BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L06

Length=473
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011031070.1|  PREDICTED: homeobox-leucine zipper protein A...  71.2    7e-12   Populus euphratica
ref|XP_002306291.2|  hypothetical protein POPTR_0005s07290g           70.9    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011031071.1|  PREDICTED: homeobox-leucine zipper protein A...  69.7    3e-11   Populus euphratica
emb|CDP01514.1|  unnamed protein product                              70.1    3e-11   Coffea canephora [robusta coffee]
gb|KJB18238.1|  hypothetical protein B456_003G041500                  67.4    1e-10   Gossypium raimondii
gb|KJB18237.1|  hypothetical protein B456_003G041500                  67.4    1e-10   Gossypium raimondii
ref|XP_011022832.1|  PREDICTED: homeobox-leucine zipper protein A...  66.6    4e-10   Populus euphratica
ref|XP_006380403.1|  hypothetical protein POPTR_0007s05010g           66.2    4e-10   Populus trichocarpa [western balsam poplar]
dbj|BAA21017.1|  DNA-binding protein                                  62.4    2e-09   Daucus carota [carrots]
ref|XP_004504111.1|  PREDICTED: homeobox-leucine zipper protein A...  63.9    2e-09   Cicer arietinum [garbanzo]
ref|XP_011100030.1|  PREDICTED: homeobox-leucine zipper protein A...  63.9    3e-09   Sesamum indicum [beniseed]
ref|XP_007159709.1|  hypothetical protein PHAVU_002G260700g           63.2    4e-09   Phaseolus vulgaris [French bean]
gb|KHN06556.1|  Homeobox-leucine zipper protein ATHB-16               62.8    7e-09   Glycine soja [wild soybean]
ref|XP_004288161.1|  PREDICTED: homeobox-leucine zipper protein A...  62.4    1e-08   Fragaria vesca subsp. vesca
ref|XP_003524258.2|  PREDICTED: homeobox-leucine zipper protein A...  62.4    1e-08   
ref|XP_008374197.1|  PREDICTED: homeobox-leucine zipper protein A...  62.0    1e-08   
ref|XP_011465283.1|  PREDICTED: homeobox-leucine zipper protein A...  62.0    1e-08   Fragaria vesca subsp. vesca
ref|XP_006584635.1|  PREDICTED: homeodomain-leucine zipper protei...  61.6    2e-08   Glycine max [soybeans]
gb|KDP29729.1|  hypothetical protein JCGZ_18664                       61.6    2e-08   Jatropha curcas
ref|XP_004250119.1|  PREDICTED: homeobox-leucine zipper protein A...  61.2    3e-08   Solanum lycopersicum
ref|XP_007047858.1|  Alanine--glyoxylate aminotransferase 2 isofo...  60.8    4e-08   
gb|ACK38184.1|  unknown                                               58.2    4e-08   Medicago truncatula
ref|XP_009365821.1|  PREDICTED: homeobox-leucine zipper protein A...  59.3    1e-07   Pyrus x bretschneideri [bai li]
gb|KHN29035.1|  Homeobox-leucine zipper protein ATHB-16               58.9    2e-07   Glycine soja [wild soybean]
gb|KJB71222.1|  hypothetical protein B456_011G111500                  58.2    2e-07   Gossypium raimondii
ref|XP_006353200.1|  PREDICTED: homeobox-leucine zipper protein A...  58.5    3e-07   Solanum tuberosum [potatoes]
gb|KEH20782.1|  homeobox associated leucine zipper protein            58.2    3e-07   Medicago truncatula
ref|XP_007205507.1|  hypothetical protein PRUPE_ppa008318mg           57.8    4e-07   Prunus persica
emb|CBI33148.3|  unnamed protein product                              57.0    6e-07   Vitis vinifera
ref|XP_008338560.1|  PREDICTED: homeobox-leucine zipper protein A...  57.0    8e-07   
ref|XP_004143453.1|  PREDICTED: homeobox-leucine zipper protein A...  56.2    1e-06   Cucumis sativus [cucumbers]
ref|XP_008440572.1|  PREDICTED: homeobox-leucine zipper protein A...  56.2    2e-06   Cucumis melo [Oriental melon]
ref|XP_007205506.1|  hypothetical protein PRUPE_ppa008318mg           56.2    2e-06   Prunus persica
ref|XP_003632476.1|  PREDICTED: homeobox-leucine zipper protein A...  56.2    2e-06   Vitis vinifera
emb|CAN62215.1|  hypothetical protein VITISV_008512                   55.8    2e-06   Vitis vinifera
ref|XP_008235150.1|  PREDICTED: homeobox-leucine zipper protein A...  55.5    3e-06   Prunus mume [ume]
gb|KDO60669.1|  hypothetical protein CISIN_1g0195702mg                54.3    4e-06   Citrus sinensis [apfelsine]
gb|KDO60668.1|  hypothetical protein CISIN_1g0195702mg                54.3    4e-06   Citrus sinensis [apfelsine]
gb|KDO60665.1|  hypothetical protein CISIN_1g0195702mg                54.7    4e-06   Citrus sinensis [apfelsine]
gb|KDO60667.1|  hypothetical protein CISIN_1g0195702mg                54.7    4e-06   Citrus sinensis [apfelsine]
gb|KDO60666.1|  hypothetical protein CISIN_1g0195702mg                54.7    5e-06   Citrus sinensis [apfelsine]
ref|XP_006466270.1|  PREDICTED: homeobox-leucine zipper protein A...  54.7    6e-06   Citrus sinensis [apfelsine]
ref|XP_006426320.1|  hypothetical protein CICLE_v10026013mg           54.3    6e-06   Citrus clementina [clementine]
gb|KDO60664.1|  hypothetical protein CISIN_1g0195702mg                53.9    8e-06   Citrus sinensis [apfelsine]
ref|XP_010106292.1|  Homeobox-leucine zipper protein ATHB-16          53.5    1e-05   Morus notabilis
ref|XP_010266919.1|  PREDICTED: homeobox-leucine zipper protein A...  53.5    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010272979.1|  PREDICTED: homeobox-leucine zipper protein A...  53.1    1e-05   Nelumbo nucifera [Indian lotus]
gb|KHG25678.1|  Homeobox-leucine zipper ATHB-16 -like protein         53.1    2e-05   Gossypium arboreum [tree cotton]
gb|KJB48871.1|  hypothetical protein B456_008G091100                  52.8    2e-05   Gossypium raimondii
ref|XP_011097532.1|  PREDICTED: homeobox-leucine zipper protein A...  52.4    3e-05   Sesamum indicum [beniseed]
ref|XP_006366219.1|  PREDICTED: homeobox-leucine zipper protein A...  52.0    4e-05   Solanum tuberosum [potatoes]



>ref|XP_011031070.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform 
X1 [Populus euphratica]
Length=329

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSLGSSDSLGALMSIC PTT++ S  NS+HVY+ EFQSML+GLD
Sbjct  1    MKRSLGSSDSLGALMSIC-PTTEEHSPRNSTHVYSREFQSMLDGLD  45



>ref|XP_002306291.2| hypothetical protein POPTR_0005s07290g [Populus trichocarpa]
 gb|EEE93287.2| hypothetical protein POPTR_0005s07290g [Populus trichocarpa]
Length=329

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSLGSSDSLGALMSIC PTT++ S  NS+HVY+ EFQSML GLD
Sbjct  1    MKRSLGSSDSLGALMSIC-PTTEEHSPRNSTHVYSREFQSMLNGLD  45



>ref|XP_011031071.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform 
X2 [Populus euphratica]
Length=328

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSLGSSDSLGALMSICP T   P   NS+HVY+ EFQSML+GLD
Sbjct  1    MKRSLGSSDSLGALMSICPTTEHSPR--NSTHVYSREFQSMLDGLD  44



>emb|CDP01514.1| unnamed protein product [Coffea canephora]
Length=360

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGALMSICP +TD+ +QGN SHVY  EFQSMLEGLD
Sbjct  1    MKR-LGSSDSLGALMSICPTSTDEHNQGN-SHVYPREFQSMLEGLD  44



>gb|KJB18238.1| hypothetical protein B456_003G041500 [Gossypium raimondii]
Length=313

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSLGSSDSLGALMSIC PTTD+ S  N +HVY+ EFQSML+GLD
Sbjct  1    MKRSLGSSDSLGALMSIC-PTTDEHSPRN-NHVYSREFQSMLDGLD  44



>gb|KJB18237.1| hypothetical protein B456_003G041500 [Gossypium raimondii]
Length=308

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSLGSSDSLGALMSIC PTTD+ S  N +HVY+ EFQSML+GLD
Sbjct  1    MKRSLGSSDSLGALMSIC-PTTDEHSPRN-NHVYSREFQSMLDGLD  44



>ref|XP_011022832.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Populus 
euphratica]
Length=328

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSLGSSDSLGALMSIC P+ ++ S  N +HVY+ EFQSML+GLD
Sbjct  1    MKRSLGSSDSLGALMSIC-PSAEERSPRNHTHVYSREFQSMLDGLD  45



>ref|XP_006380403.1| hypothetical protein POPTR_0007s05010g [Populus trichocarpa]
 gb|ABK95942.1| unknown [Populus trichocarpa]
 gb|ERP58200.1| hypothetical protein POPTR_0007s05010g [Populus trichocarpa]
Length=328

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSLGSSDSLGALMSIC P+ ++ S  N +HVY+ EFQSML+GLD
Sbjct  1    MKRSLGSSDSLGALMSIC-PSAEEHSPRNHTHVYSREFQSMLDGLD  45



>dbj|BAA21017.1| DNA-binding protein [Daucus carota]
Length=151

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR L SSDSLGALMSIC PTT++ S GN +HVY+ EFQSMLEGLD
Sbjct  1    MKR-LSSSDSLGALMSIC-PTTEEGSPGN-NHVYSREFQSMLEGLD  43



>ref|XP_004504111.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Cicer 
arietinum]
Length=305

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGALM+ICPPT +  S  N +HVY  EFQSMLEGLD
Sbjct  1    MKR-LGSSDSLGALMTICPPTEEQISPRN-NHVYGREFQSMLEGLD  44



>ref|XP_011100030.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Sesamum 
indicum]
Length=328

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSLGSSDSLGALMSICP +TD+ S      +Y  EFQ+MLEGLD
Sbjct  1    MKRSLGSSDSLGALMSICPNSTDENSPKGDYPMYTREFQTMLEGLD  46



>ref|XP_007159709.1| hypothetical protein PHAVU_002G260700g [Phaseolus vulgaris]
 gb|ESW31703.1| hypothetical protein PHAVU_002G260700g [Phaseolus vulgaris]
Length=303

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGALM+ICPPT +   + N  HVY  EFQSMLEGLD
Sbjct  1    MKR-LGSSDSLGALMTICPPTDEHSPRNN--HVYGREFQSMLEGLD  43



>gb|KHN06556.1| Homeobox-leucine zipper protein ATHB-16 [Glycine soja]
Length=314

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSD+LGALM+ICPPT +   + N  HVY  EFQSMLEGLD
Sbjct  1    MKR-LGSSDTLGALMTICPPTDEHSPRNN--HVYGKEFQSMLEGLD  43



>ref|XP_004288161.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=328

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGAL+SICP TTD+ S  N +HVY+ +FQSML+GLD
Sbjct  1    MKR-LGSSDSLGALISICPTTTDEHSPRN-NHVYSRDFQSMLDGLD  44



>ref|XP_003524258.2| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Glycine 
max]
Length=348

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSD+LGALM+ICPPT +   + N  HVY  EFQSMLEGLD
Sbjct  1    MKR-LGSSDTLGALMTICPPTDEHSPRNN--HVYGKEFQSMLEGLD  43



>ref|XP_008374197.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform 
X1 [Malus domestica]
Length=330

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGA++SICP  TD+ S   S+HVY+ EFQSMLEGLD
Sbjct  1    MKR-LGSSDSLGAMISICPIITDEQS-PRSNHVYSREFQSMLEGLD  44



>ref|XP_011465283.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=329

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGAL+SICP TT D     ++HVY+ +FQSML+GLD
Sbjct  1    MKR-LGSSDSLGALISICPTTTADEHSPRNNHVYSRDFQSMLDGLD  45



>ref|XP_006584635.1| PREDICTED: homeodomain-leucine zipper protein 56 isoform X1 [Glycine 
max]
Length=312

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGALM+ICPPT +   + N  H Y  EFQSMLEGLD
Sbjct  1    MKR-LGSSDSLGALMTICPPTDEHSPRNN--HAYGREFQSMLEGLD  43



>gb|KDP29729.1| hypothetical protein JCGZ_18664 [Jatropha curcas]
Length=322

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR L SSDSLGAL+SICP T+D+ S  NS+HVY  EFQSML+GLD
Sbjct  1    MKR-LSSSDSLGALISICP-TSDEHSPRNSNHVYGREFQSMLDGLD  44



>ref|XP_004250119.1| PREDICTED: homeobox-leucine zipper protein ATHB-6 [Solanum lycopersicum]
Length=350

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 4/48 (8%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAG-EFQSMLE-GLD  472
            MKR LGSSDSLGALMS+CP TTDD + GN SHVY+  +FQSMLE GLD
Sbjct  1    MKR-LGSSDSLGALMSMCPSTTDDQNHGN-SHVYSTRDFQSMLELGLD  46



>ref|XP_007047858.1| Alanine--glyoxylate aminotransferase 2 isoform 1 [Theobroma cacao]
 ref|XP_007047859.1| Pyrimidine 4 isoform 1 [Theobroma cacao]
 gb|EOX92015.1| Alanine--glyoxylate aminotransferase 2 isoform 1 [Theobroma cacao]
 gb|EOX92016.1| Pyrimidine 4 isoform 1 [Theobroma cacao]
Length=330

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGALMSIC PTTD+ S  N +H+Y+ EFQSML+GLD
Sbjct  1    MKR-LGSSDSLGALMSIC-PTTDEHSPRN-NHIYSREFQSMLDGLD  43



>gb|ACK38184.1| unknown [Medicago truncatula]
Length=122

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGALM+ICP T ++  + N   VY  EFQSM+EGLD
Sbjct  1    MKR-LGSSDSLGALMAICPTTEEESPRNN--QVYGREFQSMMEGLD  43



>ref|XP_009365821.1| PREDICTED: homeobox-leucine zipper protein ATHB-6 isoform X2 
[Pyrus x bretschneideri]
Length=329

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGA++SICP T +   + N  HVY+ EFQSMLEGLD
Sbjct  1    MKR-LGSSDSLGAMISICPITDEQSPRNN--HVYSREFQSMLEGLD  43



>gb|KHN29035.1| Homeobox-leucine zipper protein ATHB-16 [Glycine soja]
Length=312

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGA M+ICPPT +   + N  H Y  EFQSMLEGLD
Sbjct  1    MKR-LGSSDSLGAHMTICPPTDEHSPRNN--HAYGREFQSMLEGLD  43



>gb|KJB71222.1| hypothetical protein B456_011G111500 [Gossypium raimondii]
Length=286

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSL ALMSICP T+D+ S  N+++VY  EFQSMLEG D
Sbjct  1    MKR-LGSSDSLSALMSICP-TSDEHSPRNNNNVYIREFQSMLEGFD  44



>ref|XP_006353200.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Solanum 
tuberosum]
Length=348

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 4/48 (8%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAG-EFQSMLE-GLD  472
            MKR L SSDSLGALMS+CP TTDD + GN SHVY+  +FQSMLE GLD
Sbjct  1    MKR-LSSSDSLGALMSMCPSTTDDQNHGN-SHVYSTRDFQSMLELGLD  46



>gb|KEH20782.1| homeobox associated leucine zipper protein [Medicago truncatula]
Length=311

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGALM+ICP T ++  + N   VY  EFQSM+EGLD
Sbjct  1    MKR-LGSSDSLGALMTICPTTEEESPRNN--QVYGREFQSMMEGLD  43



>ref|XP_007205507.1| hypothetical protein PRUPE_ppa008318mg [Prunus persica]
 gb|EMJ06706.1| hypothetical protein PRUPE_ppa008318mg [Prunus persica]
Length=337

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGA++SICP T ++ S  N +HVY  +FQSML+GLD
Sbjct  1    MKR-LGSSDSLGAMISICPSTAEEQSPRN-NHVYRRDFQSMLDGLD  44



>emb|CBI33148.3| unnamed protein product [Vitis vinifera]
Length=280

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSS+SLGALM+IC PTTD+ S  N +HVY+ EFQ+M +GLD
Sbjct  1    MKR-LGSSESLGALMAIC-PTTDEHSPRN-NHVYSREFQTMFDGLD  43



>ref|XP_008338560.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Malus 
domestica]
Length=329

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDS GA++SICP T +   + N  HVY+ EFQSML+GLD
Sbjct  1    MKR-LGSSDSFGAMISICPTTEEHSPRNN--HVYSREFQSMLDGLD  43



>ref|XP_004143453.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Cucumis 
sativus]
 ref|XP_004173863.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Cucumis 
sativus]
 gb|KGN48728.1| hypothetical protein Csa_6G499720 [Cucumis sativus]
Length=324

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR  GSSDSLGALMS+CP T+++ S  NS HVY  EFQSML+GLD
Sbjct  1    MKRH-GSSDSLGALMSVCP-TSEEQSPRNS-HVYGREFQSMLDGLD  43



>ref|XP_008440572.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Cucumis 
melo]
Length=324

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR  GSSDSLGALMS+CP T+++ S  NS HVY  EFQSML+GLD
Sbjct  1    MKRH-GSSDSLGALMSVCP-TSEEQSPRNS-HVYGREFQSMLDGLD  43



>ref|XP_007205506.1| hypothetical protein PRUPE_ppa008318mg [Prunus persica]
 gb|EMJ06705.1| hypothetical protein PRUPE_ppa008318mg [Prunus persica]
Length=336

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGA++SICP T +   + N  HVY  +FQSML+GLD
Sbjct  1    MKR-LGSSDSLGAMISICPSTEEQSPRNN--HVYRRDFQSMLDGLD  43



>ref|XP_003632476.1| PREDICTED: homeobox-leucine zipper protein ATHB-6 [Vitis vinifera]
Length=335

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSS+SLGALM+IC PTTD+ S  N +HVY+ EFQ+M +GLD
Sbjct  1    MKR-LGSSESLGALMAIC-PTTDEHSPRN-NHVYSREFQTMFDGLD  43



>emb|CAN62215.1| hypothetical protein VITISV_008512 [Vitis vinifera]
Length=345

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSS+SLGALM+IC PTTD+ S  N +HVY+ EFQ+M +GLD
Sbjct  1    MKR-LGSSESLGALMAIC-PTTDEHSPRN-NHVYSREFQTMFDGLD  43



>ref|XP_008235150.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Prunus 
mume]
Length=337

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSSDSLGA++SICP T ++ S  N +HVY  +F SML+GLD
Sbjct  1    MKR-LGSSDSLGAMISICPSTAEEHSPRN-NHVYRRDFHSMLDGLD  44



>gb|KDO60669.1| hypothetical protein CISIN_1g0195702mg, partial [Citrus sinensis]
Length=239

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +2

Query  335  MKRSLGSSD-SLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSL SSD SLGALMSICP T +   + N   VY+ EFQ+ML+GLD
Sbjct  1    MKRSLCSSDDSLGALMSICPATDEQSPRNN--QVYSREFQTMLDGLD  45



>gb|KDO60668.1| hypothetical protein CISIN_1g0195702mg, partial [Citrus sinensis]
Length=242

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +2

Query  335  MKRSLGSSD-SLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSL SSD SLGALMSICP T +   + N   VY+ EFQ+ML+GLD
Sbjct  1    MKRSLCSSDDSLGALMSICPATDEQSPRNN--QVYSREFQTMLDGLD  45



>gb|KDO60665.1| hypothetical protein CISIN_1g0195702mg, partial [Citrus sinensis]
Length=308

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +2

Query  335  MKRSLGSSD-SLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSL SSD SLGALMSICP T +   + N   VY+ EFQ+ML+GLD
Sbjct  1    MKRSLCSSDDSLGALMSICPATDEQSPRNN--QVYSREFQTMLDGLD  45



>gb|KDO60667.1| hypothetical protein CISIN_1g0195702mg, partial [Citrus sinensis]
Length=302

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +2

Query  335  MKRSLGSSD-SLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSL SSD SLGALMSICP T +   + N   VY+ EFQ+ML+GLD
Sbjct  1    MKRSLCSSDDSLGALMSICPATDEQSPRNN--QVYSREFQTMLDGLD  45



>gb|KDO60666.1| hypothetical protein CISIN_1g0195702mg, partial [Citrus sinensis]
Length=304

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +2

Query  335  MKRSLGSSD-SLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSL SSD SLGALMSICP T +   + N   VY+ EFQ+ML+GLD
Sbjct  1    MKRSLCSSDDSLGALMSICPATDEQSPRNN--QVYSREFQTMLDGLD  45



>ref|XP_006466270.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Citrus 
sinensis]
Length=338

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +2

Query  335  MKRSLGSSD-SLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSL SSD SLGALMSICP T +   + N   VY+ EFQ+ML+GLD
Sbjct  1    MKRSLCSSDDSLGALMSICPATDEQSPRNN--QVYSREFQTMLDGLD  45



>ref|XP_006426320.1| hypothetical protein CICLE_v10026013mg [Citrus clementina]
 gb|ESR39560.1| hypothetical protein CICLE_v10026013mg [Citrus clementina]
 gb|KDO60661.1| hypothetical protein CISIN_1g0195702mg [Citrus sinensis]
 gb|KDO60662.1| hypothetical protein CISIN_1g0195702mg [Citrus sinensis]
 gb|KDO60663.1| hypothetical protein CISIN_1g0195702mg [Citrus sinensis]
Length=338

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +2

Query  335  MKRSLGSSD-SLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSL SSD SLGALMSICP T +   + N   VY+ EFQ+ML+GLD
Sbjct  1    MKRSLCSSDDSLGALMSICPATDEQSPRNN--QVYSREFQTMLDGLD  45



>gb|KDO60664.1| hypothetical protein CISIN_1g0195702mg [Citrus sinensis]
Length=315

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +2

Query  335  MKRSLGSSD-SLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKRSL SSD SLGALMSICP T +   + N   VY+ EFQ+ML+GLD
Sbjct  1    MKRSLCSSDDSLGALMSICPATDEQSPRNN--QVYSREFQTMLDGLD  45



>ref|XP_010106292.1| Homeobox-leucine zipper protein ATHB-16 [Morus notabilis]
 gb|EXC09709.1| Homeobox-leucine zipper protein ATHB-16 [Morus notabilis]
Length=342

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR L SSDSLGALMS+CP T +   + N  HVY  +F+SML+GLD
Sbjct  1    MKR-LSSSDSLGALMSVCPTTEEQSPRNN--HVYGRDFRSMLDGLD  43



>ref|XP_010266919.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Nelumbo 
nucifera]
Length=334

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR LGSS+SLGA++SICP + ++   G S+HVY   FQSML+GLD
Sbjct  1    MKR-LGSSESLGAVISICP-SAEEKGLGASNHVYRRSFQSMLDGLD  44



>ref|XP_010272979.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Nelumbo 
nucifera]
Length=337

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 1/40 (3%)
 Frame = +2

Query  353  SSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            SSDSLGAL+SICP +T++ S G ++HVY  +FQSML+GLD
Sbjct  6    SSDSLGALISICP-STEERSSGANNHVYRRDFQSMLDGLD  44



>gb|KHG25678.1| Homeobox-leucine zipper ATHB-16 -like protein [Gossypium arboreum]
Length=328

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLE  463
            MKRSLGSSDS+   MSIC PTTD+ S  N +H+Y+ E QSML+
Sbjct  1    MKRSLGSSDSMATFMSIC-PTTDEESPRN-NHIYSKELQSMLD  41



>gb|KJB48871.1| hypothetical protein B456_008G091100 [Gossypium raimondii]
Length=326

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLE  463
            MKRSLG SDS+ A MSIC PTTD+ S  N +H+Y+ E QSML+
Sbjct  1    MKRSLGCSDSMAAFMSIC-PTTDEESPRN-NHIYSKELQSMLD  41



>ref|XP_011097532.1| PREDICTED: homeobox-leucine zipper protein ATHB-6 [Sesamum indicum]
Length=305

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 5/46 (11%)
 Frame = +2

Query  335  MKRSLGSSDSLGALMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR L SSDSLGALMSICP +TD+    +++ +Y  EFQ+M+EGLD
Sbjct  1    MKR-LSSSDSLGALMSICPNSTDE----HNNPMYTREFQTMMEGLD  41



>ref|XP_006366219.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Solanum 
tuberosum]
Length=325

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 3/47 (6%)
 Frame = +2

Query  335  MKRSLGSSDSLGA-LMSICPPTTDDPSQGNSSHVYAGEFQSMLEGLD  472
            MKR + S+DSLGA L SIC  TTD+ +  N+ HVY+ +FQSMLEGLD
Sbjct  1    MKR-VRSNDSLGAPLTSICQNTTDEHNNWNN-HVYSRDFQSMLEGLD  45



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180