDH-LLNAEHHFSTFKAKFGKTYATKEEHDHRFGVFKSNMRRARLHAQL  88

Query  287  DPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWR  466
            DPSAVHGVTKFSDLTP EF R F G+         +RLPA A KAPILPT+NLP DFDWR
Sbjct  89   DPSAVHGVTKFSDLTPAEFHRKFLGLK-------PLRLPAHAQKAPILPTNNLPKDFDWR  141

Query  467  DHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            D GAVT VK+QGSCGSCWSFSTTGALEGAHFLAT
Sbjct  142  DKGAVTNVKDQGSCGSCWSFSTTGALEGAHFLAT  175



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 132/183 (72%), Gaps = 9/183 (5%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR   F L+   L  +     D S  +P IRQVV EE+  D+ LLN DH F+LFKSK+ 
Sbjct  1    MDRAVFFLLIASALLVSISGEVDKSVNNP-IRQVVKEEN--DEQLLNLDHQFTLFKSKYE  57

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K+Y  + EHD+RF VFKAN+RRA+RHQ LDPSAVHGVT+FSD+TPKEF R + G+     
Sbjct  58   KTYKNQVEHDHRFRVFKANVRRARRHQQLDPSAVHGVTQFSDVTPKEFSRKYLGL-----  112

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
             K + RLP D  KA ILPT  LPTDFDWR+ GAVT VKNQG CGSCWSFS TGALEGAHF
Sbjct  113  -KRRFRLPNDTQKAAILPTSELPTDFDWREKGAVTPVKNQGLCGSCWSFSATGALEGAHF  171

Query  560  LAT  568
            LAT
Sbjct  172  LAT  174



>gb|AEQ94105.1| putative drought-inducible cysteine proteinase [Elaeis guineensis]
Length=187

 Score =   218 bits (554),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 131/160 (82%), Gaps = 4/160 (3%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRA  268
            ++ +DPLI QVV E D +D+  LNA+ HFS F  +FGKSY  E+EH YRFSVFKANLRRA
Sbjct  28   YAEDDPLIVQVVPESD-EDELRLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRA  86

Query  269  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLP  448
            +RHQ +DP+AVHG+TKFSDLTP EFRRT+ G+   R  +  +   A +++APILPT+NLP
Sbjct  87   RRHQKMDPTAVHGITKFSDLTPAEFRRTYLGLRGGRRLRRAL---ASSHEAPILPTNNLP  143

Query  449  TDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            TDFDWRDHGAVTGVK+QGSCGSCWSFS +GALEGA+FLAT
Sbjct  144  TDFDWRDHGAVTGVKDQGSCGSCWSFSASGALEGANFLAT  183



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 125/158 (79%), Gaps = 2/158 (1%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            AEDPLIRQVV   D D+D  LNA+ HF  F  +FGKSY   +EH YR SVFKANLRRA+R
Sbjct  23   AEDPLIRQVVPGGD-DNDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKANLRRARR  81

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            HQLLDPSA HGVTKFSDLTP EFRRT+ G+ KSR   L+  L   A++AP+LPTD LP D
Sbjct  82   HQLLDPSAEHGVTKFSDLTPAEFRRTYLGLRKSRRALLR-ELGESAHEAPVLPTDGLPDD  140

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRDHGAV  VKNQGSCGSCWSFS +GALEGAH+LAT
Sbjct  141  FDWRDHGAVGPVKNQGSCGSCWSFSASGALEGAHYLAT  178



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score =   225 bits (573),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 133/183 (73%), Gaps = 23/183 (13%)
 Frame = +2

Query  38   FSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDP------LLNADHHFSLFKSKFG  199
            FSLLI+        RA     DPLIRQVV   DGD +        L A+HHFS FK K+G
Sbjct  77   FSLLIVS-------RAQSDGADPLIRQVV---DGDGESHHHHHDALGAEHHFSFFKHKYG  126

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            KSY ++EEHDYRF VFKANLRRA  HQ LDPSA HG+T+FSD+ P EFR++  G+     
Sbjct  127  KSYASKEEHDYRFDVFKANLRRAACHQRLDPSAQHGMTRFSDMIPAEFRKSQLGLRG---  183

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
                ++LPADA +APILPT+NLP DFDWR+HGAVT VKNQGSCGSCWSFSTTGALEGAHF
Sbjct  184  ----LKLPADATEAPILPTENLPEDFDWREHGAVTAVKNQGSCGSCWSFSTTGALEGAHF  239

Query  560  LAT  568
            LAT
Sbjct  240  LAT  242



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score =   225 bits (573),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 133/185 (72%), Gaps = 25/185 (14%)
 Frame = +2

Query  38   FSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDP--------LLNADHHFSLFKSK  193
            FSLLI+        RA     DPLIRQVV   DGD +          L A+HHFS FK K
Sbjct  77   FSLLIVS-------RAQSDGADPLIRQVV---DGDGESHXXXXXXXALGAEHHFSFFKHK  126

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            +GKSY ++EEHDYRF VFKANLRRA  HQ LDPSA HG+T+FSD+ P EFR++  G+   
Sbjct  127  YGKSYASKEEHDYRFDVFKANLRRAACHQRLDPSAQHGMTRFSDMIPAEFRKSQLGLRG-  185

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                  ++LPADA +APILPT+NLP DFDWR+HGAVT VKNQGSCGSCWSFSTTGALEGA
Sbjct  186  ------LKLPADATEAPILPTENLPEDFDWREHGAVTAVKNQGSCGSCWSFSTTGALEGA  239

Query  554  HFLAT  568
            HFLAT
Sbjct  240  HFLAT  244



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 127/157 (81%), Gaps = 10/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            ++ LIRQVV  EDGD+  LLNA+HHFS FK+KF K+Y T+EEHDYRF VFK+NL RAK H
Sbjct  27   DNILIRQVV--EDGDEH-LLNAEHHFSAFKTKFSKTYATKEEHDYRFGVFKSNLLRAKSH  83

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDPSA+HGVTKFSDLTP EFR  F G+         + LP+DA+ APILPTDNLP DF
Sbjct  84   QELDPSAIHGVTKFSDLTPSEFRSQFLGLK-------PLSLPSDAHNAPILPTDNLPKDF  136

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVT VKNQG+ GSCWSFSTTGALEGAHFLAT
Sbjct  137  DWRDHGAVTNVKNQGTGGSCWSFSTTGALEGAHFLAT  173



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 135/185 (73%), Gaps = 11/185 (6%)
 Frame = +2

Query  20   MDRFFL-FSLLIIGLASASFVRADFS-AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSK  193
            MDR  L FS+ ++     S   +D +  +D +IRQVV    G +  +L ++ HFSLFK K
Sbjct  1    MDRLKLYFSVFVLSFFIVSVSSSDVNDGDDLVIRQVVG---GAEPQVLTSEDHFSLFKRK  57

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            FGK Y + EEHDYRFSVFKANLRRA+RHQ LDPSA HGVT+FSDLT  EFR+   GV   
Sbjct  58   FGKVYASNEEHDYRFSVFKANLRRARRHQKLDPSATHGVTQFSDLTRSEFRKKHLGVRSG  117

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                   +LP DANKAPILPT+NLP DFDWRDHGAVT VKNQGSCGSCWSFS TGALEGA
Sbjct  118  ------FKLPKDANKAPILPTENLPEDFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGA  171

Query  554  HFLAT  568
            +FLAT
Sbjct  172  NFLAT  176



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 127/157 (81%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +D LIRQVV   D ++D LLNA+HHF+ FKSKF KSY T+EEHDYRF VFKANL +AK H
Sbjct  21   DDFLIRQVV---DNEEDHLLNAEHHFTSFKSKFSKSYATKEEHDYRFGVFKANLIKAKLH  77

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDP+A HG+TKFSDLT  EFRR F G++K      ++RLPA A KAPILPT NLP DF
Sbjct  78   QKLDPTAEHGITKFSDLTASEFRRQFLGLNK------RLRLPAHAQKAPILPTTNLPEDF  131

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWR+ GAVT VK+QGSCGSCW+FSTTGALEGAH+LAT
Sbjct  132  DWREKGAVTPVKDQGSCGSCWAFSTTGALEGAHYLAT  168



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 138/183 (75%), Gaps = 12/183 (7%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSA---EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            F +F LLI+ ++ +S + A+ S+   +D +IRQVV   DG +  +L+++ HFSLFK KFG
Sbjct  8    FSVFVLLILFVSVSSGIVAETSSSDGDDLVIRQVV---DGAEPKVLSSEDHFSLFKRKFG  64

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K Y + EEHDYR SVFKANLRRA+RHQ LDPSA HGVT+FSDLT  EFR+   GV     
Sbjct  65   KVYASSEEHDYRLSVFKANLRRARRHQKLDPSARHGVTQFSDLTRSEFRKKHLGVRGG--  122

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
                 +LP DANKAPILPT+NLP DFDWRD GAVT VKNQGSCGSCWSFS TGALEGA+F
Sbjct  123  ----FKLPKDANKAPILPTENLPEDFDWRDRGAVTPVKNQGSCGSCWSFSATGALEGANF  178

Query  560  LAT  568
            LAT
Sbjct  179  LAT  181



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 135/185 (73%), Gaps = 11/185 (6%)
 Frame = +2

Query  20   MDRFFL-FSLLIIGLASASFVRADFS-AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSK  193
            MDR  L FS+ ++     S   +D +  +D +IRQVV    G +  +L ++ HFSLFK K
Sbjct  1    MDRLKLYFSVFVLSFFIVSVSSSDVNDGDDLVIRQVVG---GAEPQVLTSEDHFSLFKRK  57

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            FGK Y + EEHDYRFSVFKANLRRA+RHQ LDPSA HGVT+FSDLT  EFR+   GV   
Sbjct  58   FGKVYASNEEHDYRFSVFKANLRRARRHQKLDPSATHGVTQFSDLTRSEFRKKHLGVRSG  117

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                   +LP DANKAPILPT+NLP DFDWRDHGAVT VKNQGSCGSCWSFS TGALEGA
Sbjct  118  ------FKLPKDANKAPILPTENLPEDFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGA  171

Query  554  HFLAT  568
            +FLAT
Sbjct  172  NFLAT  176



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 126/157 (80%), Gaps = 10/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +D LIRQVV + +   + LLNA++HFS FK+KFG++Y T+EEHDYRF +FK NL RAK H
Sbjct  29   DDLLIRQVVPDAE---EHLLNAENHFSAFKTKFGRTYATKEEHDYRFRIFKNNLLRAKSH  85

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDPSAVHGVTKFSDLTP EF R F G+         +RLP+DA KAPILPT +LP+DF
Sbjct  86   QKLDPSAVHGVTKFSDLTPAEFSRQFLGLKP-------LRLPSDAQKAPILPTSDLPSDF  138

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVTGVKNQGSCGSCWSFS  GALEGAHFL+T
Sbjct  139  DWRDHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLST  175



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 141/183 (77%), Gaps = 11/183 (6%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR FL +LL+  + + +    D + +D LIRQV    D +DD LLNA+HHF+ FKSKF 
Sbjct  1    MDRSFLLALLLFSVVATA--TKDDNNDDFLIRQVT---DHEDDQLLNAEHHFTTFKSKFS  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            KSY T+EEHDYRF VFK+NL++AK HQ LDPSA HGVTKFSDLT  EFRR F G+ K   
Sbjct  56   KSYATKEEHDYRFGVFKSNLKKAKLHQKLDPSAEHGVTKFSDLTASEFRRQFLGLKK---  112

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
               ++RLPA A KAPILPT+NLP DFDWR+ GAVT VK+QGSCGSCW+FSTTGALEGA++
Sbjct  113  ---RLRLPAHAQKAPILPTNNLPEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGANY  169

Query  560  LAT  568
            LAT
Sbjct  170  LAT  172



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 136/181 (75%), Gaps = 12/181 (7%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVV-SEEDGDDDPLLNADHHFSLFKSKFGKS  205
            +FLF    IGL S+       S  DPLIRQV   ++DG +   L A+HHFSLFK++F KS
Sbjct  14   YFLF----IGLISSEAFSVVGSEVDPLIRQVTDGQDDGVETQPLTAEHHFSLFKARFKKS  69

Query  206  YDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKK  385
            Y +EEEHDYRF VF+ANLRRA+RHQ LDPSA HGVT+FSDLTP EFR       K     
Sbjct  70   YGSEEEHDYRFKVFRANLRRAERHQKLDPSATHGVTQFSDLTPGEFR-------KRFLGL  122

Query  386  LKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLA  565
             ++RLP DAN+APILPTDNLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGA+FLA
Sbjct  123  RRLRLPTDANQAPILPTDNLPEDFDWREKGAVTPVKNQGSCGSCWSFSTTGALEGANFLA  182

Query  566  T  568
            T
Sbjct  183  T  183



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 126/157 (80%), Gaps = 7/157 (4%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPL-LNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            D LIRQVV +     +   L+  HHFSLFK +FG+SY ++EEHDYRF VF+ANLRRA+RH
Sbjct  35   DALIRQVVDDGGDGREGGPLSDHHHFSLFKRRFGRSYGSQEEHDYRFGVFRANLRRARRH  94

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDPSA HGVT+FSDLTP EFRRT  G+ +      K++LP DAN+APILPT +LP DF
Sbjct  95   QKLDPSAAHGVTQFSDLTPSEFRRTHLGLRR------KVKLPKDANEAPILPTQDLPKDF  148

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVT VKNQGSCGSCWSFSTTGALEGA++LAT
Sbjct  149  DWRDHGAVTAVKNQGSCGSCWSFSTTGALEGANYLAT  185



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 128/158 (81%), Gaps = 7/158 (4%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            AEDP+IRQV S++ G+   LL A+ HFSLFK KFGK Y  E EH+YRFSVFKAN+ RA+R
Sbjct  26   AEDPIIRQVTSDDAGNS--LLGAEGHFSLFKRKFGKEYSNEAEHNYRFSVFKANMARARR  83

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            HQ+LDP+AVHGVT+FSDLT +EF+  + G+ K +   LK  LP    +APILPT++LP D
Sbjct  84   HQILDPTAVHGVTQFSDLTEEEFQERYLGL-KGKLDFLKSNLP----EAPILPTNDLPAD  138

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRDHGAVT +KNQGSCGSCWSFSTTGALEGAHFLAT
Sbjct  139  FDWRDHGAVTPIKNQGSCGSCWSFSTTGALEGAHFLAT  176



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 136/185 (74%), Gaps = 11/185 (6%)
 Frame = +2

Query  20   MDRFFL-FSLLIIGLASASFVRADFS-AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSK  193
            MDR  L FS+ ++     S   +D +  +D +IRQVV    G +  +L ++ HFSLFKSK
Sbjct  1    MDRLKLCFSVFVLFFLIVSVSSSDVNDGDDLVIRQVVG---GAEPQVLTSEDHFSLFKSK  57

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            FGK Y + EEHDYRFSVFKANLRRA+RHQ LDPSA HGVT+FSDLT  EFR+   GV   
Sbjct  58   FGKVYASNEEHDYRFSVFKANLRRARRHQKLDPSARHGVTQFSDLTRSEFRKKHLGV---  114

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
               +   +LP DANKAPILPT+NLP DFDWRD GAVT VKNQGSCGSCWSFS TGALEGA
Sbjct  115  ---RAGFKLPKDANKAPILPTENLPEDFDWRDRGAVTPVKNQGSCGSCWSFSATGALEGA  171

Query  554  HFLAT  568
            +FLAT
Sbjct  172  NFLAT  176



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 125/161 (78%), Gaps = 8/161 (5%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNAD-HHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRR  265
            F+ +D LIRQVV  +D     LL A+ HHFSLFK KF KSY ++EEHDYRFSVFK+NLRR
Sbjct  24   FNGDDSLIRQVVEGQDESSSNLLTAEQHHFSLFKRKFKKSYLSQEEHDYRFSVFKSNLRR  83

Query  266  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNL  445
            A RHQ LDP+A HGVT+FSDLT  EFR+   G+ K       +RLP DAN APILPT++L
Sbjct  84   AARHQKLDPTASHGVTQFSDLTSAEFRKQVLGLRK-------LRLPKDANTAPILPTNDL  136

Query  446  PTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            P DFDWR+ GAV  VKNQGSCGSCWSFSTTGALEGAHFLAT
Sbjct  137  PEDFDWREKGAVGPVKNQGSCGSCWSFSTTGALEGAHFLAT  177



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 128/164 (78%), Gaps = 12/164 (7%)
 Frame = +2

Query  92   SAEDPLIRQVVSEEDGD-----DDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKAN  256
            +A+D LIRQVV +  G+     +D LLNA+HHF+ FK+KFGK Y T+EEHD RF VFK+N
Sbjct  21   AADDILIRQVVPDAVGEAAEKEEDHLLNAEHHFASFKAKFGKKYATKEEHDRRFGVFKSN  80

Query  257  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPT  436
            LRRA+ H  LDPSAVHGVTKFSDLTP EFRR F G          +RLPA+A KAPILPT
Sbjct  81   LRRARLHAKLDPSAVHGVTKFSDLTPAEFRRQFLGFK-------PLRLPANAQKAPILPT  133

Query  437  DNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             +LP DFDWRD GAVT VK+QG+CGSCWSFSTTGALEGAH+LAT
Sbjct  134  KDLPKDFDWRDKGAVTNVKDQGACGSCWSFSTTGALEGAHYLAT  177



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 126/156 (81%), Gaps = 11/156 (7%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            DPLIRQV    DGD   +LNA+HHF+ FK+KFGKSY T+EEHDYRF VF+ANLRRAK H 
Sbjct  24   DPLIRQVT---DGDHH-MLNAEHHFTTFKTKFGKSYATQEEHDYRFGVFRANLRRAKLHA  79

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
             LDPSA HGVTKFSDLTP+EF+R + G+         +RLP+ ANKAPILPT +LP +FD
Sbjct  80   KLDPSAEHGVTKFSDLTPEEFKRQYLGLK-------PLRLPSTANKAPILPTSDLPENFD  132

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WRD GAVT VKNQGSCGSCW+FSTTGALEGAH+L+T
Sbjct  133  WRDKGAVTPVKNQGSCGSCWAFSTTGALEGAHYLST  168



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 125/161 (78%), Gaps = 8/161 (5%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNAD-HHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRR  265
            F+ +D LIRQVV  +D     LL A+ HHFSLFK KF KSY ++EEHDYRFSVFK+NLRR
Sbjct  24   FNGDDSLIRQVVEGQDESSSNLLTAEQHHFSLFKRKFKKSYLSQEEHDYRFSVFKSNLRR  83

Query  266  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNL  445
            A RHQ LDP+A HGVT+FSDLT  EFR+   G+ K       +RLP DAN APILPT++L
Sbjct  84   AARHQKLDPTASHGVTQFSDLTSAEFRKQVLGLRK-------LRLPKDANTAPILPTNDL  136

Query  446  PTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            P DFDWR+ GAV  VKNQGSCGSCWSFSTTGALEGAHFLAT
Sbjct  137  PEDFDWREKGAVGPVKNQGSCGSCWSFSTTGALEGAHFLAT  177



>gb|AFK47617.1| unknown [Medicago truncatula]
Length=241

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 130/161 (81%), Gaps = 9/161 (6%)
 Frame = +2

Query  86   DFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRR  265
            D +++D LIRQVV   D  +D +LNA+HHF+ FKSKF K+Y T+EEHDYRF VFK+NL +
Sbjct  25   DTNSDDLLIRQVV---DTAEDHILNAEHHFTSFKSKFSKNYATKEEHDYRFGVFKSNLIK  81

Query  266  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNL  445
            AK HQ LDPSA HG+TKFSDLT  EFRR F G++K      ++RLPA A KAPILPT+NL
Sbjct  82   AKLHQKLDPSAQHGITKFSDLTASEFRRQFLGLNK------RLRLPAHAQKAPILPTNNL  135

Query  446  PTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            P DFDWR+ GAVT VK+QGSCGSCW+FSTTGALEGA++LAT
Sbjct  136  PEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGANYLAT  176



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 126/157 (80%), Gaps = 10/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +D LIRQVV + +   + LLNA++HFS FK++FG++Y T+EEHDYRF +FK NL RAK H
Sbjct  29   DDLLIRQVVPDAE---EHLLNAENHFSAFKTRFGRTYATKEEHDYRFRIFKNNLLRAKSH  85

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDPSAVHGVTKFSDLTP EF R F G+         +RLP+DA KAPILPT +LP+DF
Sbjct  86   QKLDPSAVHGVTKFSDLTPAEFSRQFLGLKP-------LRLPSDAQKAPILPTSDLPSDF  138

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVTGVKNQGSCGSCWSFS  GALEGAHFL+T
Sbjct  139  DWRDHGAVTGVKNQGSCGSCWSFSAVGALEGAHFLST  175



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 138/192 (72%), Gaps = 19/192 (10%)
 Frame = +2

Query  20   MDRF----FLFSLLI-----IGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHH  172
            M+RF      F++L+      G++S     A    ED LIRQVVS   G DD  L A+ H
Sbjct  1    MERFNAIPLFFAILLSATVAYGVSSDQINSAVSDEEDILIRQVVS---GADDRPLTAEQH  57

Query  173  FSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRT  352
            F  FK KFGK+Y T+EEHDYRF VFKANLR+AKRHQ LDP AVHGVT+FSDLT  EFR  
Sbjct  58   FQDFKLKFGKTYTTDEEHDYRFRVFKANLRKAKRHQKLDPDAVHGVTRFSDLTESEFREN  117

Query  353  FHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFST  532
            F G++       ++RLPADA++APILPTDNL +DFDWRD GAVT VK+QGSCGSCWSFS 
Sbjct  118  FVGLN-------RLRLPADAHQAPILPTDNLASDFDWRDQGAVTPVKDQGSCGSCWSFSA  170

Query  533  TGALEGAHFLAT  568
             GALEGA+FL+T
Sbjct  171  VGALEGANFLST  182



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 125/161 (78%), Gaps = 8/161 (5%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNAD-HHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRR  265
            F+ +D LIRQVV  +D     LL  + HHFSLFK KF KSY +++EHDYRFSVFK+NLRR
Sbjct  24   FNGDDSLIRQVVEGQDESSSNLLTGEQHHFSLFKRKFKKSYLSQQEHDYRFSVFKSNLRR  83

Query  266  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNL  445
            A RHQ LDP+A HGVT+FSDLT  EFR+   G+ K       +RLP DANKAPILPT++L
Sbjct  84   AARHQKLDPTASHGVTQFSDLTAAEFRKQVLGLRK-------LRLPKDANKAPILPTNDL  136

Query  446  PTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            P DFDWR+ GAV  VKNQGSCGSCWSFSTTGALEGAHFLAT
Sbjct  137  PEDFDWREKGAVGPVKNQGSCGSCWSFSTTGALEGAHFLAT  177



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 135/181 (75%), Gaps = 12/181 (7%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVV-SEEDGDDDPLLNADHHFSLFKSKFGKS  205
            +FLF    IGL S+       S  DPLIRQV   ++DG +   L A+HHFSLFK++F KS
Sbjct  14   YFLF----IGLISSEAFSVVGSEVDPLIRQVTDGQDDGVETQPLTAEHHFSLFKARFKKS  69

Query  206  YDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKK  385
            Y +EEEHDYRF VF+ANLRRA RHQ LDPSA HGVT+FSDLTP EFR       K     
Sbjct  70   YGSEEEHDYRFKVFRANLRRAARHQKLDPSATHGVTQFSDLTPGEFR-------KRFLGL  122

Query  386  LKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLA  565
             ++RLP DAN+APILPTDNLP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGA+FLA
Sbjct  123  RRLRLPKDANQAPILPTDNLPEDFDWREKGAVTPVKNQGSCGSCWSFSTTGALEGANFLA  182

Query  566  T  568
            T
Sbjct  183  T  183



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   221 bits (563),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 125/161 (78%), Gaps = 8/161 (5%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNAD-HHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRR  265
            F+ +D LIRQVV  +D     LL A+ HH SLFK KF KSY ++EEHDYRFSVFK+NLRR
Sbjct  30   FNGDDSLIRQVVEGQDESSPNLLTAEQHHLSLFKRKFKKSYLSQEEHDYRFSVFKSNLRR  89

Query  266  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNL  445
            A RHQ LDP+A HGVT+FSDLT  EFR+   G+ K       +RLP DANKAPILPT++L
Sbjct  90   AARHQKLDPTASHGVTQFSDLTSAEFRKQVLGLRK-------LRLPKDANKAPILPTNDL  142

Query  446  PTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            P DFDWR+ GAV  VKNQGSCGSCWSFSTTGALEGAHFLAT
Sbjct  143  PEDFDWREKGAVGPVKNQGSCGSCWSFSTTGALEGAHFLAT  183



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 124/156 (79%), Gaps = 10/156 (6%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            D LIRQVV   D ++D +LNA+HHFS FKSKF K+Y T+EEHDYRF VFK+N+RRAK H 
Sbjct  1    DLLIRQVV---DDNEDHVLNAEHHFSTFKSKFSKTYATKEEHDYRFGVFKSNVRRAKLHA  57

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
             LDPSAVHGVTKFSDLTP EFRR F G+         +RLP  A KAPILPT +LP DFD
Sbjct  58   KLDPSAVHGVTKFSDLTPSEFRRQFLGLK-------PLRLPEHAQKAPILPTHDLPEDFD  110

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WRD GAVT VKNQGSCGSCW+FSTTGALEG+HFLAT
Sbjct  111  WRDKGAVTHVKNQGSCGSCWAFSTTGALEGSHFLAT  146



>gb|AEQ94152.1| drought-inducible cysteine proteinase [Elaeis guineensis]
Length=252

 Score =   217 bits (552),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 131/160 (82%), Gaps = 4/160 (3%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRA  268
            ++ +DPLI QVV E D +D+  LNA+ HFS F  +FGKSY  E+EH YRFSVFKANLRRA
Sbjct  28   YAEDDPLIVQVVPESD-EDELRLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRA  86

Query  269  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLP  448
            +RHQ +DP+AVHG+TKFSDLTP EFRRT+ G+   R  +  +   A +++APILPT+NLP
Sbjct  87   RRHQKMDPTAVHGITKFSDLTPAEFRRTYLGLRGGRRLRRAL---ASSHEAPILPTNNLP  143

Query  449  TDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            TDFDWRDHGAVTGVK+QGSCGSCWSFS +GALEGA+FLAT
Sbjct  144  TDFDWRDHGAVTGVKDQGSCGSCWSFSASGALEGANFLAT  183



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score =   220 bits (561),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 137/185 (74%), Gaps = 11/185 (6%)
 Frame = +2

Query  20   MDRFFL-FSLLIIGLASASFVRADFS-AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSK  193
            MDR  L FS+ ++    AS   +D +  +D +IRQVV    G D  +L++  HFSLFK K
Sbjct  1    MDRLKLCFSVFVLFFFIASVSSSDVNDGDDLVIRQVVG---GADSEVLSSADHFSLFKKK  57

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            FGK Y + EEHDYRFSVFKANLR+A+RHQ LDPSA HGVT+FSDLT  EFR+   GV   
Sbjct  58   FGKVYASNEEHDYRFSVFKANLRQARRHQKLDPSARHGVTQFSDLTRSEFRKKHLGV---  114

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
               K   +LP DANKAPILPT+NLP +FDWRDHGAVT VKNQGSCGSCWSFS TGALEGA
Sbjct  115  ---KGGFKLPKDANKAPILPTENLPEEFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGA  171

Query  554  HFLAT  568
            +FL+T
Sbjct  172  NFLST  176



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 130/159 (82%), Gaps = 10/159 (6%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHH-FSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAK  271
             ++PLIRQVV+  DG D  LL+ADHH F+LFK+ +GK+Y T+EEHDYRFSVFK NLRRA+
Sbjct  18   VDEPLIRQVVT--DGID--LLDADHHHFALFKADYGKAYATQEEHDYRFSVFKTNLRRAR  73

Query  272  RHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPT  451
              Q LDPSAVHGVT FSDLTP EFR ++ G+ K R     ++LP DA +AP+LPTD+LP 
Sbjct  74   SRQQLDPSAVHGVTMFSDLTPDEFRNSYLGLRKRR-----LKLPTDAKQAPLLPTDHLPE  128

Query  452  DFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DFDWRD GAVT VK+QGSCGSCWSFSTTGALEGA++LAT
Sbjct  129  DFDWRDKGAVTAVKDQGSCGSCWSFSTTGALEGANYLAT  167



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 135/184 (73%), Gaps = 13/184 (7%)
 Frame = +2

Query  17   NMDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKF  196
            N     +F L+I  +  A+   AD   ++PLI QVV E  G     L A+HHF  FK +F
Sbjct  2    NNPTLIIFFLVIFSVFFAA--SADGGDDEPLIMQVV-EGSG---VRLGAEHHFLDFKRRF  55

Query  197  GKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSR  376
            GK+Y ++EEH+YRF VFKAN+RRA+RHQ LDPSA HGVT+FSDLT  EFR    G+    
Sbjct  56   GKAYASQEEHNYRFEVFKANMRRARRHQSLDPSAAHGVTRFSDLTASEFRNKVLGLRG--  113

Query  377  AKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAH  556
                 +RLP++ANKAPILPTDNLP+DFDWRDHGAVT VKNQGSCGSCWSFSTTGALEGAH
Sbjct  114  -----VRLPSNANKAPILPTDNLPSDFDWRDHGAVTPVKNQGSCGSCWSFSTTGALEGAH  168

Query  557  FLAT  568
            FL+T
Sbjct  169  FLST  172



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score =   220 bits (561),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 124/158 (78%), Gaps = 2/158 (1%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            AEDPLIRQVV   D D+D  LNA+ HF  F  +FGKSY   +EH YR SVFK NLRRA+R
Sbjct  23   AEDPLIRQVVPGGD-DNDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKDNLRRARR  81

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            HQLLDPSA HGVTKFSDLTP EFRRT+ G+ KSR   L+  L   A++AP+LPTD LP D
Sbjct  82   HQLLDPSAEHGVTKFSDLTPAEFRRTYLGLRKSRRALLR-ELGESAHEAPVLPTDGLPDD  140

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRDHGAV  VKNQGSCGSCWSFS +GALEGAH+LAT
Sbjct  141  FDWRDHGAVGPVKNQGSCGSCWSFSASGALEGAHYLAT  178



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 126/159 (79%), Gaps = 10/159 (6%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDP-LLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAK  271
             +D +IRQVV   DG  +P +L+++ HFSLFKSKFGK Y + EEHDYRFSVFKANLRRA+
Sbjct  26   GDDAVIRQVV---DGAAEPNVLSSEDHFSLFKSKFGKVYASGEEHDYRFSVFKANLRRAR  82

Query  272  RHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPT  451
            RHQ +DPSA HGVT+FSDLT  EFR    GV      K   +LP DANKAPILPT+NLP 
Sbjct  83   RHQKMDPSARHGVTQFSDLTRSEFREKHLGV------KGGFKLPKDANKAPILPTENLPE  136

Query  452  DFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DFDWRDHGAVT VKNQGSCGSCWSFS TGALEGA+FLAT
Sbjct  137  DFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLAT  175



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 124/157 (79%), Gaps = 2/157 (1%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            EDPLIRQVV   D D+D  LNA+ HF  F  +FGKSY   +EH YR SVFKANLRRA+RH
Sbjct  26   EDPLIRQVVPGGD-DNDLELNAESHFLNFVQRFGKSYKDADEHAYRLSVFKANLRRARRH  84

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            QLLDPSA HG+TKFSDLTP EFRRT+ G+ KSR   L+  L   A++AP+LPTD LP DF
Sbjct  85   QLLDPSAEHGITKFSDLTPAEFRRTYLGLRKSRRALLR-ELGDSAHEAPVLPTDGLPEDF  143

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAV  VKNQGSCGSCWSFS +GALEGAH+LAT
Sbjct  144  DWRDHGAVGPVKNQGSCGSCWSFSASGALEGAHYLAT  180



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 120/154 (78%), Gaps = 9/154 (6%)
 Frame = +2

Query  107  LIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLL  286
            +IRQVV   DG +  +L ++ HFSLFK KFGK Y + EEHDYR SVFKANLRRAKRHQ L
Sbjct  31   VIRQVV---DGSEPKILTSEDHFSLFKKKFGKVYVSNEEHDYRLSVFKANLRRAKRHQKL  87

Query  287  DPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWR  466
            DPSA+HGVT+FSDLT  EFR+   GV          +LP DANKAPILP +NLP DFDWR
Sbjct  88   DPSAIHGVTQFSDLTRSEFRKMHLGVRSG------FKLPKDANKAPILPVENLPEDFDWR  141

Query  467  DHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DHGAVT VKNQGSCGSCWSFS TGALEGA+FLAT
Sbjct  142  DHGAVTPVKNQGSCGSCWSFSATGALEGANFLAT  175



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 8/154 (5%)
 Frame = +2

Query  107  LIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLL  286
            LIRQVV E + +D  LLNA+HHFS FK+KFGK+Y T+EEHD+RF VFK+NLRRA+ H  L
Sbjct  29   LIRQVVPEGEVEDH-LLNAEHHFSNFKAKFGKTYATKEEHDHRFGVFKSNLRRARLHAQL  87

Query  287  DPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWR  466
            DPSAVHGVTKFSDLT  EF+R F G+         + LPA+A KAPILPT+NLP DFDWR
Sbjct  88   DPSAVHGVTKFSDLTAAEFQRQFLGLK-------PLGLPANAQKAPILPTNNLPKDFDWR  140

Query  467  DHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            D GAVT VK+QG+CGSCWSFSTTGALEGAHFLAT
Sbjct  141  DKGAVTNVKDQGACGSCWSFSTTGALEGAHFLAT  174



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 12/187 (6%)
 Frame = +2

Query  20   MDRF--FLFSLLIIGLASASFVRADFSAEDPLIRQVVS--EEDGDDDPLLNADHHFSLFK  187
            + RF   LFS  ++  A+AS V +D  ++D LIRQVV+  ++  +DD LLNA+HHFS FK
Sbjct  4    LSRFVLLLFSSSLVFAATASTVSSD-ESDDLLIRQVVAGADDHDNDDLLLNAEHHFSSFK  62

Query  188  SKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVH  367
             +FGK+Y + +EHD RF VFKANLRRAKR+Q+LDPSAVHGVT+F DLTP EFRRT+ G+ 
Sbjct  63   KRFGKAYTSCDEHDRRFGVFKANLRRAKRNQILDPSAVHGVTQFFDLTPAEFRRTYLGLK  122

Query  368  KSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALE  547
                   ++RLPAD ++APILPT++LP DFDWRDHGAVT VKNQGSCGSCWSFS TGALE
Sbjct  123  -------RLRLPADTHEAPILPTNDLPADFDWRDHGAVTPVKNQGSCGSCWSFSATGALE  175

Query  548  GAHFLAT  568
            GA+FLAT
Sbjct  176  GANFLAT  182



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 130/161 (81%), Gaps = 9/161 (6%)
 Frame = +2

Query  86   DFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRR  265
            D +++D LIRQVV   D  +D +LNA+HHF+ FKSKF K+Y T+EEHDYRF VFK+NL +
Sbjct  25   DTNSDDLLIRQVV---DTAEDHILNAEHHFTSFKSKFSKNYATKEEHDYRFGVFKSNLIK  81

Query  266  AKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNL  445
            AK HQ LDPSA HG+TKFSDLT  EFRR F G++K      ++RLPA A KAPILPT+NL
Sbjct  82   AKLHQKLDPSAQHGITKFSDLTASEFRRQFLGLNK------RLRLPAHAQKAPILPTNNL  135

Query  446  PTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            P DFDWR+ GAVT VK+QGSCGSCW+FSTTGALEGA++LAT
Sbjct  136  PEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGANYLAT  176



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 130/167 (78%), Gaps = 9/167 (5%)
 Frame = +2

Query  68   ASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVF  247
            A+ V  D + +D +IRQVV   D ++D LLNA+HHF+ FKSKF KSY T+EEHDYRF VF
Sbjct  16   ATAVTDDTNNDDFIIRQVV---DNEEDHLLNAEHHFTSFKSKFSKSYATKEEHDYRFGVF  72

Query  248  KANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPI  427
            K+NL +AK HQ  DP+A HG+TKFSDLT  EFRR F G+ K      ++RLPA A KAPI
Sbjct  73   KSNLIKAKLHQNRDPTAEHGITKFSDLTASEFRRQFLGLKK------RLRLPAHAQKAPI  126

Query  428  LPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            LPT NLP DFDWR+ GAVT VK+QGSCGSCW+FSTTGALEGAH+LAT
Sbjct  127  LPTTNLPEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGAHYLAT  173



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 133/192 (69%), Gaps = 19/192 (10%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFS---------AEDPLIRQVVSEEDGDDDPLLNADHH  172
            M RF   +L    L SA+     FS          ED LIRQVVS   G DD LL A+  
Sbjct  1    MARFNAIALFFAILLSATVAYGVFSDQIDGDVSDGEDLLIRQVVS---GADDRLLTAEQR  57

Query  173  FSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRT  352
            F  FK KFGK+Y T EEHDYRF VFK NLR+AKRHQ LDP AVHGVT+FSDLT  EFR  
Sbjct  58   FQNFKLKFGKTYATAEEHDYRFRVFKDNLRKAKRHQKLDPDAVHGVTRFSDLTESEFREN  117

Query  353  FHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFST  532
            F G++       ++RLPADA++APILPTDNL +DFDWRD GAVT VK+QGSCGSCWSFS 
Sbjct  118  FVGLN-------RLRLPADAHQAPILPTDNLASDFDWRDKGAVTPVKDQGSCGSCWSFSA  170

Query  533  TGALEGAHFLAT  568
             GALEGA+FL+T
Sbjct  171  VGALEGANFLST  182



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 133/186 (72%), Gaps = 15/186 (8%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPL---IRQVVSEEDGDDDPLLNADHHFSLFKS  190
            MDR   F L+    ASA FV     A+D     I+QVV EE+  D+ LLN DH F+LFKS
Sbjct  1    MDRAVFFLLI----ASALFVTISGVADDGFGNPIKQVVREEN--DEQLLNLDHQFTLFKS  54

Query  191  KFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHK  370
            K+ K+Y  + EHD+RF VFKAN+RRA+RHQ LDPSAVHGVT+FSD+TPKEF R + G+  
Sbjct  55   KYEKTYKNQVEHDHRFRVFKANVRRARRHQQLDPSAVHGVTQFSDVTPKEFSRKYLGL--  112

Query  371  SRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEG  550
                K +  LP D  KA ILPT  LPTDFDWR+ GAVT VKNQG CGSCWSFS TGALEG
Sbjct  113  ----KRRFSLPNDTQKAAILPTSELPTDFDWREKGAVTPVKNQGLCGSCWSFSATGALEG  168

Query  551  AHFLAT  568
            AHFLAT
Sbjct  169  AHFLAT  174



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 121/156 (78%), Gaps = 13/156 (8%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            DP+I QVV      DD  L A+HHF  FK +FGK Y TEEEH YRF+VFK+N+ RA+RHQ
Sbjct  27   DPMICQVV------DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQ  80

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
            LLDPSAVHGVT+FSDLTP EFR +  G+         + LP+DA+ APILPTDNLP DFD
Sbjct  81   LLDPSAVHGVTRFSDLTPMEFRHSVLGLRG-------VGLPSDADSAPILPTDNLPKDFD  133

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WR+HGAVT VKNQGSCGSCWSFS TGALEGAHFL+T
Sbjct  134  WREHGAVTPVKNQGSCGSCWSFSATGALEGAHFLST  169



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 121/156 (78%), Gaps = 13/156 (8%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            DP+I QVV      DD  L A+HHF  FK +FGK Y TEEEH YRF+VFK+N+ RA+RHQ
Sbjct  27   DPMICQVV------DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQ  80

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
            LLDPSAVHGVT+FSDLTP EFR +  G+         + LP+DA+ APILPTDNLP DFD
Sbjct  81   LLDPSAVHGVTRFSDLTPMEFRHSVLGLRG-------VGLPSDADSAPILPTDNLPKDFD  133

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WR+HGAVT VKNQGSCGSCWSFS TGALEGAHFL+T
Sbjct  134  WREHGAVTPVKNQGSCGSCWSFSATGALEGAHFLST  169



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score =   218 bits (554),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 124/159 (78%), Gaps = 10/159 (6%)
 Frame = +2

Query  95   AEDPLIRQVVSEEDGDDDP-LLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAK  271
             +D +IRQVV   DG  +P +L ++ HFSLFK KFGK Y + EEHDYRFSVFKANLRRA+
Sbjct  26   GDDAVIRQVV---DGAAEPNVLTSEDHFSLFKRKFGKVYASGEEHDYRFSVFKANLRRAR  82

Query  272  RHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPT  451
            RHQ +DPSA HGVT+FSDLT  EFR    GV      K   +LP DANKAPILPT+NLP 
Sbjct  83   RHQKMDPSARHGVTQFSDLTRSEFREKHLGV------KGGFKLPKDANKAPILPTENLPE  136

Query  452  DFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DFDWRDHGAVT VKNQGSCGSCWSFS TGALEGA+FLAT
Sbjct  137  DFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLAT  175



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score =   218 bits (554),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 129/163 (79%), Gaps = 13/163 (8%)
 Frame = +2

Query  101  DPLIRQV-------VSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANL  259
            D LIRQV       +S  +  ++ LL A+HHFSLFK KF K+Y ++EEHD+RF++FKANL
Sbjct  29   DQLIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKANL  88

Query  260  RRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTD  439
            RRA RHQ LDPSA HG+T+FSDLTP EFRRT+ G+ +      K+RLP DA++APILPT+
Sbjct  89   RRAARHQKLDPSATHGITQFSDLTPAEFRRTYLGLRR------KLRLPKDADQAPILPTN  142

Query  440  NLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +LP DFDWR+ GAV  VK+QGSCGSCWSFSTTGALEGA+FLAT
Sbjct  143  DLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLAT  185



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 139/188 (74%), Gaps = 17/188 (9%)
 Frame = +2

Query  20   MDRFFL----FSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDP-LLNADHHFSLF  184
            MDR  L    F+LL I ++++S        +D +I+QVV   DG  DP +L+++ HFSLF
Sbjct  1    MDRLKLSLSVFALLFIVVSASS---DGNEGDDLVIKQVV---DGGADPNVLSSEDHFSLF  54

Query  185  KSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGV  364
            K KFGK Y + EEHDYRFSVFK+NLRRA+RHQ LDPSA HGVT+FSDLT  EF+R   GV
Sbjct  55   KKKFGKVYASREEHDYRFSVFKSNLRRARRHQKLDPSARHGVTQFSDLTRSEFKRKHLGV  114

Query  365  HKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGAL  544
                  K   +LP DANKAPILPT+NLP +FDWR+ GAVT VKNQGSCGSCWSFS TGAL
Sbjct  115  ------KGGFKLPKDANKAPILPTENLPVEFDWRERGAVTPVKNQGSCGSCWSFSATGAL  168

Query  545  EGAHFLAT  568
            EGA+FLAT
Sbjct  169  EGANFLAT  176



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 129/163 (79%), Gaps = 13/163 (8%)
 Frame = +2

Query  101  DPLIRQV-------VSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANL  259
            D +IRQV       +S  +  ++ LL A+HHFSLFK KF K+Y ++EEHD+RF++FKANL
Sbjct  29   DQMIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDHRFTIFKANL  88

Query  260  RRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTD  439
            RRA RHQ LDPSA HG+T+FSDLTP EFRRT+ G+ +      K+RLP DA++APILPT+
Sbjct  89   RRAARHQKLDPSATHGITQFSDLTPAEFRRTYLGLRR------KLRLPKDADQAPILPTN  142

Query  440  NLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +LP DFDWR+ GAV  VK+QGSCGSCWSFSTTGALEGA+FLAT
Sbjct  143  DLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLAT  185



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 121/156 (78%), Gaps = 13/156 (8%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            DP+I QVV      DD  L A+HHF  FK +FGK Y TEEEH YRF+VFK+N+ RA+RHQ
Sbjct  27   DPMICQVV------DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQ  80

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
            LLDPSAVHGVT+FSDLTP EF+ +  G+         + LP+DA+ APILPTDNLP DFD
Sbjct  81   LLDPSAVHGVTQFSDLTPMEFQHSVLGLRG-------VGLPSDADSAPILPTDNLPKDFD  133

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WR+HGAVT VKNQGSCGSCWSFS TGALEGAHFL+T
Sbjct  134  WREHGAVTPVKNQGSCGSCWSFSATGALEGAHFLST  169



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 138/185 (75%), Gaps = 17/185 (9%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDP-----LLNADHHFSLFKSK  193
            F + S+L +   +A  +  D   EDPLIRQV    DG D+      LL A+HHFSLFK K
Sbjct  10   FVISSILFVSAVTAETLTTD--GEDPLIRQVT---DGQDESSANPNLLGAEHHFSLFKKK  64

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            F K+Y ++EEHDYRF +FK+NLRRA+RHQ LDP+A HGVT+FSDLT  EFRR F G+   
Sbjct  65   FKKTYASQEEHDYRFKIFKSNLRRAERHQKLDPTATHGVTQFSDLTHSEFRRQFLGLR--  122

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
                 ++RLP DAN+AP+LPT++LP DFDWR+ GAVT VKNQGSCGSCWSFSTTGALEGA
Sbjct  123  -----RLRLPKDANEAPMLPTNDLPADFDWREKGAVTAVKNQGSCGSCWSFSTTGALEGA  177

Query  554  HFLAT  568
            ++LAT
Sbjct  178  NYLAT  182



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 129/157 (82%), Gaps = 4/157 (3%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +DPLI QVV E D +D+  LNA+ HFS F  +FGKSY  E+EH YRFSVFKANLRRA+RH
Sbjct  33   DDPLIVQVVPESD-EDELRLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARRH  91

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q +DP+AVHG+TKFSDLTP EFRRT+ G+   R  +  +   A +++APILPT+NLPTDF
Sbjct  92   QKMDPTAVHGITKFSDLTPAEFRRTYLGLRGGRRLRRAL---ASSHEAPILPTNNLPTDF  148

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVTGVK+QGSCGSCWSFS +GALEGA+FLAT
Sbjct  149  DWRDHGAVTGVKDQGSCGSCWSFSASGALEGANFLAT  185



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 124/156 (79%), Gaps = 9/156 (6%)
 Frame = +2

Query  107  LIRQVVSE--EDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            LIRQVV +  E  ++D LLNA+HHF+ FK+KF K+Y T+EEHD+RF VFK+NLRRA+ H 
Sbjct  54   LIRQVVPDVGEAEEEDNLLNAEHHFASFKAKFAKTYATKEEHDHRFGVFKSNLRRARLHA  113

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
             LDPSAVHGVTKFSDLTP EFRR F G+         +R PA A KAPILPT +LP DFD
Sbjct  114  KLDPSAVHGVTKFSDLTPAEFRRQFLGLK-------PLRFPAHAQKAPILPTKDLPKDFD  166

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WRD GAVT VK+QG+CGSCWSFSTTGALEGAH+LAT
Sbjct  167  WRDKGAVTNVKDQGACGSCWSFSTTGALEGAHYLAT  202



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 120/156 (77%), Gaps = 13/156 (8%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            DP+I QVV      DD  L A+HHF  FK +FGK Y TEEEH YRF+VFK+N+ RA+RHQ
Sbjct  27   DPMICQVV------DDEGLGAEHHFLEFKRRFGKVYATEEEHGYRFNVFKSNMHRARRHQ  80

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
            LLDPSAVHGVT+FSDLTP EF+ +  G+         + LP+DA+ APILPTDNLP DFD
Sbjct  81   LLDPSAVHGVTQFSDLTPMEFQHSVLGLRG-------VGLPSDADSAPILPTDNLPKDFD  133

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WR HGAVT VKNQGSCGSCWSFS TGALEGAHFL+T
Sbjct  134  WRGHGAVTPVKNQGSCGSCWSFSATGALEGAHFLST  169



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score =   215 bits (548),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 134/186 (72%), Gaps = 12/186 (6%)
 Frame = +2

Query  11   H*NMDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKS  190
            H  +  +F   L+ + + S S   A+   +D LIRQVV     D+  +L+++ HFSLFK 
Sbjct  3    HHRLKLYFSVFLVFVFIVSVSSSDAN-DGDDLLIRQVV-----DEAKVLSSEDHFSLFKK  56

Query  191  KFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHK  370
            KFGK Y + EEHDYR SVFKANLRRA+RHQ LDPSA HGVT+FSDLT  EFR+   GV  
Sbjct  57   KFGKVYASNEEHDYRLSVFKANLRRARRHQKLDPSARHGVTQFSDLTRAEFRKKHLGV--  114

Query  371  SRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEG  550
                K   +LP DANKAPILPT+NLP +FDWRD GAVT VKNQGSCGSCWSFS TGALEG
Sbjct  115  ----KGGFKLPKDANKAPILPTENLPEEFDWRDRGAVTPVKNQGSCGSCWSFSATGALEG  170

Query  551  AHFLAT  568
            A+FLAT
Sbjct  171  ANFLAT  176



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score =   215 bits (548),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 139/188 (74%), Gaps = 17/188 (9%)
 Frame = +2

Query  20   MDRFFL----FSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDP-LLNADHHFSLF  184
            MDR  L    F+LL I ++++S        +D +I+QVV   DG  +P +L+++ HFSLF
Sbjct  1    MDRLKLSLSVFALLFIVVSASS---DGNEGDDLVIKQVV---DGGAEPNVLSSEDHFSLF  54

Query  185  KSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGV  364
            K KFGK Y + EEHDYRFSVFK+NLRRA+RHQ LDPSA HGVT+FSDLT  EF+R   GV
Sbjct  55   KKKFGKVYASREEHDYRFSVFKSNLRRARRHQKLDPSARHGVTQFSDLTRSEFKRKHLGV  114

Query  365  HKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGAL  544
                  K   +LP DANKAPILPT+NLP +FDWR+ GAVT VKNQGSCGSCWSFS TGAL
Sbjct  115  ------KGGFKLPKDANKAPILPTENLPEEFDWRERGAVTPVKNQGSCGSCWSFSATGAL  168

Query  545  EGAHFLAT  568
            EGA+FLAT
Sbjct  169  EGANFLAT  176



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score =   215 bits (548),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 132/186 (71%), Gaps = 14/186 (8%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPL---IRQVVSEEDGDDDPLLNADHHFSLFKS  190
            M    +FSLLI   ASA FV      +D     I+QVV EE+  D+ LLN DH F+ FKS
Sbjct  2    MMDLAVFSLLI---ASALFVTISGVVDDGFGNPIKQVVREEN--DEQLLNLDHQFTQFKS  56

Query  191  KFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHK  370
            K+ K+Y  + EHD+RF VFKAN+RRA+RHQ LDPSAVHGVT+FSD+TPKEF R + G+  
Sbjct  57   KYEKTYKNQVEHDHRFRVFKANVRRARRHQQLDPSAVHGVTQFSDVTPKEFSRKYLGL--  114

Query  371  SRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEG  550
                K +  LP D  KA ILPT  LPTDFDWR+ GAVT VKNQG CGSCWSFS TGALEG
Sbjct  115  ----KRRFSLPNDTQKAAILPTSELPTDFDWREKGAVTPVKNQGLCGSCWSFSATGALEG  170

Query  551  AHFLAT  568
            AHFLAT
Sbjct  171  AHFLAT  176



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score =   215 bits (547),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 130/180 (72%), Gaps = 11/180 (6%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
             F  SLL     S SF   +   ED LIRQVV   +G +  +L+++ HFSLFK +FGK Y
Sbjct  7    LFSVSLLFAFFVSVSFCENN--GEDILIRQVV---NGSEPKVLSSEDHFSLFKRRFGKVY  61

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             + EEH +RF+VF++NL+RA RHQ +DPSA HGVT+FSDLTP EFRR   GV        
Sbjct  62   GSLEEHRHRFAVFRSNLQRAMRHQKMDPSARHGVTQFSDLTPSEFRRMHLGVRGG-----  116

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
              +LP DAN+APILPT +LP DFDWRD GAVT VKNQGSCGSCWSFSTTGALEGAHFL+T
Sbjct  117  -FKLPKDANQAPILPTKDLPVDFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLST  175



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 130/180 (72%), Gaps = 11/180 (6%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
             F  SLL     S SF   +   ED LIRQVV   +G +  +L+++ HFSLFK +FGK Y
Sbjct  7    LFSVSLLFAFFVSVSFCENN--GEDILIRQVV---NGSEPKVLSSEDHFSLFKRRFGKVY  61

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             + EEH +RF+VF++NL+RA RHQ +DPSA HGVT+FSDLTP EFRR   GV        
Sbjct  62   GSLEEHRHRFAVFRSNLQRAMRHQKMDPSARHGVTQFSDLTPSEFRRMHLGVRGG-----  116

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
              +LP DAN+APILPT +LP DFDWRD GAVT VKNQGSCGSCWSFSTTGALEGAHFL+T
Sbjct  117  -FKLPKDANQAPILPTKDLPEDFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLST  175



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 124/158 (78%), Gaps = 4/158 (3%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPL-LNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKR  274
            E+PLIRQVV    GDD+ L LNA+ HF+ F  +FGKSY   +EH YR SVFKANLRRA+R
Sbjct  26   EEPLIRQVVG--GGDDNELELNAERHFASFVQRFGKSYRDADEHAYRLSVFKANLRRARR  83

Query  275  HQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTD  454
            HQLLDPSA HGVTKFSDLTP EFRR + G+  SR   L+  L   A++AP+LPTD LP D
Sbjct  84   HQLLDPSAEHGVTKFSDLTPAEFRRAYLGLRTSRRAFLR-GLGGSAHEAPVLPTDGLPDD  142

Query  455  FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            FDWRDHGAV  VKNQGSCGSCWSFS +GALEGA++LAT
Sbjct  143  FDWRDHGAVGPVKNQGSCGSCWSFSASGALEGANYLAT  180



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 121/157 (77%), Gaps = 2/157 (1%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            EDPLIRQVV   DGDD+ L     HF+ F  +FGK+Y   EEH +R SVFKANLRRA+RH
Sbjct  29   EDPLIRQVVGGADGDDNDL-ELSSHFTSFVQRFGKTYKDAEEHAHRLSVFKANLRRARRH  87

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            QLLDPSA HG+TKFSDLTP EFRRTF G+  SR   L+  +   A+ AP+LPTD LP DF
Sbjct  88   QLLDPSAEHGITKFSDLTPAEFRRTFLGLKTSRRSFLR-EIGGSAHDAPVLPTDGLPDDF  146

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAV  VKNQGSCGSCWSFS +GALEGA++LAT
Sbjct  147  DWRDHGAVGPVKNQGSCGSCWSFSASGALEGANYLAT  183



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 7/141 (5%)
 Frame = +2

Query  146  DPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSD  325
            D  L A+HHF  FK +FGK+Y ++EEH+YRF VFKAN+RRA+RHQ LDPSA HGVT+FSD
Sbjct  8    DVRLGAEHHFLDFKRRFGKAYASQEEHNYRFEVFKANMRRARRHQSLDPSAAHGVTRFSD  67

Query  326  LTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGS  505
            LT  EFR    G+         +RLP++ANKAPILPTDNLP+DFDWRDHGAVT VKNQGS
Sbjct  68   LTASEFRNKVLGLRG-------VRLPSNANKAPILPTDNLPSDFDWRDHGAVTPVKNQGS  120

Query  506  CGSCWSFSTTGALEGAHFLAT  568
            CGSCWSFSTTGALEGAHFL+T
Sbjct  121  CGSCWSFSTTGALEGAHFLST  141



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 131/179 (73%), Gaps = 15/179 (8%)
 Frame = +2

Query  32   FLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYD  211
            FL  + I+ ++S+     D    D LIRQVV     D+  +L+++ HFSLFK KFGK Y 
Sbjct  12   FLVFVFIVSVSSSDANDGD----DLLIRQVV-----DEAKVLSSEDHFSLFKKKFGKVYA  62

Query  212  TEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLK  391
            + EEHDYR SVFKANLRRA+RHQ LDPSA HGVT+FSDLT  EF++   GV      K  
Sbjct  63   SNEEHDYRLSVFKANLRRARRHQKLDPSARHGVTQFSDLTRAEFKKKHLGV------KGG  116

Query  392  IRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             +LP DANKAPILPT+NLP +FDWRD GAVT VKNQGSCGSCWSFS TGALEGA+FLAT
Sbjct  117  FKLPKDANKAPILPTENLPEEFDWRDRGAVTPVKNQGSCGSCWSFSATGALEGANFLAT  175



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 130/178 (73%), Gaps = 12/178 (7%)
 Frame = +2

Query  35   LFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDT  214
            LFS+ +I +  +  V  D   ED LIRQVV E +     +L+++ HF+LFK KFGK Y +
Sbjct  8    LFSVSLIFVFVSVSVCGD---EDVLIRQVVDETE---PKVLSSEDHFTLFKKKFGKVYGS  61

Query  215  EEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKI  394
             EEH YRFSVFKANL RA RHQ +DPSA HGVT+FSDLT  EFRR   GV      K   
Sbjct  62   IEEHYYRFSVFKANLLRAMRHQKMDPSARHGVTQFSDLTRSEFRRKHLGV------KGGF  115

Query  395  RLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +LP DAN+APILPT NLP +FDWRD GAVT VKNQGSCGSCWSFSTTGALEGAHFLAT
Sbjct  116  KLPKDANQAPILPTQNLPEEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLAT  173



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 130/178 (73%), Gaps = 12/178 (7%)
 Frame = +2

Query  35   LFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDT  214
            LFS+ +I +  +  V  D   ED LIRQVV E    +  +L+++ HF+LFK KFGK Y +
Sbjct  8    LFSVSLIFVFVSVSVCGD---EDVLIRQVVDE---TEPKVLSSEDHFTLFKKKFGKVYGS  61

Query  215  EEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKI  394
             EEH YRFSVFKANL RA RHQ +DPSA HGVT+FSDLT  EFRR   GV      K   
Sbjct  62   IEEHYYRFSVFKANLLRAMRHQKMDPSARHGVTQFSDLTRSEFRRKHLGV------KGGF  115

Query  395  RLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +LP DAN+APILPT NLP +FDWRD GAVT VKNQGSCGSCWSFSTTGALEGAHFLAT
Sbjct  116  KLPKDANQAPILPTQNLPEEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLAT  173



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 130/179 (73%), Gaps = 15/179 (8%)
 Frame = +2

Query  32   FLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYD  211
            FL    I+ ++S+     D    D +IRQVV     D+  +L+++ HFSLFK KFGK Y 
Sbjct  12   FLVFFFIVSVSSSDANDGD----DLVIRQVV-----DEAKVLSSEDHFSLFKKKFGKVYA  62

Query  212  TEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLK  391
            + EEHDYR SVFKANLRRA+RHQ LDPSA HGVT+FSDLT  EFR+   GV      K  
Sbjct  63   SNEEHDYRLSVFKANLRRARRHQKLDPSARHGVTQFSDLTRAEFRKKHLGV------KGG  116

Query  392  IRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             +LP DANKAPILPT+NLP +FDWRD GAVT VKNQGSCGSCWSFS TGALEGA+FLAT
Sbjct  117  FKLPKDANKAPILPTENLPEEFDWRDRGAVTPVKNQGSCGSCWSFSATGALEGANFLAT  175



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 127/163 (78%), Gaps = 13/163 (8%)
 Frame = +2

Query  101  DPLIRQV-------VSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANL  259
            D LIRQV       +S  +  ++ LL A+HHFSLFK KF K+Y ++EEHD RF++FKANL
Sbjct  29   DQLIRQVTDGGDEILSHHESTNNDLLGAEHHFSLFKKKFNKAYASQEEHDRRFTIFKANL  88

Query  260  RRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTD  439
            RRA R Q LDPSA HGVT+FSDLTP EFRRT+ G+ +      K+RLP DA++APILPT+
Sbjct  89   RRAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLRR------KLRLPKDADQAPILPTN  142

Query  440  NLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +LP DFDWR+ GAV  VK+QGSCGSCWSFSTTGALEGA+FLAT
Sbjct  143  DLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLAT  185



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 136/188 (72%), Gaps = 16/188 (9%)
 Frame = +2

Query  20   MDRF----FLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDP-LLNADHHFSLF  184
            MDR      LF L  + L+++S    +   +D +I+QVV   DG  +P +L+++ HFSLF
Sbjct  1    MDRLKLSLSLFVLFFLVLSASS--DGNEGGDDLVIKQVV---DGGAEPNVLSSEDHFSLF  55

Query  185  KSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGV  364
            K KFGK Y + EEHDYRFSVFK NLRRA+RHQ LDPSA HGVT+FSDLT  EF++   GV
Sbjct  56   KKKFGKVYASSEEHDYRFSVFKTNLRRARRHQKLDPSARHGVTQFSDLTRSEFKKKHLGV  115

Query  365  HKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGAL  544
                      +LP DANKAPILPT+NLP +FDWRD GAVT VKNQGSCGSCWSFS TGAL
Sbjct  116  RGG------FKLPKDANKAPILPTENLPEEFDWRDRGAVTPVKNQGSCGSCWSFSATGAL  169

Query  545  EGAHFLAT  568
            EGA+FLAT
Sbjct  170  EGANFLAT  177



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 127/181 (70%), Gaps = 16/181 (9%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSA-EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKS  205
             F  SLL +      FV       ED LIRQVV E +     +L+++ HF+LFK KFGK 
Sbjct  7    LFSVSLLFV------FVSVSICGDEDLLIRQVVDEAE---PKVLSSEDHFTLFKKKFGKD  57

Query  206  YDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKK  385
            Y + EEH YRFSVFKANLRRA RHQ +DPSA HGVT+FSDLT  EFRR   GV       
Sbjct  58   YGSIEEHYYRFSVFKANLRRAMRHQKMDPSARHGVTQFSDLTGSEFRRKHLGVTGG----  113

Query  386  LKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLA  565
               +LP DAN+APILPT NLP +FDWRD GAVT VKNQGSCGSCWSFSTTGALEGAHFLA
Sbjct  114  --FKLPKDANQAPILPTHNLPEEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLA  171

Query  566  T  568
            T
Sbjct  172  T  172



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score =   213 bits (541),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 120/156 (77%), Gaps = 13/156 (8%)
 Frame = +2

Query  101  DPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQ  280
            DPLIRQVV  E       L A+HHF  FK +FGK Y +EEEH YRF+VFK+N+ RA+RHQ
Sbjct  27   DPLIRQVVDGEG------LGAEHHFLEFKRRFGKVYVSEEEHGYRFNVFKSNMHRARRHQ  80

Query  281  LLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFD  460
            LLDPSAVHGVT+FSDLTP EFR +  G+         + LP+DA+ APIL TDNLP DFD
Sbjct  81   LLDPSAVHGVTRFSDLTPMEFRHSVLGLRG-------VGLPSDADSAPILRTDNLPKDFD  133

Query  461  WRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            WR+HGAVT VKNQGSCG+CWSFS TGALEGAHFL+T
Sbjct  134  WREHGAVTPVKNQGSCGACWSFSATGALEGAHFLST  169



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score =   213 bits (541),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 142/186 (76%), Gaps = 7/186 (4%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAE---DPLIRQVVSEEDGDDDPLLNADHHFSLFKS  190
            M+R FL  LL++ +A ++ V +  S++   DPLI QVV + + DD+ +LNA+ HFS F  
Sbjct  1    MERRFLSPLLLVLVALSTSVVSSSSSDADNDPLILQVVPDAE-DDELMLNAEAHFSSFLR  59

Query  191  KFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHK  370
            +FGKSY  E+EH YRFSVFKANL RA+RHQ LDP+AVHG+TKFSDLTP EFRR + G+H 
Sbjct  60   RFGKSYADEKEHAYRFSVFKANLWRAQRHQRLDPTAVHGITKFSDLTPAEFRRNYLGLHG  119

Query  371  SRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEG  550
             R  +   R  A +++APILPT++LPTD DWRD GAVT VK+QGSCGSCWSFS  GALEG
Sbjct  120  WRRLR---RALAASHEAPILPTNDLPTDIDWRDSGAVTAVKDQGSCGSCWSFSAAGALEG  176

Query  551  AHFLAT  568
            A+FLAT
Sbjct  177  ANFLAT  182



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 137/183 (75%), Gaps = 15/183 (8%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MDR FL +LL+  + + +    D + +D LIRQV    D +DD LLNA+HHF+ FKSKF 
Sbjct  1    MDRSFLLALLLFSVVATA--TKDDNNDDFLIRQVT---DHEDDQLLNAEHHFTTFKSKFS  55

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            KSY T+EEHDYRF VFK+NL++AK HQ LDPSA HGVTKFSDLT  EFRR F G+ K   
Sbjct  56   KSYATKEEHDYRFGVFKSNLKKAKLHQKLDPSAEHGVTKFSDLTASEFRRQFLGLKK---  112

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
               ++RLPA A KAPILPT+NLP DFDWR+ GAVT     GSCGSCW+FSTTGALEGA++
Sbjct  113  ---RLRLPAHAQKAPILPTNNLPEDFDWREKGAVT----PGSCGSCWAFSTTGALEGANY  165

Query  560  LAT  568
            LAT
Sbjct  166  LAT  168



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 127/154 (82%), Gaps = 4/154 (3%)
 Frame = +2

Query  107  LIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLL  286
            LI QVVSE D +D+ +LNA+ HFS F  +FGKSY  E+EH YRFSVFKANLRRA+RHQ +
Sbjct  33   LIVQVVSEAD-EDELMLNAEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARRHQKM  91

Query  287  DPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWR  466
            DP+AVHG+TK+SDLTP EFRRTF G+   R  +  +   A +++APILPT++LPTDFDWR
Sbjct  92   DPTAVHGITKYSDLTPAEFRRTFLGLRGGRRLRRAL---ASSHEAPILPTNDLPTDFDWR  148

Query  467  DHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DHGAVTGVK+QGSCGSCWSFS  G+LEGA+FLAT
Sbjct  149  DHGAVTGVKDQGSCGSCWSFSAAGSLEGANFLAT  182



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 122/157 (78%), Gaps = 9/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            EDP+IRQVVS+   D   LL+A+ HFS F S++GKSY  E EH YRFSVFK+NLRRA+RH
Sbjct  23   EDPVIRQVVSD---DQQQLLSAEAHFSSFLSRYGKSYADEAEHAYRFSVFKSNLRRARRH  79

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDP+AVHGVT+F+DLTP EFRRT+ G+ +      + R     + APILPT+ LP DF
Sbjct  80   QRLDPTAVHGVTRFADLTPSEFRRTYLGLRR------RPRTAGSTHDAPILPTNELPADF  133

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVT VKNQGSCGSCWSFS  GALEGA++L+T
Sbjct  134  DWRDHGAVTPVKNQGSCGSCWSFSAAGALEGANYLST  170



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 129/172 (75%), Gaps = 4/172 (2%)
 Frame = +2

Query  59   LASASFVRADFSAEDPLIRQVVSEEDGDDD--PLLNADHHFSLFKSKFGKSYDTEEEHDY  232
            L SA    A  +AEDPLI QVV +   DD+    LNA+ HF+ F  +FGKSY  + E  +
Sbjct  25   LCSAEPDDASAAAEDPLIEQVVGDGAADDELEMELNAEAHFASFVRRFGKSYRDDGERAH  84

Query  233  RFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADA  412
            R SVFKANLRRA+RHQ LDP+AVHGVT+FSDLTP EFRR F G+ +S A+ L     + A
Sbjct  85   RMSVFKANLRRARRHQRLDPTAVHGVTQFSDLTPDEFRRQFLGLRRSSARDL--LKGSSA  142

Query  413  NKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ++APILPTD LPTDFDWR+HGAV  VKNQGSCGSCWSFS +GALEGAH+LAT
Sbjct  143  HQAPILPTDGLPTDFDWREHGAVGPVKNQGSCGSCWSFSASGALEGAHYLAT  194



>ref|XP_010690815.1| PREDICTED: cysteine proteinase RD19a [Beta vulgaris subsp. vulgaris]
Length=403

 Score =   211 bits (537),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 128/166 (77%), Gaps = 8/166 (5%)
 Frame = +2

Query  77   VRADFSAEDPLIRQVVSEEDGDDDPL-LNADH-HFSLFKSKFGKSYDTEEEHDYRFSVFK  250
            +  DFS  D +IRQVVS +    + L L+  H HFSLFK +F KSY T+EEHDYRF+VFK
Sbjct  56   ISGDFSG-DEIIRQVVSNDALSLNSLDLSQPHQHFSLFKKRFNKSYATQEEHDYRFNVFK  114

Query  251  ANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPIL  430
            ANLRRAKR+Q LDP+AVHGVT+FSDLT  EFR  F G  KSR     ++ PA ANKAPIL
Sbjct  115  ANLRRAKRNQELDPTAVHGVTRFSDLTQSEFRNRFLGARKSR-----LKYPAHANKAPIL  169

Query  431  PTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            PTD+LP DFDWR+ GAVT  K+QG CGSCW+FSTTGA+EGAHFLAT
Sbjct  170  PTDDLPLDFDWRELGAVTPPKDQGGCGSCWAFSTTGAMEGAHFLAT  215



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 132/186 (71%), Gaps = 13/186 (7%)
 Frame = +2

Query  20   MDRF---FLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKS  190
            MD+F   F  SL++  L S SF   D  ++D LIRQVV+  +     +L+++ HF+LFK 
Sbjct  1    MDQFRALFSVSLVLFVLVSVSFCEDD--SDDLLIRQVVNVTE---PRVLSSEDHFALFKR  55

Query  191  KFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHK  370
            KFGK Y + EEH +R S+F+ NL RA  HQ +DP A HGVT+FSDLTP EFRR   GV  
Sbjct  56   KFGKVYGSVEEHYHRLSIFRRNLLRAMHHQRMDPFASHGVTQFSDLTPSEFRRMHLGV--  113

Query  371  SRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEG  550
               K L  ++P D N+APILPT NLP +FDWRD GAVT VKNQGSCGSCWSFSTTGALEG
Sbjct  114  ---KGLGFKIPKDVNQAPILPTQNLPKEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEG  170

Query  551  AHFLAT  568
            AHFLAT
Sbjct  171  AHFLAT  176



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   207 bits (528),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 119/157 (76%), Gaps = 10/157 (6%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            EDPLI QVV  E   D   LNA+ HF+ F S+FGK+Y  EEE  +R  VFKANLRRA RH
Sbjct  34   EDPLILQVVDLEK--DGLTLNAEAHFTSFMSRFGKTYADEEERSHRLKVFKANLRRAARH  91

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDP+AVHG+TKFSDLTP EFR  + G        L+ + PA +++APILPT++LPTDF
Sbjct  92   QRLDPTAVHGITKFSDLTPAEFRSAYLG--------LRRQTPASSHQAPILPTNDLPTDF  143

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVTGVKNQGSCGSCWSFS   ALEGA+FLAT
Sbjct  144  DWRDHGAVTGVKNQGSCGSCWSFSAAAALEGANFLAT  180



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 134/186 (72%), Gaps = 12/186 (6%)
 Frame = +2

Query  20   MDRFFLFSLLII-GLASASFVRADFSAED--PLIRQVVSEEDGDDDPLLNADHHFSLFKS  190
            MD  F+  LL++  +A+AS    + +  D  PLI QVV +E G+    L+A+ HF+ F  
Sbjct  1    MDHLFVSVLLLLCSVAAASSFSGNAAGADGDPLILQVVDDEKGE--LALSAEAHFASFVR  58

Query  191  KFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHK  370
            +FGK+Y  EEE   RF VFKANL RA R+Q LDP+A+HGVTKFSDL+P EFRR + G+ +
Sbjct  59   RFGKTYADEEERALRFKVFKANLHRAARYQRLDPTAIHGVTKFSDLSPAEFRRAYLGLRR  118

Query  371  SRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEG  550
              A K         ++APILPTD+LPTDFDWRD+GAVTGVKNQGSCGSCWSFST GALEG
Sbjct  119  PEAHK-------STHEAPILPTDDLPTDFDWRDYGAVTGVKNQGSCGSCWSFSTAGALEG  171

Query  551  AHFLAT  568
            A+FLAT
Sbjct  172  ANFLAT  177



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   205 bits (522),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            EDPLI QVV   D +++  LNA+ HF+ F  +FGKSY   +EH++R SVF+ANLRRA+RH
Sbjct  34   EDPLIEQVVGG-DAENELELNAEAHFASFVRRFGKSYRDADEHEHRLSVFRANLRRARRH  92

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDPSAVHG+TKFSDLTP EFR  F G+ KSR   LK  +   A+ AP LPTD LPT+F
Sbjct  93   QRLDPSAVHGITKFSDLTPDEFRERFLGLRKSRRSFLK-GISGSAHDAPALPTDGLPTEF  151

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWR+HGAV  VK+QGSCGSCWSFST+GALEGA++LAT
Sbjct  152  DWREHGAVGPVKDQGSCGSCWSFSTSGALEGANYLAT  188



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 122/157 (78%), Gaps = 2/157 (1%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            EDPLI QVV   D +++  LNA+ HF+ F  +FGKSY   +EH +R SVF+ANLRRA+RH
Sbjct  31   EDPLIEQVVGG-DAENELELNAEAHFATFVRRFGKSYRDADEHAHRLSVFRANLRRARRH  89

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDPSAVHG+TKFSDLTP EFR  F G+ KSR   LK  +   A+ AP LPTD LPT+F
Sbjct  90   QRLDPSAVHGITKFSDLTPDEFRERFLGLRKSRRSFLK-GISGSAHDAPALPTDGLPTEF  148

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWR+HGAV  VK+QGSCGSCWSFST+GALEGA++LAT
Sbjct  149  DWREHGAVGPVKDQGSCGSCWSFSTSGALEGANYLAT  185



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 119/160 (74%), Gaps = 8/160 (5%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPL---LNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRA  268
            E+PLIRQVV    G  DPL   L  D  F  F  +FGK+Y   EEH +R SVFKANLRRA
Sbjct  29   EEPLIRQVV----GGADPLDNDLELDSQFVGFVQRFGKTYRDAEEHAHRLSVFKANLRRA  84

Query  269  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLP  448
            +RHQLLDPSA HGVTKFSDLTP EFRRT+ G+  +R   L+  +   A+ AP+LPTD LP
Sbjct  85   RRHQLLDPSAEHGVTKFSDLTPAEFRRTYLGLKTTRRSFLR-EMAGSAHDAPVLPTDGLP  143

Query  449  TDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             DFDWRDHGAV  VKNQGSCGSCWSFS +GALEGA++LA+
Sbjct  144  EDFDWRDHGAVGPVKNQGSCGSCWSFSASGALEGANYLAS  183



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 118/160 (74%), Gaps = 8/160 (5%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPL---LNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRA  268
            E+PLIRQVV    G  DPL   L  D  F  F  +FGK+Y   EEH +R SVFKA LRRA
Sbjct  21   EEPLIRQVV----GGADPLDNDLELDSQFLGFVQRFGKTYRDAEEHAHRLSVFKATLRRA  76

Query  269  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLP  448
            +RHQLLDPSA HGVTKFSDLTP EFRRTF G+  +R   L+  +   A+ AP+LPTD LP
Sbjct  77   RRHQLLDPSAEHGVTKFSDLTPAEFRRTFLGLKTTRRSFLR-EMAGSAHDAPVLPTDGLP  135

Query  449  TDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             DFDWRDHGAV  VKNQGSCGSCWSFS +GALEGA++LAT
Sbjct  136  EDFDWRDHGAVGPVKNQGSCGSCWSFSASGALEGANYLAT  175



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 123/157 (78%), Gaps = 4/157 (3%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            +DPLI QVV + + DD+ +LN + HFS F  +FGKSY  E+EH YRFSVFKANLRRA+RH
Sbjct  28   DDPLILQVVPDAE-DDELMLNTEAHFSSFLRRFGKSYADEKEHAYRFSVFKANLRRARRH  86

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDP+AVHG+TKFSDLTP EFRR +      R  +   R  A +++APILPT++LPTD 
Sbjct  87   QRLDPTAVHGITKFSDLTPAEFRRNY---LGLRGGRRLRRALAASHEAPILPTNDLPTDI  143

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWRDHGAVT VK+QGSCGSCWSFS  GALEGA+FLAT
Sbjct  144  DWRDHGAVTAVKDQGSCGSCWSFSAAGALEGANFLAT  180



>emb|CDP08018.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   196 bits (497),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 128/173 (74%), Gaps = 11/173 (6%)
 Frame = +2

Query  59   LASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRF  238
            + SAS ++ D S      RQVV  +D D DPLLNADHHFSLFK K+GK+Y T+EE DYRF
Sbjct  27   VESASIIQEDLS-----FRQVVPLDD-DVDPLLNADHHFSLFKKKYGKTYSTQEEDDYRF  80

Query  239  SVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANK  418
            SVFKANL RAKRHQLLDPSAVHG+TKFSDLTP EF++  H  H  + ++L +   A+ N+
Sbjct  81   SVFKANLHRAKRHQLLDPSAVHGITKFSDLTPSEFQQRLHLGHHKQKRRLSVS--AEPNE  138

Query  419  APILPTDNLPTD---FDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            APILPT +LP+     D+R  G VT VK++GSC S W+FS+TGA+E A+ LA+
Sbjct  139  APILPTRDLPSPGSALDYRQWGVVTPVKDEGSCRSSWAFSSTGAVEAANALAS  191



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 126/175 (72%), Gaps = 7/175 (4%)
 Frame = +2

Query  44   LLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEE  223
            LL+ G+A+ S        EDPLI QVV   D  ++  LNA+ HF+ F  +F KSY   +E
Sbjct  38   LLLSGVAALSS-----PVEDPLIEQVVGG-DEKNELELNAEAHFASFVQRFNKSYRDADE  91

Query  224  HDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLP  403
            H +R SVF ANLRRA+RHQ LDPSAVHGVTKFSDLTP EFR  F G+ K R   LK  L 
Sbjct  92   HAHRLSVFTANLRRARRHQRLDPSAVHGVTKFSDLTPDEFRDRFLGLRKYRRSFLK-GLS  150

Query  404  ADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
              A+ AP LPTD LPT+FDWR+HGAV  VK+QGSCGSCWSFST+GALEGAH+LAT
Sbjct  151  GSAHDAPALPTDGLPTEFDWREHGAVGPVKDQGSCGSCWSFSTSGALEGAHYLAT  205



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 117/160 (73%), Gaps = 8/160 (5%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPL---LNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRA  268
            E+PLIRQVV    G  DPL   L  D     F  +FGK+Y   EEH +R SVFKANLRRA
Sbjct  29   EEPLIRQVV----GGADPLDNDLELDSQLLGFVQRFGKTYRDAEEHAHRLSVFKANLRRA  84

Query  269  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLP  448
            +RHQ+LDPSA HGVTKFSDLTP EFRRTF G+  +R   L+  +   A+ AP+LPTD LP
Sbjct  85   RRHQMLDPSAEHGVTKFSDLTPAEFRRTFLGLKTTRRSFLR-EMAGSAHDAPVLPTDGLP  143

Query  449  TDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             DFDWRDHGAV  VKNQGSC SCWSFS +GALEGA++LAT
Sbjct  144  EDFDWRDHGAVGPVKNQGSCWSCWSFSASGALEGANYLAT  183



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   197 bits (502),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 129/182 (71%), Gaps = 19/182 (10%)
 Frame = +2

Query  38   FSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPL-----LNADHHFSLFKSKFGK  202
            FSLLI+        RA   + DPLIRQVV   D           L A+HHFSLFK KFGK
Sbjct  11   FSLLIVS-------RAQLDSTDPLIRQVVEGRDESHHHHDHDHALGAEHHFSLFKHKFGK  63

Query  203  SYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAK  382
            SY ++EEHDYRF VFKANLRRA RHQ LDPSA HGVT+FSD+ P EFR++  G+      
Sbjct  64   SYASKEEHDYRFDVFKANLRRAARHQRLDPSAQHGVTRFSDMPPAEFRKSQLGLR-----  118

Query  383  KLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFL  562
               ++LP DA KAPILPT+NLP DFDWR+HGA   VKNQGSCGSCWS STTGALEGAHFL
Sbjct  119  --GLKLPEDATKAPILPTENLPEDFDWREHGAAPAVKNQGSCGSCWSSSTTGALEGAHFL  176

Query  563  AT  568
            AT
Sbjct  177  AT  178



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 106/133 (80%), Gaps = 6/133 (5%)
 Frame = +2

Query  170  HFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRR  349
            HFSLFK +FGK Y + EEH +RF+VF++NL+RA RHQ +DPSA HGVT+FSDLTP EFRR
Sbjct  30   HFSLFKRRFGKVYGSLEEHHHRFAVFRSNLQRAMRHQRMDPSARHGVTQFSDLTPSEFRR  89

Query  350  TFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFS  529
               GV          +LP DAN+APILPT +LP DFDWRD GAVT VKNQGSCGSCWSFS
Sbjct  90   MHLGVRGG------FKLPKDANQAPILPTKDLPEDFDWRDRGAVTPVKNQGSCGSCWSFS  143

Query  530  TTGALEGAHFLAT  568
            TTGALEGAHFL+T
Sbjct  144  TTGALEGAHFLST  156



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score =   195 bits (495),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 118/157 (75%), Gaps = 4/157 (3%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            EDPLI QVV   + ++D  L+A+ HF+ F+ +FG++Y    E  YR SVF ANLRRA+RH
Sbjct  34   EDPLIEQVVGGGE-EEDAQLDAEAHFASFERRFGRTYRDAGERAYRMSVFAANLRRARRH  92

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
            Q LDP+A HGVTKFSDLTP EFR  F G+   R   L+  +  + ++APILPTD LP DF
Sbjct  93   QRLDPTATHGVTKFSDLTPGEFRDRFLGL---RRPSLEGLVGGEPHEAPILPTDGLPDDF  149

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWR+HGAV  VK+QGSCGSCWSFST+GALEGAHFLAT
Sbjct  150  DWREHGAVGPVKDQGSCGSCWSFSTSGALEGAHFLAT  186



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score =   194 bits (494),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 126/175 (72%), Gaps = 15/175 (9%)
 Frame = +2

Query  53   IGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDY  232
            I  ++A++  +D   EDPLIRQVV + +G+   L +A+ HF+ F  +F K+Y   EE   
Sbjct  16   IAASTAAYSTSD-GIEDPLIRQVVQDAEGELTAL-DAEVHFARFIKRFRKTYADTEERAR  73

Query  233  RFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLP---  403
            RF+VFKANL RA+RHQLLDP+AVHGVTKFSDLTP EFRR +          L +R P   
Sbjct  74   RFAVFKANLLRARRHQLLDPTAVHGVTKFSDLTPAEFRRAY----------LGLRGPTFV  123

Query  404  ADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            + ++ APILPT++LP +FDWRDHGAVT VKNQGSCGSCWSFS  GALEGAHFL T
Sbjct  124  SSSHDAPILPTNDLPENFDWRDHGAVTPVKNQGSCGSCWSFSAAGALEGAHFLTT  178



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score =   193 bits (490),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 103/131 (79%), Gaps = 6/131 (5%)
 Frame = +2

Query  176  SLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTF  355
            +LFK KFGK Y + EEH YRFSVFKANL RA RHQ +DPSA HGVT+FSDLT  EFRR  
Sbjct  1    ALFKKKFGKVYGSIEEHYYRFSVFKANLLRAMRHQKMDPSARHGVTQFSDLTRSEFRRKH  60

Query  356  HGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTT  535
             GV      K   +LP DAN+APILPT NLP +FDWRD GAVT VKNQGSCGSCWSFSTT
Sbjct  61   LGV------KGGFKLPKDANQAPILPTQNLPEEFDWRDRGAVTPVKNQGSCGSCWSFSTT  114

Query  536  GALEGAHFLAT  568
            GALEGAHFLAT
Sbjct  115  GALEGAHFLAT  125



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score =   187 bits (476),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 107/144 (74%), Gaps = 4/144 (3%)
 Frame = +2

Query  146  DPLLN---ADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTK  316
            DPL N    D  F  F  +FGK+Y   EEH +R SVFKANLRRA+RHQ+LDPSA HGVTK
Sbjct  33   DPLANDLELDSQFLGFVQRFGKTYRDAEEHAHRLSVFKANLRRARRHQMLDPSAEHGVTK  92

Query  317  FSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKN  496
            FSDL P EFRRTF G+  +R   L+  +   A+ AP+LPTD LP DFDWRD GAV  VKN
Sbjct  93   FSDLAPAEFRRTFLGLKTTRRSFLR-EMAGSAHDAPVLPTDGLPEDFDWRDQGAVGPVKN  151

Query  497  QGSCGSCWSFSTTGALEGAHFLAT  568
            QGSCGSCWSFS +GALEGA++LAT
Sbjct  152  QGSCGSCWSFSASGALEGANYLAT  175



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 122/180 (68%), Gaps = 15/180 (8%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
            F LFS+L +  +           EDP+I+QVV +          A++ F+ FK +FGK Y
Sbjct  8    FMLFSVLFLFFSVDLAFSMPKDREDPIIQQVVDKG--------GAEYQFNEFKQRFGKVY  59

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             +++EHDYRF+VFK+NL RAKRH ++DPSA HGVT+FSDLTP+EFR +  G+        
Sbjct  60   SSKDEHDYRFNVFKSNLHRAKRHGIMDPSATHGVTRFSDLTPREFRNSILGLK-------  112

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             + LP  A  APIL T+NLP DFDWR+ GAVT V+NQG CGS WSFST GALEGAHFL++
Sbjct  113  GVGLPRHAKAAPILSTENLPRDFDWREKGAVTPVRNQGFCGSSWSFSTIGALEGAHFLSS  172



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 121/180 (67%), Gaps = 15/180 (8%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
              LFS+L +  +           EDP+I+QVV +          A+H F+ FK +FGK Y
Sbjct  8    LMLFSVLFLFFSVDLAFSTPNDREDPIIQQVVDKG--------GAEHQFNEFKQRFGKVY  59

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             +++EHDYRF+VFK+NL RAKRH ++DPSA HGVT+FSDLTP+EFR +  G+        
Sbjct  60   SSKDEHDYRFNVFKSNLHRAKRHVIMDPSATHGVTRFSDLTPREFRNSILGLK-------  112

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             + LP  A  APIL ++NLP DFDWR+ GAVT V+NQG CGS WSFST GALEGA+FL+T
Sbjct  113  GVGLPRHAKAAPILSSENLPRDFDWREKGAVTPVRNQGFCGSSWSFSTIGALEGANFLST  172



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 121/180 (67%), Gaps = 15/180 (8%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
              LFS+L +  +           EDP+I+QVV +          A+H F+ FK +FGK Y
Sbjct  7    LMLFSVLFLFFSVDLAFSTPNDREDPIIQQVVDKG--------GAEHQFNEFKQRFGKVY  58

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             +++EHDYRF+VFK+NL RAKRH ++DPSA HGVT+FSDLTP+EFR +  G+        
Sbjct  59   SSKDEHDYRFNVFKSNLHRAKRHVIMDPSATHGVTRFSDLTPREFRNSILGLK-------  111

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             + LP  A  APIL ++NLP DFDWR+ GAVT V+NQG CGS WSFST GALEGA+FL+T
Sbjct  112  GVGLPRHAKAAPILSSENLPRDFDWREKGAVTPVRNQGFCGSSWSFSTIGALEGANFLST  171



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 121/180 (67%), Gaps = 15/180 (8%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
              LFS+L +  +           EDP+I+QVV +          A++ F+ FK +FGK Y
Sbjct  7    LMLFSVLFLFFSVDLAFSTPNDREDPIIQQVVDKG--------GAEYQFNEFKQRFGKVY  58

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             +++EHDYRF+VFK+NL RAKRH ++DPSA HGVT+FSDLTP+EFR +  G+        
Sbjct  59   SSKDEHDYRFNVFKSNLHRAKRHGIMDPSATHGVTRFSDLTPREFRNSILGLK-------  111

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
             + LP  A  APIL ++NLP DFDWR+ GAVT V+NQG CGS WSFST GALEGAHFL++
Sbjct  112  GVGLPRHAKAAPILSSENLPRDFDWREKGAVTPVRNQGFCGSSWSFSTIGALEGAHFLSS  171



>ref|XP_009117680.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=357

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 120/183 (66%), Gaps = 8/183 (4%)
 Frame = +2

Query  20   MDRFFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFG  199
            MD F +  LL +   S S         D LIRQVV+  +  +  +++ + HF+LFK K+G
Sbjct  1    MDHFRV-CLLFVLFVSVSVCEKHHGRNDILIRQVVNGSE-SEPTVMSWEDHFALFKRKYG  58

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            K Y++ EEH +RF +F++N  RA RHQ +DP A HGVT+FSDLT  EFRR   GV     
Sbjct  59   KVYNSHEEHQHRFWIFRSNFMRATRHQRMDPFARHGVTQFSDLTHSEFRRKHLGV-----  113

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
             K        A++APIL T NLP DFDWRD GAVT VKNQG+CGS WSFSTTGALEGAHF
Sbjct  114  -KGAYTFSQHADQAPILDTKNLPGDFDWRDRGAVTPVKNQGACGSSWSFSTTGALEGAHF  172

Query  560  LAT  568
            LAT
Sbjct  173  LAT  175



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 112/149 (75%), Gaps = 13/149 (9%)
 Frame = +2

Query  131  EDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGV  310
            ++GD   LL+ + HF  F ++FGK+Y T E + +R  VF+ANL RA  HQ LDPSAVHG+
Sbjct  7    DNGDRSALLDVETHFKSFIARFGKAYATAEAYAHRLKVFEANLVRAVSHQALDPSAVHGI  66

Query  311  TKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPA---DANKAPILPTDNLPTDFDWRDHGAV  481
            T+FSDLT +EF++ F          L +R+P+   +ANKAP+LPT++LP DFDWR+HGAV
Sbjct  67   TQFSDLTEEEFKQQF----------LGLRVPSRLREANKAPVLPTNDLPEDFDWREHGAV  116

Query  482  TGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            T VKNQG+CGSCW+FSTTGA+EGAHFL T
Sbjct  117  TEVKNQGACGSCWAFSTTGAIEGAHFLET  145



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 118/174 (68%), Gaps = 11/174 (6%)
 Frame = +2

Query  62   ASASFVRADFSAEDPLIRQVVSEEDG-----DDDPLLNADHHFSLFKSKFGKSYDTEEEH  226
            A+A+ VR+    ED LI QVV   DG     +   LL+A+ HF+ F+ +FG++Y      
Sbjct  5    AAATVVRSA-EEEDALIEQVVGGGDGDGDDRELGELLDAEAHFASFERRFGRTYRDAXXX  63

Query  227  DYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPA  406
                 VFKANLRRA+RHQLLDPSA HGVTKFSDLTP EFR  + G+       L     A
Sbjct  64   XXXXXVFKANLRRARRHQLLDPSASHGVTKFSDLTPAEFRERYLGLRGGGRTSL-----A  118

Query  407  DANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
               +APILPTD LP DFDWR+HGAV  VK+QGSCGSCWSFST+GALEGAH+LAT
Sbjct  119  STAEAPILPTDGLPADFDWREHGAVGPVKDQGSCGSCWSFSTSGALEGAHYLAT  172



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 120/185 (65%), Gaps = 16/185 (9%)
 Frame = +2

Query  32   FLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDD------PLLNADHHFSLFKSK  193
             LFS   I   S  F+ +    +D LIRQV  E   D         L NA+ HF  F  +
Sbjct  6    LLFSAFCI--FSVIFLSSATKPDDDLIRQVTDEVVSDPQILDARSALFNAEVHFRHFIRR  63

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            +GK Y   EEH++RF VFK+NL RA  HQ LDP A HGVTKFSDLT +EFR  + G+   
Sbjct  64   YGKKYSGPEEHEHRFGVFKSNLLRALEHQKLDPRASHGVTKFSDLTQEEFRHQYLGL---  120

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
            RA  L+     DA+ APILPT++LP DFDWR+ GAVT VKNQGSCGSCW+FSTTGALEGA
Sbjct  121  RAPPLR-----DAHDAPILPTNDLPEDFDWREKGAVTEVKNQGSCGSCWAFSTTGALEGA  175

Query  554  HFLAT  568
            +FL T
Sbjct  176  NFLKT  180



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 120/185 (65%), Gaps = 16/185 (9%)
 Frame = +2

Query  32   FLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDD------PLLNADHHFSLFKSK  193
             LFS   I   S  F+ +    +D LIRQV  E   D         L NA+ HF  F  +
Sbjct  6    LLFSAFCI--FSVIFLSSATRPDDDLIRQVTDEVVSDPQILDARSALFNAEVHFRHFIRR  63

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            +GK Y   EEH++RF VFK+NL RA  HQ LDP A HGVTKFSDLT +EFR  + G+   
Sbjct  64   YGKKYSGPEEHEHRFGVFKSNLLRALEHQKLDPRASHGVTKFSDLTQEEFRHQYLGL---  120

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
            RA  L+     DA+ APILPT++LP DFDWR+ GAVT VKNQGSCGSCW+FSTTGALEGA
Sbjct  121  RAPPLR-----DAHDAPILPTNDLPEDFDWREKGAVTEVKNQGSCGSCWAFSTTGALEGA  175

Query  554  HFLAT  568
            +FL T
Sbjct  176  NFLKT  180



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 117/166 (70%), Gaps = 20/166 (12%)
 Frame = +2

Query  101  DPLIRQVVS----EEDGDDDP---LLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANL  259
            D  IR+V      E +G  D    LL+ + HF  F ++FGK+Y T E + +R  VF+ANL
Sbjct  27   DSGIREVTDTARDESNGRLDAAKALLDVETHFKSFIARFGKAYATAEAYAHRLKVFEANL  86

Query  260  RRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPA---DANKAPIL  430
             RA  HQ LDPSAVHG+T+FSDLT +EF++ F          L +R+P+   +ANKAP+L
Sbjct  87   VRAVSHQALDPSAVHGITQFSDLTEEEFKQQF----------LGLRVPSRLREANKAPVL  136

Query  431  PTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            PT++LP DFDWR+HGAVT VKNQG+CGSCW+FSTTGA+EGAHFL T
Sbjct  137  PTNDLPEDFDWREHGAVTEVKNQGACGSCWAFSTTGAIEGAHFLET  182



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 119/185 (64%), Gaps = 16/185 (9%)
 Frame = +2

Query  32   FLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDD------PLLNADHHFSLFKSK  193
             LFS   I   S  F+ +    +D LIRQV  E   D         L NA+ HF  F  +
Sbjct  6    LLFSAFCI--FSVIFLSSATRPDDDLIRQVTDEVVSDPQILDARSALFNAEVHFRHFIRR  63

Query  194  FGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKS  373
            +GK Y   EEH++RF VFK+NL RA  HQ LDP A HGVTKFSDLT + FR  + G+   
Sbjct  64   YGKKYSGPEEHEHRFGVFKSNLLRALEHQKLDPRASHGVTKFSDLTQEGFRHQYLGL---  120

Query  374  RAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGA  553
            RA  L+     DA+ APILPT++LP DFDWR+ GAVT VKNQGSCGSCW+FSTTGALEGA
Sbjct  121  RAPPLR-----DAHDAPILPTNDLPEDFDWREKGAVTEVKNQGSCGSCWAFSTTGALEGA  175

Query  554  HFLAT  568
            +FL T
Sbjct  176  NFLKT  180



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = +2

Query  218  EEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIR  397
            +EH +R SVF+ NLRRA+RHQ LDPSAVHG+TKFSDLTP EFR  F G+ KSR   LK  
Sbjct  96   DEHAHRLSVFRDNLRRARRHQRLDPSAVHGITKFSDLTPDEFRERFLGLRKSRRSFLK-G  154

Query  398  LPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +   A+ AP LPTD LPT+FDWR+HGAV  VK+QGSCGSCWSFST+GALEGA++LAT
Sbjct  155  ISGSAHDAPALPTDGLPTEFDWREHGAVGPVKDQGSCGSCWSFSTSGALEGANYLAT  211



>ref|XP_002876278.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52537.1| hypothetical protein ARALYDRAFT_485911 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 107/167 (64%), Gaps = 6/167 (4%)
 Frame = +2

Query  74   FVRADFSAEDPLIRQVVSEEDGDDDPLLNA--DHHFSLFKSKFGKSYDTEEEHDYRFSVF  247
            F     S ED  IRQV ++E      LL    +  F +F S +GK+Y T EE+ +R  +F
Sbjct  16   FCHVVASVEDLTIRQVTADERRVRPNLLGTHTESKFRVFMSDYGKNYSTREEYIHRLGIF  75

Query  248  KANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPI  427
              N+ +A  HQ++DP+AVHGVT+FSDLT +EF+R + GV          R  A   +AP+
Sbjct  76   AKNVLKAAEHQMMDPTAVHGVTQFSDLTEEEFKRMYTGVADVGGS----RGHAVGAEAPM  131

Query  428  LPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +  D LP DFDWR+ G VT VKNQG+CGSCW+FSTTGA EGAHF++T
Sbjct  132  VEVDGLPEDFDWREKGGVTEVKNQGACGSCWAFSTTGAAEGAHFVST  178



>emb|CAB41090.1| cysteine proteinase precursor-like protein [Arabidopsis thaliana]
Length=363

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 105/167 (63%), Gaps = 6/167 (4%)
 Frame = +2

Query  74   FVRADFSAEDPLIRQVVSEEDGDDDPLLNA--DHHFSLFKSKFGKSYDTEEEHDYRFSVF  247
            F     S ED  IRQV ++       LL    +  F LF S +GK+Y T EE+ +R  +F
Sbjct  16   FCHVVASVEDLTIRQVTADNRRIRPNLLGTHTESKFRLFMSDYGKNYSTREEYIHRLGIF  75

Query  248  KANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPI  427
              N+ +A  HQ++DPSAVHGVT+FSDLT +EF+R + GV          R      +AP+
Sbjct  76   AKNVLKAAEHQMMDPSAVHGVTQFSDLTEEEFKRMYTGVADVGGS----RGGTVGAEAPM  131

Query  428  LPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +  D LP DFDWR+ G VT VKNQG+CGSCW+FSTTGA EGAHF++T
Sbjct  132  VEVDGLPEDFDWREKGGVTEVKNQGACGSCWAFSTTGAAEGAHFVST  178



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 91/123 (74%), Gaps = 8/123 (7%)
 Frame = +2

Query  200  KSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRA  379
            + Y T+EEHD+RF VFK+NLRRA       P  VHGVTKFSDLTP EFRR F G+     
Sbjct  15   RPYATKEEHDHRFGVFKSNLRRASCTPSSTPR-VHGVTKFSDLTPAEFRRQFLGLKA---  70

Query  380  KKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHF  559
                +R PA A KAPILPT +LP DFDWRD GAVT VK+QG CGSCWSFSTTGALEGA++
Sbjct  71   ----VRFPAHAQKAPILPTKDLPKDFDWRDKGAVTNVKDQGGCGSCWSFSTTGALEGAYY  126

Query  560  LAT  568
            LAT
Sbjct  127  LAT  129



>ref|NP_567010.5| Papain family cysteine protease [Arabidopsis thaliana]
 gb|AAL49820.1| putative cysteine proteinase [Arabidopsis thaliana]
 gb|AEE79316.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=367

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 105/167 (63%), Gaps = 6/167 (4%)
 Frame = +2

Query  74   FVRADFSAEDPLIRQVVSEEDGDDDPLLNA--DHHFSLFKSKFGKSYDTEEEHDYRFSVF  247
            F     S ED  IRQV ++       LL    +  F LF S +GK+Y T EE+ +R  +F
Sbjct  16   FCHVVASVEDLTIRQVTADNRRIRPNLLGTHTESKFRLFMSDYGKNYSTREEYIHRLGIF  75

Query  248  KANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPI  427
              N+ +A  HQ++DPSAVHGVT+FSDLT +EF+R + GV          R      +AP+
Sbjct  76   AKNVLKAAEHQMMDPSAVHGVTQFSDLTEEEFKRMYTGVADVGGS----RGGTVGAEAPM  131

Query  428  LPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +  D LP DFDWR+ G VT VKNQG+CGSCW+FSTTGA EGAHF++T
Sbjct  132  VEVDGLPEDFDWREKGGVTEVKNQGACGSCWAFSTTGAAEGAHFVST  178



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 112/168 (67%), Gaps = 11/168 (7%)
 Frame = +2

Query  83   ADFSAEDPLIRQVVSEEDGD---DD---PLLNADHHFSLFKSKFGKSYDTEEEHDYRFSV  244
            +D +A  P   + V++ DG+   DD    LLNA+ HF+ F  KF K Y   EEH  RFS+
Sbjct  39   SDLNAVLPNPIREVTDMDGEGVIDDLRRGLLNAEAHFAHFVKKFNKEYSGAEEHARRFSI  98

Query  245  FKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAP  424
            FK NL +A RHQ LD  A+HG+ KFSDLT +EF   + G+  +  + L  R       AP
Sbjct  99   FKKNLHKALRHQKLDRDAIHGINKFSDLTEEEFHEQYLGL-TTPPRSLSQR----TQPAP  153

Query  425  ILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ILPTD+LP DFDWR+ GAVT VKNQG+CGSCW+FSTTGA+EGA+F+ T
Sbjct  154  ILPTDDLPPDFDWRELGAVTPVKNQGACGSCWTFSTTGAMEGANFMKT  201



>ref|XP_002978562.1| hypothetical protein SELMODRAFT_109056 [Selaginella moellendorffii]
 gb|EFJ20548.1| hypothetical protein SELMODRAFT_109056 [Selaginella moellendorffii]
Length=343

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 109/180 (61%), Gaps = 17/180 (9%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
              L  LLI+ +  +S  R D       IRQV    + DD      + HF  F  KFGK Y
Sbjct  7    IILVGLLILVICCSSSNRLDIGK----IRQVTDNLEVDD-----VEGHFKHFMQKFGKVY  57

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             T EE+ +R  VF+ANL      +  DP+A+HG+T F+DLTP+E  R F G  K+ + ++
Sbjct  58   GTTEEYVHRLKVFQANLVHVMSLKKQDPTAIHGITSFADLTPEELSR-FLGFRKAYSNRV  116

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
                    N+AP+LPTDNLP  FDWR+HGAVT VK QG CGSCW+FSTTG +EGA+FL T
Sbjct  117  -------VNQAPLLPTDNLPEAFDWREHGAVTPVKFQGRCGSCWTFSTTGVVEGANFLKT  169



>gb|KFK34737.1| hypothetical protein AALP_AA5G186400 [Arabis alpina]
Length=369

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 111/180 (62%), Gaps = 13/180 (7%)
 Frame = +2

Query  47   LIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNA--DHHFSLFKSKFGKSYDTEE  220
            L+I      F     S ED  IRQV  +       LL    +  F +F S +GKSY T E
Sbjct  8    LLITCTHFFFCHVTGSLEDLTIRQVTDDRQRVLPNLLGTHTETKFRVFMSDYGKSYSTRE  67

Query  221  EHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGV----HKSRAKKL  388
            E+ +R  +F  N+ +A  HQ++DP+AVHGVT+FSDLT KEF++ + GV    H      +
Sbjct  68   EYVHRLGIFARNVLKAAEHQMMDPTAVHGVTRFSDLTEKEFKKMYTGVADVSHGGGVGAV  127

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ++       +AP+L  + LP DFDWR+ GAVT +K+QG CGSCW+FSTTGA+EGAHF++T
Sbjct  128  RM-------EAPMLEVEGLPEDFDWREKGAVTEIKDQGKCGSCWAFSTTGAVEGAHFVST  180



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 107/157 (68%), Gaps = 21/157 (13%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRH  277
            EDPLI QVV   + ++D  L+A+ HF+ F+ +FG++Y                 RRA+R 
Sbjct  34   EDPLIDQVVGGGE-EEDAQLDAEAHFASFERRFGRTY--------------PGPRRARR-  77

Query  278  QLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDF  457
              LDP+A HGVTKFSDLTP EFR  F G+   R   L+  +  + ++APILPTD LP DF
Sbjct  78   --LDPTATHGVTKFSDLTPGEFRDRFLGL---RRPSLEGLVGGEPHEAPILPTDGLPDDF  132

Query  458  DWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            DWR+HGAV  VK+QGSCGSCWSFST+GALEGAHFLAT
Sbjct  133  DWREHGAVGPVKDQGSCGSCWSFSTSGALEGAHFLAT  169



>ref|XP_002970484.1| hypothetical protein SELMODRAFT_93661 [Selaginella moellendorffii]
 gb|EFJ28614.1| hypothetical protein SELMODRAFT_93661 [Selaginella moellendorffii]
Length=343

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 110/180 (61%), Gaps = 17/180 (9%)
 Frame = +2

Query  29   FFLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSY  208
              L  LLI+ +  +S  R D       IRQV      D+  + + + HF  F  KFGK Y
Sbjct  7    IILVGLLILVVCCSSSNRLDIGK----IRQVT-----DNLEVKDVEGHFKHFMQKFGKVY  57

Query  209  DTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKL  388
             T EE+ +R  VF+ANL      +  DP+A+HG+T F+DLTP+E  R F G  K+ + ++
Sbjct  58   GTTEEYVHRLKVFQANLAHVMSLKKQDPTAIHGITSFADLTPEELSR-FLGFRKAYSNRV  116

Query  389  KIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
                    N+AP+LPTDNLP  FDWR+HGAVT VK QG CGSCW+FSTTG +EGA+FL T
Sbjct  117  -------VNQAPLLPTDNLPEAFDWREHGAVTPVKFQGRCGSCWTFSTTGVVEGANFLKT  169



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 87/104 (84%), Gaps = 5/104 (5%)
 Frame = +2

Query  257  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPT  436
            +RRA+RHQ LDP+AVHGVT+FSDLTP EF+RT+ G+ K      K  L   A++AP+LPT
Sbjct  1    MRRARRHQQLDPTAVHGVTQFSDLTPGEFKRTYLGLRKG-----KKHLVGSAHEAPLLPT  55

Query  437  DNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ++LP DFDWRD GAVTGVKNQGSCGSCWSFST+GALEGA+FLAT
Sbjct  56   NDLPEDFDWRDKGAVTGVKNQGSCGSCWSFSTSGALEGANFLAT  99



>ref|XP_007218137.1| hypothetical protein PRUPE_ppa007240mg [Prunus persica]
 gb|EMJ19336.1| hypothetical protein PRUPE_ppa007240mg [Prunus persica]
Length=377

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 110/176 (63%), Gaps = 19/176 (11%)
 Frame = +2

Query  59   LASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRF  238
            +++ SF   D +A+DP+I QV      +  PLL  +  F +F  K+GK Y T +E+ +R 
Sbjct  25   ISTLSFALHD-AAQDPIIHQVTD----NHRPLLGTERSFQMFIEKYGKKYSTRKEYMHRL  79

Query  239  SVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANK  418
             +F  N+ RA  HQ LDP+AVHGVT FSDL+ +EF R + G        ++   PA +N 
Sbjct  80   GIFAKNMVRAAEHQALDPTAVHGVTPFSDLSEEEFERMYTG--------MRAVPPASSND  131

Query  419  A------PILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
                   P++   +LP +FDWR+ GAVT VK QG CGSCW+FSTTGA+EGA+F+AT
Sbjct  132  GVSDSAPPVMDVGDLPENFDWREKGAVTEVKMQGGCGSCWAFSTTGAIEGANFIAT  187



>ref|XP_008233261.1| PREDICTED: cysteine proteinase 15A [Prunus mume]
Length=377

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 111/176 (63%), Gaps = 19/176 (11%)
 Frame = +2

Query  59   LASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRF  238
            +++ SF   D +++DP+I QV      +  PLL  +  F +F  K+GK Y T++E+ +R 
Sbjct  25   ISTLSFALHD-ASQDPIIHQVTD----NHRPLLGTERSFQMFIEKYGKKYSTQKEYMHRL  79

Query  239  SVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANK  418
             +F  N+ RA  HQ LDP+AVHGVT FSDL+ +EF R + G        ++   PA +N 
Sbjct  80   GIFAKNMVRAAEHQALDPTAVHGVTPFSDLSEEEFERMYTG--------MRAVPPASSND  131

Query  419  A------PILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
                   P++   +LP +FDWR+ GAVT VK QG CGSCW+FSTTGA+EGA+F+AT
Sbjct  132  GVSDSAPPVMDVSDLPKNFDWREKGAVTEVKMQGGCGSCWAFSTTGAIEGANFIAT  187



>ref|XP_010534431.1| PREDICTED: cysteine proteinase 15A [Tarenaya hassleriana]
Length=379

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 110/177 (62%), Gaps = 10/177 (6%)
 Frame = +2

Query  47   LIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADH---HFSLFKSKFGKSYDTE  217
            LI+     S V +D   ED  IRQV      D    L   H    F  F S++GKSY+T 
Sbjct  19   LILVTDGVSCVASDH--EDLAIRQVTE----DHRKTLVGTHTESRFRAFMSEYGKSYETR  72

Query  218  EEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIR  397
            EE+ +R  VF  N+ RA  HQ++DP+AVHGVT+FSDLT +EF R F GV  +    + ++
Sbjct  73   EEYVHRLGVFARNVLRAAEHQMMDPTAVHGVTQFSDLTEEEFERMFTGVLAADEGGVGVQ  132

Query  398  LPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
              A A    +   D LP DFDWR+ GAVT VK QG+CGSCW+FSTTGA+EGA+F++T
Sbjct  133  -EAAAEDVEMAEIDGLPEDFDWREKGAVTDVKMQGACGSCWAFSTTGAIEGANFVST  188



>ref|XP_001781954.1| predicted protein [Physcomitrella patens]
 gb|EDQ53250.1| predicted protein [Physcomitrella patens]
Length=369

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 96/139 (69%), Gaps = 7/139 (5%)
 Frame = +2

Query  152  LLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLT  331
            LL A+  F  F  +FGK Y T EE+++RF VFK+NL RA +HQ LDP+A HGVT FSDLT
Sbjct  49   LLGAEKQFESFIKEFGKVYHTVEEYEHRFKVFKSNLLRALKHQALDPTASHGVTMFSDLT  108

Query  332  PKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCG  511
             +EF   + G+ +  A        + A  A  LPT +LP  FDWR+ GAV  VKNQGSCG
Sbjct  109  EEEFATQYLGLKRPSAL-------STAPTAEPLPTGDLPPSFDWREKGAVGPVKNQGSCG  161

Query  512  SCWSFSTTGALEGAHFLAT  568
            SCW+FSTTGA+EGAHFLAT
Sbjct  162  SCWAFSTTGAVEGAHFLAT  180



>emb|CDX73424.1| BnaC08g25790D [Brassica napus]
Length=364

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 110/179 (61%), Gaps = 11/179 (6%)
 Frame = +2

Query  41   SLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADH---HFSLFKSKFGKSYD  211
            +L ++   +A F     S ED  IRQV      D  P L   H    F +F S +GKSY 
Sbjct  5    TLALVLTCTAIFCHVAVSLEDLTIRQVTE----DRLPNLLGTHTERKFRVFMSDYGKSYS  60

Query  212  TEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLK  391
            T EE+ +R  +F  N+ +A  HQ++DP+AVHGVT+FSDLT  EF+R ++GV         
Sbjct  61   TREEYIHRLGIFAKNVLKAAEHQMMDPTAVHGVTQFSDLTEDEFKRMYNGVVDVDRGHGG  120

Query  392  IRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +       +AP L    LP DFDWR+ GAVT VK+QG+CGSCW+FSTTGA+EGA+F++T
Sbjct  121  VV----GAEAPKLEIKGLPKDFDWREKGAVTEVKDQGACGSCWAFSTTGAVEGANFVST  175



>ref|XP_006403513.1| hypothetical protein EUTSA_v10010475mg [Eutrema salsugineum]
 gb|ESQ44966.1| hypothetical protein EUTSA_v10010475mg [Eutrema salsugineum]
Length=367

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 107/164 (65%), Gaps = 12/164 (7%)
 Frame = +2

Query  92   SAEDPLIRQVVSEEDGDDDPLLN-----ADHHFSLFKSKFGKSYDTEEEHDYRFSVFKAN  256
            S ED  IRQV       DD L N      +  F +F S +GKSY T EE+ +R  +F  N
Sbjct  22   SLEDLTIRQVT------DDRLSNLLGTHTETKFRVFMSDYGKSYSTREEYVHRLGIFAKN  75

Query  257  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPT  436
            + +A  HQ+LDP+AVHGVT+FSDLT +EF R + GV        +      A +AP++  
Sbjct  76   VLKAAEHQMLDPTAVHGVTRFSDLTEEEFTRMYTGVVGVVDVGGRRGGTVGA-EAPMVEV  134

Query  437  DNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            + LPTDFDWR+ GAVT VK+QG+CGSCW+FSTTGA+EGAHF++T
Sbjct  135  EGLPTDFDWREKGAVTEVKDQGACGSCWAFSTTGAVEGAHFVST  178



>ref|XP_006293095.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
 gb|EOA25993.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
Length=367

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 106/168 (63%), Gaps = 8/168 (5%)
 Frame = +2

Query  74   FVRADFSAEDPLIRQVVSEEDGDDDPLLNA--DHHFSLFKSKFGKSYDTEEEHDYRFSVF  247
            F  A  S +D  IRQV  +       LL    +  F +F S FGKSY T EE+ +R  +F
Sbjct  16   FFHAVASVDDITIRQVTDDGRQVRPNLLGTHTESKFRVFMSDFGKSYSTREEYVHRLGIF  75

Query  248  KANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHK-SRAKKLKIRLPADANKAP  424
              N+ +A  HQ++DP+AVHGVT+FSDLT  EF+R + GV    R   + +       +AP
Sbjct  76   AKNVLKAAEHQMMDPTAVHGVTQFSDLTEDEFKRMYTGVADVDRGHGVTV-----GAEAP  130

Query  425  ILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            ++  + LP DFDWR+ G VT VKNQG+CGSCW+FSTTGA EGAHF++T
Sbjct  131  MVDVEGLPDDFDWREKGGVTEVKNQGACGSCWAFSTTGAAEGAHFVST  178



>ref|XP_008446834.1| PREDICTED: cysteine proteinase 15A [Cucumis melo]
Length=371

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 12/182 (7%)
 Frame = +2

Query  32   FLFSLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYD  211
            F  +LLI  + SA+ +R D       +RQV   E  ++ P   ++  F++F  K+GKSY 
Sbjct  12   FSLTLLISAIPSATALRHD----PEFLRQVTDGEIFNNLPA-GSERKFAMFMEKYGKSYP  66

Query  212  TEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLK  391
            T +E+ +R  +F  NL RA  HQ LDP+AVHGVT+FSDL+ +EF R F GV   R     
Sbjct  67   TRKEYLHRLGIFVKNLIRAAEHQALDPTAVHGVTQFSDLSEEEFERMFMGV---RGGAGG  123

Query  392  IRLPADANKAPILPTD---NLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFL  562
              LP + N+A  +  +    LP  FDWR+ GAVTGVK QG+CGSCW+FST GA+EGA+F+
Sbjct  124  AGLP-EMNQAVEVSAEEVKGLPERFDWREKGAVTGVKMQGTCGSCWAFSTCGAVEGANFI  182

Query  563  AT  568
            AT
Sbjct  183  AT  184



>ref|XP_009116190.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=364

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 110/179 (61%), Gaps = 11/179 (6%)
 Frame = +2

Query  41   SLLIIGLASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADH---HFSLFKSKFGKSYD  211
            +L ++   +A F     S ED  IRQV      D  P L   H    F +F S +GKSY 
Sbjct  5    TLALVLTCTAIFCHVAVSLEDLTIRQVTE----DRLPNLLGTHTERKFRVFMSDYGKSYS  60

Query  212  TEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLK  391
            T EE+ +R  +F  N+ +A  HQ++DP+AVHGVT+FSDLT +EF+R + GV         
Sbjct  61   TREEYIHRLGIFAKNVLKAAEHQMMDPTAVHGVTQFSDLTEEEFKRMYTGVVDVDRGHGG  120

Query  392  IRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            +       +AP L    LP DFDWR+ GAVT VK+QG+CGSCW+FSTTGA+EGA+F++T
Sbjct  121  VV----GAEAPQLDIKGLPKDFDWREKGAVTEVKDQGACGSCWAFSTTGAVEGANFVST  175



>emb|CDY56961.1| BnaA09g55030D [Brassica napus]
Length=364

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 108/175 (62%), Gaps = 17/175 (10%)
 Frame = +2

Query  62   ASASFVRADFSAEDPLIRQVVSEEDGDDDPLLNADH---HFSLFKSKFGKSYDTEEEHDY  232
             +A F     S ED  IRQV      D  P L   H    F +F S +GKSY T EE+ +
Sbjct  12   CTAIFCHVAVSLEDLTIRQVTE----DRLPNLLGTHTERKFRVFMSDYGKSYSTREEYIH  67

Query  233  RFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHG---VHKSRAKKLKIRLP  403
            R  +F  N+ +A  HQ++DP+AVHGVT+FSDLT +EF+R + G   V +     + +   
Sbjct  68   RLGIFAKNVLKAAEHQMMDPTAVHGVTQFSDLTEEEFKRMYTGVVDVDRGHGGVVGV---  124

Query  404  ADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
                +AP L    LP DFDWR+ GAVT VK+QG+CGSCW+FSTTGA+EGA+F++T
Sbjct  125  ----EAPQLDIKGLPKDFDWREKGAVTEVKDQGACGSCWAFSTTGAVEGANFVST  175



>ref|XP_001761980.1| predicted protein [Physcomitrella patens]
 gb|EDQ73084.1| predicted protein [Physcomitrella patens]
Length=369

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 114/182 (63%), Gaps = 18/182 (10%)
 Frame = +2

Query  44   LLIIGLASASFVRADFSAEDPL---IRQVVSEEDGDDD------PLLNADHHFSLFKSKF  196
            LL++G+    F  A F+A  P    IR+V  +   +         L+ A+  F  F   F
Sbjct  6    LLLVGIVVLGF--AGFAASLPTGDTIREVTDDALSNGSVEQFAHALIGAEKRFESFMKDF  63

Query  197  GKSYDTEEEHDYRFSVFKANLRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSR  376
            GK Y + EE+++RF VFK+NL +A +HQ LDP+A HGVT FSDLT +EF   + G+ +  
Sbjct  64   GKVYHSVEEYEHRFGVFKSNLLKALKHQALDPTASHGVTMFSDLTEEEFTSKYLGLKRPS  123

Query  377  AKKLKIRLPADANKAPILPTDNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAH  556
                   + + A +AP LPT++LP +FDWR+ GAV  VK+QG CGSCW+FSTTGA+EGAH
Sbjct  124  -------VLSSAPQAPPLPTEDLPPNFDWREKGAVGPVKDQGGCGSCWAFSTTGAVEGAH  176

Query  557  FL  562
            FL
Sbjct  177  FL  178



>ref|XP_007010012.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY18822.1| Papain family cysteine protease [Theobroma cacao]
Length=382

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 102/164 (62%), Gaps = 11/164 (7%)
 Frame = +2

Query  98   EDPLIRQVVSEEDGDDDPLLN-------ADHHFSLFKSKFGKSYDTEEEHDYRFSVFKAN  256
            ++P I QV      +  P LN           F +F  K+GK+Y T EE+ +R  +F  N
Sbjct  35   QEPTILQVTD----NLIPTLNRKFSRNYVHKEFQVFVEKYGKNYSTTEEYMHRLGIFAKN  90

Query  257  LRRAKRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAKKLKIRLPADANKAPILPT  436
            L RA  HQ+LDP+AVHGVT+FSDL+ +EF R + GV    A      +    ++A ++  
Sbjct  91   LIRAAEHQVLDPTAVHGVTQFSDLSEEEFERLYTGVKGGMAAAAPRMMDGVGSEAEMVEV  150

Query  437  DNLPTDFDWRDHGAVTGVKNQGSCGSCWSFSTTGALEGAHFLAT  568
            D LP  FDWR+ GAVT VK QG+CGSCW+FSTTGA+EGA+F+AT
Sbjct  151  DGLPESFDWREKGAVTEVKMQGACGSCWAFSTTGAIEGANFVAT  194



>gb|AAN57719.1| cysteine proteinase precursor [Solanum melongena]
Length=120

 Score =   146 bits (368),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 2/98 (2%)
 Frame = +2

Query  89   FSAEDPLIRQVVSEEDGDDDPLLNADHHFSLFKSKFGKSYDTEEEHDYRFSVFKANLRRA  268
            FS +DPLIRQVVSE   DD+ +LNA+HHFSLFKSK+GK Y ++EEHD+R  VFKANLRRA
Sbjct  21   FSDDDPLIRQVVSE--TDDNHMLNAEHHFSLFKSKYGKIYASQEEHDHRLKVFKANLRRA  78

Query  269  KRHQLLDPSAVHGVTKFSDLTPKEFRRTFHGVHKSRAK  382
            +RHQLLDP+A HG+T+FSDLTP EFRRT+ G+HK R K
Sbjct  79   RRHQLLDPTAEHGITQFSDLTPSEFRRTYLGLHKPRPK  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515