BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L04

Length=568
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011075501.1|  PREDICTED: uncharacterized protein LOC105159964    218   7e-67   Sesamum indicum [beniseed]
ref|XP_011070995.1|  PREDICTED: uncharacterized protein LOC105156535    214   2e-65   Sesamum indicum [beniseed]
ref|XP_009590050.1|  PREDICTED: uncharacterized protein LOC104087...    207   1e-62   Nicotiana tomentosiformis
ref|XP_009590038.1|  PREDICTED: uncharacterized protein LOC104087...    207   2e-62   Nicotiana tomentosiformis
ref|XP_009765410.1|  PREDICTED: uncharacterized protein LOC104216...    206   6e-62   Nicotiana sylvestris
ref|XP_009765409.1|  PREDICTED: uncharacterized protein LOC104216...    206   6e-62   Nicotiana sylvestris
ref|XP_009765411.1|  PREDICTED: uncharacterized protein LOC104216...    205   6e-62   Nicotiana sylvestris
ref|XP_009765407.1|  PREDICTED: uncharacterized protein LOC104216...    206   6e-62   Nicotiana sylvestris
gb|EYU28755.1|  hypothetical protein MIMGU_mgv1a010687mg                205   1e-61   Erythranthe guttata [common monkey flower]
gb|KDP41198.1|  hypothetical protein JCGZ_15605                         201   3e-60   Jatropha curcas
ref|XP_010551546.1|  PREDICTED: uncharacterized protein LOC104822125    200   4e-60   Tarenaya hassleriana [spider flower]
ref|XP_009616758.1|  PREDICTED: uncharacterized protein LOC104109233    200   6e-60   Nicotiana tomentosiformis
ref|XP_010532809.1|  PREDICTED: uncharacterized protein LOC104808...    197   5e-59   Tarenaya hassleriana [spider flower]
ref|XP_004490059.1|  PREDICTED: uncharacterized protein LOC101496707    196   1e-58   Cicer arietinum [garbanzo]
emb|CDP00334.1|  unnamed protein product                                196   2e-58   Coffea canephora [robusta coffee]
gb|EYU22411.1|  hypothetical protein MIMGU_mgv1a011126mg                196   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_008806006.1|  PREDICTED: probable E3 ubiquitin ligase SUD1...    194   4e-58   
ref|XP_009380155.1|  PREDICTED: uncharacterized protein LOC103968613    194   9e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008806003.1|  PREDICTED: uncharacterized protein LOC103718...    194   1e-57   Phoenix dactylifera
ref|XP_003517979.1|  PREDICTED: uncharacterized protein LOC100812998    194   1e-57   Glycine max [soybeans]
ref|XP_010532800.1|  PREDICTED: uncharacterized protein LOC104808...    193   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_003613769.1|  E3 ubiquitin-protein ligase MARCH3                 192   3e-57   
ref|XP_006366707.1|  PREDICTED: uncharacterized protein LOC102579...    193   3e-57   Solanum tuberosum [potatoes]
ref|XP_007046096.1|  RING/FYVE/PHD zinc finger superfamily protei...    193   3e-57   
ref|XP_007046100.1|  RING/FYVE/PHD zinc finger superfamily protei...    192   4e-57   
ref|XP_003613768.1|  E3 ubiquitin-protein ligase MARCH3                 192   5e-57   Medicago truncatula
ref|XP_009410006.1|  PREDICTED: uncharacterized protein LOC103992138    192   5e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003518727.1|  PREDICTED: uncharacterized protein LOC100779674    192   7e-57   Glycine max [soybeans]
gb|KHG14333.1|  Ectonucleoside triphosphate diphosphohydrolase 1        201   8e-57   Gossypium arboreum [tree cotton]
ref|XP_006827237.1|  hypothetical protein AMTR_s00010p00261170          192   9e-57   Amborella trichopoda
ref|XP_010926555.1|  PREDICTED: uncharacterized protein LOC105048801    192   1e-56   Elaeis guineensis
ref|XP_007046097.1|  RING/FYVE/PHD zinc finger superfamily protei...    192   1e-56   
ref|XP_010917045.1|  PREDICTED: uncharacterized protein LOC105041733    191   1e-56   Elaeis guineensis
ref|XP_007157624.1|  hypothetical protein PHAVU_002G085200g             190   7e-56   Phaseolus vulgaris [French bean]
ref|XP_007157623.1|  hypothetical protein PHAVU_002G085200g             189   8e-56   Phaseolus vulgaris [French bean]
gb|KJB30403.1|  hypothetical protein B456_005G141600                    188   1e-55   Gossypium raimondii
ref|XP_006355132.1|  PREDICTED: uncharacterized protein LOC102582422    189   1e-55   Solanum tuberosum [potatoes]
gb|KJB30401.1|  hypothetical protein B456_005G141600                    188   2e-55   Gossypium raimondii
gb|KHG25683.1|  E3 ubiquitin-protein ligase MARCH3                      188   2e-55   Gossypium arboreum [tree cotton]
ref|XP_004228377.1|  PREDICTED: uncharacterized protein LOC101247951    188   4e-55   Solanum lycopersicum
ref|XP_006438690.1|  hypothetical protein CICLE_v10032323mg             187   4e-55   
ref|XP_011013496.1|  PREDICTED: uncharacterized protein LOC105117507    186   1e-54   Populus euphratica
ref|XP_004238803.1|  PREDICTED: uncharacterized protein LOC101267890    186   1e-54   Solanum lycopersicum
gb|KJB79984.1|  hypothetical protein B456_013G085600                    183   2e-54   Gossypium raimondii
ref|XP_007046098.1|  RING/FYVE/PHD zinc finger superfamily protei...    186   4e-54   
ref|XP_008780577.1|  PREDICTED: uncharacterized protein LOC103700...    185   4e-54   Phoenix dactylifera
ref|XP_008780583.1|  PREDICTED: uncharacterized protein LOC103700...    185   4e-54   Phoenix dactylifera
ref|XP_002315052.1|  zinc finger family protein                         185   4e-54   Populus trichocarpa [western balsam poplar]
gb|KJB79979.1|  hypothetical protein B456_013G085600                    184   5e-54   Gossypium raimondii
gb|KJB79983.1|  hypothetical protein B456_013G085600                    184   5e-54   Gossypium raimondii
ref|XP_002522435.1|  membrane associated ring finger 1,8, putative      184   7e-54   Ricinus communis
gb|EPS60115.1|  hypothetical protein M569_14689                         180   7e-54   Genlisea aurea
gb|KJB79981.1|  hypothetical protein B456_013G085600                    183   1e-53   Gossypium raimondii
ref|XP_009773410.1|  PREDICTED: uncharacterized protein LOC104223638    184   1e-53   Nicotiana sylvestris
ref|XP_010939492.1|  PREDICTED: uncharacterized protein LOC105058...    183   1e-53   Elaeis guineensis
ref|XP_010939493.1|  PREDICTED: uncharacterized protein LOC105058...    184   1e-53   
ref|XP_007046099.1|  RING/FYVE/PHD zinc finger superfamily protei...    182   2e-53   
gb|KHG27428.1|  E3 ubiquitin-protein ligase MARCH3                      183   2e-53   Gossypium arboreum [tree cotton]
ref|XP_004159987.1|  PREDICTED: uncharacterized LOC101203306            183   4e-53   
ref|XP_008802607.1|  PREDICTED: uncharacterized protein LOC103716403    181   1e-52   Phoenix dactylifera
gb|KHG27429.1|  March3                                                  182   2e-52   Gossypium arboreum [tree cotton]
ref|XP_010258346.1|  PREDICTED: uncharacterized protein LOC104598128    181   2e-52   Nelumbo nucifera [Indian lotus]
ref|XP_004297302.1|  PREDICTED: uncharacterized protein LOC101305065    180   2e-52   Fragaria vesca subsp. vesca
emb|CDP20951.1|  unnamed protein product                                180   6e-52   Coffea canephora [robusta coffee]
ref|XP_010937150.1|  PREDICTED: uncharacterized protein LOC105056595    179   8e-52   Elaeis guineensis
ref|XP_006440600.1|  hypothetical protein CICLE_v10021492mg             177   1e-51   
ref|XP_004138916.1|  PREDICTED: uncharacterized protein LOC101203306    179   1e-51   Cucumis sativus [cucumbers]
ref|XP_003577386.1|  PREDICTED: uncharacterized protein LOC100843600    178   2e-51   Brachypodium distachyon [annual false brome]
ref|XP_006477456.1|  PREDICTED: uncharacterized protein LOC102627...    178   2e-51   Citrus sinensis [apfelsine]
ref|XP_002284912.1|  PREDICTED: uncharacterized protein LOC100250124    178   2e-51   Vitis vinifera
tpg|DAA40086.1|  TPA: hypothetical protein ZEAMMB73_046641              176   2e-51   
ref|XP_008441710.1|  PREDICTED: uncharacterized protein LOC103485788    177   5e-51   Cucumis melo [Oriental melon]
ref|XP_006440601.1|  hypothetical protein CICLE_v10021492mg             177   6e-51   Citrus clementina [clementine]
ref|XP_006605567.1|  PREDICTED: uncharacterized protein LOC100817542    177   6e-51   Glycine max [soybeans]
ref|XP_011017093.1|  PREDICTED: uncharacterized protein LOC105120538    176   7e-51   Populus euphratica
ref|XP_006395746.1|  hypothetical protein EUTSA_v10004698mg             177   7e-51   Eutrema salsugineum [saltwater cress]
ref|XP_002312245.1|  zinc finger family protein                         176   1e-50   Populus trichocarpa [western balsam poplar]
ref|XP_004956801.1|  PREDICTED: uncharacterized protein LOC101773583    176   1e-50   Setaria italica
ref|NP_001150513.1|  LOC100284144                                       176   1e-50   Zea mays [maize]
gb|ACG39364.1|  protein binding protein                                 176   1e-50   Zea mays [maize]
ref|XP_008239941.1|  PREDICTED: uncharacterized protein LOC103338510    176   1e-50   Prunus mume [ume]
emb|CDY03025.1|  BnaC07g22020D                                          176   1e-50   
dbj|BAJ89773.1|  predicted protein                                      176   2e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009369292.1|  PREDICTED: uncharacterized protein LOC103958715    175   3e-50   Pyrus x bretschneideri [bai li]
ref|XP_009587067.1|  PREDICTED: uncharacterized protein LOC104084...    175   4e-50   
ref|XP_010029833.1|  PREDICTED: uncharacterized protein LOC104419767    174   5e-50   Eucalyptus grandis [rose gum]
ref|XP_009800764.1|  PREDICTED: uncharacterized protein LOC104246...    174   8e-50   Nicotiana sylvestris
ref|XP_009339242.1|  PREDICTED: uncharacterized protein LOC103931466    173   1e-49   Pyrus x bretschneideri [bai li]
ref|XP_009403166.1|  PREDICTED: uncharacterized protein LOC103986795    173   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010097611.1|  E3 ubiquitin-protein ligase MARCH3                 174   2e-49   Morus notabilis
ref|XP_004509969.1|  PREDICTED: uncharacterized protein LOC101495932    173   2e-49   Cicer arietinum [garbanzo]
ref|XP_009800765.1|  PREDICTED: uncharacterized protein LOC104246...    172   2e-49   Nicotiana sylvestris
ref|XP_002273832.1|  PREDICTED: uncharacterized protein LOC100256824    172   2e-49   Vitis vinifera
gb|KHN28147.1|  E3 ubiquitin-protein ligase MARCH3                      171   2e-49   Glycine soja [wild soybean]
ref|XP_003578110.1|  PREDICTED: uncharacterized protein LOC100834851    172   2e-49   Brachypodium distachyon [annual false brome]
ref|XP_006354779.1|  PREDICTED: uncharacterized protein LOC102584...    173   3e-49   Solanum tuberosum [potatoes]
ref|XP_008339898.1|  PREDICTED: uncharacterized protein LOC103402...    172   3e-49   
ref|XP_008339901.1|  PREDICTED: uncharacterized protein LOC103402...    172   3e-49   
ref|XP_006354777.1|  PREDICTED: uncharacterized protein LOC102584...    172   3e-49   Solanum tuberosum [potatoes]
ref|XP_006583965.1|  PREDICTED: uncharacterized protein LOC100814...    171   3e-49   
emb|CBI31954.3|  unnamed protein product                                179   4e-49   Vitis vinifera
ref|XP_004299359.1|  PREDICTED: uncharacterized protein LOC101304869    172   4e-49   Fragaria vesca subsp. vesca
ref|XP_009360339.1|  PREDICTED: uncharacterized protein LOC103950823    172   4e-49   
ref|XP_006291580.1|  hypothetical protein CARUB_v10017735mg             172   4e-49   
ref|XP_010425071.1|  PREDICTED: uncharacterized protein LOC104710208    172   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008784037.1|  PREDICTED: uncharacterized protein LOC103703101    172   4e-49   Phoenix dactylifera
ref|XP_010514065.1|  PREDICTED: uncharacterized protein LOC104790065    172   5e-49   Camelina sativa [gold-of-pleasure]
ref|XP_004241583.1|  PREDICTED: uncharacterized protein LOC101254...    172   6e-49   Solanum lycopersicum
ref|XP_008389465.1|  PREDICTED: uncharacterized protein LOC103451...    172   7e-49   
ref|XP_008389466.1|  PREDICTED: uncharacterized protein LOC103451...    171   7e-49   
ref|XP_010322568.1|  PREDICTED: uncharacterized protein LOC101254...    172   8e-49   Solanum lycopersicum
ref|XP_006583964.1|  PREDICTED: uncharacterized protein LOC100814...    171   9e-49   
ref|XP_008221617.1|  PREDICTED: uncharacterized protein LOC103321578    171   1e-48   Prunus mume [ume]
ref|XP_010044750.1|  PREDICTED: uncharacterized protein LOC104433...    171   1e-48   Eucalyptus grandis [rose gum]
gb|KCW86856.1|  hypothetical protein EUGRSUZ_B03447                     170   1e-48   Eucalyptus grandis [rose gum]
ref|XP_009587066.1|  PREDICTED: uncharacterized protein LOC104084...    171   1e-48   Nicotiana tomentosiformis
ref|XP_008446351.1|  PREDICTED: uncharacterized protein LOC103489118    171   2e-48   Cucumis melo [Oriental melon]
gb|KJB50917.1|  hypothetical protein B456_008G193100                    171   2e-48   Gossypium raimondii
gb|AJK93584.1|  RING/FYVE/PHD zinc finger superfamily protein           170   2e-48   Suaeda glauca
ref|XP_010527903.1|  PREDICTED: uncharacterized protein LOC104805161    171   2e-48   
ref|XP_006364596.1|  PREDICTED: uncharacterized protein LOC102599897    171   2e-48   Solanum tuberosum [potatoes]
ref|XP_002514758.1|  membrane associated ring finger 1,8, putative      171   2e-48   Ricinus communis
ref|XP_009395958.1|  PREDICTED: uncharacterized protein LOC103981...    170   3e-48   
ref|XP_009800763.1|  PREDICTED: uncharacterized protein LOC104246...    171   3e-48   Nicotiana sylvestris
ref|XP_010044749.1|  PREDICTED: uncharacterized protein LOC104433...    170   4e-48   Eucalyptus grandis [rose gum]
ref|XP_009395955.1|  PREDICTED: uncharacterized protein LOC103981...    170   4e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH19720.1|  RING/FYVE/PHD zinc finger protein                       169   4e-48   Medicago truncatula
ref|XP_007222594.1|  hypothetical protein PRUPE_ppa009881mg             169   5e-48   
ref|XP_008374545.1|  PREDICTED: uncharacterized protein LOC103437820    168   1e-47   Malus domestica [apple tree]
gb|KCW86855.1|  hypothetical protein EUGRSUZ_B03447                     169   2e-47   Eucalyptus grandis [rose gum]
ref|NP_001061887.1|  Os08g0436200                                       167   2e-47   
ref|XP_010554312.1|  PREDICTED: uncharacterized protein LOC104824079    168   2e-47   Tarenaya hassleriana [spider flower]
ref|XP_006417033.1|  hypothetical protein EUTSA_v10008459mg             167   3e-47   Eutrema salsugineum [saltwater cress]
ref|XP_010678518.1|  PREDICTED: uncharacterized protein LOC104894048    167   4e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009614787.1|  PREDICTED: uncharacterized protein LOC104107639    167   4e-47   Nicotiana tomentosiformis
ref|NP_850667.1|  RING/FYVE/PHD zinc finger superfamily protein         165   4e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67520.1|  BnaAnng24500D                                          167   4e-47   Brassica napus [oilseed rape]
ref|XP_006659436.1|  PREDICTED: uncharacterized protein LOC102716...    166   8e-47   
ref|XP_006659437.1|  PREDICTED: uncharacterized protein LOC102716...    166   9e-47   
ref|XP_008393160.1|  PREDICTED: uncharacterized protein LOC103455354    166   1e-46   
ref|NP_850668.1|  RING/FYVE/PHD zinc finger superfamily protein         165   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683185.1|  PREDICTED: uncharacterized protein LOC104897916    165   1e-46   
ref|XP_010257454.1|  PREDICTED: uncharacterized protein LOC104597545    165   2e-46   Nelumbo nucifera [Indian lotus]
ref|NP_178396.1|  RING/FYVE/PHD zinc finger-containing protein          165   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009796377.1|  PREDICTED: uncharacterized protein LOC104242...    165   2e-46   Nicotiana sylvestris
gb|KDP31254.1|  hypothetical protein JCGZ_11630                         166   2e-46   Jatropha curcas
ref|XP_004952876.1|  PREDICTED: uncharacterized protein LOC101767...    164   2e-46   Setaria italica
emb|CDY45188.1|  BnaA06g33920D                                          165   2e-46   Brassica napus [oilseed rape]
ref|XP_004135456.1|  PREDICTED: uncharacterized protein LOC101205076    165   3e-46   Cucumis sativus [cucumbers]
ref|XP_009130216.1|  PREDICTED: uncharacterized protein LOC103855008    164   4e-46   Brassica rapa
ref|XP_004235988.1|  PREDICTED: uncharacterized protein LOC101260808    165   4e-46   Solanum lycopersicum
ref|XP_009796375.1|  PREDICTED: uncharacterized protein LOC104242...    165   4e-46   Nicotiana sylvestris
ref|XP_010458939.1|  PREDICTED: uncharacterized protein LOC104740106    165   5e-46   Camelina sativa [gold-of-pleasure]
ref|NP_190339.1|  RING/FYVE/PHD zinc finger superfamily protein         164   6e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973407.1|  RING/FYVE/PHD zinc finger-containing protein          163   8e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KJB39912.1|  hypothetical protein B456_007G037500                    160   9e-46   Gossypium raimondii
ref|XP_009152224.1|  PREDICTED: uncharacterized protein LOC103875455    163   1e-45   Brassica rapa
ref|XP_004155388.1|  PREDICTED: uncharacterized protein LOC101228402    165   1e-45   
ref|XP_007037351.1|  RING/FYVE/PHD zinc finger superfamily protei...    163   1e-45   
ref|XP_007037352.1|  RING/FYVE/PHD zinc finger superfamily protei...    162   2e-45   
ref|XP_004137411.1|  PREDICTED: uncharacterized protein LOC101217964    162   2e-45   Cucumis sativus [cucumbers]
ref|XP_008442459.1|  PREDICTED: uncharacterized protein LOC103486295    162   2e-45   Cucumis melo [Oriental melon]
gb|KJB39913.1|  hypothetical protein B456_007G037500                    162   2e-45   Gossypium raimondii
gb|KFK34055.1|  hypothetical protein AALP_AA5G096200                    163   3e-45   Arabis alpina [alpine rockcress]
gb|EAY86410.1|  hypothetical protein OsI_07789                          160   4e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_010502308.1|  PREDICTED: uncharacterized protein LOC104779627    161   4e-45   Camelina sativa [gold-of-pleasure]
ref|NP_001047219.1|  Os02g0577100                                       160   6e-45   
ref|XP_006280868.1|  hypothetical protein CARUB_v10026858mg             161   7e-45   
emb|CDY33757.1|  BnaA09g45630D                                          160   8e-45   Brassica napus [oilseed rape]
ref|XP_002876853.1|  zinc finger family protein                         160   8e-45   
ref|XP_003575220.1|  PREDICTED: uncharacterized protein LOC100838110    160   9e-45   Brachypodium distachyon [annual false brome]
ref|XP_006306327.1|  hypothetical protein CARUB_v10012202mg             160   1e-44   Capsella rubella
ref|XP_007158651.1|  hypothetical protein PHAVU_002G170900g             160   1e-44   Phaseolus vulgaris [French bean]
gb|KJB39911.1|  hypothetical protein B456_007G037500                    162   1e-44   Gossypium raimondii
ref|XP_006647414.1|  PREDICTED: uncharacterized protein LOC102704395    159   1e-44   Oryza brachyantha
gb|AFW62739.1|  hypothetical protein ZEAMMB73_991282                    157   2e-44   
ref|XP_009117914.1|  PREDICTED: uncharacterized protein LOC103842978    158   5e-44   Brassica rapa
gb|EEE68755.1|  hypothetical protein OsJ_27447                          159   7e-44   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147728.1|  protein binding protein                            157   8e-44   
ref|NP_001152950.1|  protein binding protein                            157   9e-44   Zea mays [maize]
emb|CDX81628.1|  BnaC08g39730D                                          157   1e-43   
ref|NP_001131973.1|  uncharacterized protein LOC100193371               158   1e-43   Zea mays [maize]
ref|XP_010426199.1|  PREDICTED: uncharacterized protein LOC104711219    157   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006659438.1|  PREDICTED: uncharacterized protein LOC102716...    156   2e-43   
ref|XP_008676546.1|  PREDICTED: uncharacterized protein LOC100193...    159   2e-43   Zea mays [maize]
ref|XP_004979617.1|  PREDICTED: uncharacterized protein LOC101786...    157   3e-43   Setaria italica
gb|ABR16909.1|  unknown                                                 157   3e-43   Picea sitchensis
ref|XP_002864796.1|  hypothetical protein ARALYDRAFT_496422             156   6e-43   
ref|XP_006291602.1|  hypothetical protein CARUB_v10017756mg             155   1e-42   Capsella rubella
gb|AAM61387.1|  nucleoside triphosphatase, putative                     155   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007037350.1|  RING/FYVE/PHD zinc finger superfamily protei...    156   1e-42   
ref|XP_008643782.1|  PREDICTED: protein binding protein isoform X1      154   2e-42   Zea mays [maize]
ref|NP_001150855.1|  protein binding protein                            154   2e-42   Zea mays [maize]
ref|XP_009771049.1|  PREDICTED: uncharacterized protein LOC104221645    154   3e-42   Nicotiana sylvestris
gb|EAZ18892.1|  hypothetical protein OsJ_34434                          155   3e-42   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001068224.1|  Os11g0600700                                       154   4e-42   
ref|XP_006404365.1|  hypothetical protein EUTSA_v10010967mg             154   5e-42   Eutrema salsugineum [saltwater cress]
ref|XP_002875846.1|  zinc finger family protein                         153   1e-41   Arabidopsis lyrata subsp. lyrata
ref|NP_172878.1|  RING-variant domain-containing protein                152   1e-41   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42747.1|  unknown protein                                        152   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007210032.1|  hypothetical protein PRUPE_ppa019151mg             152   1e-41   
ref|XP_010483957.1|  PREDICTED: uncharacterized protein LOC104762381    153   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010444094.1|  PREDICTED: uncharacterized protein LOC104726...    153   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010550603.1|  PREDICTED: uncharacterized protein LOC104821422    152   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_010503357.1|  PREDICTED: uncharacterized protein LOC104780556    152   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010444093.1|  PREDICTED: uncharacterized protein LOC104726...    153   3e-41   Camelina sativa [gold-of-pleasure]
gb|KHG30735.1|  E3 ubiquitin-protein ligase MARCH2                      152   6e-41   Gossypium arboreum [tree cotton]
emb|CDY47401.1|  BnaCnng15100D                                          150   8e-41   Brassica napus [oilseed rape]
emb|CDY00288.1|  BnaA06g21890D                                          150   1e-40   
ref|XP_006394393.1|  hypothetical protein EUTSA_v10004664mg             150   1e-40   Eutrema salsugineum [saltwater cress]
gb|KCW83611.1|  hypothetical protein EUGRSUZ_B00506                     145   2e-40   Eucalyptus grandis [rose gum]
ref|XP_009151367.1|  PREDICTED: uncharacterized protein LOC103874679    149   3e-40   Brassica rapa
emb|CDY39330.1|  BnaC05g10490D                                          148   4e-40   Brassica napus [oilseed rape]
ref|NP_568953.1|  RING/FYVE/PHD zinc finger-containing protein          149   5e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495897.1|  PREDICTED: uncharacterized protein LOC104773043    147   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010458913.1|  PREDICTED: uncharacterized protein LOC104740089    147   6e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006663028.1|  PREDICTED: uncharacterized protein LOC102719334    147   9e-40   
ref|XP_010515059.1|  PREDICTED: uncharacterized protein LOC104790960    147   1e-39   Camelina sativa [gold-of-pleasure]
gb|KDO55564.1|  hypothetical protein CISIN_1g039690mg                   145   1e-39   Citrus sinensis [apfelsine]
tpg|DAA40085.1|  TPA: hypothetical protein ZEAMMB73_046641              147   1e-39   
ref|XP_008352983.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    142   1e-39   
emb|CDY21792.1|  BnaA06g20610D                                          147   2e-39   Brassica napus [oilseed rape]
gb|ADA67984.1|  RING-type E3 ubiquitin ligase                           147   2e-39   Brassica napus [oilseed rape]
ref|XP_009149902.1|  PREDICTED: uncharacterized protein LOC103873230    146   3e-39   Brassica rapa
emb|CDY65201.1|  BnaCnng45990D                                          147   4e-39   Brassica napus [oilseed rape]
emb|CDY08974.1|  BnaC08g12040D                                          143   4e-39   Brassica napus [oilseed rape]
ref|XP_004952874.1|  PREDICTED: uncharacterized protein LOC101767...    146   7e-39   
gb|AAF43925.1|AC012188_2  Contains similarity to PIT1 from Arabid...    145   9e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002966474.1|  hypothetical protein SELMODRAFT_67929              142   1e-38   
emb|CDX77863.1|  BnaC03g53560D                                          144   2e-38   
emb|CDY61272.1|  BnaA06g38610D                                          144   3e-38   Brassica napus [oilseed rape]
ref|XP_002890046.1|  hypothetical protein ARALYDRAFT_471592             142   4e-38   
ref|XP_010476475.1|  PREDICTED: uncharacterized protein LOC104755722    142   9e-38   Camelina sativa [gold-of-pleasure]
emb|CDY49102.1|  BnaA06g09040D                                          141   1e-37   Brassica napus [oilseed rape]
ref|XP_009148711.1|  PREDICTED: uncharacterized protein LOC103872120    141   1e-37   Brassica rapa
gb|ABR17862.1|  unknown                                                 141   2e-37   Picea sitchensis
gb|KHG30736.1|  hypothetical protein F383_12635                         143   9e-37   Gossypium arboreum [tree cotton]
ref|XP_010546060.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH7      140   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_006578575.1|  PREDICTED: uncharacterized protein LOC100805...    136   3e-36   Glycine max [soybeans]
gb|EPS64256.1|  zinc finger family protein                              133   5e-36   Genlisea aurea
ref|XP_006578574.1|  PREDICTED: uncharacterized protein LOC100805...    137   7e-36   Glycine max [soybeans]
ref|XP_006578573.1|  PREDICTED: uncharacterized protein LOC100805...    137   8e-36   Glycine max [soybeans]
ref|XP_006578572.1|  PREDICTED: uncharacterized protein LOC100805...    137   1e-35   
gb|KHN32528.1|  hypothetical protein glysoja_041264                     137   1e-35   Glycine soja [wild soybean]
gb|EPS73951.1|  hypothetical protein M569_00809                         134   1e-35   Genlisea aurea
ref|XP_010091521.1|  E3 ubiquitin-protein ligase MARCH4                 135   3e-35   
ref|XP_008243441.1|  PREDICTED: uncharacterized protein LOC103341682    130   3e-34   
ref|XP_006581971.1|  PREDICTED: probable E3 ubiquitin ligase SUD1       130   4e-34   
gb|KHN30844.1|  hypothetical protein glysoja_034868                     132   7e-34   Glycine soja [wild soybean]
ref|XP_006837217.1|  hypothetical protein AMTR_s00105p00126340          132   8e-34   Amborella trichopoda
ref|XP_007222878.1|  hypothetical protein PRUPE_ppa009956mg             131   1e-33   Prunus persica
ref|XP_011070658.1|  PREDICTED: uncharacterized protein LOC105156...    130   2e-33   Sesamum indicum [beniseed]
ref|XP_011070656.1|  PREDICTED: uncharacterized protein LOC105156...    130   3e-33   
ref|XP_006478622.1|  PREDICTED: uncharacterized protein LOC102616...    129   1e-32   Citrus sinensis [apfelsine]
ref|XP_006478623.1|  PREDICTED: uncharacterized protein LOC102616...    128   1e-32   Citrus sinensis [apfelsine]
ref|XP_010243775.1|  PREDICTED: uncharacterized protein LOC104587750    128   1e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006364806.1|  PREDICTED: uncharacterized protein LOC102588122    128   2e-32   
gb|KDP44246.1|  hypothetical protein JCGZ_05713                         126   2e-32   Jatropha curcas
ref|XP_009356170.1|  PREDICTED: uncharacterized protein LOC103947055    128   2e-32   Pyrus x bretschneideri [bai li]
gb|KDP34978.1|  hypothetical protein JCGZ_09266                         128   2e-32   Jatropha curcas
gb|KDO64031.1|  hypothetical protein CISIN_1g037907mg                   128   2e-32   Citrus sinensis [apfelsine]
ref|XP_010254599.1|  PREDICTED: uncharacterized protein LOC104595...    127   4e-32   Nelumbo nucifera [Indian lotus]
ref|XP_011091566.1|  PREDICTED: uncharacterized protein LOC105171966    126   6e-32   Sesamum indicum [beniseed]
gb|KJB50654.1|  hypothetical protein B456_008G181000                    126   9e-32   Gossypium raimondii
ref|XP_004297345.1|  PREDICTED: uncharacterized protein LOC101292888    126   1e-31   Fragaria vesca subsp. vesca
ref|XP_010672410.1|  PREDICTED: uncharacterized protein LOC104888...    125   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006355779.1|  PREDICTED: uncharacterized protein LOC102604544    125   1e-31   Solanum tuberosum [potatoes]
ref|XP_010672411.1|  PREDICTED: uncharacterized protein LOC104888...    125   1e-31   
gb|KHG21423.1|  ERAD-associated E3 ubiquitin-protein ligase doa[2]0     125   2e-31   Gossypium arboreum [tree cotton]
ref|XP_006442820.1|  hypothetical protein CICLE_v10021736mg             125   2e-31   Citrus clementina [clementine]
ref|XP_007045063.1|  RING/FYVE/PHD zinc finger superfamily protei...    125   2e-31   Theobroma cacao [chocolate]
gb|KJB15495.1|  hypothetical protein B456_002G181200                    125   2e-31   Gossypium raimondii
ref|XP_007138180.1|  hypothetical protein PHAVU_009G187100g             125   3e-31   Phaseolus vulgaris [French bean]
ref|XP_007138181.1|  hypothetical protein PHAVU_009G187100g             125   3e-31   Phaseolus vulgaris [French bean]
ref|XP_010660070.1|  PREDICTED: uncharacterized protein LOC100259...    124   4e-31   Vitis vinifera
gb|EYU36694.1|  hypothetical protein MIMGU_mgv1a012462mg                124   5e-31   Erythranthe guttata [common monkey flower]
gb|KJB30843.1|  hypothetical protein B456_005G163500                    124   6e-31   Gossypium raimondii
emb|CDY57563.1|  BnaCnng32140D                                          120   7e-31   Brassica napus [oilseed rape]
ref|XP_009772052.1|  PREDICTED: uncharacterized protein LOC104222520    124   7e-31   Nicotiana sylvestris
ref|XP_008350848.1|  PREDICTED: uncharacterized protein LOC103414227    124   7e-31   
gb|KJB30842.1|  hypothetical protein B456_005G163500                    124   7e-31   
ref|XP_006468818.1|  PREDICTED: uncharacterized protein LOC102626...    124   8e-31   
ref|XP_006448307.1|  hypothetical protein CICLE_v10016251mg             124   9e-31   
ref|XP_006468816.1|  PREDICTED: uncharacterized protein LOC102626...    124   9e-31   
ref|XP_009776076.1|  PREDICTED: uncharacterized protein LOC104225893    123   1e-30   
ref|XP_008339582.1|  PREDICTED: uncharacterized protein LOC103402618    123   1e-30   
ref|XP_008806276.1|  PREDICTED: uncharacterized protein LOC103719010    123   2e-30   
ref|XP_009607417.1|  PREDICTED: uncharacterized protein LOC104101...    122   2e-30   
ref|XP_011002850.1|  PREDICTED: uncharacterized protein LOC105109...    122   2e-30   
ref|XP_011002851.1|  PREDICTED: uncharacterized protein LOC105109...    122   3e-30   
ref|XP_009607418.1|  PREDICTED: uncharacterized protein LOC104101...    122   3e-30   
gb|AIY53276.1|  zinc finger protein                                     121   4e-30   
ref|XP_008389994.1|  PREDICTED: uncharacterized protein LOC103452258    123   4e-30   
ref|XP_007033119.1|  RING/FYVE/PHD zinc finger superfamily protein      123   5e-30   
ref|XP_009610708.1|  PREDICTED: uncharacterized protein LOC104104351    122   5e-30   
ref|XP_004244754.1|  PREDICTED: uncharacterized protein LOC101251013    121   6e-30   
ref|XP_002534507.1|  membrane associated ring finger 1,8, putative      121   6e-30   
gb|KCW64625.1|  hypothetical protein EUGRSUZ_G02211                     120   6e-30   
ref|XP_006376436.1|  hypothetical protein POPTR_0013s13030g             122   7e-30   
ref|XP_011037396.1|  PREDICTED: uncharacterized protein LOC105134...    120   8e-30   
ref|XP_002530590.1|  membrane associated ring finger 1,8, putative      123   9e-30   
ref|XP_004496990.1|  PREDICTED: uncharacterized protein LOC101496313    121   1e-29   
ref|XP_006344211.1|  PREDICTED: uncharacterized protein LOC102602348    120   2e-29   
gb|KHG19119.1|  E3 ubiquitin-protein ligase MARCH2                      120   2e-29   
gb|KDP22672.1|  hypothetical protein JCGZ_02514                         120   2e-29   
ref|XP_010660002.1|  PREDICTED: uncharacterized protein LOC100259...    120   2e-29   
ref|XP_010659955.1|  PREDICTED: uncharacterized protein LOC100259...    120   2e-29   
emb|CBI26931.3|  unnamed protein product                                120   2e-29   
ref|XP_010066654.1|  PREDICTED: uncharacterized protein LOC104453736    120   2e-29   
gb|KHG02935.1|  E3 ubiquitin-protein ligase MARCH8                      119   2e-29   
gb|KEH44137.1|  RING/FYVE/PHD zinc finger protein                       118   3e-29   
ref|XP_006482169.1|  PREDICTED: uncharacterized protein LOC102615...    119   3e-29   
ref|XP_004150858.1|  PREDICTED: uncharacterized protein LOC101213226    119   4e-29   
ref|XP_006482167.1|  PREDICTED: uncharacterized protein LOC102615...    119   4e-29   
gb|KDO63160.1|  hypothetical protein CISIN_1g023641mg                   117   4e-29   
ref|XP_010254994.1|  PREDICTED: uncharacterized protein LOC104595...    118   5e-29   
ref|XP_008467135.1|  PREDICTED: uncharacterized protein LOC103504...    120   5e-29   
gb|KHN42395.1|  E3 ubiquitin-protein ligase MARCH3                      119   5e-29   
ref|XP_008790604.1|  PREDICTED: uncharacterized protein LOC103707761    118   6e-29   
ref|XP_004238863.1|  PREDICTED: uncharacterized protein LOC101260726    119   6e-29   
emb|CBI24671.3|  unnamed protein product                                117   6e-29   
ref|XP_010923913.1|  PREDICTED: uncharacterized protein LOC105046...    119   7e-29   
ref|XP_003592556.1|  E3 ubiquitin-protein ligase MARCH2                 119   7e-29   
ref|XP_010923907.1|  PREDICTED: uncharacterized protein LOC105046...    119   7e-29   
gb|KDO63159.1|  hypothetical protein CISIN_1g023641mg                   118   8e-29   
gb|KDO63154.1|  hypothetical protein CISIN_1g023641mg                   118   9e-29   
gb|KDO63158.1|  hypothetical protein CISIN_1g023641mg                   118   9e-29   
ref|XP_009396349.1|  PREDICTED: uncharacterized protein LOC103981359    118   1e-28   
ref|XP_006858891.1|  hypothetical protein AMTR_s00066p00203490          117   1e-28   
gb|KDO64739.1|  hypothetical protein CISIN_1g024200mg                   117   1e-28   
ref|NP_671763.1|  RING/FYVE/PHD zinc finger-containing protein          118   1e-28   
gb|KJB71666.1|  hypothetical protein B456_011G136400                    117   1e-28   
gb|KDO63153.1|  hypothetical protein CISIN_1g023641mg                   118   1e-28   
ref|XP_010108929.1|  E3 ubiquitin-protein ligase MARCH2                 117   1e-28   
ref|XP_004236990.1|  PREDICTED: uncharacterized protein LOC101256764    117   2e-28   
ref|XP_002314820.2|  hypothetical protein POPTR_0010s12590g             117   2e-28   
ref|XP_008788186.1|  PREDICTED: uncharacterized protein LOC103706...    117   2e-28   
ref|XP_008788185.1|  PREDICTED: uncharacterized protein LOC103706...    117   3e-28   
ref|XP_009383348.1|  PREDICTED: uncharacterized protein LOC103971117    116   3e-28   
ref|XP_011038692.1|  PREDICTED: uncharacterized protein LOC105135498    117   3e-28   
ref|XP_002312427.2|  hypothetical protein POPTR_0008s12630g             117   3e-28   
ref|XP_008467137.1|  PREDICTED: uncharacterized protein LOC103504...    117   3e-28   
ref|XP_002532634.1|  membrane associated ring finger 1,8, putative      115   4e-28   
ref|XP_007143010.1|  hypothetical protein PHAVU_007G036000g             116   4e-28   
emb|CDP00728.1|  unnamed protein product                                116   5e-28   
gb|EPS65283.1|  hypothetical protein M569_09497                         115   5e-28   
ref|XP_010923954.1|  PREDICTED: uncharacterized protein LOC105046...    116   7e-28   
ref|XP_010650714.1|  PREDICTED: uncharacterized protein LOC100254146    115   7e-28   
ref|XP_010660303.1|  PREDICTED: uncharacterized protein LOC100259...    115   7e-28   
ref|XP_006430675.1|  hypothetical protein CICLE_v10012424mg             115   8e-28   
ref|XP_009787123.1|  PREDICTED: uncharacterized protein LOC104235135    115   8e-28   
ref|XP_006430676.1|  hypothetical protein CICLE_v10012424mg             115   9e-28   
ref|XP_006430674.1|  hypothetical protein CICLE_v10012424mg             115   9e-28   
ref|XP_010039304.1|  PREDICTED: uncharacterized protein LOC104428001    115   9e-28   
ref|XP_003536639.1|  PREDICTED: uncharacterized protein LOC100792...    115   9e-28   
ref|XP_007033751.1|  RING/FYVE/PHD zinc finger superfamily protein      115   1e-27   
ref|XP_009594058.1|  PREDICTED: uncharacterized protein LOC104090623    115   1e-27   
ref|XP_006430677.1|  hypothetical protein CICLE_v10012424mg             115   1e-27   
gb|KCW46024.1|  hypothetical protein EUGRSUZ_L00001                     114   1e-27   
ref|XP_011037394.1|  PREDICTED: uncharacterized protein LOC105134...    114   2e-27   
ref|XP_010926072.1|  PREDICTED: uncharacterized protein LOC105048...    114   2e-27   
gb|KJB06539.1|  hypothetical protein B456_001G084900                    114   2e-27   
ref|XP_011037395.1|  PREDICTED: uncharacterized protein LOC105134...    114   2e-27   
ref|XP_006360421.1|  PREDICTED: uncharacterized protein LOC102582...    114   2e-27   
ref|XP_009390216.1|  PREDICTED: uncharacterized protein LOC103976654    114   3e-27   
ref|XP_010046896.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    110   3e-27   
gb|KHN06737.1|  E3 ubiquitin-protein ligase MARCH2                      114   3e-27   
ref|XP_010926071.1|  PREDICTED: uncharacterized protein LOC105048...    114   3e-27   
ref|XP_010681681.1|  PREDICTED: uncharacterized protein LOC104896612    114   3e-27   
ref|XP_008787606.1|  PREDICTED: uncharacterized protein LOC103705...    114   3e-27   
gb|KJB06538.1|  hypothetical protein B456_001G084900                    114   3e-27   
ref|XP_009388797.1|  PREDICTED: uncharacterized protein LOC103975539    114   4e-27   
ref|XP_010046895.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    110   4e-27   
ref|XP_008787604.1|  PREDICTED: uncharacterized protein LOC103705...    114   4e-27   
ref|XP_002876740.1|  zinc finger family protein                         114   5e-27   
ref|XP_010926069.1|  PREDICTED: uncharacterized protein LOC105048...    114   5e-27   
gb|EPS61887.1|  hypothetical protein M569_12907                         113   5e-27   
ref|XP_008229323.1|  PREDICTED: uncharacterized protein LOC103328694    113   6e-27   
ref|XP_010502092.1|  PREDICTED: uncharacterized protein LOC104779426    113   7e-27   
gb|EAZ09084.1|  hypothetical protein OsI_31350                          113   8e-27   
ref|XP_011075797.1|  PREDICTED: uncharacterized protein LOC105160216    113   8e-27   
ref|XP_002305850.2|  hypothetical protein POPTR_0004s09240g             113   8e-27   
ref|XP_007215830.1|  hypothetical protein PRUPE_ppa010144mg             113   8e-27   
gb|EYU44593.1|  hypothetical protein MIMGU_mgv1a011860mg                113   9e-27   
ref|XP_006292251.1|  hypothetical protein CARUB_v10018459mg             113   9e-27   
ref|XP_009418417.1|  PREDICTED: uncharacterized protein LOC103998623    113   1e-26   
ref|XP_011022996.1|  PREDICTED: uncharacterized protein LOC105124605    112   1e-26   
gb|KCW78604.1|  hypothetical protein EUGRSUZ_C00071                     111   1e-26   
ref|XP_009410748.1|  PREDICTED: uncharacterized protein LOC103992674    112   1e-26   
ref|XP_010424862.1|  PREDICTED: uncharacterized protein LOC104710032    112   2e-26   
ref|XP_010916315.1|  PREDICTED: uncharacterized protein LOC105041...    111   2e-26   
ref|XP_002270912.1|  PREDICTED: uncharacterized protein LOC100258...    112   2e-26   
ref|XP_010259330.1|  PREDICTED: uncharacterized protein LOC104598799    112   2e-26   
gb|KGN51502.1|  hypothetical protein Csa_5G571450                       111   2e-26   
ref|XP_006383364.1|  hypothetical protein POPTR_0005s14860g             111   3e-26   
ref|XP_010916308.1|  PREDICTED: uncharacterized protein LOC105041...    112   3e-26   
ref|XP_010101388.1|  hypothetical protein L484_020403                   112   3e-26   
ref|XP_009390944.1|  PREDICTED: uncharacterized protein LOC103977...    112   3e-26   
ref|XP_009390947.1|  PREDICTED: uncharacterized protein LOC103977...    112   3e-26   
ref|XP_010513840.1|  PREDICTED: uncharacterized protein LOC104789888    111   4e-26   
ref|XP_011035147.1|  PREDICTED: uncharacterized protein LOC105133046    111   4e-26   
ref|XP_006383363.1|  hypothetical protein POPTR_0005s14860g             110   4e-26   
gb|EAZ44714.1|  hypothetical protein OsJ_29344                          110   5e-26   
ref|XP_003535949.2|  PREDICTED: uncharacterized protein LOC100776501    110   6e-26   
ref|XP_010909202.1|  PREDICTED: uncharacterized protein LOC105035348    109   8e-26   
ref|XP_008811791.1|  PREDICTED: uncharacterized protein LOC103722...    110   1e-25   
ref|XP_002276790.1|  PREDICTED: uncharacterized protein LOC100249210    110   1e-25   
ref|XP_008811797.1|  PREDICTED: uncharacterized protein LOC103722...    109   1e-25   
ref|XP_009387270.1|  PREDICTED: uncharacterized protein LOC103974...    109   1e-25   
ref|XP_004140823.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    109   1e-25   
ref|XP_009387267.1|  PREDICTED: uncharacterized protein LOC103974...    109   1e-25   
ref|XP_009387269.1|  PREDICTED: uncharacterized protein LOC103974...    109   1e-25   
gb|KGN57446.1|  hypothetical protein Csa_3G186720                       109   1e-25   
ref|XP_009387268.1|  PREDICTED: uncharacterized protein LOC103974...    109   2e-25   
emb|CDY37369.1|  BnaC02g33870D                                          109   2e-25   
emb|CDY17684.1|  BnaA06g35030D                                          109   2e-25   
ref|XP_010268340.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    109   2e-25   
ref|XP_010923891.1|  PREDICTED: uncharacterized protein LOC105046...    110   2e-25   
ref|XP_010923899.1|  PREDICTED: uncharacterized protein LOC105046...    110   2e-25   
ref|XP_009101355.1|  PREDICTED: uncharacterized protein LOC103827595    109   2e-25   
gb|ACJ66654.1|  unknown protein pCav21                                  106   2e-25   
ref|XP_010268193.1|  PREDICTED: uncharacterized protein LOC104605219    108   2e-25   
emb|CDY40388.1|  BnaA02g27020D                                          109   3e-25   
ref|XP_010440907.1|  PREDICTED: uncharacterized protein LOC104724158    108   3e-25   
ref|XP_009107128.1|  PREDICTED: uncharacterized protein LOC103832791    108   3e-25   
ref|XP_009371816.1|  PREDICTED: uncharacterized protein LOC103961035    108   3e-25   
ref|XP_011097150.1|  PREDICTED: uncharacterized protein LOC105176...    108   3e-25   
ref|XP_011099499.1|  PREDICTED: uncharacterized protein LOC105177906    108   3e-25   
gb|AFK46834.1|  unknown                                                 107   5e-25   
ref|XP_010907695.1|  PREDICTED: uncharacterized protein LOC105034300    107   6e-25   
ref|XP_006574535.1|  PREDICTED: uncharacterized protein LOC100797029    107   6e-25   
emb|CDX77813.1|  BnaC07g20670D                                          108   6e-25   
ref|XP_011097148.1|  PREDICTED: uncharacterized protein LOC105176...    108   6e-25   
gb|KCW52104.1|  hypothetical protein EUGRSUZ_J01539                     108   7e-25   
ref|XP_004157210.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    105   8e-25   
gb|EPS74335.1|  hypothetical protein M569_00421                         102   9e-25   
ref|XP_011021333.1|  PREDICTED: uncharacterized protein LOC105123441    107   1e-24   
ref|XP_010268014.1|  PREDICTED: uncharacterized protein LOC104605096    107   1e-24   
dbj|BAD52455.1|  unknown protein                                        106   2e-24   
ref|NP_001041874.1|  Os01g0121200                                       107   2e-24   
ref|XP_010923921.1|  PREDICTED: uncharacterized protein LOC105046...    107   2e-24   
ref|XP_008358156.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    107   2e-24   
gb|ACG47085.1|  zinc finger protein                                     105   2e-24   
ref|XP_004970883.1|  PREDICTED: uncharacterized protein LOC101759...    105   2e-24   
ref|XP_006398516.1|  hypothetical protein EUTSA_v10001001mg             106   3e-24   
ref|XP_002981153.1|  hypothetical protein SELMODRAFT_420592             106   3e-24   
emb|CDP02728.1|  unnamed protein product                                106   3e-24   
ref|XP_010496094.1|  PREDICTED: uncharacterized protein LOC104773209    106   3e-24   
ref|XP_002870874.1|  zinc finger family protein                         106   3e-24   
ref|XP_006643709.1|  PREDICTED: uncharacterized protein LOC102702322    106   3e-24   
ref|XP_007199462.1|  hypothetical protein PRUPE_ppa027017mg             103   4e-24   
ref|XP_010660371.1|  PREDICTED: uncharacterized protein LOC100258...    105   4e-24   
gb|AES82182.2|  RING/FYVE/PHD zinc finger protein                       103   4e-24   
gb|KCW52105.1|  hypothetical protein EUGRSUZ_J01539                     105   4e-24   
ref|XP_004300461.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    105   4e-24   
gb|KHF97876.1|  E3 ubiquitin-protein ligase MARCH7                      104   5e-24   
ref|XP_004970882.1|  PREDICTED: uncharacterized protein LOC101759...    105   5e-24   
ref|XP_004968102.1|  PREDICTED: uncharacterized protein LOC101773...    105   6e-24   
ref|XP_010552002.1|  PREDICTED: uncharacterized protein LOC104822...    105   6e-24   
gb|ACJ85496.1|  unknown                                                 103   6e-24   
ref|XP_010232681.1|  PREDICTED: uncharacterized protein LOC100838...    104   6e-24   
ref|XP_009763427.1|  PREDICTED: uncharacterized protein LOC104215...    105   6e-24   
gb|AFK49536.1|  unknown                                                 104   8e-24   
ref|XP_010552011.1|  PREDICTED: uncharacterized protein LOC104822...    105   8e-24   
ref|XP_009763430.1|  PREDICTED: uncharacterized protein LOC104215...    104   9e-24   
emb|CBH32661.1|  Zinc finger, C3HC4 type (RING finger) domain con...    105   9e-24   
ref|XP_003625963.1|  E3 ubiquitin-protein ligase MARCH3                 103   1e-23   
ref|XP_003567743.1|  PREDICTED: uncharacterized protein LOC100827574    105   1e-23   
ref|XP_009380938.1|  PREDICTED: uncharacterized protein LOC103969...    104   1e-23   
ref|XP_009614974.1|  PREDICTED: uncharacterized protein LOC104107...    102   1e-23   
ref|NP_198623.1|  RING/FYVE/PHD zinc finger-containing protein          104   1e-23   
gb|ACG24835.1|  zinc finger protein                                     103   1e-23   
ref|XP_004495906.1|  PREDICTED: uncharacterized protein LOC101504360    103   1e-23   
ref|XP_004968099.1|  PREDICTED: uncharacterized protein LOC101773...    105   1e-23   
ref|XP_009380939.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    102   1e-23   
ref|XP_002275880.1|  PREDICTED: uncharacterized protein LOC100260...    103   2e-23   
ref|XP_010652236.1|  PREDICTED: uncharacterized protein LOC100260...    103   2e-23   
ref|NP_001056255.1|  Os05g0552400                                       103   2e-23   
gb|EEC79657.1|  hypothetical protein OsI_20898                          103   2e-23   
ref|XP_004968100.1|  PREDICTED: uncharacterized protein LOC101773...    104   2e-23   
ref|XP_010032660.1|  PREDICTED: uncharacterized protein LOC104422128    103   2e-23   
ref|XP_010087249.1|  E3 ubiquitin-protein ligase MARCH2                 103   2e-23   
ref|XP_011079563.1|  PREDICTED: uncharacterized protein LOC105163...    102   2e-23   
ref|XP_011079562.1|  PREDICTED: uncharacterized protein LOC105163...    102   2e-23   
ref|XP_010316073.1|  PREDICTED: uncharacterized protein LOC101248546    103   3e-23   
gb|ACN34184.1|  unknown                                                 103   3e-23   
ref|XP_010554013.1|  PREDICTED: uncharacterized protein LOC104823916    103   3e-23   
ref|XP_003564830.1|  PREDICTED: uncharacterized protein LOC100838...    102   4e-23   
ref|XP_009614971.1|  PREDICTED: uncharacterized protein LOC104107...    102   4e-23   
ref|XP_006293188.1|  hypothetical protein CARUB_v10019505mg             102   5e-23   
ref|XP_009125058.1|  PREDICTED: uncharacterized protein LOC103850...    102   5e-23   
emb|CDP10865.1|  unnamed protein product                                102   5e-23   
ref|XP_006654751.1|  PREDICTED: uncharacterized protein LOC102711155    102   5e-23   
ref|NP_001132646.1|  protein binding protein                            102   6e-23   
gb|KEH43207.1|  RING/FYVE/PHD zinc finger protein                       102   6e-23   
ref|XP_007216224.1|  hypothetical protein PRUPE_ppa016732mg           99.8    6e-23   
ref|XP_008341754.1|  PREDICTED: E3 ubiquitin-protein ligase MARCH...    101   6e-23   
ref|XP_006645157.1|  PREDICTED: uncharacterized protein LOC102705677    102   6e-23   
gb|KJB41820.1|  hypothetical protein B456_007G123200                    102   7e-23   
emb|CDY47868.1|  BnaA07g14130D                                          102   7e-23   



>ref|XP_011075501.1| PREDICTED: uncharacterized protein LOC105159964 [Sesamum indicum]
 ref|XP_011075502.1| PREDICTED: uncharacterized protein LOC105159964 [Sesamum indicum]
Length=286

 Score =   218 bits (555),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 132/168 (79%), Gaps = 8/168 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTD--EVGSGLPVD-GAKHIEKKTESAGTSSSAVVED-KVVGMGKEK  247
            MGE+ VVN +QL K++  E    +P+  G     KK E  G+SSS   ED KVV +    
Sbjct  1    MGENLVVNVNQLPKSEAGEPSQQVPLAVGCGPNGKKPEMVGSSSSMASEDDKVVVI---V  57

Query  248  DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
            D EVADEEAPLIG+ ECRICQEEDS+ NLE+PCACSGSLKYAHRKCVQ+WCNEKGDITCE
Sbjct  58   DNEVADEEAPLIGMGECRICQEEDSLTNLESPCACSGSLKYAHRKCVQYWCNEKGDITCE  117

Query  428  ICHQPYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIAE  568
            ICHQ YQPGYTAPPR   +ETTIDIGG WQISGTPLD+HDPRLLAIAE
Sbjct  118  ICHQSYQPGYTAPPRPPSDETTIDIGGVWQISGTPLDMHDPRLLAIAE  165



>ref|XP_011070995.1| PREDICTED: uncharacterized protein LOC105156535 [Sesamum indicum]
 ref|XP_011070996.1| PREDICTED: uncharacterized protein LOC105156535 [Sesamum indicum]
Length=297

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 126/167 (75%), Gaps = 6/167 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIE---KKTESAGTSSSAVVEDKVVGMGKEKD  250
            MGEH VVN DQL K + VG   PV  A       KK E  G+SSS   ED    +    D
Sbjct  1    MGEHLVVNVDQLPKPEAVGPSEPVPWAMEFAPTGKKPELVGSSSSTASEDDK--VVVVVD  58

Query  251  IEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  430
             + ADE+APLIG+ ECRICQEEDS+KNLE+PCACSGSLKYAHRKCVQHWCNEKGDITCEI
Sbjct  59   NDDADEKAPLIGMGECRICQEEDSLKNLESPCACSGSLKYAHRKCVQHWCNEKGDITCEI  118

Query  431  CHQPYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIAE  568
            CHQPYQPG+TAPPR   +E ++DIGG WQISG PLD+HDPRLLAI E
Sbjct  119  CHQPYQPGFTAPPRPPSDEASVDIGGVWQISGAPLDMHDPRLLAITE  165



>ref|XP_009590050.1| PREDICTED: uncharacterized protein LOC104087321 isoform X2 [Nicotiana 
tomentosiformis]
Length=294

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 126/164 (77%), Gaps = 7/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MGEH VVN D++V  D    G  V  A    KK +  G SSS  V++K +     ++ E 
Sbjct  1    MGEHLVVNDDRVVNPD---GGETVQIAVENRKKPDVGGPSSSKTVKEKEL---AVEEEEE  54

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            A+EE PLIG  ECRICQ+EDS+ NLE+PCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ
Sbjct  55   ANEEVPLIGNAECRICQDEDSLNNLESPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  114

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR+QPEET IDI GGWQI+GTPLDLHDPR LAI E
Sbjct  115  PYQPGYTAPPRAQPEETIIDIGGGWQIAGTPLDLHDPRFLAIRE  158



>ref|XP_009590038.1| PREDICTED: uncharacterized protein LOC104087321 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590046.1| PREDICTED: uncharacterized protein LOC104087321 isoform X1 [Nicotiana 
tomentosiformis]
Length=295

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 126/164 (77%), Gaps = 7/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MGEH VVN D++V  D    G  V  A    KK +  G SSS  V++K +     ++ E 
Sbjct  1    MGEHLVVNDDRVVNPD---GGETVQIAVENRKKPDVGGPSSSKTVKEKEL---AVEEEEE  54

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            A+EE PLIG  ECRICQ+EDS+ NLE+PCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ
Sbjct  55   ANEEVPLIGNAECRICQDEDSLNNLESPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  114

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR+QPEET IDI GGWQI+GTPLDLHDPR LAI E
Sbjct  115  PYQPGYTAPPRAQPEETIIDIGGGWQIAGTPLDLHDPRFLAIRE  158



>ref|XP_009765410.1| PREDICTED: uncharacterized protein LOC104216961 isoform X3 [Nicotiana 
sylvestris]
Length=295

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 122/164 (74%), Gaps = 7/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MGEH VVN D++V  D    G  V  A    KK E  G SSS   +         ++ E 
Sbjct  1    MGEHLVVNDDRVVNPD---GGETVQIAVENRKKPEVEGPSSS---KTGKEKELAMEEEEE  54

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            A+EE PLIG  ECRICQ+EDS+ NLE+PCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ
Sbjct  55   ANEEVPLIGNAECRICQDEDSLNNLESPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  114

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR+QPEET IDI GGWQI+GTPLDLHDPR LAI E
Sbjct  115  PYQPGYTAPPRAQPEETIIDIGGGWQIAGTPLDLHDPRFLAIRE  158



>ref|XP_009765409.1| PREDICTED: uncharacterized protein LOC104216961 isoform X2 [Nicotiana 
sylvestris]
Length=296

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 122/164 (74%), Gaps = 7/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MGEH VVN D++V  D    G  V  A    KK E  G SSS   +         ++ E 
Sbjct  1    MGEHLVVNDDRVVNPD---GGETVQIAVENRKKPEVEGPSSS---KTGKEKELAMEEEEE  54

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            A+EE PLIG  ECRICQ+EDS+ NLE+PCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ
Sbjct  55   ANEEVPLIGNAECRICQDEDSLNNLESPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  114

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR+QPEET IDI GGWQI+GTPLDLHDPR LAI E
Sbjct  115  PYQPGYTAPPRAQPEETIIDIGGGWQIAGTPLDLHDPRFLAIRE  158



>ref|XP_009765411.1| PREDICTED: uncharacterized protein LOC104216961 isoform X4 [Nicotiana 
sylvestris]
Length=294

 Score =   205 bits (522),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 122/164 (74%), Gaps = 7/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MGEH VVN D++V  D    G  V  A    KK E  G SSS   +         ++ E 
Sbjct  1    MGEHLVVNDDRVVNPD---GGETVQIAVENRKKPEVEGPSSS---KTGKEKELAMEEEEE  54

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            A+EE PLIG  ECRICQ+EDS+ NLE+PCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ
Sbjct  55   ANEEVPLIGNAECRICQDEDSLNNLESPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  114

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR+QPEET IDI GGWQI+GTPLDLHDPR LAI E
Sbjct  115  PYQPGYTAPPRAQPEETIIDIGGGWQIAGTPLDLHDPRFLAIRE  158



>ref|XP_009765407.1| PREDICTED: uncharacterized protein LOC104216961 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009765408.1| PREDICTED: uncharacterized protein LOC104216961 isoform X1 [Nicotiana 
sylvestris]
Length=297

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 122/164 (74%), Gaps = 7/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MGEH VVN D++V  D    G  V  A    KK E  G SSS   +         ++ E 
Sbjct  1    MGEHLVVNDDRVVNPD---GGETVQIAVENRKKPEVEGPSSS---KTGKEKELAMEEEEE  54

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            A+EE PLIG  ECRICQ+EDS+ NLE+PCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ
Sbjct  55   ANEEVPLIGNAECRICQDEDSLNNLESPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  114

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR+QPEET IDI GGWQI+GTPLDLHDPR LAI E
Sbjct  115  PYQPGYTAPPRAQPEETIIDIGGGWQIAGTPLDLHDPRFLAIRE  158



>gb|EYU28755.1| hypothetical protein MIMGU_mgv1a010687mg [Erythranthe guttata]
Length=305

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 124/166 (75%), Gaps = 6/166 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSS--AVVEDKVVGMGKEKDI  253
            MG+H VVN +QL K++ V     V       KK E  G++SS  AV  DKVV      D 
Sbjct  1    MGDHLVVNVNQLPKSEAVEPSQSVSHFGDFGKKPEMMGSTSSLAAVENDKVV---VVVDH  57

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
            E  DE+APL+ + ECRICQEEDS+ NLE+PCACSGSLKYAHRKCVQ+WCNEKGD TCEIC
Sbjct  58   EEPDEDAPLLDMGECRICQEEDSLNNLESPCACSGSLKYAHRKCVQYWCNEKGDTTCEIC  117

Query  434  HQPYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIAE  568
            H+ YQ GYTA PR  P+ETTIDIGG WQISGTPLD+HDPRLLAIAE
Sbjct  118  HKQYQSGYTAIPRPPPDETTIDIGGVWQISGTPLDMHDPRLLAIAE  163



>gb|KDP41198.1| hypothetical protein JCGZ_15605 [Jatropha curcas]
Length=285

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 122/166 (73%), Gaps = 10/166 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDK-VVGMGKEKDIE  256
            M +H V+  D+L++        PV+     +    +AG S S   E+    G+GKE++ E
Sbjct  1    MSDHVVLYVDRLIRP-------PVEAEADHKPVEAAAGPSCSRPDEETDSAGLGKERNEE  53

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
              DE+ PLI + ECRICQEEDSV N+ETPCACSGSLKYAHRKCVQHWCNEKGDI+CEICH
Sbjct  54   DNDEDKPLIQVAECRICQEEDSVNNMETPCACSGSLKYAHRKCVQHWCNEKGDISCEICH  113

Query  437  QPYQPGYTAPPR-SQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            QPYQPGYTAPPR  + E+T IDI GGW ISGTPLDL DPRLLAIAE
Sbjct  114  QPYQPGYTAPPRPPRTEDTAIDIGGGWTISGTPLDLRDPRLLAIAE  159



>ref|XP_010551546.1| PREDICTED: uncharacterized protein LOC104822125 [Tarenaya hassleriana]
Length=278

 Score =   200 bits (509),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 119/164 (73%), Gaps = 16/164 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H VV  D++V+       +P +  +   +   +AG SSS            +K I+ 
Sbjct  1    MSDHLVVFVDRMVRP------VPANPVRAETESPNAAGPSSST---------SPDKAIDE  45

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE PLI   ECRICQEEDSVKNLE+PCACSGSLK+AHR+CVQHWCNEKGDI CEICHQ
Sbjct  46   GGEEEPLIQSAECRICQEEDSVKNLESPCACSGSLKFAHRECVQHWCNEKGDIICEICHQ  105

Query  440  PYQPGYTA-PPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTA PPR QPEETTIDIGGW ISGTP+D++DPRLLAIAE
Sbjct  106  PYQPGYTAPPPRPQPEETTIDIGGWTISGTPVDVNDPRLLAIAE  149



>ref|XP_009616758.1| PREDICTED: uncharacterized protein LOC104109233 [Nicotiana tomentosiformis]
 ref|XP_009616766.1| PREDICTED: uncharacterized protein LOC104109233 [Nicotiana tomentosiformis]
 ref|XP_009616774.1| PREDICTED: uncharacterized protein LOC104109233 [Nicotiana tomentosiformis]
 ref|XP_009616781.1| PREDICTED: uncharacterized protein LOC104109233 [Nicotiana tomentosiformis]
Length=277

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 115/164 (70%), Gaps = 19/164 (12%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+  VV  DQLVK +             + K  E  G SS   VE        E+  EV
Sbjct  1    MGDRVVVYMDQLVKPN----------GPEVTKNPEMVGPSSLMTVE--------EEGNEV  42

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            A+EE PLIG  ECRICQEEDS+  LE+PCACSGSLK+AHR CVQHWC+EKGDITCEICHQ
Sbjct  43   ANEEVPLIGRGECRICQEEDSLDKLESPCACSGSLKFAHRACVQHWCDEKGDITCEICHQ  102

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             YQPGYT PPR+  EET IDI GGWQISGTPLDLHDPRLLAIAE
Sbjct  103  QYQPGYTVPPRTVAEETIIDIGGGWQISGTPLDLHDPRLLAIAE  146



>ref|XP_010532809.1| PREDICTED: uncharacterized protein LOC104808720 isoform X2 [Tarenaya 
hassleriana]
Length=282

 Score =   197 bits (502),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 117/164 (71%), Gaps = 16/164 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H VV  D++V+       +P +  +   ++ ++AG SSSA           EK ++ 
Sbjct  1    MSDHLVVYVDRMVRP------VPANPVQAETERPDAAGPSSSA---------SPEKRVDE  45

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE PLI   ECRICQEEDS+KNLE+PC CSGSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  46   GGEEEPLIQSAECRICQEEDSLKNLESPCGCSGSLKYAHRKCVQHWCNEKGDIICEICHQ  105

Query  440  PYQPGYTA-PPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTA PPR QPEETTID+ GW IS TPLDL DPRL AIA+
Sbjct  106  PYQPGYTAPPPRPQPEETTIDVRGWTISDTPLDLPDPRLFAIAD  149



>ref|XP_004490059.1| PREDICTED: uncharacterized protein LOC101496707 [Cicer arietinum]
Length=287

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 120/170 (71%), Gaps = 15/170 (9%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVG-----MGKE  244
            M +H V+  D L +       +PVD  +   +       S +AV  D   G     +  +
Sbjct  1    MSDHLVLFVDHLERP------VPVDPVEQPAQLPSEPSPSPAAV--DAASGPSGSTLPVD  52

Query  245  KDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITC  424
            +++E  DEE PLI + ECRICQEEDSV NLETPCACSGSLKYAHRKCVQHWCNEKGDITC
Sbjct  53   REVEDCDEEEPLIQMVECRICQEEDSVSNLETPCACSGSLKYAHRKCVQHWCNEKGDITC  112

Query  425  EICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            EICHQPYQPGYTA PPR  PEETTI+I GGW +SG+PLDL DPRLLAIAE
Sbjct  113  EICHQPYQPGYTAPPPRPNPEETTIEIGGGWTLSGSPLDLRDPRLLAIAE  162



>emb|CDP00334.1| unnamed protein product [Coffea canephora]
Length=292

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 116/165 (70%), Gaps = 8/165 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVK-TDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE  256
            M E   V+ D+ VK   E+     VD     E    S   +     E+ VV MG+ ++  
Sbjct  1    MSEILAVHADRFVKPVQEINPYGIVDEKPQREMVGPSTSLAPRPEEEEVVVMMGENEN--  58

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
               EEAPLI + ECRICQEEDS+ NLETPCACSGSLKYAHRKCVQHWCNEKGDI CEICH
Sbjct  59   ---EEAPLIAMAECRICQEEDSLTNLETPCACSGSLKYAHRKCVQHWCNEKGDIICEICH  115

Query  437  QPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            QPYQPGYTA  R  PEETTIDI GGWQ+SG PLDLHDPRLLAIAE
Sbjct  116  QPYQPGYTA-SRPNPEETTIDIGGGWQLSGAPLDLHDPRLLAIAE  159



>gb|EYU22411.1| hypothetical protein MIMGU_mgv1a011126mg [Erythranthe guttata]
Length=292

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 117/164 (71%), Gaps = 1/164 (1%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MGEH VVN DQL K + VG   PV  A       ++    +S+    K        D + 
Sbjct  1    MGEHLVVNVDQLAKAEGVGPSQPVPQAMGCGPSGKNPELVASSSAPPKDDKAAVADDDDD  60

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             DEEAPLIG+ ECRICQEEDS  NLE+PCACSGSLKYAHRKCVQHWCNEKGD TCEICH+
Sbjct  61   VDEEAPLIGMGECRICQEEDSFNNLESPCACSGSLKYAHRKCVQHWCNEKGDTTCEICHR  120

Query  440  PYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIAE  568
             YQ GYTAPPR   +ETTIDIGG WQISG PLD+HDPRL+A+AE
Sbjct  121  QYQSGYTAPPRPPSDETTIDIGGVWQISGNPLDMHDPRLVALAE  164



>ref|XP_008806006.1| PREDICTED: probable E3 ubiquitin ligase SUD1 isoform X2 [Phoenix 
dactylifera]
Length=254

 Score =   194 bits (494),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 120/163 (74%), Gaps = 1/163 (1%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H V+N D+LVK++ V S   +  +K   K   S+  S ++      VG   +K+   
Sbjct  1    MGDHLVLNVDRLVKSETVESPQAMKASKSSGKAVHSSLPSVASSSVVASVGEEGKKEYSG  60

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ++EE PLI + ECRICQEED V+NLE PCACSGSLKYAHR CVQ WCNEKGDITCEICH+
Sbjct  61   SEEEEPLIQMVECRICQEEDHVENLEIPCACSGSLKYAHRACVQRWCNEKGDITCEICHE  120

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
             Y+PGYTAPPR+ P+ETTIDI GGW I+GTPLDL DP LLA+A
Sbjct  121  QYKPGYTAPPRANPDETTIDISGGWTITGTPLDLRDPSLLAMA  163



>ref|XP_009380155.1| PREDICTED: uncharacterized protein LOC103968613 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380156.1| PREDICTED: uncharacterized protein LOC103968613 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380157.1| PREDICTED: uncharacterized protein LOC103968613 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380158.1| PREDICTED: uncharacterized protein LOC103968613 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380159.1| PREDICTED: uncharacterized protein LOC103968613 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380161.1| PREDICTED: uncharacterized protein LOC103968613 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380162.1| PREDICTED: uncharacterized protein LOC103968613 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380163.1| PREDICTED: uncharacterized protein LOC103968613 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380164.1| PREDICTED: uncharacterized protein LOC103968613 [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   194 bits (493),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 113/164 (69%), Gaps = 11/164 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEK-DIE  256
            MG+H VV  D+L+K + V +           +        S+      + G  ++K D +
Sbjct  1    MGDHVVVQLDRLIKPETVDA---------TRENGHPESNPSAPSFSQVISGFDRDKEDHK  51

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            VADE  PLI   ECRICQEED +KNLETPCACSGSLKYAHR CVQ WCNEKGDI CEICH
Sbjct  52   VADEGEPLIQTVECRICQEEDQIKNLETPCACSGSLKYAHRTCVQRWCNEKGDIICEICH  111

Query  437  QPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            + Y+PGYT PPR  PEETTIDI GGW I+GTPLDLHDPRLLA+A
Sbjct  112  ESYKPGYTVPPRVNPEETTIDISGGWTITGTPLDLHDPRLLAMA  155



>ref|XP_008806003.1| PREDICTED: uncharacterized protein LOC103718803 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008806004.1| PREDICTED: uncharacterized protein LOC103718803 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008806005.1| PREDICTED: uncharacterized protein LOC103718803 isoform X1 [Phoenix 
dactylifera]
Length=291

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 120/163 (74%), Gaps = 1/163 (1%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H V+N D+LVK++ V S   +  +K   K   S+  S ++      VG   +K+   
Sbjct  1    MGDHLVLNVDRLVKSETVESPQAMKASKSSGKAVHSSLPSVASSSVVASVGEEGKKEYSG  60

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ++EE PLI + ECRICQEED V+NLE PCACSGSLKYAHR CVQ WCNEKGDITCEICH+
Sbjct  61   SEEEEPLIQMVECRICQEEDHVENLEIPCACSGSLKYAHRACVQRWCNEKGDITCEICHE  120

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
             Y+PGYTAPPR+ P+ETTIDI GGW I+GTPLDL DP LLA+A
Sbjct  121  QYKPGYTAPPRANPDETTIDISGGWTITGTPLDLRDPSLLAMA  163



>ref|XP_003517979.1| PREDICTED: uncharacterized protein LOC100812998 [Glycine max]
Length=286

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 116/168 (69%), Gaps = 13/168 (8%)
 Frame = +2

Query  80   MGEHSVVNFDQL---VKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKD  250
            M +H VV  D+L   V  D V                +++G+S +A VED         D
Sbjct  1    MSDHLVVFVDRLARPVPVDPVAQPPSEPSPPPAPVNADASGSSGTAPVEDC--------D  52

Query  251  IEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  430
             E   EE PLI + ECRICQEED V NLETPCACSGSLKYAHRKCVQHWC+EKGDITCEI
Sbjct  53   GEGGGEEEPLIQMAECRICQEEDGVSNLETPCACSGSLKYAHRKCVQHWCDEKGDITCEI  112

Query  431  CHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            CHQPYQPGYTA PPR  PEETTIDI GGW ISGTPLDL DPRLLAIAE
Sbjct  113  CHQPYQPGYTAPPPRPNPEETTIDIGGGWTISGTPLDLRDPRLLAIAE  160



>ref|XP_010532800.1| PREDICTED: uncharacterized protein LOC104808720 isoform X1 [Tarenaya 
hassleriana]
Length=283

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 117/165 (71%), Gaps = 17/165 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H VV  D++V+       +P +  +   ++ ++AG SSSA           EK ++ 
Sbjct  1    MSDHLVVYVDRMVRP------VPANPVQAETERPDAAGPSSSA---------SPEKRVDE  45

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE PLI   ECRICQEEDS+KNLE+PC CSGSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  46   GGEEEPLIQSAECRICQEEDSLKNLESPCGCSGSLKYAHRKCVQHWCNEKGDIICEICHQ  105

Query  440  PYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTA PPR QPEETTID+  GW IS TPLDL DPRL AIA+
Sbjct  106  PYQPGYTAPPPRPQPEETTIDVSRGWTISDTPLDLPDPRLFAIAD  150



>ref|XP_003613769.1| E3 ubiquitin-protein ligase MARCH3 [Medicago truncatula]
 gb|AES96727.1| RING/FYVE/PHD zinc finger protein [Medicago truncatula]
Length=257

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 120/169 (71%), Gaps = 13/169 (8%)
 Frame = +2

Query  80   MGEHSVVNFDQL----VKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEK  247
            M +H VV  DQL    V  D+  + LP D +      T  AG+S S    D+      + 
Sbjct  1    MSDHLVVIVDQLDHPVVPVDQQPAHLPSDPSPSPSPATADAGSSGSGSAVDR------DG  54

Query  248  DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
            D +  DEE PLI + ECRICQEEDSV NLETPCACSGSLKYAHRKCVQHWCNEKGDITCE
Sbjct  55   D-DCGDEEEPLIQMVECRICQEEDSVSNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  113

Query  428  ICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            ICHQPYQ GYTA PPR  PEETTI+I GGW +SG+PLDL DPRLLAIAE
Sbjct  114  ICHQPYQSGYTAPPPRPVPEETTIEIGGGWTLSGSPLDLRDPRLLAIAE  162



>ref|XP_006366707.1| PREDICTED: uncharacterized protein LOC102579093 isoform X1 [Solanum 
tuberosum]
 ref|XP_006366708.1| PREDICTED: uncharacterized protein LOC102579093 isoform X2 [Solanum 
tuberosum]
Length=301

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 123/167 (74%), Gaps = 7/167 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKT---DEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKD  250
            MGEH VV  +  V+    D   SG P++  K   +  E  G SSS  +++K +     ++
Sbjct  1    MGEHLVVKDEDRVRVGNADASSSGEPIENGKKATEVVEGTGASSSKTMKEKEL---AVEE  57

Query  251  IEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  430
             E  +EE PLIG  ECRICQ+ED++ NLE+PCAC GSLKYAHRKCVQHWCNEKGDITCEI
Sbjct  58   EEEGNEEVPLIGGAECRICQDEDTLNNLESPCACCGSLKYAHRKCVQHWCNEKGDITCEI  117

Query  431  CHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            CHQ YQPGYTAPPR++ E+T IDI GGWQI+GTPL+LHDPRLLAI E
Sbjct  118  CHQQYQPGYTAPPRARSEDTIIDIGGGWQIAGTPLELHDPRLLAIRE  164



>ref|XP_007046096.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY01928.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
Length=285

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 119/164 (73%), Gaps = 6/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+LV+   V S     G       TE +G S S   ++K V  G E++ + 
Sbjct  1    MSDHLVLYVDRLVRPVPVQSLESEAG-----PSTEISGPSCSVEDKEKEVVRGGEEEEDE  55

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             +EE PLI   ECRICQEEDS+KNLETPCACSGSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  56   EEEEEPLIHAAECRICQEEDSIKNLETPCACSGSLKYAHRKCVQHWCNEKGDIICEICHQ  115

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR   EET IDI GGW ISGTPLDL DPRLLAIAE
Sbjct  116  PYQPGYTAPPRPHTEETAIDIGGGWTISGTPLDLRDPRLLAIAE  159



>ref|XP_007046100.1| RING/FYVE/PHD zinc finger superfamily protein isoform 5 [Theobroma 
cacao]
 gb|EOY01932.1| RING/FYVE/PHD zinc finger superfamily protein isoform 5 [Theobroma 
cacao]
Length=257

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 119/164 (73%), Gaps = 6/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+LV+   V S     G       TE +G S S   ++K V  G E++ + 
Sbjct  1    MSDHLVLYVDRLVRPVPVQSLESEAG-----PSTEISGPSCSVEDKEKEVVRGGEEEEDE  55

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             +EE PLI   ECRICQEEDS+KNLETPCACSGSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  56   EEEEEPLIHAAECRICQEEDSIKNLETPCACSGSLKYAHRKCVQHWCNEKGDIICEICHQ  115

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR   EET IDI GGW ISGTPLDL DPRLLAIAE
Sbjct  116  PYQPGYTAPPRPHTEETAIDIGGGWTISGTPLDLRDPRLLAIAE  159



>ref|XP_003613768.1| E3 ubiquitin-protein ligase MARCH3 [Medicago truncatula]
 gb|AES96726.1| RING/FYVE/PHD zinc finger protein [Medicago truncatula]
Length=290

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 118/169 (70%), Gaps = 13/169 (8%)
 Frame = +2

Query  80   MGEHSVVNFDQL----VKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEK  247
            M +H VV  DQL    V  D+  + LP D +      T  AG+S S    D+        
Sbjct  1    MSDHLVVIVDQLDHPVVPVDQQPAHLPSDPSPSPSPATADAGSSGSGSAVDR-------D  53

Query  248  DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
              +  DEE PLI + ECRICQEEDSV NLETPCACSGSLKYAHRKCVQHWCNEKGDITCE
Sbjct  54   GDDCGDEEEPLIQMVECRICQEEDSVSNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  113

Query  428  ICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            ICHQPYQ GYTA PPR  PEETTI+I GGW +SG+PLDL DPRLLAIAE
Sbjct  114  ICHQPYQSGYTAPPPRPVPEETTIEIGGGWTLSGSPLDLRDPRLLAIAE  162



>ref|XP_009410006.1| PREDICTED: uncharacterized protein LOC103992138 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410008.1| PREDICTED: uncharacterized protein LOC103992138 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410009.1| PREDICTED: uncharacterized protein LOC103992138 [Musa acuminata 
subsp. malaccensis]
Length=288

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 120/163 (74%), Gaps = 7/163 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H V++ D+L    + GS    + A+  ++   +A  +SS    DK V   +EKD +V
Sbjct  1    MGDHVVLHIDRLTTIRKEGSTSSAEAARGSDRTLSAAPVASSG---DKKV---EEKDNKV  54

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             +EE PLI + +CRICQ+ED +KNLE PCACSGSLKYAHR CVQHWCNEKGDITCEICH+
Sbjct  55   GEEEEPLIQMVDCRICQDEDHIKNLEAPCACSGSLKYAHRACVQHWCNEKGDITCEICHE  114

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
             Y+PGYTAPP+  P +  IDI GGW I+G+PLDLHDPR+LA+A
Sbjct  115  QYKPGYTAPPQVHPTDAAIDINGGWIITGSPLDLHDPRILAMA  157



>ref|XP_003518727.1| PREDICTED: uncharacterized protein LOC100779674 [Glycine max]
Length=289

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 117/174 (67%), Gaps = 22/174 (13%)
 Frame = +2

Query  80   MGEHSVVNFDQLVK---------TDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVG  232
            M +H VV  D+L +         T +V S      A        S+GTS S         
Sbjct  1    MSDHLVVFVDRLARPVPVDPVAQTAQVPSEPSPPPAAVDADAAGSSGTSPS---------  51

Query  233  MGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKG  412
              ++ D E  DEE PLI + ECRICQEED V NLETPCACSGSLKYAHRKCVQHWC+EKG
Sbjct  52   --EDCDGEGGDEEEPLIQMAECRICQEEDGVSNLETPCACSGSLKYAHRKCVQHWCDEKG  109

Query  413  DITCEICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            DITCEICHQPYQPGYTA PPR  PEETTIDI GGW ISGTPLDL DPRLLAIAE
Sbjct  110  DITCEICHQPYQPGYTAPPPRPNPEETTIDIGGGWTISGTPLDLRDPRLLAIAE  163



>gb|KHG14333.1| Ectonucleoside triphosphate diphosphohydrolase 1 [Gossypium arboreum]
Length=814

 Score =   201 bits (512),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 102/164 (62%), Positives = 119/164 (73%), Gaps = 18/164 (11%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+L+K +E  +G            TE  G  SS ++E K  G+     +  
Sbjct  543  MSDHLVLGVDRLMKPEESDAG----------PSTEVPG--SSCLLESKEKGV-----VNG  585

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             +EE PLI   ECRICQ+EDS+KNLETPCACSGSLKYAHRKCVQHWCNEKG+I CEICHQ
Sbjct  586  EEEEEPLIQSAECRICQDEDSIKNLETPCACSGSLKYAHRKCVQHWCNEKGNIKCEICHQ  645

Query  440  PYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIAE  568
            PY+PGYTA PR+Q EET+IDIGG W ISGTPLDL DPRLLAIAE
Sbjct  646  PYEPGYTALPRTQTEETSIDIGGVWTISGTPLDLRDPRLLAIAE  689



>ref|XP_006827237.1| hypothetical protein AMTR_s00010p00261170 [Amborella trichopoda]
 gb|ERM94474.1| hypothetical protein AMTR_s00010p00261170 [Amborella trichopoda]
Length=292

 Score =   192 bits (488),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 122/170 (72%), Gaps = 13/170 (8%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSG-----LPVD-GAKHIEKKTESAGTSSSAVVEDKVVGMGK  241
            MGEH V+  D  +      SG     LP   G  +  + + S+G+S+     D+  G G 
Sbjct  1    MGEHLVLYVDHPITPATFESGERPERLPATPGETNQVQGSLSSGSSTQGSPVDEN-GEGS  59

Query  242  EKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDIT  421
            E    + DEE PL+   ECRICQEED+VKNLETPCACSGSLK+AHRKCVQ WCNEKGDIT
Sbjct  60   E----IHDEEQPLLQNVECRICQEEDNVKNLETPCACSGSLKFAHRKCVQRWCNEKGDIT  115

Query  422  CEICHQPYQPGYTAPP-RSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            CEICHQPY+PGYTAPP R+ P++TTIDI GGW ISGTPLDLHDPRLLA+A
Sbjct  116  CEICHQPYKPGYTAPPARANPDDTTIDISGGWAISGTPLDLHDPRLLAMA  165



>ref|XP_010926555.1| PREDICTED: uncharacterized protein LOC105048801 [Elaeis guineensis]
Length=311

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 119/169 (70%), Gaps = 15/169 (9%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAG-----TSSSAVVEDKVVGMGKE  244
            MG+H VVN D+LVKT+ V S           K +ES+G     +  S      VV +G E
Sbjct  22   MGDHLVVNADRLVKTETVES--------QARKTSESSGEDVHVSLPSVASSSVVVSVGDE  73

Query  245  -KDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDIT  421
             K+   A+EE PLI   ECRICQEED VKNLE PCACSGSLKYAHR CVQ WCNEKGDIT
Sbjct  74   GKEYSGAEEEEPLIQTVECRICQEEDHVKNLEIPCACSGSLKYAHRTCVQRWCNEKGDIT  133

Query  422  CEICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            CEICH+ Y PGYTAPPR+ P+ET IDI GGW I+GTPLDL DPRLLA+A
Sbjct  134  CEICHEQYNPGYTAPPRANPDETIIDIRGGWTITGTPLDLRDPRLLAVA  182



>ref|XP_007046097.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY01929.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
Length=318

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 119/164 (73%), Gaps = 6/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+LV+   V S     G       TE +G S S   ++K V  G E++ + 
Sbjct  1    MSDHLVLYVDRLVRPVPVQSLESEAG-----PSTEISGPSCSVEDKEKEVVRGGEEEEDE  55

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             +EE PLI   ECRICQEEDS+KNLETPCACSGSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  56   EEEEEPLIHAAECRICQEEDSIKNLETPCACSGSLKYAHRKCVQHWCNEKGDIICEICHQ  115

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR   EET IDI GGW ISGTPLDL DPRLLAIAE
Sbjct  116  PYQPGYTAPPRPHTEETAIDIGGGWTISGTPLDLRDPRLLAIAE  159



>ref|XP_010917045.1| PREDICTED: uncharacterized protein LOC105041733 [Elaeis guineensis]
Length=291

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 119/163 (73%), Gaps = 1/163 (1%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H V++ D+LVK + V S   +  +K   K    +  S ++      VG   +K+   
Sbjct  1    MGDHLVLDVDRLVKPEAVESLQAMKASKSSGKAVHGSLPSVASSSVVASVGDEGKKEYSG  60

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ++EE PLI + ECRICQEED+VKNLE PCACSGSLKYAHR CVQ WCNEKGDITCEICH+
Sbjct  61   SEEEEPLIQMVECRICQEEDNVKNLEIPCACSGSLKYAHRACVQRWCNEKGDITCEICHE  120

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
             Y+PGYTAPP + P+ETTIDI GGW I+GTPLDL DPRLLA+A
Sbjct  121  QYKPGYTAPPPANPDETTIDISGGWTITGTPLDLRDPRLLAMA  163



>ref|XP_007157624.1| hypothetical protein PHAVU_002G085200g [Phaseolus vulgaris]
 gb|ESW29618.1| hypothetical protein PHAVU_002G085200g [Phaseolus vulgaris]
Length=291

 Score =   190 bits (482),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +2

Query  239  KEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDI  418
            + +D +  DEE PLI + ECRICQEED V NLETPCACSGSLKYAHRKCVQHWC+EKGDI
Sbjct  54   ENRDGDGGDEEEPLIQMAECRICQEEDGVSNLETPCACSGSLKYAHRKCVQHWCDEKGDI  113

Query  419  TCEICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             CEICHQPYQPGYTA PPR+ PEETTIDI GGW ISGTPLDL DPRLLAIAE
Sbjct  114  ICEICHQPYQPGYTAPPPRANPEETTIDIGGGWTISGTPLDLRDPRLLAIAE  165



>ref|XP_007157623.1| hypothetical protein PHAVU_002G085200g [Phaseolus vulgaris]
 gb|ESW29617.1| hypothetical protein PHAVU_002G085200g [Phaseolus vulgaris]
Length=292

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 97/112 (87%), Gaps = 2/112 (2%)
 Frame = +2

Query  239  KEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDI  418
            + +D +  DEE PLI + ECRICQEED V NLETPCACSGSLKYAHRKCVQHWC+EKGDI
Sbjct  54   ENRDGDGGDEEEPLIQMAECRICQEEDGVSNLETPCACSGSLKYAHRKCVQHWCDEKGDI  113

Query  419  TCEICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             CEICHQPYQPGYTA PPR+ PEETTIDI GGW ISGTPLDL DPRLLAIAE
Sbjct  114  ICEICHQPYQPGYTAPPPRANPEETTIDIGGGWTISGTPLDLRDPRLLAIAE  165



>gb|KJB30403.1| hypothetical protein B456_005G141600 [Gossypium raimondii]
Length=261

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 114/164 (70%), Gaps = 15/164 (9%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+LV+   +    PV+    +   TE +G S S   ++   G G       
Sbjct  1    MSDHLVLYVDRLVRPVPLQ---PVES--EVGPSTEISGPSCSPKEKEIFRGGG-------  48

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE PLI   ECRICQEEDSV+NLETPCACSGSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  49   --EEEPLIQTAECRICQEEDSVENLETPCACSGSLKYAHRKCVQHWCNEKGDIICEICHQ  106

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGY AP R Q EET IDI GGW ISGTP+DL DPRLLAIAE
Sbjct  107  PYQPGYIAPSRPQTEETAIDIGGGWTISGTPVDLRDPRLLAIAE  150



>ref|XP_006355132.1| PREDICTED: uncharacterized protein LOC102582422 [Solanum tuberosum]
Length=286

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 124/165 (75%), Gaps = 12/165 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIE-KKTESAGTSSSAVVEDKVVGMGKEKDIE  256
            MG+  VV+ D+LVK +         GA+ ++ K  E  G+SS+  V++K V + +E++ E
Sbjct  1    MGDCLVVHTDRLVKAN---------GAEIMDGKNPEMVGSSSAIAVDEKKV-LEEEEEEE  50

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
              DEE PLIG  ECRICQEEDS+  LE+PCACSGSLKY HR CVQHWCNEKGDITCEICH
Sbjct  51   EGDEEVPLIGRAECRICQEEDSLDKLESPCACSGSLKYTHRTCVQHWCNEKGDITCEICH  110

Query  437  QPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            Q YQPGYT PPR   EET IDI GGWQISGTPL+LHDPR+LAIAE
Sbjct  111  QQYQPGYTVPPRPVAEETIIDIGGGWQISGTPLNLHDPRVLAIAE  155



>gb|KJB30401.1| hypothetical protein B456_005G141600 [Gossypium raimondii]
 gb|KJB30402.1| hypothetical protein B456_005G141600 [Gossypium raimondii]
Length=277

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 115/165 (70%), Gaps = 17/165 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI-E  256
            M +H V+  D+LV+   +    PV+    +   TE +G S S           KEK+I  
Sbjct  1    MSDHLVLYVDRLVRPVPLQ---PVE--SEVGPSTEISGPSCSP----------KEKEIFR  45

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
               EE PLI   ECRICQEEDSV+NLETPCACSGSLKYAHRKCVQHWCNEKGDI CEICH
Sbjct  46   GGGEEEPLIQTAECRICQEEDSVENLETPCACSGSLKYAHRKCVQHWCNEKGDIICEICH  105

Query  437  QPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            QPYQPGY AP R Q EET IDI GGW ISGTP+DL DPRLLAIAE
Sbjct  106  QPYQPGYIAPSRPQTEETAIDIGGGWTISGTPVDLRDPRLLAIAE  150



>gb|KHG25683.1| E3 ubiquitin-protein ligase MARCH3 [Gossypium arboreum]
Length=277

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 114/165 (69%), Gaps = 17/165 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI-E  256
            M +H V+  D+LV+   +    PV+        TE +G S S           KEK+I  
Sbjct  1    MSDHLVLYVDRLVRPVPLQ---PVESEAG--PSTEISGPSCSP----------KEKEIFR  45

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
               EE PLI   ECRICQEEDSV+NLETPC CSGSLKYAHRKCVQHWCNEKGDI CEICH
Sbjct  46   GGGEEEPLIQTAECRICQEEDSVENLETPCTCSGSLKYAHRKCVQHWCNEKGDIICEICH  105

Query  437  QPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            QPYQPGY APPR Q EET IDI GGW ISGTP+DL DPRLLAIAE
Sbjct  106  QPYQPGYIAPPRPQTEETAIDIGGGWTISGTPVDLRDPRLLAIAE  150



>ref|XP_004228377.1| PREDICTED: uncharacterized protein LOC101247951 [Solanum lycopersicum]
 ref|XP_010321927.1| PREDICTED: uncharacterized protein LOC101247951 [Solanum lycopersicum]
 ref|XP_010321959.1| PREDICTED: uncharacterized protein LOC101247951 [Solanum lycopersicum]
Length=304

 Score =   188 bits (478),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 121/168 (72%), Gaps = 6/168 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVK---TDEVGS-GLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEK  247
            MGEH VV  +  V+   TD + S G  ++  K   +  E  G SSS     K   +   +
Sbjct  1    MGEHLVVKDEDRVRVGNTDALSSSGEQIENGKKATEVVEGIGASSSNSKTMKEKEL-AVE  59

Query  248  DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
            + E  +EE PLIG  ECRICQ+EDS+ NLE+PCAC GSLKYAHRKCVQHWCNEKGDITCE
Sbjct  60   EEEEGNEEVPLIGGAECRICQDEDSLNNLESPCACCGSLKYAHRKCVQHWCNEKGDITCE  119

Query  428  ICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            ICHQ YQPGYTAPPR++ E+T IDI GGWQI+GTPL+LHDPRLLAI E
Sbjct  120  ICHQQYQPGYTAPPRARSEDTIIDIGGGWQIAGTPLELHDPRLLAIRE  167



>ref|XP_006438690.1| hypothetical protein CICLE_v10032323mg [Citrus clementina]
 ref|XP_006438691.1| hypothetical protein CICLE_v10032323mg [Citrus clementina]
 ref|XP_006438692.1| hypothetical protein CICLE_v10032323mg [Citrus clementina]
 ref|XP_006438693.1| hypothetical protein CICLE_v10032323mg [Citrus clementina]
 ref|XP_006483154.1| PREDICTED: uncharacterized protein LOC102616509 [Citrus sinensis]
 gb|ESR51930.1| hypothetical protein CICLE_v10032323mg [Citrus clementina]
 gb|ESR51931.1| hypothetical protein CICLE_v10032323mg [Citrus clementina]
 gb|ESR51932.1| hypothetical protein CICLE_v10032323mg [Citrus clementina]
 gb|ESR51933.1| hypothetical protein CICLE_v10032323mg [Citrus clementina]
 gb|KDO82925.1| hypothetical protein CISIN_1g023293mg [Citrus sinensis]
Length=284

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 116/167 (69%), Gaps = 15/167 (9%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKV---VGMGKEKD  250
            M +H V+  D+L++ + V            E+   +A  +S  V+ED+       G + D
Sbjct  1    MSDHVVLYVDRLIRPESVQ-----------EEGDGAARETSGGVLEDEAGPSCSAGNDVD  49

Query  251  IEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  430
             E   E+ PL+ + ECRICQEEDS+ NLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI
Sbjct  50   DEKVGEDEPLLQVGECRICQEEDSINNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  109

Query  431  CHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            CHQ Y+P YTAPP  + EET I+I GGW ISGTPLDL DPRLLAIAE
Sbjct  110  CHQQYKPNYTAPPPPRLEETAIEIGGGWTISGTPLDLRDPRLLAIAE  156



>ref|XP_011013496.1| PREDICTED: uncharacterized protein LOC105117507 [Populus euphratica]
Length=280

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 115/167 (69%), Gaps = 17/167 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAV--VEDKVVGMGKEKDI  253
            M +H V++ DQL++     +  P +  K I K+ +   + S A   ++D + G       
Sbjct  1    MSDHMVLDVDQLIRP--ASTAPPEESDKAIVKEADVGPSCSKANEGIDDGISG-------  51

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
                EE PLI   ECRICQEEDSV NLE PCACSGSLKYAHRKCVQHWCNEKGDITCEIC
Sbjct  52   ----EEEPLIQGAECRICQEEDSVSNLENPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  107

Query  434  HQPYQPGYTAPPR-SQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            HQPYQPGYTAPPR    E+T IDI GGW ISGT LDL DPRLLAIAE
Sbjct  108  HQPYQPGYTAPPRPPHSEDTAIDIGGGWTISGTQLDLRDPRLLAIAE  154



>ref|XP_004238803.1| PREDICTED: uncharacterized protein LOC101267890 [Solanum lycopersicum]
Length=285

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 122/165 (74%), Gaps = 13/165 (8%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIE-KKTESAGTSSSAVVEDKVVGMGKEKDIE  256
            MG+  VV+ D++VK +         GA+ ++ K  E  G+SS+  V++K V   +E+  E
Sbjct  1    MGDCLVVHTDRIVKAN---------GAEIMDGKNPEMVGSSSAIAVDEKKVLEEEEE--E  49

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
              DEE PLIG  ECRICQEEDS+  LE+PCACSGSLKY HR CVQHWCNEKGDITCEICH
Sbjct  50   EGDEEVPLIGRAECRICQEEDSLDKLESPCACSGSLKYTHRACVQHWCNEKGDITCEICH  109

Query  437  QPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            Q YQPGYT PPR   EET IDI GGWQISGTPL+LHDPR+LAIAE
Sbjct  110  QQYQPGYTVPPRPVAEETIIDIGGGWQISGTPLNLHDPRVLAIAE  154



>gb|KJB79984.1| hypothetical protein B456_013G085600 [Gossypium raimondii]
Length=213

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 92/104 (88%), Gaps = 1/104 (1%)
 Frame = +2

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ++EE PLI + ECRICQEEDS+KNLETPCAC+GSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  44   SNEEDPLIQVAECRICQEEDSIKNLETPCACNGSLKYAHRKCVQHWCNEKGDIICEICHQ  103

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             YQP YTAPPR+Q +ET IDI GGW ISGTPLDL D RLLAIAE
Sbjct  104  SYQPDYTAPPRTQTDETAIDIGGGWTISGTPLDLRDSRLLAIAE  147



>ref|XP_007046098.1| RING/FYVE/PHD zinc finger superfamily protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY01930.1| RING/FYVE/PHD zinc finger superfamily protein isoform 3, partial 
[Theobroma cacao]
Length=314

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 106/131 (81%), Gaps = 1/131 (1%)
 Frame = +2

Query  179  TESAGTSSSAVVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSG  358
            TE +G S S   ++K V  G E++ +  +EE PLI   ECRICQEEDS+KNLETPCACSG
Sbjct  25   TEISGPSCSVEDKEKEVVRGGEEEEDEEEEEEPLIHAAECRICQEEDSIKNLETPCACSG  84

Query  359  SLKYAHRKCVQHWCNEKGDITCEICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLD  535
            SLKYAHRKCVQHWCNEKGDI CEICHQPYQPGYTAPPR   EET IDI GGW ISGTPLD
Sbjct  85   SLKYAHRKCVQHWCNEKGDIICEICHQPYQPGYTAPPRPHTEETAIDIGGGWTISGTPLD  144

Query  536  LHDPRLLAIAE  568
            L DPRLLAIAE
Sbjct  145  LRDPRLLAIAE  155



>ref|XP_008780577.1| PREDICTED: uncharacterized protein LOC103700406 isoform X1 [Phoenix 
dactylifera]
Length=290

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 115/165 (70%), Gaps = 7/165 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESA-GTSSSAVVEDKVVGMGKE-KDI  253
            M +H V+N D LVK + V S       K  E   E+  G+  S      V  +G E K+ 
Sbjct  1    MRDHLVLNVDPLVKLETVES----QAGKASESSGEAVHGSLPSVASSSVVASVGDEGKEY  56

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
              A+EE PLI   ECRICQEED VKNLE PCACSGSLKYAHR CVQ WCNEKGDITCEIC
Sbjct  57   SGAEEEEPLIQTVECRICQEEDHVKNLEIPCACSGSLKYAHRTCVQRWCNEKGDITCEIC  116

Query  434  HQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            H+ Y+ GYTAPPR+ P+ETTIDI GGW I+GTPLDL DPRLLA+A
Sbjct  117  HEQYKSGYTAPPRANPDETTIDISGGWTITGTPLDLRDPRLLAVA  161



>ref|XP_008780583.1| PREDICTED: uncharacterized protein LOC103700406 isoform X2 [Phoenix 
dactylifera]
Length=289

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 115/165 (70%), Gaps = 7/165 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESA-GTSSSAVVEDKVVGMGKE-KDI  253
            M +H V+N D LVK + V S       K  E   E+  G+  S      V  +G E K+ 
Sbjct  1    MRDHLVLNVDPLVKLETVES----QAGKASESSGEAVHGSLPSVASSSVVASVGDEGKEY  56

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
              A+EE PLI   ECRICQEED VKNLE PCACSGSLKYAHR CVQ WCNEKGDITCEIC
Sbjct  57   SGAEEEEPLIQTVECRICQEEDHVKNLEIPCACSGSLKYAHRTCVQRWCNEKGDITCEIC  116

Query  434  HQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            H+ Y+ GYTAPPR+ P+ETTIDI GGW I+GTPLDL DPRLLA+A
Sbjct  117  HEQYKSGYTAPPRANPDETTIDISGGWTITGTPLDLRDPRLLAVA  161



>ref|XP_002315052.1| zinc finger family protein [Populus trichocarpa]
 gb|EEF01223.1| zinc finger family protein [Populus trichocarpa]
Length=280

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 113/170 (66%), Gaps = 23/170 (14%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEK----  247
            M +H V++ DQL++                   T  A  S  A+V++  VG    +    
Sbjct  1    MSDHVVLDVDQLIRP----------------ASTAPAEESDKAIVKEADVGPSCSRANDG  44

Query  248  -DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITC  424
             D  ++ EE PLI   ECRICQEEDSV NLE PCACSGSLKYAHRKCVQHWCNEKGDITC
Sbjct  45   IDDGISGEEEPLIQGAECRICQEEDSVSNLENPCACSGSLKYAHRKCVQHWCNEKGDITC  104

Query  425  EICHQPYQPGYTAPPR-SQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            EICHQPYQPGYTAPPR    E+T IDI GGW ISGT LDL DPRLLAIAE
Sbjct  105  EICHQPYQPGYTAPPRPPHSEDTGIDIGGGWTISGTQLDLRDPRLLAIAE  154



>gb|KJB79979.1| hypothetical protein B456_013G085600 [Gossypium raimondii]
 gb|KJB79980.1| hypothetical protein B456_013G085600 [Gossypium raimondii]
 gb|KJB79982.1| hypothetical protein B456_013G085600 [Gossypium raimondii]
 gb|KJB79985.1| hypothetical protein B456_013G085600 [Gossypium raimondii]
 gb|KJB79986.1| hypothetical protein B456_013G085600 [Gossypium raimondii]
Length=273

 Score =   184 bits (468),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 92/104 (88%), Gaps = 1/104 (1%)
 Frame = +2

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ++EE PLI + ECRICQEEDS+KNLETPCAC+GSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  44   SNEEDPLIQVAECRICQEEDSIKNLETPCACNGSLKYAHRKCVQHWCNEKGDIICEICHQ  103

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             YQP YTAPPR+Q +ET IDI GGW ISGTPLDL D RLLAIAE
Sbjct  104  SYQPDYTAPPRTQTDETAIDIGGGWTISGTPLDLRDSRLLAIAE  147



>gb|KJB79983.1| hypothetical protein B456_013G085600 [Gossypium raimondii]
Length=248

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 92/104 (88%), Gaps = 1/104 (1%)
 Frame = +2

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ++EE PLI + ECRICQEEDS+KNLETPCAC+GSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  44   SNEEDPLIQVAECRICQEEDSIKNLETPCACNGSLKYAHRKCVQHWCNEKGDIICEICHQ  103

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             YQP YTAPPR+Q +ET IDI GGW ISGTPLDL D RLLAIAE
Sbjct  104  SYQPDYTAPPRTQTDETAIDIGGGWTISGTPLDLRDSRLLAIAE  147



>ref|XP_002522435.1| membrane associated ring finger 1,8, putative [Ricinus communis]
 gb|EEF39927.1| membrane associated ring finger 1,8, putative [Ricinus communis]
Length=283

 Score =   184 bits (468),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 114/165 (69%), Gaps = 10/165 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+L+         P   +         AG S S   E+    + ++ + + 
Sbjct  1    MSDHVVLYVDRLIT--------PSSSSPEEVADRAVAGPSCSRPNEEPNGVVQEKGNDDN  52

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             +EE PLI + ECRICQEEDSV NLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH+
Sbjct  53   DNEEEPLIKVAECRICQEEDSVTNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHK  112

Query  440  PYQPGYTAPPR-SQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAP R  Q E+T IDI GGW ISGTPLDL DPRLLAIAE
Sbjct  113  PYQPGYTAPLRPPQAEDTAIDIGGGWTISGTPLDLRDPRLLAIAE  157



>gb|EPS60115.1| hypothetical protein M569_14689, partial [Genlisea aurea]
Length=163

 Score =   180 bits (457),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = +2

Query  266  EEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPY  445
            EE PLI + ECRICQ+EDSVKNLE+PCAC+GSLKYAHRKCVQHWCNEKGDITCEICHQPY
Sbjct  1    EETPLIRLEECRICQDEDSVKNLESPCACTGSLKYAHRKCVQHWCNEKGDITCEICHQPY  60

Query  446  QPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIAE  568
            QPGY+APPR   +ETTIDIGG W+ISG P+D++DPRLLAI +
Sbjct  61   QPGYSAPPRPPSDETTIDIGGVWRISGAPIDMNDPRLLAITD  102



>gb|KJB79981.1| hypothetical protein B456_013G085600 [Gossypium raimondii]
Length=257

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 92/104 (88%), Gaps = 1/104 (1%)
 Frame = +2

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ++EE PLI + ECRICQEEDS+KNLETPCAC+GSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  44   SNEEDPLIQVAECRICQEEDSIKNLETPCACNGSLKYAHRKCVQHWCNEKGDIICEICHQ  103

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             YQP YTAPPR+Q +ET IDI GGW ISGTPLDL D RLLAIAE
Sbjct  104  SYQPDYTAPPRTQTDETAIDIGGGWTISGTPLDLRDSRLLAIAE  147



>ref|XP_009773410.1| PREDICTED: uncharacterized protein LOC104223638 [Nicotiana sylvestris]
 ref|XP_009773416.1| PREDICTED: uncharacterized protein LOC104223638 [Nicotiana sylvestris]
 ref|XP_009773417.1| PREDICTED: uncharacterized protein LOC104223638 [Nicotiana sylvestris]
Length=277

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 114/164 (70%), Gaps = 19/164 (12%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+  VV  D+LVK +          A+ I K  E  G SSS  VE++   +  E+    
Sbjct  1    MGDRVVVYVDRLVKPN----------AEEIIKNPEMVGPSSSMTVEEEDDEVVNEE----  46

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
                 PLI   ECRICQEEDS+  LE+PCACSGSLKYAHR CVQHWC+EKGDITCEICHQ
Sbjct  47   ----VPLICRGECRICQEEDSLDKLESPCACSGSLKYAHRACVQHWCDEKGDITCEICHQ  102

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             YQPGYT PPR+  EET IDI GGWQISGTPLDLHDPRLLAIAE
Sbjct  103  QYQPGYTVPPRTVAEETIIDIGGGWQISGTPLDLHDPRLLAIAE  146



>ref|XP_010939492.1| PREDICTED: uncharacterized protein LOC105058313 isoform X1 [Elaeis 
guineensis]
Length=279

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 1/163 (1%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H V+  D+L+    +G+    +G+    +   ++       V        ++++   
Sbjct  1    MGDHLVLYVDRLIAPQTIGTIQEKEGSSSSGEPVHASFVPLPLPVGSTKGKEEEKEEHMD  60

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             D+E PLI + ECRICQEED +KNLETPCACSGSLKY HR CVQHWCNEKGDITCEICH+
Sbjct  61   EDDEEPLIQMAECRICQEEDHIKNLETPCACSGSLKYVHRACVQHWCNEKGDITCEICHE  120

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            PY+PGYTAPPR+ P+ETTIDI GGW I+G PLDLHD R+LA+A
Sbjct  121  PYKPGYTAPPRATPDETTIDISGGWTITGAPLDLHDHRILAMA  163



>ref|XP_010939493.1| PREDICTED: uncharacterized protein LOC105058313 isoform X2 [Elaeis 
guineensis]
Length=297

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 1/163 (1%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H V+  D+L+    +G+    +G+    +   ++       V        ++++   
Sbjct  1    MGDHLVLYVDRLIAPQTIGTIQEKEGSSSSGEPVHASFVPLPLPVGSTKGKEEEKEEHMD  60

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             D+E PLI + ECRICQEED +KNLETPCACSGSLKY HR CVQHWCNEKGDITCEICH+
Sbjct  61   EDDEEPLIQMAECRICQEEDHIKNLETPCACSGSLKYVHRACVQHWCNEKGDITCEICHE  120

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            PY+PGYTAPPR+ P+ETTIDI GGW I+G PLDLHD R+LA+A
Sbjct  121  PYKPGYTAPPRATPDETTIDISGGWTITGAPLDLHDHRILAMA  163



>ref|XP_007046099.1| RING/FYVE/PHD zinc finger superfamily protein isoform 4, partial 
[Theobroma cacao]
 gb|EOY01931.1| RING/FYVE/PHD zinc finger superfamily protein isoform 4, partial 
[Theobroma cacao]
Length=258

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 88/99 (89%), Gaps = 1/99 (1%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI   ECRICQEEDS+KNLETPCACSGSLKYAHRKCVQHWCNEKGDI CEICHQPYQPG
Sbjct  12   PLIHAAECRICQEEDSIKNLETPCACSGSLKYAHRKCVQHWCNEKGDIICEICHQPYQPG  71

Query  455  YTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            YTAPPR   EET IDI GGW ISGTPLDL DPRLLAIAE
Sbjct  72   YTAPPRPHTEETAIDIGGGWTISGTPLDLRDPRLLAIAE  110



>gb|KHG27428.1| E3 ubiquitin-protein ligase MARCH3 [Gossypium arboreum]
Length=273

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 116/164 (71%), Gaps = 18/164 (11%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+LV+        PV  A+ +E     AG S+    + K      ++  + 
Sbjct  1    MSDHLVLYVDRLVR--------PVP-ARPVES---GAGPSTEEKEKVK-----DKEVFQG  43

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ++EE PLI + ECRICQEEDS+KNLETPCAC+GSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  44   SNEEDPLIQVAECRICQEEDSIKNLETPCACNGSLKYAHRKCVQHWCNEKGDIICEICHQ  103

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             YQP YTAPPR   +ET IDI GGW ISGTPLDL DPRLLAIAE
Sbjct  104  SYQPDYTAPPRPPTDETAIDIGGGWTISGTPLDLRDPRLLAIAE  147



>ref|XP_004159987.1| PREDICTED: uncharacterized LOC101203306 [Cucumis sativus]
Length=307

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 100/126 (79%), Gaps = 9/126 (7%)
 Frame = +2

Query  194  TSSSAVVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYA  373
            +SS+A   D+ V      D +  +E+ PLI + ECRICQEEDS+ NLETPCACSGSLKYA
Sbjct  45   SSSTATAHDRTV------DTDAPNEDDPLIQVAECRICQEEDSLNNLETPCACSGSLKYA  98

Query  374  HRKCVQHWCNEKGDITCEICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPR  550
            HRKCVQHWCNEKGDITCEICHQPYQPGYTAPPRS  EET ID+ G W I+G PLDL D R
Sbjct  99   HRKCVQHWCNEKGDITCEICHQPYQPGYTAPPRS--EETAIDMEGRWTIAGNPLDLRDTR  156

Query  551  LLAIAE  568
            LLAIAE
Sbjct  157  LLAIAE  162



>ref|XP_008802607.1| PREDICTED: uncharacterized protein LOC103716403 [Phoenix dactylifera]
Length=291

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 1/163 (1%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H V++ D+L+    +G+    +G+    +   +    S   V  +     +E++   
Sbjct  1    MGDHLVLHVDRLIAPQTIGTIHQKEGSSSSGEPVHAPSVPSPLPVGSRKDKEEEEEERLD  60

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             D+E PLI + ECRICQEED +KNLETPCACSGSLKY HR CVQHWCNEKGDITCEICH+
Sbjct  61   EDDEEPLIQMAECRICQEEDHIKNLETPCACSGSLKYVHRACVQHWCNEKGDITCEICHE  120

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            PY+PGYTAPP+  P+ETTIDI GGW I   PLDL DPR+LA+A
Sbjct  121  PYKPGYTAPPQVHPDETTIDISGGWTIGSAPLDLRDPRVLALA  163



>gb|KHG27429.1| March3 [Gossypium arboreum]
Length=323

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +2

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ++EE PLI + ECRICQEEDS+KNLETPCAC+GSLKYAHRKCVQHWCNEKGDI CEICHQ
Sbjct  44   SNEEDPLIQVAECRICQEEDSIKNLETPCACNGSLKYAHRKCVQHWCNEKGDIICEICHQ  103

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             YQP YTAPPR   +ET IDI GGW ISGTPLDL DPRLLAIAE
Sbjct  104  SYQPDYTAPPRPPTDETAIDIGGGWTISGTPLDLRDPRLLAIAE  147



>ref|XP_010258346.1| PREDICTED: uncharacterized protein LOC104598128 [Nelumbo nucifera]
 ref|XP_010258347.1| PREDICTED: uncharacterized protein LOC104598128 [Nelumbo nucifera]
Length=288

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 118/166 (71%), Gaps = 10/166 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLV--KTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI  253
            MG+H ++  D+L+   T +   G  V G      + ++A  S  AV EDK V     ++ 
Sbjct  1    MGDHLILYVDRLITPATLQSMQGADVSGPSGEGSRAQTAVPSGPAV-EDKRV-----EEH  54

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
            +V+DEE PL+   ECRICQEED +KNLETPCACSGSLK+AHRKCVQ WCNEKGDITCEIC
Sbjct  55   DVSDEEEPLLQTMECRICQEEDHIKNLETPCACSGSLKFAHRKCVQRWCNEKGDITCEIC  114

Query  434  HQPYQPGYTAPPRSQPE-ETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            HQ YQPGYTAPP      ETTIDI G W ISG+PLDLHDPRLLA+A
Sbjct  115  HQSYQPGYTAPPPPPRPLETTIDISGAWTISGSPLDLHDPRLLAMA  160



>ref|XP_004297302.1| PREDICTED: uncharacterized protein LOC101305065 [Fragaria vesca 
subsp. vesca]
 ref|XP_011463070.1| PREDICTED: uncharacterized protein LOC101305065 [Fragaria vesca 
subsp. vesca]
 ref|XP_011463071.1| PREDICTED: uncharacterized protein LOC101305065 [Fragaria vesca 
subsp. vesca]
Length=284

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 114/167 (68%), Gaps = 14/167 (8%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIE----KKTESAGTSSSAVVEDKVVGMGKEK  247
            M +H V+  D+L++   + S  P + A  ++    +K ++A  + +        G     
Sbjct  1    MSDHLVLYVDRLIRP--MVSQPPSEPAAEVKPDLPEKEDAAAETEAGCSSSAAEG-----  53

Query  248  DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
               V +EE PLI   ECRICQ+EDSV NLETPCAC GSLKYAHRKCVQHWCNEKGDITCE
Sbjct  54   ---VEEEEEPLIQTAECRICQDEDSVSNLETPCACCGSLKYAHRKCVQHWCNEKGDITCE  110

Query  428  ICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIAE  568
            ICHQ YQPGYTAPPR  P+ETTI+IGGW +SG PL L DPR+L+I E
Sbjct  111  ICHQTYQPGYTAPPRPHPDETTIEIGGWTLSGAPLSLDDPRILSITE  157



>emb|CDP20951.1| unnamed protein product [Coffea canephora]
Length=299

 Score =   180 bits (456),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 118/169 (70%), Gaps = 18/169 (11%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTS----SSAVVE--DKVVGMGK  241
            MGE  +V  D ++  D + S            K+E AGTS    SS +V     V+ + +
Sbjct  1    MGEDLIVKVDHVITPDALQSA----------PKSEGAGTSVERSSSHLVNPPASVIDIKE  50

Query  242  EKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDIT  421
            ++D  V ++E PLI   ECRICQEEDS+KNLE PCACSGSLK+AHR CVQ WC+EKG IT
Sbjct  51   DEDDNVGEDE-PLIQTVECRICQEEDSIKNLEVPCACSGSLKFAHRACVQRWCDEKGGIT  109

Query  422  CEICHQPYQPGYTAPPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            CEICHQPYQP YTAPP + PE+T IDIG GW I+GTP+DL+DPRL+A+A
Sbjct  110  CEICHQPYQPNYTAPPPTLPEDTAIDIGEGWTIAGTPVDLNDPRLIAMA  158



>ref|XP_010937150.1| PREDICTED: uncharacterized protein LOC105056595 [Elaeis guineensis]
Length=291

 Score =   179 bits (454),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 112/163 (69%), Gaps = 1/163 (1%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MGEH V+N D+L     + +    +G+   E+ T+     S   V        +E++   
Sbjct  1    MGEHLVLNVDRLETPQHIETKRGKEGSSSSEEATDGPSVPSPLPVGSSKDKEEEEEEHID  60

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             DEE PLI + ECRICQEED +KNLETPC C+GSLKYAHR CVQHWCNEKGDITCEICH+
Sbjct  61   DDEEEPLIRMVECRICQEEDHIKNLETPCGCNGSLKYAHRACVQHWCNEKGDITCEICHE  120

Query  440  PYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIA  565
             Y+PGYTAPPR  P+ET IDI G W I+G PLDLHD R+LA+A
Sbjct  121  QYKPGYTAPPRVHPDETAIDISGDWTITGAPLDLHDHRILAMA  163



>ref|XP_006440600.1| hypothetical protein CICLE_v10021492mg [Citrus clementina]
 gb|ESR53840.1| hypothetical protein CICLE_v10021492mg [Citrus clementina]
Length=227

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 116/164 (71%), Gaps = 7/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+L+  D + S    + +   E+ + S    S AVV      M + ++  V
Sbjct  1    MSDHLVLCVDRLLTPDSLPSMQGTESSASSEEGSSSHSVDSPAVV-----SMKEAEEHGV  55

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            +DEE PLI   ECRICQEEDS+KNLE PC+CSGSLKYAHRKCVQ WCNEKGD+TCEICHQ
Sbjct  56   SDEEEPLIQTVECRICQEEDSIKNLEVPCSCSGSLKYAHRKCVQRWCNEKGDVTCEICHQ  115

Query  440  PYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            PYQPGYTA PP  Q E+TTIDI   W +SG PLDLHDPRL+A+A
Sbjct  116  PYQPGYTAPPPPPQSEDTTIDISEAWTVSGAPLDLHDPRLVAMA  159



>ref|XP_004138916.1| PREDICTED: uncharacterized protein LOC101203306 [Cucumis sativus]
 gb|KGN61376.1| hypothetical protein Csa_2G100580 [Cucumis sativus]
Length=309

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 98/124 (79%), Gaps = 9/124 (7%)
 Frame = +2

Query  200  SSAVVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHR  379
            S+A   D+ V      + +  +E+ PLI + ECRICQEEDS+ NLETPCACSGSLKYAHR
Sbjct  49   STATAHDRTV------ETDAPNEDDPLIQVAECRICQEEDSLNNLETPCACSGSLKYAHR  102

Query  380  KCVQHWCNEKGDITCEICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLL  556
            KCVQHWCNEKGDITCEICHQPYQPGYTAPPRS  EET ID+ G W I+G PLDL D RLL
Sbjct  103  KCVQHWCNEKGDITCEICHQPYQPGYTAPPRS--EETAIDMEGRWTIAGNPLDLRDTRLL  160

Query  557  AIAE  568
            AIAE
Sbjct  161  AIAE  164



>ref|XP_003577386.1| PREDICTED: uncharacterized protein LOC100843600 [Brachypodium 
distachyon]
Length=283

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 110/163 (67%), Gaps = 16/163 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H VVN D        GS    DG    EK +E+   +++ V    VV +  E     
Sbjct  1    MGDHVVVNVD--------GSANGKDGGI-AEKPSEA--VTAALVASSAVVDLVDED----  45

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              E+ PLI   ECRICQEEDSVKNLE PC C+GSLKYAHR CVQ WCNEKGDI CEICH+
Sbjct  46   GGEDEPLIQAAECRICQEEDSVKNLEKPCNCNGSLKYAHRACVQRWCNEKGDIMCEICHE  105

Query  440  PYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIA  565
             Y+PGYTAPPR QP+ET IDI G W I+GTPLDL DPR+LA+A
Sbjct  106  QYKPGYTAPPRVQPDETAIDISGDWTITGTPLDLRDPRILAVA  148



>ref|XP_006477456.1| PREDICTED: uncharacterized protein LOC102627455 isoform X1 [Citrus 
sinensis]
 ref|XP_006477457.1| PREDICTED: uncharacterized protein LOC102627455 isoform X2 [Citrus 
sinensis]
Length=289

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 118/164 (72%), Gaps = 6/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+L+  D + S    + +   E+ + S    S A V    + M + ++ +V
Sbjct  1    MSDHLVLCVDRLLTPDSLPSMQGTESSASSEEGSSSHSVDSPACV----ISMKEAEEHDV  56

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ++EE PLI   ECRICQEEDS+KNLE PC+CSGSLKYAHRKCVQ WCNEKGD+TCEICHQ
Sbjct  57   SNEEEPLIQTVECRICQEEDSIKNLEVPCSCSGSLKYAHRKCVQRWCNEKGDVTCEICHQ  116

Query  440  PYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            PYQPGYTA PP  Q E+TTIDI   W +SGTPLDLHDPRL+A+A
Sbjct  117  PYQPGYTAPPPPPQSEDTTIDISEAWTVSGTPLDLHDPRLVAMA  160



>ref|XP_002284912.1| PREDICTED: uncharacterized protein LOC100250124 [Vitis vinifera]
 ref|XP_010663358.1| PREDICTED: uncharacterized protein LOC100250124 [Vitis vinifera]
 emb|CBI15222.3| unnamed protein product [Vitis vinifera]
Length=291

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 115/167 (69%), Gaps = 10/167 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGS--GLPVDGAKHIEKKTESAGT--SSSAVVEDKVVGMGKEK  247
            MG+H V+  D+L+K   + S  G  V G+     +   + T   S++ +EDK +      
Sbjct  1    MGDHLVLCVDRLIKPQTLQSLQGTEVSGSSEGGDEGSCSHTVDPSTSALEDKGLEEHHGP  60

Query  248  DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
            + E       LI   ECRICQEEDS+KNLE PCACSGSLK+AHRKCVQ WCNEKGD+TCE
Sbjct  61   EEEEP-----LIQTVECRICQEEDSIKNLEVPCACSGSLKFAHRKCVQRWCNEKGDVTCE  115

Query  428  ICHQPYQPGYTAPPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            ICHQPYQPGYTAPP  Q E+ TIDI  GW ISGTPLDL+DPRLLA+A
Sbjct  116  ICHQPYQPGYTAPPPPQSEDATIDISEGWTISGTPLDLNDPRLLAMA  162



>tpg|DAA40086.1| TPA: hypothetical protein ZEAMMB73_046641 [Zea mays]
Length=240

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 111/164 (68%), Gaps = 11/164 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH ++N D L   +      P +    ++ K+     +    +   ++ +G+     +
Sbjct  1    MKEHLMLNIDDLSILE------PNEVIGTVKNKSSGETIAHPPSMAHAILAVGES----M  50

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              E  PL+ + ECRICQEEDS+KNLE+PCAC+GSLKYAHR CVQ WCNEKGD+TCEICH+
Sbjct  51   VSEAEPLLQVVECRICQEEDSIKNLESPCACTGSLKYAHRTCVQRWCNEKGDVTCEICHE  110

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PY+ GYTAPPR  P+ETTIDI GGW I+GT  DL DPR+LA+A+
Sbjct  111  PYEHGYTAPPRGHPDETTIDISGGWTITGTAFDLRDPRILAVAQ  154



>ref|XP_008441710.1| PREDICTED: uncharacterized protein LOC103485788 [Cucumis melo]
 ref|XP_008441711.1| PREDICTED: uncharacterized protein LOC103485788 [Cucumis melo]
Length=290

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 100/126 (79%), Gaps = 9/126 (7%)
 Frame = +2

Query  194  TSSSAVVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYA  373
            +SS+A   D+ +      + +  +E+ PLI + ECRICQEEDS+ NLETPCACSGSLKYA
Sbjct  45   SSSTATPHDRTL------EPDAPNEDDPLILVAECRICQEEDSLSNLETPCACSGSLKYA  98

Query  374  HRKCVQHWCNEKGDITCEICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPR  550
            HRKCVQHWCNEKGDITCEICHQPYQPGYTAPPRS  EET ID+ G W I+G PLDL D R
Sbjct  99   HRKCVQHWCNEKGDITCEICHQPYQPGYTAPPRS--EETAIDMEGRWTIAGNPLDLRDTR  156

Query  551  LLAIAE  568
            LLAIAE
Sbjct  157  LLAIAE  162



>ref|XP_006440601.1| hypothetical protein CICLE_v10021492mg [Citrus clementina]
 gb|ESR53841.1| hypothetical protein CICLE_v10021492mg [Citrus clementina]
Length=288

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 116/164 (71%), Gaps = 7/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+L+  D + S    + +   E+ + S    S AVV      M + ++  V
Sbjct  1    MSDHLVLCVDRLLTPDSLPSMQGTESSASSEEGSSSHSVDSPAVV-----SMKEAEEHGV  55

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            +DEE PLI   ECRICQEEDS+KNLE PC+CSGSLKYAHRKCVQ WCNEKGD+TCEICHQ
Sbjct  56   SDEEEPLIQTVECRICQEEDSIKNLEVPCSCSGSLKYAHRKCVQRWCNEKGDVTCEICHQ  115

Query  440  PYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            PYQPGYTA PP  Q E+TTIDI   W +SG PLDLHDPRL+A+A
Sbjct  116  PYQPGYTAPPPPPQSEDTTIDISEAWTVSGAPLDLHDPRLVAMA  159



>ref|XP_006605567.1| PREDICTED: uncharacterized protein LOC100817542 [Glycine max]
Length=286

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PL+ + ECRICQEEDSV  LETPC+CSGSLKYAHRKCVQ WCNEKGDITCEICH+ Y+PG
Sbjct  59   PLLQLAECRICQEEDSVSGLETPCSCSGSLKYAHRKCVQRWCNEKGDITCEICHKSYEPG  118

Query  455  YTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            YTA PPR QPEETT+DI GGW ISGTPLDL DPRLLAIAE
Sbjct  119  YTAPPPRPQPEETTLDIGGGWTISGTPLDLRDPRLLAIAE  158



>ref|XP_011017093.1| PREDICTED: uncharacterized protein LOC105120538 [Populus euphratica]
Length=280

 Score =   176 bits (447),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 114/167 (68%), Gaps = 17/167 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPV--DGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI  253
            M +H V++ D+L++        PV  +  + + K+ ++  +SS A         GKE   
Sbjct  1    MSDHVVLDVDRLIRP-------PVTEESFQAVVKEADAGPSSSRASEGTDGHVSGKEG--  51

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
                EE PLI   ECRICQEEDS+ NLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC
Sbjct  52   ----EEEPLIQGGECRICQEEDSISNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  107

Query  434  HQPYQPGYTAPPR-SQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            HQPYQP YTAPP     E+T IDI GGW ISG+ LDL DPRLLAIAE
Sbjct  108  HQPYQPDYTAPPHPPNSEDTAIDIGGGWTISGSQLDLRDPRLLAIAE  154



>ref|XP_006395746.1| hypothetical protein EUTSA_v10004698mg [Eutrema salsugineum]
 ref|XP_006395747.1| hypothetical protein EUTSA_v10004698mg [Eutrema salsugineum]
 gb|ESQ33032.1| hypothetical protein EUTSA_v10004698mg [Eutrema salsugineum]
 gb|ESQ33033.1| hypothetical protein EUTSA_v10004698mg [Eutrema salsugineum]
Length=295

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 114/164 (70%), Gaps = 19/164 (12%)
 Frame = +2

Query  89   HSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEVADE  268
            H VVN D+L +       LP   ++    ++ES          + +  +  EK I+++DE
Sbjct  10   HMVVNVDELTRP----VPLPPVNSEIENTRSESP---------EPLTVVANEKAIDISDE  56

Query  269  EA--PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQP  442
            E   PLI   ECRICQ+E  +KNLE+PCACSGSLKYAHRKCVQ WCNEKG+I CEICHQP
Sbjct  57   EENEPLIASGECRICQDECPIKNLESPCACSGSLKYAHRKCVQRWCNEKGNIICEICHQP  116

Query  443  YQPGYTAPPRS-QPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            YQPG+TAPP   QPEETTIDI GGW ISG  LDLHDPRLLAIAE
Sbjct  117  YQPGFTAPPPPLQPEETTIDIGGGWTISG--LDLHDPRLLAIAE  158



>ref|XP_002312245.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE89612.1| zinc finger family protein [Populus trichocarpa]
Length=280

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 114/167 (68%), Gaps = 17/167 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPV--DGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI  253
            M +H V++ D+L+K        PV  +  + I K+ + AG S S   E     +  E+  
Sbjct  1    MSDHVVLDVDRLIKP-------PVTEESVQAIVKEAD-AGPSCSRASEGTDGRVSGEEG-  51

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
                EE PLI   ECRICQEEDS+ NLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC
Sbjct  52   ----EEEPLIQGGECRICQEEDSISNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  107

Query  434  HQPYQPGYTAPPR-SQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            HQPYQP YTAPP     E+T IDI GGW ISGT LDL DPRLLAIAE
Sbjct  108  HQPYQPDYTAPPHPPHSEDTAIDIGGGWTISGTQLDLRDPRLLAIAE  154



>ref|XP_004956801.1| PREDICTED: uncharacterized protein LOC101773583 [Setaria italica]
Length=274

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 5/153 (3%)
 Frame = +2

Query  113  LVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEVADEEAPLIGIR  292
            ++  D++    P +    ++  +     +    +   ++ MG+     +  EE PL+ + 
Sbjct  1    MLNVDDLIVPEPNEATGAVKNTSSGEAIAHPPSMAHAILAMGES----MVSEEEPLLQMV  56

Query  293  ECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGYTAPPR  472
            ECRICQEEDS+KNLE+PCAC+GSLKYAHR CVQ WCNEKGD+TCEICH+PY+ GYTAPPR
Sbjct  57   ECRICQEEDSIKNLESPCACTGSLKYAHRACVQRWCNEKGDVTCEICHEPYEHGYTAPPR  116

Query  473  SQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            + P+ETTIDI GGW I+GT  DL DPR+LA+A+
Sbjct  117  AHPDETTIDISGGWTITGTAFDLRDPRILAVAQ  149



>ref|NP_001150513.1| LOC100284144 [Zea mays]
 ref|XP_008668070.1| PREDICTED: LOC100284144 isoform X1 [Zea mays]
 gb|ACN26533.1| unknown [Zea mays]
 tpg|DAA40087.1| TPA: protein binding protein isoform 1 [Zea mays]
 tpg|DAA40088.1| TPA: protein binding protein isoform 2 [Zea mays]
Length=279

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 111/164 (68%), Gaps = 11/164 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH ++N D L   +      P +    ++ K+     +    +   ++ +G+     +
Sbjct  1    MKEHLMLNIDDLSILE------PNEVIGTVKNKSSGETIAHPPSMAHAILAVGES----M  50

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              E  PL+ + ECRICQEEDS+KNLE+PCAC+GSLKYAHR CVQ WCNEKGD+TCEICH+
Sbjct  51   VSEAEPLLQVVECRICQEEDSIKNLESPCACTGSLKYAHRTCVQRWCNEKGDVTCEICHE  110

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PY+ GYTAPPR  P+ETTIDI GGW I+GT  DL DPR+LA+A+
Sbjct  111  PYEHGYTAPPRGHPDETTIDISGGWTITGTAFDLRDPRILAVAQ  154



>gb|ACG39364.1| protein binding protein [Zea mays]
Length=279

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 111/164 (68%), Gaps = 11/164 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH ++N D L   +      P +    ++ K+     +    +   ++ +G+     +
Sbjct  1    MKEHLMLNIDDLSILE------PNEVIGTVKNKSSGETIAHPPSMAHAILAVGES----M  50

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              E  PL+ + ECRICQEEDS+KNLE+PCAC+GSLKYAHR CVQ WCNEKGD+TCEICH+
Sbjct  51   VSEAEPLLQVVECRICQEEDSIKNLESPCACTGSLKYAHRTCVQRWCNEKGDVTCEICHE  110

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PY+ GYTAPPR  P+ETTIDI GGW I+GT  DL DPR+LA+A+
Sbjct  111  PYEHGYTAPPRGHPDETTIDISGGWTITGTAFDLRDPRILAVAQ  154



>ref|XP_008239941.1| PREDICTED: uncharacterized protein LOC103338510 [Prunus mume]
 ref|XP_008239943.1| PREDICTED: uncharacterized protein LOC103338510 [Prunus mume]
 ref|XP_008239944.1| PREDICTED: uncharacterized protein LOC103338510 [Prunus mume]
 ref|XP_008239945.1| PREDICTED: uncharacterized protein LOC103338510 [Prunus mume]
Length=289

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 118/166 (71%), Gaps = 10/166 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGS--GLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI  253
            MG+H V+  D+  K + + S  G    G+      ++SA   + A+    V G+G++   
Sbjct  1    MGDHLVLCVDRFTKPESLQSPQGNEAPGSSSEGSCSQSAELPTHAI---DVKGVGEKV--  55

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
             V++EE PLI   ECRICQEEDSVKNLE PC CSGSLK+AHRKCVQ WCNEKGDITCEIC
Sbjct  56   -VSEEEEPLIQTVECRICQEEDSVKNLEVPCTCSGSLKFAHRKCVQRWCNEKGDITCEIC  114

Query  434  HQPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            HQPYQPGYTA PP  Q E+TTIDI  GW ISGTPLDL DPRLLA+A
Sbjct  115  HQPYQPGYTAPPPPPQSEDTTIDISEGWTISGTPLDLRDPRLLAMA  160



>emb|CDY03025.1| BnaC07g22020D [Brassica napus]
Length=293

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 109/162 (67%), Gaps = 17/162 (10%)
 Frame = +2

Query  89   HSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEVADE  268
            H VVN D L         +P   +  +  + E+    S+ VV DK + +  ++      E
Sbjct  10   HMVVNVDGL---------MPPVPSPPVNAEVENIREESTVVVNDKAIDISDDE----GQE  56

Query  269  EAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQ  448
              PLI   ECRICQ+E  +K LE+PCACSGSLKYAHRKCVQ WCNEKG+I CEICHQPYQ
Sbjct  57   NEPLIASAECRICQDECPIKTLESPCACSGSLKYAHRKCVQRWCNEKGNIICEICHQPYQ  116

Query  449  PGYTAPPRS-QPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PGYTAPP S QPEETTIDI GGW ISG  LDLHDPRLL IAE
Sbjct  117  PGYTAPPPSPQPEETTIDIGGGWTISG--LDLHDPRLLPIAE  156



>dbj|BAJ89773.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03689.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88644.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=278

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 112/162 (69%), Gaps = 12/162 (7%)
 Frame = +2

Query  86   EHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEVAD  265
            +H ++N D+L+    V   + V GA    K + S  T++  +       +G      +  
Sbjct  4    DHLMLNVDRLM----VPEPIEVTGAP---KSSSSRDTTALPITGHSFFAVGDS----MVP  52

Query  266  EEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPY  445
            EE PL+ + ECRICQEED +KNLE+PCAC+GS+KYAHR CVQ WCNEKGD+TCEICH+PY
Sbjct  53   EEEPLLQMTECRICQEEDDIKNLESPCACTGSVKYAHRACVQRWCNEKGDVTCEICHEPY  112

Query  446  QPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            + GYTAPPR  P+ETTIDI GGW I+GT  DL DPR+LA+A+
Sbjct  113  EHGYTAPPRPHPDETTIDISGGWTITGTAFDLRDPRILAVAQ  154



>ref|XP_009369292.1| PREDICTED: uncharacterized protein LOC103958715 [Pyrus x bretschneideri]
 ref|XP_009369293.1| PREDICTED: uncharacterized protein LOC103958715 [Pyrus x bretschneideri]
 ref|XP_009369294.1| PREDICTED: uncharacterized protein LOC103958715 [Pyrus x bretschneideri]
Length=286

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 116/165 (70%), Gaps = 11/165 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEV-GSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE  256
            MG+H V+  D   K + + GS  P  G+      + SA   + A+    V G+G++    
Sbjct  1    MGDHLVLCVDHFTKPESLQGSENP--GSSVEGSCSHSAKLPTCAI---DVKGVGEKT---  52

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            V++EE PLI   ECRICQEEDSVKNLE PC+CSGSLK+AHRKCVQ WCNEKGDI CEICH
Sbjct  53   VSEEEEPLIQTVECRICQEEDSVKNLEVPCSCSGSLKFAHRKCVQRWCNEKGDIICEICH  112

Query  437  QPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            QPYQ GYTA PP  Q E+TTIDI  GW ISGTPLDL DPRLLA+A
Sbjct  113  QPYQHGYTAPPPPPQSEDTTIDISDGWTISGTPLDLRDPRLLAMA  157



>ref|XP_009587067.1| PREDICTED: uncharacterized protein LOC104084817 isoform X2 [Nicotiana 
tomentosiformis]
Length=310

 Score =   175 bits (444),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 110/164 (67%), Gaps = 8/164 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVV-EDKVVGMGKEKDIE  256
            M EH V+  D+L+  + + S LP       E    S G S S VV    V+    ++   
Sbjct  1    MEEHLVLCVDRLITPESLHS-LP-----RSEDAESSGGRSCSQVVGTSSVIDANDDEHPG  54

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            V  EE PL+   ECRICQEEDSVKNLE PC CSGSLKYAHRKCVQ WC+EKGDITCEICH
Sbjct  55   VGGEEEPLLQNVECRICQEEDSVKNLEVPCRCSGSLKYAHRKCVQRWCDEKGDITCEICH  114

Query  437  QPYQPGYTA-PPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            QPYQ GYTA PP  Q E+T IDI GW + GT +DLHDPRLLA+A
Sbjct  115  QPYQSGYTAPPPPPQSEDTAIDIRGWTVGGTQIDLHDPRLLAMA  158



>ref|XP_010029833.1| PREDICTED: uncharacterized protein LOC104419767 [Eucalyptus grandis]
Length=286

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 110/167 (66%), Gaps = 14/167 (8%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH V+  D  +  +          ++ +EK  + AG  SS+   D      + +DI+V
Sbjct  1    MSEHLVLCVDHFITPER---------SQSLEKAAKPAGEGSSSHTADPATSAVEVEDIQV  51

Query  260  AD---EEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  430
             +   EE PLI   ECRICQEEDS+KNLETPCACSGSLKYAHRKCVQ WCNEKGD+ CEI
Sbjct  52   INTCEEEEPLIQTVECRICQEEDSIKNLETPCACSGSLKYAHRKCVQRWCNEKGDVICEI  111

Query  431  CHQPYQPGYTAPPR-SQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            CHQ Y+PGYTAPP     E+  IDI  GW ++G PLDL DPR+LA+A
Sbjct  112  CHQAYEPGYTAPPAPPNSEDAAIDISEGWTLAGAPLDLRDPRILAMA  158



>ref|XP_009800764.1| PREDICTED: uncharacterized protein LOC104246615 isoform X2 [Nicotiana 
sylvestris]
Length=310

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 111/164 (68%), Gaps = 8/164 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVV-EDKVVGMGKEKDIE  256
            M EH V+  D+L+  + + S LP       E    S G S S VV    V+     + + 
Sbjct  1    MEEHLVLCVDRLITPESLHS-LP-----RSEDAESSVGRSCSQVVGTSSVIDANDNEHLG  54

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            V  EE PL+   ECRICQEEDSVKNLE PC CSGSLKYAHRKCVQ WC+EKGDITCEICH
Sbjct  55   VGGEEEPLLQNVECRICQEEDSVKNLEVPCRCSGSLKYAHRKCVQRWCDEKGDITCEICH  114

Query  437  QPYQPGYTA-PPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            QPYQPGYTA PP  Q E+T IDI GW + GT +DLHDPRLLA+A
Sbjct  115  QPYQPGYTAPPPPPQSEDTAIDIRGWTVGGTQIDLHDPRLLAMA  158



>ref|XP_009339242.1| PREDICTED: uncharacterized protein LOC103931466 [Pyrus x bretschneideri]
 ref|XP_009339250.1| PREDICTED: uncharacterized protein LOC103931466 [Pyrus x bretschneideri]
 ref|XP_009339258.1| PREDICTED: uncharacterized protein LOC103931466 [Pyrus x bretschneideri]
 ref|XP_009339268.1| PREDICTED: uncharacterized protein LOC103931466 [Pyrus x bretschneideri]
 ref|XP_009339273.1| PREDICTED: uncharacterized protein LOC103931466 [Pyrus x bretschneideri]
Length=287

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 118/165 (72%), Gaps = 11/165 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEV-GSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE  256
            MG+H V+  D+  KT+ + GS  P  G+      ++SA   + A+    V G+G++    
Sbjct  1    MGDHLVLCVDRFTKTESLQGSETP--GSSVEGSSSQSAELPTCAI---DVKGVGEKA---  52

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            VA+EE PLI   ECRICQEEDSVKNLE PC+CSGSLK+AHRKCVQ WCNEKGDI CEICH
Sbjct  53   VAEEEEPLIQTVECRICQEEDSVKNLEVPCSCSGSLKFAHRKCVQRWCNEKGDIICEICH  112

Query  437  QPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            Q YQP YTA PP  Q E+TTIDI  GW ISGTPLDL DPRLLA+A
Sbjct  113  QSYQPDYTAPPPPPQSEDTTIDISDGWTISGTPLDLRDPRLLAMA  157



>ref|XP_009403166.1| PREDICTED: uncharacterized protein LOC103986795 [Musa acuminata 
subsp. malaccensis]
Length=291

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 117/167 (70%), Gaps = 11/167 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEK----  247
            MG+H V++ D+L+    V +    +G        E+A   +  +      G G EK    
Sbjct  1    MGDHVVLHVDRLMTPQTVET----EGGS--ASSAEAAPVPALTLSSISEAGSGDEKGGQE  54

Query  248  DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
            + +VA+EE PLI + +CRICQEED +KNLE PCACSGSLKYAHR CVQ WCNEKGD TCE
Sbjct  55   ESKVAEEEEPLIQMVDCRICQEEDHIKNLEAPCACSGSLKYAHRACVQRWCNEKGDTTCE  114

Query  428  ICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            ICH+ Y+PGYTAPPR  P+ETTI+I GGW I+G+PLDLH+PR+LA+A
Sbjct  115  ICHEQYKPGYTAPPRGHPDETTIEINGGWIITGSPLDLHNPRILAMA  161



>ref|XP_010097611.1| E3 ubiquitin-protein ligase MARCH3 [Morus notabilis]
 gb|EXB69690.1| E3 ubiquitin-protein ligase MARCH3 [Morus notabilis]
Length=301

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 118/173 (68%), Gaps = 16/173 (9%)
 Frame = +2

Query  80   MGEHSVVNFDQLVK---------TDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVG  232
            M +H VV  D+L++         + EV    PVDG         +AG   S+   D+   
Sbjct  1    MSDHMVVFVDRLIRPVAVQSAAESSEVSGSGPVDGGADGGPGPNAAGPGPSSSATDE---  57

Query  233  MGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKG  412
              K++D E   EE PLI   ECRICQEEDS+K+LETPCACSGSLKYAHRKCVQHWCNEKG
Sbjct  58   --KQEDEEGLGEEEPLIQTAECRICQEEDSLKDLETPCACSGSLKYAHRKCVQHWCNEKG  115

Query  413  DITCEICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            D  CEICHQPYQPGYTAPP   P+ET I+I GGW ISGTPL+L DPRLLAIAE
Sbjct  116  DTICEICHQPYQPGYTAPPPPPPDETAIEIGGGWTISGTPLEL-DPRLLAIAE  167



>ref|XP_004509969.1| PREDICTED: uncharacterized protein LOC101495932 [Cicer arietinum]
Length=287

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 88/99 (89%), Gaps = 2/99 (2%)
 Frame = +2

Query  278  LIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGY  457
            L+ + ECRICQ+EDS+ NLE+PCACSGSLKYAHRKCVQ WCNEKGDITCEICH+ Y+PGY
Sbjct  62   LLQMAECRICQDEDSINNLESPCACSGSLKYAHRKCVQRWCNEKGDITCEICHKSYEPGY  121

Query  458  TA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            TA PPR  PEETTIDI GGW ISGTPLDL DPRLLAIAE
Sbjct  122  TAPPPRPNPEETTIDIGGGWTISGTPLDLRDPRLLAIAE  160



>ref|XP_009800765.1| PREDICTED: uncharacterized protein LOC104246615 isoform X3 [Nicotiana 
sylvestris]
Length=248

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 111/165 (67%), Gaps = 9/165 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVV-EDKVVGMGKEKDIE  256
            M EH V+  D+L+  + + S LP       E    S G S S VV    V+     + + 
Sbjct  1    MEEHLVLCVDRLITPESLHS-LP-----RSEDAESSVGRSCSQVVGTSSVIDANDNEHLG  54

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            V  EE PL+   ECRICQEEDSVKNLE PC CSGSLKYAHRKCVQ WC+EKGDITCEICH
Sbjct  55   VGGEEEPLLQNVECRICQEEDSVKNLEVPCRCSGSLKYAHRKCVQRWCDEKGDITCEICH  114

Query  437  QPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            QPYQPGYTA PP  Q E+T IDI  GW + GT +DLHDPRLLA+A
Sbjct  115  QPYQPGYTAPPPPPQSEDTAIDISRGWTVGGTQIDLHDPRLLAMA  159



>ref|XP_002273832.1| PREDICTED: uncharacterized protein LOC100256824 [Vitis vinifera]
 ref|XP_010652040.1| PREDICTED: uncharacterized protein LOC100256824 [Vitis vinifera]
 emb|CAN70908.1| hypothetical protein VITISV_040117 [Vitis vinifera]
Length=279

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 115/165 (70%), Gaps = 16/165 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+ ++        PV      E   E+AG S+S V +DK V   +  +   
Sbjct  1    MSDHLVLYVDRPIR--------PVTSQSVQEAGAETAGPSTS-VADDKRVEENEGSN---  48

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE P + + ECRICQEEDS++NLETPCACSGSLKYAHRKCVQ WCNEKGDI CEICHQ
Sbjct  49   --EEEPFLKMMECRICQEEDSLENLETPCACSGSLKYAHRKCVQRWCNEKGDIICEICHQ  106

Query  440  PYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTA PP   PE+T IDI GGW ISGTPLDL DPRLLA+AE
Sbjct  107  PYQPGYTAPPPPPHPEDTAIDIGGGWTISGTPLDLRDPRLLAMAE  151



>gb|KHN28147.1| E3 ubiquitin-protein ligase MARCH3, partial [Glycine soja]
Length=230

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 89/102 (87%), Gaps = 2/102 (2%)
 Frame = +2

Query  269  EAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQ  448
            +APL+ + ECRICQEEDSV +LETPC+CSGSLKYAHRKCVQ WCNEKGDI CEICH+ Y+
Sbjct  1    DAPLLQLAECRICQEEDSVSDLETPCSCSGSLKYAHRKCVQRWCNEKGDIICEICHKSYE  60

Query  449  PGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PGYTA PPR QPEETTIDI GGW ISG PLDL D RLLAIAE
Sbjct  61   PGYTAPPPRPQPEETTIDIGGGWTISGMPLDLRDTRLLAIAE  102



>ref|XP_003578110.1| PREDICTED: uncharacterized protein LOC100834851 [Brachypodium 
distachyon]
 ref|XP_010238157.1| PREDICTED: uncharacterized protein LOC100834851 [Brachypodium 
distachyon]
 ref|XP_010238158.1| PREDICTED: uncharacterized protein LOC100834851 [Brachypodium 
distachyon]
Length=278

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 110/165 (67%), Gaps = 13/165 (8%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVG-SGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE  256
            M +H ++N D+L+  + +  +G P   +           + S   V D ++         
Sbjct  1    MKDHLMLNVDRLMVPEPIEVTGAPKSSSSRDVTAQLPPTSHSFFAVGDSMI---------  51

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
               EE PL+ + ECRICQEED +KNLE+PCAC+GS+KYAHR CVQ WCNEKGD+TCEICH
Sbjct  52   --PEEEPLLQMLECRICQEEDDIKNLESPCACTGSVKYAHRACVQRWCNEKGDVTCEICH  109

Query  437  QPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            +PY+ GYTAPPR  P+ETTIDI GGW I+GT  DL DPR+LA+A+
Sbjct  110  EPYEHGYTAPPRPHPDETTIDISGGWTITGTTFDLRDPRILAVAQ  154



>ref|XP_006354779.1| PREDICTED: uncharacterized protein LOC102584648 isoform X3 [Solanum 
tuberosum]
 ref|XP_006354780.1| PREDICTED: uncharacterized protein LOC102584648 isoform X4 [Solanum 
tuberosum]
Length=298

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 109/164 (66%), Gaps = 8/164 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH V+  D L+  + + S LP       E    S GTS +  V        +E +   
Sbjct  1    MEEHLVLRVDHLITPESLHS-LP-----RPEHTEFSGGTSVTQTVGTSSGIDAQENEYPR  54

Query  260  A-DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            A DEE PL+   ECRICQEEDS+KNLE PC CSGSLKYAHRKCVQ WC+EKGDITCEICH
Sbjct  55   AGDEEEPLLQTVECRICQEEDSLKNLEMPCGCSGSLKYAHRKCVQRWCDEKGDITCEICH  114

Query  437  QPYQPGYTA-PPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            Q YQPGYTA PP  Q E+T+IDI GW + GT +D HDPRLLA+A
Sbjct  115  QLYQPGYTARPPPPQSEDTSIDIRGWTVGGTQVDFHDPRLLAMA  158



>ref|XP_008339898.1| PREDICTED: uncharacterized protein LOC103402896 isoform X1 [Malus 
domestica]
 ref|XP_008339899.1| PREDICTED: uncharacterized protein LOC103402896 isoform X1 [Malus 
domestica]
 ref|XP_008339900.1| PREDICTED: uncharacterized protein LOC103402896 isoform X1 [Malus 
domestica]
Length=289

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = +2

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            A+E+  LI   ECRICQ+EDS+ NLE+PCAC GSLKYAHRKCVQHWCNEKGDITCEICHQ
Sbjct  52   AEEDEXLIQTAECRICQDEDSISNLESPCACCGSLKYAHRKCVQHWCNEKGDITCEICHQ  111

Query  440  PYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR   +ETTI+ GG W +SGTPL L DPR+L+IAE
Sbjct  112  PYQPGYTAPPRPPSDETTIEFGGAWTLSGTPLSLDDPRILSIAE  155



>ref|XP_008339901.1| PREDICTED: uncharacterized protein LOC103402896 isoform X2 [Malus 
domestica]
Length=282

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = +2

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            A+E+  LI   ECRICQ+EDS+ NLE+PCAC GSLKYAHRKCVQHWCNEKGDITCEICHQ
Sbjct  52   AEEDEXLIQTAECRICQDEDSISNLESPCACCGSLKYAHRKCVQHWCNEKGDITCEICHQ  111

Query  440  PYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR   +ETTI+ GG W +SGTPL L DPR+L+IAE
Sbjct  112  PYQPGYTAPPRPPSDETTIEFGGAWTLSGTPLSLDDPRILSIAE  155



>ref|XP_006354777.1| PREDICTED: uncharacterized protein LOC102584648 isoform X1 [Solanum 
tuberosum]
 ref|XP_006354778.1| PREDICTED: uncharacterized protein LOC102584648 isoform X2 [Solanum 
tuberosum]
Length=299

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 109/164 (66%), Gaps = 8/164 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH V+  D L+  + + S LP       E    S GTS +  V        +E +   
Sbjct  1    MEEHLVLRVDHLITPESLHS-LP-----RPEHTEFSGGTSVTQTVGTSSGIDAQENEYPR  54

Query  260  A-DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            A DEE PL+   ECRICQEEDS+KNLE PC CSGSLKYAHRKCVQ WC+EKGDITCEICH
Sbjct  55   AGDEEEPLLQTVECRICQEEDSLKNLEMPCGCSGSLKYAHRKCVQRWCDEKGDITCEICH  114

Query  437  QPYQPGYTA-PPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            Q YQPGYTA PP  Q E+T+IDI GW + GT +D HDPRLLA+A
Sbjct  115  QLYQPGYTARPPPPQSEDTSIDIRGWTVGGTQVDFHDPRLLAMA  158



>ref|XP_006583965.1| PREDICTED: uncharacterized protein LOC100814390 isoform X2 [Glycine 
max]
Length=255

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 113/167 (68%), Gaps = 12/167 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESA--GTSSSAVVEDKVVGMGKEKDI  253
            M +H V+  D LV+   V   L     + +    E+A  G S S+           E D 
Sbjct  1    MNDHLVLFVDHLVRPVPVVEPLAQQPPEPVTPVNEAAVAGPSGSSP--------SAEDDG  52

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
            +   E+APL+ + ECRICQEEDSV +LETPC+CSGSLKYAHRKCVQ WCNEKGDI CEIC
Sbjct  53   DDDGEDAPLLQLAECRICQEEDSVSDLETPCSCSGSLKYAHRKCVQRWCNEKGDIICEIC  112

Query  434  HQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            H+ Y+PGYTA PPR QPEETTIDI GGW ISG PLDL D RLLAIAE
Sbjct  113  HKSYEPGYTAPPPRPQPEETTIDIGGGWTISGMPLDLRDTRLLAIAE  159



>emb|CBI31954.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   179 bits (453),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 100/165 (61%), Positives = 116/165 (70%), Gaps = 16/165 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+ ++        PV      E   E+AG S+S V +DK V        E 
Sbjct  313  MSDHLVLYVDRPIR--------PVTSQSVQEAGAETAGPSTS-VADDKRVEE-----NEG  358

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ++EE P + + ECRICQEEDS++NLETPCACSGSLKYAHRKCVQ WCNEKGDI CEICHQ
Sbjct  359  SNEEEPFLKMMECRICQEEDSLENLETPCACSGSLKYAHRKCVQRWCNEKGDIICEICHQ  418

Query  440  PYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTA PP   PE+T IDI GGW ISGTPLDL DPRLLA+AE
Sbjct  419  PYQPGYTAPPPPPHPEDTAIDIGGGWTISGTPLDLRDPRLLAMAE  463



>ref|XP_004299359.1| PREDICTED: uncharacterized protein LOC101304869 [Fragaria vesca 
subsp. vesca]
Length=292

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 107/168 (64%), Gaps = 11/168 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEV----GSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEK  247
            M +H V+  D   K D +    G+  P    +     +  +    S  ++ K  G     
Sbjct  1    MSDHLVLCVDHFTKPDSLQAPKGTETPGSSLEASSSSSSQSAEIPSCAIDIKGAGENA--  58

Query  248  DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
               V++EE PLI   ECRICQEED V NLE PCACSGSLKYAHRKCVQ WCNEKGDI CE
Sbjct  59   ---VSEEEEPLIQTVECRICQEEDGVSNLEVPCACSGSLKYAHRKCVQRWCNEKGDIICE  115

Query  428  ICHQPYQPGYTAP-PRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            ICHQPYQPGYTAP P  Q E+TTIDI   W ISGTPLDL DPRLLA+A
Sbjct  116  ICHQPYQPGYTAPSPPPQSEDTTIDISEAWTISGTPLDLRDPRLLAMA  163



>ref|XP_009360339.1| PREDICTED: uncharacterized protein LOC103950823 [Pyrus x bretschneideri]
Length=291

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 109/164 (66%), Gaps = 8/164 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+L++     +  P           E AG       E    G       E 
Sbjct  1    MSDHLVLYVDRLLRP---MAAQPPSEPAEAGSVPEPAGPEP----ERDAAGPSSSSSSEE  53

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ADEE PLI   ECRICQ+EDSV NLE+PCAC GSLKYAHRKCVQ+WCNEKGDITCEICHQ
Sbjct  54   ADEEEPLIQTAECRICQDEDSVSNLESPCACCGSLKYAHRKCVQYWCNEKGDITCEICHQ  113

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR   +ETTI+I GGW +SGTPL L DPR+L+IAE
Sbjct  114  PYQPGYTAPPRPPSDETTIEIGGGWTLSGTPLSLDDPRILSIAE  157



>ref|XP_006291580.1| hypothetical protein CARUB_v10017735mg [Capsella rubella]
 gb|EOA24478.1| hypothetical protein CARUB_v10017735mg [Capsella rubella]
Length=298

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 110/163 (67%), Gaps = 19/163 (12%)
 Frame = +2

Query  89   HSVVNFDQLVKTDEVGSGLPVDGAKHIEK-KTESAGTSSSAVVEDKVVGMGKEKDIEVAD  265
            H V+N D L+         PV  +  +E+ ++ES    ++    DK + +         D
Sbjct  14   HMVINVDGLMMR-------PVPLSPEVEEMRSESRVVVNNNNNNDKAIDVSD-------D  59

Query  266  EEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPY  445
            E  PLI   ECRIC +E  V+NLE+PCACSGSLKYAHRKCVQ WCNEKG+I CEICHQPY
Sbjct  60   ENEPLIVSAECRICSDESPVENLESPCACSGSLKYAHRKCVQRWCNEKGNILCEICHQPY  119

Query  446  QPGYTAPPRS-QPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            QPGYTAPP   QPEETTIDI GGW ISG  LDLHDPRLLAIAE
Sbjct  120  QPGYTAPPPPVQPEETTIDIGGGWTISG--LDLHDPRLLAIAE  160



>ref|XP_010425071.1| PREDICTED: uncharacterized protein LOC104710208 [Camelina sativa]
 ref|XP_010425072.1| PREDICTED: uncharacterized protein LOC104710208 [Camelina sativa]
Length=284

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 92/113 (81%), Gaps = 4/113 (4%)
 Frame = +2

Query  236  GKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGD  415
              +K I+++DE  PLI   ECRIC ++  + NLE+PCACSGSLKYAHRKCVQ WCNEKG+
Sbjct  36   NNDKAIDISDENEPLIASAECRICSDDSPIDNLESPCACSGSLKYAHRKCVQRWCNEKGN  95

Query  416  ITCEICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            I CEICHQPYQPGYTA PP  QPEETTIDI GGW ISG  LDLHDPRLLAIAE
Sbjct  96   ILCEICHQPYQPGYTAPPPPVQPEETTIDIGGGWTISG--LDLHDPRLLAIAE  146



>ref|XP_008784037.1| PREDICTED: uncharacterized protein LOC103703101 [Phoenix dactylifera]
Length=288

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 112/163 (69%), Gaps = 4/163 (2%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG H V+N D+LV +    +    +G+   E+        S   V       GKE++   
Sbjct  1    MGGHLVLNVDRLVTSQPTETKEEKEGSSSSEEAAHGPSDPSPLPVGSN---KGKEEERID  57

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             DEE PLI + ECRICQEED +KNLETPCACSGSLKYAHR CVQ WCNEKGDITCEICH+
Sbjct  58   DDEEEPLIQMVECRICQEEDHIKNLETPCACSGSLKYAHRACVQRWCNEKGDITCEICHE  117

Query  440  PYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIA  565
             Y+PGYTAPP+  P+ETTIDI G W I+G PLDLHD R+LA+A
Sbjct  118  QYKPGYTAPPQVHPDETTIDISGDWNITGAPLDLHDHRILAMA  160



>ref|XP_010514065.1| PREDICTED: uncharacterized protein LOC104790065 [Camelina sativa]
Length=285

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 4/111 (4%)
 Frame = +2

Query  242  EKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDIT  421
            +K I+++DE  PLI   ECRIC ++  ++NLE+PCACSGSLKYAHRKCVQ WCNEKG+I 
Sbjct  39   DKAIDISDENEPLIASAECRICSDDSPIENLESPCACSGSLKYAHRKCVQRWCNEKGNIL  98

Query  422  CEICHQPYQPGYTAPPRS-QPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            CEICHQPYQPGYTAPP   QPEETTIDI GGW ISG  LDLHDPRLLAIAE
Sbjct  99   CEICHQPYQPGYTAPPPPVQPEETTIDIGGGWTISG--LDLHDPRLLAIAE  147



>ref|XP_004241583.1| PREDICTED: uncharacterized protein LOC101254808 isoform X2 [Solanum 
lycopersicum]
Length=307

 Score =   172 bits (436),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 111/164 (68%), Gaps = 8/164 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH V+  D L+  + + S LP    +H E    S GTS +  V        +E + + 
Sbjct  1    MEEHLVLRVDHLITPESLHS-LP--RPEHTEL---SGGTSVTQTVGTSSGIDAQENEYQR  54

Query  260  A-DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            A DEE PL+   ECRICQEEDS+KNLE PC CSGSLKYAHRKCVQ WC+EKGDITCEICH
Sbjct  55   AGDEEEPLLQTVECRICQEEDSLKNLEIPCGCSGSLKYAHRKCVQQWCDEKGDITCEICH  114

Query  437  QPYQPGYTAPPRS-QPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            Q Y PGYTA P S Q E+T+IDI GW + GT +D HDPRLLA+A
Sbjct  115  QLYHPGYTARPASPQSEDTSIDIRGWTVGGTQVDFHDPRLLAMA  158



>ref|XP_008389465.1| PREDICTED: uncharacterized protein LOC103451817 isoform X1 [Malus 
domestica]
Length=298

 Score =   172 bits (435),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 87/99 (88%), Gaps = 1/99 (1%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI   ECRICQ+EDS+ NLE+PCAC GSLKYAHRKCVQ+WCNEKGDITCEICHQPYQPG
Sbjct  59   PLIQTAECRICQDEDSISNLESPCACCGSLKYAHRKCVQYWCNEKGDITCEICHQPYQPG  118

Query  455  YTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            YTAPPR   +ETTI+I GGW +SGTPL L DPR+L+IAE
Sbjct  119  YTAPPRPPSDETTIEIGGGWTLSGTPLSLDDPRILSIAE  157



>ref|XP_008389466.1| PREDICTED: uncharacterized protein LOC103451817 isoform X2 [Malus 
domestica]
Length=291

 Score =   171 bits (434),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 109/164 (66%), Gaps = 8/164 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+L++     +  P           E AG       E    G       E 
Sbjct  1    MSDHLVLYVDRLLRPM---AAQPPSEPAEAGSVPEPAGPEP----ERGAAGPSSSSSSEE  53

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ADEE PLI   ECRICQ+EDS+ NLE+PCAC GSLKYAHRKCVQ+WCNEKGDITCEICHQ
Sbjct  54   ADEEEPLIQTAECRICQDEDSISNLESPCACCGSLKYAHRKCVQYWCNEKGDITCEICHQ  113

Query  440  PYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQPGYTAPPR   +ETTI+I GGW +SGTPL L DPR+L+IAE
Sbjct  114  PYQPGYTAPPRPPSDETTIEIGGGWTLSGTPLSLDDPRILSIAE  157



>ref|XP_010322568.1| PREDICTED: uncharacterized protein LOC101254808 isoform X1 [Solanum 
lycopersicum]
Length=308

 Score =   172 bits (435),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 111/164 (68%), Gaps = 8/164 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH V+  D L+  + + S LP    +H E    S GTS +  V        +E + + 
Sbjct  1    MEEHLVLRVDHLITPESLHS-LP--RPEHTEL---SGGTSVTQTVGTSSGIDAQENEYQR  54

Query  260  A-DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            A DEE PL+   ECRICQEEDS+KNLE PC CSGSLKYAHRKCVQ WC+EKGDITCEICH
Sbjct  55   AGDEEEPLLQTVECRICQEEDSLKNLEIPCGCSGSLKYAHRKCVQQWCDEKGDITCEICH  114

Query  437  QPYQPGYTAPPRS-QPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            Q Y PGYTA P S Q E+T+IDI GW + GT +D HDPRLLA+A
Sbjct  115  QLYHPGYTARPASPQSEDTSIDIRGWTVGGTQVDFHDPRLLAMA  158



>ref|XP_006583964.1| PREDICTED: uncharacterized protein LOC100814390 isoform X1 [Glycine 
max]
Length=287

 Score =   171 bits (433),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 113/167 (68%), Gaps = 12/167 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESA--GTSSSAVVEDKVVGMGKEKDI  253
            M +H V+  D LV+   V   L     + +    E+A  G S S+           E D 
Sbjct  1    MNDHLVLFVDHLVRPVPVVEPLAQQPPEPVTPVNEAAVAGPSGSSP--------SAEDDG  52

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
            +   E+APL+ + ECRICQEEDSV +LETPC+CSGSLKYAHRKCVQ WCNEKGDI CEIC
Sbjct  53   DDDGEDAPLLQLAECRICQEEDSVSDLETPCSCSGSLKYAHRKCVQRWCNEKGDIICEIC  112

Query  434  HQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            H+ Y+PGYTA PPR QPEETTIDI GGW ISG PLDL D RLLAIAE
Sbjct  113  HKSYEPGYTAPPPRPQPEETTIDIGGGWTISGMPLDLRDTRLLAIAE  159



>ref|XP_008221617.1| PREDICTED: uncharacterized protein LOC103321578 [Prunus mume]
Length=283

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI   ECRICQ+EDS+ NLE+PCAC GSLKYAHRKCVQHWCNEKGDITCEICHQ YQPG
Sbjct  59   PLIQTAECRICQDEDSISNLESPCACCGSLKYAHRKCVQHWCNEKGDITCEICHQTYQPG  118

Query  455  YTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            YTAPPR   +ETTI+I GGW +SGTPL L DPR+L+IAE
Sbjct  119  YTAPPRPPSDETTIEIGGGWTLSGTPLSLDDPRILSIAE  157



>ref|XP_010044750.1| PREDICTED: uncharacterized protein LOC104433635 isoform X2 [Eucalyptus 
grandis]
 gb|KCW86857.1| hypothetical protein EUGRSUZ_B03447 [Eucalyptus grandis]
Length=274

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 87/99 (88%), Gaps = 2/99 (2%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI + ECRICQ+EDSV NLE+PCACSGSLKYAHRKC+QHWCNEKGDITCEICHQ +QP 
Sbjct  50   PLIQMAECRICQDEDSVSNLESPCACSGSLKYAHRKCIQHWCNEKGDITCEICHQQFQPN  109

Query  455  YTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            YTAPPR  P +TTIDI GG  ISGTPLDL DPRLLA+AE
Sbjct  110  YTAPPRP-PVDTTIDIGGGLTISGTPLDLRDPRLLALAE  147



>gb|KCW86856.1| hypothetical protein EUGRSUZ_B03447 [Eucalyptus grandis]
Length=273

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 87/99 (88%), Gaps = 2/99 (2%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI + ECRICQ+EDSV NLE+PCACSGSLKYAHRKC+QHWCNEKGDITCEICHQ +QP 
Sbjct  50   PLIQMAECRICQDEDSVSNLESPCACSGSLKYAHRKCIQHWCNEKGDITCEICHQQFQPN  109

Query  455  YTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            YTAPPR  P +TTIDI GG  ISGTPLDL DPRLLA+AE
Sbjct  110  YTAPPRP-PVDTTIDIGGGLTISGTPLDLRDPRLLALAE  147



>ref|XP_009587066.1| PREDICTED: uncharacterized protein LOC104084817 isoform X1 [Nicotiana 
tomentosiformis]
Length=311

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 110/165 (67%), Gaps = 9/165 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVV-EDKVVGMGKEKDIE  256
            M EH V+  D+L+  + + S LP       E    S G S S VV    V+    ++   
Sbjct  1    MEEHLVLCVDRLITPESLHS-LP-----RSEDAESSGGRSCSQVVGTSSVIDANDDEHPG  54

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            V  EE PL+   ECRICQEEDSVKNLE PC CSGSLKYAHRKCVQ WC+EKGDITCEICH
Sbjct  55   VGGEEEPLLQNVECRICQEEDSVKNLEVPCRCSGSLKYAHRKCVQRWCDEKGDITCEICH  114

Query  437  QPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            QPYQ GYTA PP  Q E+T IDI  GW + GT +DLHDPRLLA+A
Sbjct  115  QPYQSGYTAPPPPPQSEDTAIDISRGWTVGGTQIDLHDPRLLAMA  159



>ref|XP_008446351.1| PREDICTED: uncharacterized protein LOC103489118 [Cucumis melo]
Length=296

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 118/174 (68%), Gaps = 17/174 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSG---------LPVDGAKHIEKKTESAGTSSSAVVEDKVVG  232
            M +H V+  D+LV+   V S          LPV G    +    S+ TS+S V E     
Sbjct  1    MSDHLVLYVDRLVRPPPVDSVPNPAEAVPLLPVGGDLESDSVGLSSSTSASNVEE-----  55

Query  233  MGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKG  412
             G+E +  +  E+  LI   ECRICQ+ED ++ LETPCACSGSLKYAHRKC+Q WCNEKG
Sbjct  56   RGEENE-GLDGEDDSLIQTAECRICQDEDVIRKLETPCACSGSLKYAHRKCIQLWCNEKG  114

Query  413  DITCEICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            DI CEICHQPYQPGYTA PP  + EET+IDI GGW I+GTPL+LHDPRLLAIAE
Sbjct  115  DIICEICHQPYQPGYTAPPPPPRIEETSIDIGGGWTITGTPLNLHDPRLLAIAE  168



>gb|KJB50917.1| hypothetical protein B456_008G193100 [Gossypium raimondii]
 gb|KJB50918.1| hypothetical protein B456_008G193100 [Gossypium raimondii]
 gb|KJB50919.1| hypothetical protein B456_008G193100 [Gossypium raimondii]
Length=286

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 114/164 (70%), Gaps = 7/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H V+  D+L+  + + S    + A    + +  +   ++  +     G+ + ++   
Sbjct  1    MGDHLVLCVDRLITPESLQSMQETEAAGSSGESSSQSSDPNACAI-----GVKEVEEHGC  55

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             DEE PLI   ECRICQEED +KNLETPCAC+GSLK+AHRKCVQHWCNEKGDITCEICHQ
Sbjct  56   CDEEEPLIQTAECRICQEEDCIKNLETPCACNGSLKFAHRKCVQHWCNEKGDITCEICHQ  115

Query  440  PYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            PYQPGYTA PP  Q E+ TIDI  GW ISG PLDL DPR+LA+A
Sbjct  116  PYQPGYTAPPPPPQSEDATIDISEGWTISGAPLDLRDPRILAMA  159



>gb|AJK93584.1| RING/FYVE/PHD zinc finger superfamily protein [Suaeda glauca]
Length=286

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 112/164 (68%), Gaps = 9/164 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H VV  D+L+ +D + S      AK  E  +ESAG +   V E       +E + +V
Sbjct  1    MGDHHVVCVDKLIASDSLQS------AKGTEA-SESAGDTHVNVAESSNSHEHQEVEEDV  53

Query  260  A-DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
              DEE PLI + ECRICQEEDSVKNLE PC+CSGSLKYAHRKCVQ WCNEKGD+ CEIC 
Sbjct  54   VPDEEQPLIQVLECRICQEEDSVKNLEAPCSCSGSLKYAHRKCVQKWCNEKGDVICEICQ  113

Query  437  QPYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIA  565
            Q YQPGYTAPP    ++T IDI   W +SG P DL+D RLLA+A
Sbjct  114  QTYQPGYTAPPPPPNDDTAIDISAQWTVSGGPFDLNDSRLLAMA  157



>ref|XP_010527903.1| PREDICTED: uncharacterized protein LOC104805161 [Tarenaya hassleriana]
 ref|XP_010527904.1| PREDICTED: uncharacterized protein LOC104805161 [Tarenaya hassleriana]
 ref|XP_010527906.1| PREDICTED: uncharacterized protein LOC104805161 [Tarenaya hassleriana]
Length=302

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 112/166 (67%), Gaps = 14/166 (8%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M  H VV  D LV+   +    PV      E    +  + S++V EDK +      DI  
Sbjct  1    MSGHMVVYVDGLVRPVPLP---PVHAEVENEGSVATEPSGSASVAEDKGI------DISD  51

Query  260  AD-EEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
             D EE PLIG  ECRICQEE  +KNLE+PCACSGSLKYAHR CVQHWCNEKG+  CEICH
Sbjct  52   GDSEEEPLIGSAECRICQEECPIKNLESPCACSGSLKYAHRNCVQHWCNEKGNTICEICH  111

Query  437  QPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            QPYQPGYTA PP   PEETTIDI GGW ISG  LDLHDPRLLAIAE
Sbjct  112  QPYQPGYTAPPPPPLPEETTIDIGGGWTISG--LDLHDPRLLAIAE  155



>ref|XP_006364596.1| PREDICTED: uncharacterized protein LOC102599897 [Solanum tuberosum]
Length=308

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 111/166 (67%), Gaps = 10/166 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKD--I  253
            MGEH  +  D+L+  + + +   + G+   E    S G S S   +    G   ++D   
Sbjct  1    MGEHLALCVDRLITPESLHT---MQGS---ENAGSSGGNSCSHPADQSSYGTANKEDEEP  54

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
            E   E+ PL+   ECRICQEEDS KNLE PC+C+GSLKYAHRKCVQ WCNEKGDI CEIC
Sbjct  55   EAGGEDEPLLQTVECRICQEEDSPKNLEIPCSCNGSLKYAHRKCVQRWCNEKGDIICEIC  114

Query  434  HQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            HQPYQPGYTA PP S  E+  ID+ GGW ++GT L+LHDPRLLA+A
Sbjct  115  HQPYQPGYTAPPPPSLSEDIAIDMSGGWTVAGTQLNLHDPRLLAMA  160



>ref|XP_002514758.1| membrane associated ring finger 1,8, putative [Ricinus communis]
 gb|EEF47864.1| membrane associated ring finger 1,8, putative [Ricinus communis]
Length=292

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 113/168 (67%), Gaps = 15/168 (9%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTE--SAGTSSSAVVEDK---VVGMGKE  244
            M +  V+  D+L+  + + S         +EK  E  S+G  SS+   D    V+ +   
Sbjct  1    MSDQLVLCADRLITPESLQS---------MEKAKEPGSSGECSSSHTADLPTCVIDVEGG  51

Query  245  KDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITC  424
             +  V++EE PL+   ECRICQEEDS+ NLE PCACSGSLK+AHRKCVQ WCNEKGDITC
Sbjct  52   GEHGVSEEEEPLLQTMECRICQEEDSINNLEAPCACSGSLKFAHRKCVQRWCNEKGDITC  111

Query  425  EICHQPYQPGYTAPPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            EICHQPYQP YTA P    E+T IDI  GW I+GTPLDLHDPR+LA+A
Sbjct  112  EICHQPYQPNYTASPPLPLEDTAIDISEGWTIAGTPLDLHDPRILAMA  159



>ref|XP_009395958.1| PREDICTED: uncharacterized protein LOC103981085 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=283

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 116/171 (68%), Gaps = 17/171 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESA-----GTSSSAVVE---DKVVGM  235
            MGEH V+  D+++         P  GA+ IE    S      G + SA+     D ++ M
Sbjct  1    MGEHLVLYVDEVIT--------PKTGAQRIEGANSSGLEATQGLACSALCTSAVDSIIEM  52

Query  236  GKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGD  415
              +++  V +EE PL+ I ECRICQEED +KNLETPCACSGS+KYAHR+CVQ WCNEKGD
Sbjct  53   DGKEESSVGEEEEPLLQIVECRICQEEDHIKNLETPCACSGSIKYAHRECVQRWCNEKGD  112

Query  416  ITCEICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            ITCEIC++ Y+PGYT  PR  P E+ I+I GGW I G+ LDLHDPR++A+A
Sbjct  113  ITCEICNEQYRPGYTVVPRVPPVESVINISGGWTIRGSHLDLHDPRVIAMA  163



>ref|XP_009800763.1| PREDICTED: uncharacterized protein LOC104246615 isoform X1 [Nicotiana 
sylvestris]
Length=311

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 111/165 (67%), Gaps = 9/165 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVV-EDKVVGMGKEKDIE  256
            M EH V+  D+L+  + + S LP       E    S G S S VV    V+     + + 
Sbjct  1    MEEHLVLCVDRLITPESLHS-LP-----RSEDAESSVGRSCSQVVGTSSVIDANDNEHLG  54

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            V  EE PL+   ECRICQEEDSVKNLE PC CSGSLKYAHRKCVQ WC+EKGDITCEICH
Sbjct  55   VGGEEEPLLQNVECRICQEEDSVKNLEVPCRCSGSLKYAHRKCVQRWCDEKGDITCEICH  114

Query  437  QPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            QPYQPGYTA PP  Q E+T IDI  GW + GT +DLHDPRLLA+A
Sbjct  115  QPYQPGYTAPPPPPQSEDTAIDISRGWTVGGTQIDLHDPRLLAMA  159



>ref|XP_010044749.1| PREDICTED: uncharacterized protein LOC104433635 isoform X1 [Eucalyptus 
grandis]
Length=293

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 87/99 (88%), Gaps = 2/99 (2%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI + ECRICQ+EDSV NLE+PCACSGSLKYAHRKC+QHWCNEKGDITCEICHQ +QP 
Sbjct  69   PLIQMAECRICQDEDSVSNLESPCACSGSLKYAHRKCIQHWCNEKGDITCEICHQQFQPN  128

Query  455  YTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            YTAPPR  P +TTIDI GG  ISGTPLDL DPRLLA+AE
Sbjct  129  YTAPPRP-PVDTTIDIGGGLTISGTPLDLRDPRLLALAE  166



>ref|XP_009395955.1| PREDICTED: uncharacterized protein LOC103981085 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395956.1| PREDICTED: uncharacterized protein LOC103981085 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395957.1| PREDICTED: uncharacterized protein LOC103981085 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=295

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 116/171 (68%), Gaps = 17/171 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESA-----GTSSSAVVE---DKVVGM  235
            MGEH V+  D+++         P  GA+ IE    S      G + SA+     D ++ M
Sbjct  1    MGEHLVLYVDEVIT--------PKTGAQRIEGANSSGLEATQGLACSALCTSAVDSIIEM  52

Query  236  GKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGD  415
              +++  V +EE PL+ I ECRICQEED +KNLETPCACSGS+KYAHR+CVQ WCNEKGD
Sbjct  53   DGKEESSVGEEEEPLLQIVECRICQEEDHIKNLETPCACSGSIKYAHRECVQRWCNEKGD  112

Query  416  ITCEICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            ITCEIC++ Y+PGYT  PR  P E+ I+I GGW I G+ LDLHDPR++A+A
Sbjct  113  ITCEICNEQYRPGYTVVPRVPPVESVINISGGWTIRGSHLDLHDPRVIAMA  163



>gb|KEH19720.1| RING/FYVE/PHD zinc finger protein [Medicago truncatula]
Length=285

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 111/168 (66%), Gaps = 14/168 (8%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDG-AKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE  256
            M +H V+  D+L++       +PV+  A+H     + A      V++      G     +
Sbjct  1    MSDHVVLFVDRLMRP------MPVEPLAQH---PAQPAPEPMPPVIQSPAGPSGSSTADD  51

Query  257  VADEEAPLIGIR--ECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  430
               E+ PL+ +   ECRICQEED + NLE PCACSGSLKYAHRKCVQ WCNEKGD TCEI
Sbjct  52   DVGEDEPLLQMEMAECRICQEEDGIDNLENPCACSGSLKYAHRKCVQRWCNEKGDTTCEI  111

Query  431  CHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            CH+ Y+P YTA PPR  PEETTIDI GGW +SGTPLDL DPRLLAIAE
Sbjct  112  CHKSYEPDYTAPPPRPHPEETTIDIGGGWTLSGTPLDLRDPRLLAIAE  159



>ref|XP_007222594.1| hypothetical protein PRUPE_ppa009881mg [Prunus persica]
 gb|EMJ23793.1| hypothetical protein PRUPE_ppa009881mg [Prunus persica]
Length=273

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI   ECRICQ+EDS+ NLE+PCAC GSLKYAHRKCVQHWCNEKGDITCEICHQ YQPG
Sbjct  63   PLIQTAECRICQDEDSISNLESPCACCGSLKYAHRKCVQHWCNEKGDITCEICHQTYQPG  122

Query  455  YTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            YTAPPR   +ETTI+I GGW +SGTPL L DPR+L+I E
Sbjct  123  YTAPPRPPSDETTIEIGGGWTLSGTPLSLDDPRILSITE  161



>ref|XP_008374545.1| PREDICTED: uncharacterized protein LOC103437820 [Malus domestica]
 ref|XP_008374546.1| PREDICTED: uncharacterized protein LOC103437820 [Malus domestica]
 ref|XP_008374547.1| PREDICTED: uncharacterized protein LOC103437820 [Malus domestica]
Length=286

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 115/165 (70%), Gaps = 11/165 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEV-GSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE  256
            MG+H V+  D   K + + GS  P  G+      + SA   + A+    V G+G++    
Sbjct  1    MGDHLVLCVDHFTKPESLQGSETP--GSSVEGSCSHSAELPTCAI---DVKGVGEKT---  52

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            V++EE PLI   ECRICQEEDSVKNLE PC+CSGSLK+AHRKCVQ WCNEKGDI CEICH
Sbjct  53   VSEEEEPLIQTVECRICQEEDSVKNLEVPCSCSGSLKFAHRKCVQRWCNEKGDIICEICH  112

Query  437  QPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            QPYQ GYTA PP    E+TTIDI  GW ISGTPLDL DPRLLA+A
Sbjct  113  QPYQHGYTAPPPPPPSEDTTIDISDGWTISGTPLDLRDPRLLAMA  157



>gb|KCW86855.1| hypothetical protein EUGRSUZ_B03447 [Eucalyptus grandis]
Length=312

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 87/99 (88%), Gaps = 2/99 (2%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI + ECRICQ+EDSV NLE+PCACSGSLKYAHRKC+QHWCNEKGDITCEICHQ +QP 
Sbjct  50   PLIQMAECRICQDEDSVSNLESPCACSGSLKYAHRKCIQHWCNEKGDITCEICHQQFQPN  109

Query  455  YTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            YTAPPR  P +TTIDI GG  ISGTPLDL DPRLLA+AE
Sbjct  110  YTAPPRP-PVDTTIDIGGGLTISGTPLDLRDPRLLALAE  147



>ref|NP_001061887.1| Os08g0436200 [Oryza sativa Japonica Group]
 dbj|BAD10141.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF23801.1| Os08g0436200 [Oryza sativa Japonica Group]
 dbj|BAG92731.1| unnamed protein product [Oryza sativa Japonica Group]
Length=276

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 88/102 (86%), Gaps = 1/102 (1%)
 Frame = +2

Query  266  EEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPY  445
            EE PLI   ECRICQEED++ NLE+PCAC+GSLKYAHR CVQ WC+EKGD+TCEICH+PY
Sbjct  51   EEEPLIQTVECRICQEEDNISNLESPCACTGSLKYAHRACVQRWCDEKGDLTCEICHEPY  110

Query  446  QPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            + GYTA PR+ P+ETTIDI GGW I+GT  DLHDPR++A+A+
Sbjct  111  KHGYTALPRAHPDETTIDISGGWTITGTAFDLHDPRIIAMAQ  152



>ref|XP_010554312.1| PREDICTED: uncharacterized protein LOC104824079 [Tarenaya hassleriana]
 ref|XP_010554313.1| PREDICTED: uncharacterized protein LOC104824079 [Tarenaya hassleriana]
Length=299

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 118/168 (70%), Gaps = 16/168 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M  H VV  + LV+   +    PV  A+    ++++AG S S    ++     + + I++
Sbjct  1    MSSHVVVYVNGLVRPVPLS---PVH-AEVENARSDAAGPSGSVAEAEE-----ENRRIDI  51

Query  260  ADEEA---PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  430
            +D EA   PLIG  ECRIC+EE S+KNLE+PCACSGSLKYAHRKC+QHWCNEKG+I CEI
Sbjct  52   SDGEADEEPLIGFAECRICREECSIKNLESPCACSGSLKYAHRKCIQHWCNEKGNIICEI  111

Query  431  CHQPYQPGYTAPPRS-QPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            CHQPYQPGY+APP     EETT++I GGW ISG  LDLH+ RLLAIAE
Sbjct  112  CHQPYQPGYSAPPPPLHTEETTVNIGGGWTISG--LDLHNHRLLAIAE  157



>ref|XP_006417033.1| hypothetical protein EUTSA_v10008459mg [Eutrema salsugineum]
 gb|ESQ35386.1| hypothetical protein EUTSA_v10008459mg [Eutrema salsugineum]
Length=272

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 94/124 (76%), Gaps = 6/124 (5%)
 Frame = +2

Query  203  SAVVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRK  382
            +AV ED  + +          EE  LI   ECRICQEE ++KNLE+PCAC+GSLKYAHRK
Sbjct  36   TAVAEDSAIDIYDGDS--TTTEEDSLICSAECRICQEESAIKNLESPCACNGSLKYAHRK  93

Query  383  CVQHWCNEKGDITCEICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLL  556
            CVQHWCNEKG+  CEICHQPYQ GYT+ PPR Q EETTIDI GGW ISG  LDLHDPRLL
Sbjct  94   CVQHWCNEKGNTLCEICHQPYQAGYTSPPPRLQSEETTIDIGGGWTISG--LDLHDPRLL  151

Query  557  AIAE  568
            AIAE
Sbjct  152  AIAE  155



>ref|XP_010678518.1| PREDICTED: uncharacterized protein LOC104894048 [Beta vulgaris 
subsp. vulgaris]
Length=287

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 114/164 (70%), Gaps = 9/164 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKE-KDIE  256
            MG+  VV  D+L+ +D + S      AK  E  +ES+G S   V E       KE  + +
Sbjct  1    MGDDHVVCVDRLITSDSLQS------AKGTEV-SESSGDSHIYVAESSNSLQPKEVGEDD  53

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            VADEE PL+ + ECRICQEEDS KNLE PC+CSGSLKYAHRKCVQ WCNEKGDI CEICH
Sbjct  54   VADEEQPLLQVVECRICQEEDSAKNLEVPCSCSGSLKYAHRKCVQRWCNEKGDIICEICH  113

Query  437  QPYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIA  565
            QPYQ GYTAPP    ++T IDI   W +SG PLDL+DPRLLA+A
Sbjct  114  QPYQSGYTAPPPPPTDDTAIDISAQWTVSGAPLDLNDPRLLAMA  157



>ref|XP_009614787.1| PREDICTED: uncharacterized protein LOC104107639 [Nicotiana tomentosiformis]
 ref|XP_009614788.1| PREDICTED: uncharacterized protein LOC104107639 [Nicotiana tomentosiformis]
Length=311

 Score =   167 bits (424),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 111/166 (67%), Gaps = 10/166 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKD--I  253
            MGEH  +  D+L+    + S   + G+   E    SAG+S S  V     G   ++D  +
Sbjct  1    MGEHLALCVDRLITPKSLHS---LQGS---EDAGSSAGSSCSHTVGQSPYGTTNKEDEEL  54

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
            E   E+ PL+   ECRICQEEDS KNLE PC C+GSLKYAHRKCVQ WCNEKGDI CEIC
Sbjct  55   EAGGEDEPLLQTVECRICQEEDSTKNLEIPCGCNGSLKYAHRKCVQRWCNEKGDIICEIC  114

Query  434  HQPYQPGYTAPPRSQP-EETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            HQ YQPGYTAPP   P E+  IDI GGW ++GT LDLHDPRLLA+A
Sbjct  115  HQSYQPGYTAPPPPSPSEDIAIDISGGWTVAGTQLDLHDPRLLAMA  160



>ref|NP_850667.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
 gb|ABL66781.1| At3g47550 [Arabidopsis thaliana]
 gb|AEE78299.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
Length=232

 Score =   165 bits (418),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 109/162 (67%), Gaps = 4/162 (2%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H  +  D+L+ ++ + S    D +     + +    +SS+V E +V      +   V
Sbjct  1    MADHLSLCTDRLITSESLDSEKDSDSSGESSYRPQGTDLASSSVNETEV----PREYYAV  56

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ADEE PL+   ECRICQEEDS KNLE PCAC+GSLKYAHRKCVQ WCNEKGDITCEICHQ
Sbjct  57   ADEEEPLLQSVECRICQEEDSTKNLEAPCACNGSLKYAHRKCVQRWCNEKGDITCEICHQ  116

Query  440  PYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            PYQ GYTAPP   P+ET I IG    +G PLDL DPR+LA+A
Sbjct  117  PYQHGYTAPPPPPPDETIIHIGDDWENGVPLDLTDPRILAMA  158



>emb|CDY67520.1| BnaAnng24500D [Brassica napus]
Length=290

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 111/162 (69%), Gaps = 12/162 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H     D+LV +D + S     G     + + + GT+S +  + + V    E++  V
Sbjct  1    MSDHLSSCTDRLVTSDHINSDNESSG-----ECSRAQGTTSLSTTKPEEV----EEESHV  51

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             DEE PLI   ECRICQEEDSVKNLE+PC+CSGSLKYAHRKCVQ WCNEKGD  CEICH+
Sbjct  52   NDEEEPLIQSVECRICQEEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDTICEICHK  111

Query  440  PYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
             YQPGYTAPP   P++T ID+G    +G PLDL+DPR+LA+A
Sbjct  112  SYQPGYTAPP---PDDTIIDMGEDWANGVPLDLNDPRILAMA  150



>ref|XP_006659436.1| PREDICTED: uncharacterized protein LOC102716520 isoform X1 [Oryza 
brachyantha]
Length=280

 Score =   166 bits (420),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 107/171 (63%), Gaps = 31/171 (18%)
 Frame = +2

Query  80   MGEHSVVNFDQLV-----KTDEVGSGLPVDGAKH--IEKKTESAGTSSSAVVEDKVVGMG  238
            M +H ++N + LV     +  EV + LP  G     +    ES GT              
Sbjct  1    MKDHLMLNVNNLVIPESVEATEVATNLPSGGVSLPPLLSVRESMGT--------------  46

Query  239  KEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDI  418
                     EE PLI   ECRICQEED+  NLE+PCAC+GSLKYAHR CVQ WC+EKGD+
Sbjct  47   ---------EEEPLIQTVECRICQEEDNTSNLESPCACTGSLKYAHRVCVQRWCDEKGDL  97

Query  419  TCEICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            TCEICH+PY+ GYTA PR+ P+ETTIDI GGW I+GT  DL DPR++A+A+
Sbjct  98   TCEICHEPYKHGYTALPRAHPDETTIDISGGWTITGTAFDLRDPRIIAMAQ  148



>ref|XP_006659437.1| PREDICTED: uncharacterized protein LOC102716520 isoform X2 [Oryza 
brachyantha]
Length=272

 Score =   166 bits (419),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 107/171 (63%), Gaps = 31/171 (18%)
 Frame = +2

Query  80   MGEHSVVNFDQLV-----KTDEVGSGLPVDGAKH--IEKKTESAGTSSSAVVEDKVVGMG  238
            M +H ++N + LV     +  EV + LP  G     +    ES GT              
Sbjct  1    MKDHLMLNVNNLVIPESVEATEVATNLPSGGVSLPPLLSVRESMGT--------------  46

Query  239  KEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDI  418
                     EE PLI   ECRICQEED+  NLE+PCAC+GSLKYAHR CVQ WC+EKGD+
Sbjct  47   ---------EEEPLIQTVECRICQEEDNTSNLESPCACTGSLKYAHRVCVQRWCDEKGDL  97

Query  419  TCEICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            TCEICH+PY+ GYTA PR+ P+ETTIDI GGW I+GT  DL DPR++A+A+
Sbjct  98   TCEICHEPYKHGYTALPRAHPDETTIDISGGWTITGTAFDLRDPRIIAMAQ  148



>ref|XP_008393160.1| PREDICTED: uncharacterized protein LOC103455354 [Malus domestica]
 ref|XP_008393161.1| PREDICTED: uncharacterized protein LOC103455354 [Malus domestica]
 ref|XP_008393162.1| PREDICTED: uncharacterized protein LOC103455354 [Malus domestica]
 ref|XP_008393163.1| PREDICTED: uncharacterized protein LOC103455354 [Malus domestica]
 ref|XP_008351841.1| PREDICTED: uncharacterized protein LOC103415275 [Malus domestica]
 ref|XP_008351842.1| PREDICTED: uncharacterized protein LOC103415275 [Malus domestica]
Length=287

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEV-GSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE  256
            MG+H V+  D+  KT+ + GS  P  G+      ++SA   + A+    V G+G EK I 
Sbjct  1    MGDHLVLCVDRFTKTESLQGSETP--GSSVEGSSSQSAELPTCAI---DVKGVG-EKAI-  53

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
              +EE PLI   ECRICQEEDSVKNLE PC+CSGSLK+AHRKCVQ WCNEKGDI CEICH
Sbjct  54   AEEEEEPLIQTVECRICQEEDSVKNLEVPCSCSGSLKFAHRKCVQRWCNEKGDIICEICH  113

Query  437  QPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            Q YQP YTA PP  Q E+TTIDI  GW ISGTPLDL DPRLLA+A
Sbjct  114  QSYQPDYTAPPPPPQSEDTTIDISDGWTISGTPLDLRDPRLLAMA  158



>ref|NP_850668.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
 gb|AEE78298.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
Length=249

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 109/162 (67%), Gaps = 4/162 (2%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H  +  D+L+ ++ + S    D +     + +    +SS+V E +V      +   V
Sbjct  1    MADHLSLCTDRLITSESLDSEKDSDSSGESSYRPQGTDLASSSVNETEV----PREYYAV  56

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ADEE PL+   ECRICQEEDS KNLE PCAC+GSLKYAHRKCVQ WCNEKGDITCEICHQ
Sbjct  57   ADEEEPLLQSVECRICQEEDSTKNLEAPCACNGSLKYAHRKCVQRWCNEKGDITCEICHQ  116

Query  440  PYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            PYQ GYTAPP   P+ET I IG    +G PLDL DPR+LA+A
Sbjct  117  PYQHGYTAPPPPPPDETIIHIGDDWENGVPLDLTDPRILAMA  158



>ref|XP_010683185.1| PREDICTED: uncharacterized protein LOC104897916 [Beta vulgaris 
subsp. vulgaris]
Length=282

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 114/165 (69%), Gaps = 11/165 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MGEH V+  D+LVK        P +  ++    + S+ +SS+A +E K     + +  E 
Sbjct  1    MGEHLVLYVDRLVK--------PTNVEENEGASSSSSSSSSNAGLEGKTDEREEVESTEG  52

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             ++E PLI   ECRICQEED V +LE PC CSGSLKYAHRKCVQ WCNEKGDITCEICHQ
Sbjct  53   EEDE-PLIQAGECRICQEEDCVSSLEVPCGCSGSLKYAHRKCVQRWCNEKGDITCEICHQ  111

Query  440  PYQPGYTA-PPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIAE  568
            PYQPGYTA PP    E+  ID GG W ISGTPLDLHDPRLLAIAE
Sbjct  112  PYQPGYTAPPPPPHSEDAAIDFGGSWTISGTPLDLHDPRLLAIAE  156



>ref|XP_010257454.1| PREDICTED: uncharacterized protein LOC104597545 [Nelumbo nucifera]
 ref|XP_010257467.1| PREDICTED: uncharacterized protein LOC104597545 [Nelumbo nucifera]
Length=288

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 111/164 (68%), Gaps = 7/164 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDG-AKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE  256
            MG+H V+  D+L+    + S +  +      E  +     SS    ED      K ++ E
Sbjct  1    MGDHLVLYVDRLMTPAALHSTVGGEAPGPSGEGPSAQIAVSSGFSSEDN-----KVEEHE  55

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            V+ EE PL+   ECRICQEED + NLE PCACSGSLKYAHRKCVQ WCNEKGDITCEICH
Sbjct  56   VSGEEEPLLQTIECRICQEEDHINNLEAPCACSGSLKYAHRKCVQRWCNEKGDITCEICH  115

Query  437  QPYQPGYTA-PPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            QPYQP YTA PP  Q E+TTI+I GW ISG P+DLHDPRLLA+A
Sbjct  116  QPYQPDYTAPPPPPQSEDTTINISGWTISGAPVDLHDPRLLAMA  159



>ref|NP_178396.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 ref|NP_849929.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 ref|NP_973405.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 ref|NP_973406.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 gb|AAC32914.1| unknown protein [Arabidopsis thaliana]
 gb|AAL38760.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14274.1| unknown protein [Arabidopsis thaliana]
 gb|AEC05645.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 gb|AEC05646.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 gb|AEC05648.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 gb|AEC05649.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
Length=271

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 96/126 (76%), Gaps = 7/126 (6%)
 Frame = +2

Query  197  SSSAVVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAH  376
            S S VV DK + +  +      DE  PLI   ECRIC +E  V+NLE+PCACSGSLKYAH
Sbjct  13   SESPVVNDKALDISDDDH---DDENEPLIVSGECRICSDESPVENLESPCACSGSLKYAH  69

Query  377  RKCVQHWCNEKGDITCEICHQPYQPGYTAPPRS-QPEETTIDI-GGWQISGTPLDLHDPR  550
            RKCVQ WCNEKG+I CEICHQPYQPGYTAPP   QPEETTIDI GGW ISG  LD+HDPR
Sbjct  70   RKCVQRWCNEKGNIICEICHQPYQPGYTAPPPPLQPEETTIDIGGGWTISG--LDVHDPR  127

Query  551  LLAIAE  568
            LLAIAE
Sbjct  128  LLAIAE  133



>ref|XP_009796377.1| PREDICTED: uncharacterized protein LOC104242963 isoform X2 [Nicotiana 
sylvestris]
Length=290

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 112/165 (68%), Gaps = 8/165 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKE-KDIE  256
            MGEH  +  D+L+  + + S   + G++  +  + +  + S  V +     + KE +++E
Sbjct  1    MGEHLALCVDRLITPESLHS---LQGSE--DAGSSAGSSCSHTVGQSPYGTINKEDEELE  55

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
               E+ PL+   ECRICQEEDS KNLE PC C+GSLKYAHRKCVQ WCNEKGDI CEICH
Sbjct  56   AGGEDEPLLQTVECRICQEEDSTKNLEIPCGCNGSLKYAHRKCVQRWCNEKGDIICEICH  115

Query  437  QPYQPGYTAPPRSQP-EETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            Q YQPGYTAPP   P E+  IDI  GW ++GT LDLHDPRLLA+A
Sbjct  116  QSYQPGYTAPPPLSPSEDIAIDISEGWTVAGTQLDLHDPRLLAMA  160



>gb|KDP31254.1| hypothetical protein JCGZ_11630 [Jatropha curcas]
Length=293

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +2

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            V  EE PLI   ECRICQEED + NLE PCACSGSLKYAHRKCVQ WCNEKGDITCEICH
Sbjct  56   VPGEEEPLIQTMECRICQEEDCINNLEAPCACSGSLKYAHRKCVQRWCNEKGDITCEICH  115

Query  437  QPYQPGYTAPPRSQP-EETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            QPYQPGYTAPP   P EET IDI  GW I+G+PLDLHDPR+LA+A
Sbjct  116  QPYQPGYTAPPPPPPLEETAIDISDGWTIAGSPLDLHDPRILAMA  160



>ref|XP_004952876.1| PREDICTED: uncharacterized protein LOC101767233 isoform X3 [Setaria 
italica]
Length=259

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 86/103 (83%), Gaps = 2/103 (2%)
 Frame = +2

Query  263  DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQP  442
            +E   LIG+ ECRICQEED  KNLE+PCACSGSLKYAHR+CVQ WCNEKGDITCEICHQ 
Sbjct  29   EEAEALIGMVECRICQEEDLAKNLESPCACSGSLKYAHRECVQRWCNEKGDITCEICHQS  88

Query  443  YQPGYTAPPRSQPEETTIDIGG--WQISGTPLDLHDPRLLAIA  565
            Y+PGYTAPP+   +ETTI+I G  W ISG  LDLHDPR+LA+A
Sbjct  89   YKPGYTAPPQVHHDETTIEISGGDWTISGNHLDLHDPRILAMA  131



>emb|CDY45188.1| BnaA06g33920D [Brassica napus]
Length=293

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 110/162 (68%), Gaps = 17/162 (10%)
 Frame = +2

Query  89   HSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEVADE  268
            H VVN D L         +P   +  +  + E+    S+ VV DK + + +++D     E
Sbjct  10   HMVVNVDGL---------MPPVPSPPVNAEVENIREESTTVVNDKAIDISEDED----QE  56

Query  269  EAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQ  448
              PLI   ECRICQ+E  +K LE+PCACSGSLKYAHRKCVQ WCNEKG+I CEICHQPYQ
Sbjct  57   NEPLIASAECRICQDECPIKTLESPCACSGSLKYAHRKCVQRWCNEKGNIICEICHQPYQ  116

Query  449  PGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PGYTA PP  QPEETTIDI GGW ISG  LDLHDPRLL IAE
Sbjct  117  PGYTAPPPPPQPEETTIDIGGGWTISG--LDLHDPRLLPIAE  156



>ref|XP_004135456.1| PREDICTED: uncharacterized protein LOC101205076 [Cucumis sativus]
 gb|KGN51915.1| hypothetical protein Csa_5G605090 [Cucumis sativus]
Length=295

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 120/174 (69%), Gaps = 18/174 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGS---------GLPVDGAKHIEKKTESAGTSSSAVVEDKVVG  232
            M +H V+  D+L +   + S          LPVDG   ++  +  +  +S++ VE++   
Sbjct  1    MSDHLVLYVDRLARPPPLDSIPNPPEAVPLLPVDG--DLDSDSPLSSPTSASSVEER---  55

Query  233  MGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKG  412
             G+E +    ++++ LI   ECRICQ+ED ++ LETPCACSGSLKYAHRKC+Q WCNEKG
Sbjct  56   -GEENEGSDGEDDS-LIQTAECRICQDEDVIRKLETPCACSGSLKYAHRKCIQLWCNEKG  113

Query  413  DITCEICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            DI CEICHQPYQP YTA PP  + EET+IDI GGW I+GTPL+LHDPR LAIAE
Sbjct  114  DIICEICHQPYQPDYTAPPPPPRIEETSIDIGGGWTITGTPLNLHDPRFLAIAE  167



>ref|XP_009130216.1| PREDICTED: uncharacterized protein LOC103855008 [Brassica rapa]
 ref|XP_009130217.1| PREDICTED: uncharacterized protein LOC103855008 [Brassica rapa]
Length=291

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 111/162 (69%), Gaps = 11/162 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H     D+LV +D + S    +G  +      S   +++  ++DK    G E++  V
Sbjct  1    MSDHLSSCTDRLVTSDHLNS----EGGSNESSGECSRAQATTKPIDDKE---GSEQE-HV  52

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             DEE PLI   ECRICQEEDSVKNLE+PC+CSGSLKYAHRKCVQ WCNEKGD  CEICH+
Sbjct  53   IDEEEPLIQSVECRICQEEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDTICEICHK  112

Query  440  PYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
             YQPGYTAPP   P++T ID+G    +G PLDL+DPR+LA+A
Sbjct  113  SYQPGYTAPP---PDDTIIDMGEDWANGVPLDLNDPRILAMA  151



>ref|XP_004235988.1| PREDICTED: uncharacterized protein LOC101260808 [Solanum lycopersicum]
Length=311

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 109/166 (66%), Gaps = 10/166 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MGEH  +  D+L+  + + S   + G+   E    S G S S  V     G   +KD E 
Sbjct  1    MGEHLALCVDRLITPESLPS---MQGS---EDAGSSEGDSCSHTVGQSACGTANKKDEEP  54

Query  260  ADEEAP--LIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
             D      L+   ECRICQEEDS KNLE PC+C+GSLKYAHRKCVQ WCNEKGDI CEIC
Sbjct  55   EDGGEDEPLLQTVECRICQEEDSPKNLEIPCSCNGSLKYAHRKCVQRWCNEKGDIICEIC  114

Query  434  HQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            HQPYQPGYTA PP S  E+  ID+ GGW ++GT LDLHDPRLLA+A
Sbjct  115  HQPYQPGYTAPPPPSLSEDIAIDMSGGWTVAGTQLDLHDPRLLAMA  160



>ref|XP_009796375.1| PREDICTED: uncharacterized protein LOC104242963 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009796376.1| PREDICTED: uncharacterized protein LOC104242963 isoform X1 [Nicotiana 
sylvestris]
Length=311

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 112/165 (68%), Gaps = 8/165 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKE-KDIE  256
            MGEH  +  D+L+  + + S   + G++  +  + +  + S  V +     + KE +++E
Sbjct  1    MGEHLALCVDRLITPESLHS---LQGSE--DAGSSAGSSCSHTVGQSPYGTINKEDEELE  55

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
               E+ PL+   ECRICQEEDS KNLE PC C+GSLKYAHRKCVQ WCNEKGDI CEICH
Sbjct  56   AGGEDEPLLQTVECRICQEEDSTKNLEIPCGCNGSLKYAHRKCVQRWCNEKGDIICEICH  115

Query  437  QPYQPGYTAPPRSQP-EETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            Q YQPGYTAPP   P E+  IDI  GW ++GT LDLHDPRLLA+A
Sbjct  116  QSYQPGYTAPPPLSPSEDIAIDISEGWTVAGTQLDLHDPRLLAMA  160



>ref|XP_010458939.1| PREDICTED: uncharacterized protein LOC104740106 [Camelina sativa]
Length=309

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +2

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
            +V +EE PLI   ECRICQEEDSVKNLE+PC+CSGSLKYAHRKCVQ WCNEKGDITCEIC
Sbjct  66   DVDEEEEPLIQSVECRICQEEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDITCEIC  125

Query  434  HQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            H+ YQPGYTAPP S  ++T IDIG    +G PLDL+DPR+ A+A
Sbjct  126  HKSYQPGYTAPPPSPADDTVIDIGEDWANGVPLDLNDPRIFAMA  169



>ref|NP_190339.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
 ref|NP_974396.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
 emb|CAB61981.1| putative protein [Arabidopsis thaliana]
 dbj|BAE98651.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE78297.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
 gb|AEE78300.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
Length=288

 Score =   164 bits (414),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 109/162 (67%), Gaps = 4/162 (2%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H  +  D+L+ ++ + S    D +     + +    +SS+V E +V      +   V
Sbjct  1    MADHLSLCTDRLITSESLDSEKDSDSSGESSYRPQGTDLASSSVNETEV----PREYYAV  56

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            ADEE PL+   ECRICQEEDS KNLE PCAC+GSLKYAHRKCVQ WCNEKGDITCEICHQ
Sbjct  57   ADEEEPLLQSVECRICQEEDSTKNLEAPCACNGSLKYAHRKCVQRWCNEKGDITCEICHQ  116

Query  440  PYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            PYQ GYTAPP   P+ET I IG    +G PLDL DPR+LA+A
Sbjct  117  PYQHGYTAPPPPPPDETIIHIGDDWENGVPLDLTDPRILAMA  158



>ref|NP_973407.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 gb|AEC05647.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
Length=275

 Score =   163 bits (413),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 96/126 (76%), Gaps = 7/126 (6%)
 Frame = +2

Query  197  SSSAVVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAH  376
            S S VV DK +      D +  DE  PLI   ECRIC +E  V+NLE+PCACSGSLKYAH
Sbjct  13   SESPVVNDKAL---DISDDDHDDENEPLIVSGECRICSDESPVENLESPCACSGSLKYAH  69

Query  377  RKCVQHWCNEKGDITCEICHQPYQPGYTAPPRS-QPEETTIDI-GGWQISGTPLDLHDPR  550
            RKCVQ WCNEKG+I CEICHQPYQPGYTAPP   QPEETTIDI GGW ISG  LD+HDPR
Sbjct  70   RKCVQRWCNEKGNIICEICHQPYQPGYTAPPPPLQPEETTIDIGGGWTISG--LDVHDPR  127

Query  551  LLAIAE  568
            LLAIAE
Sbjct  128  LLAIAE  133



>gb|KJB39912.1| hypothetical protein B456_007G037500 [Gossypium raimondii]
Length=193

 Score =   160 bits (406),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 107/165 (65%), Gaps = 10/165 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE-  256
            M +H VV  D+L K + + S    + A         +G  SS V E  V  +  E+  E 
Sbjct  1    MSDHLVVCVDRLTKPESLKSVNEPEVAG-------PSGEGSSVVAEPHVCAIDVEEVEEH  53

Query  257  -VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
               DEE PLI   ECRICQ+ED++ NLETPC+CSGSLK+AHRKCVQ WCNEKGDITCEIC
Sbjct  54   GSCDEEEPLIQTVECRICQDEDNINNLETPCSCSGSLKFAHRKCVQRWCNEKGDITCEIC  113

Query  434  HQPYQPGYTAPPRSQPEET-TIDIGGWQISGTPLDLHDPRLLAIA  565
            HQPYQPGYT PP     E  TIDI  W ++G PL LHD R+LA+A
Sbjct  114  HQPYQPGYTVPPPPPQPEVATIDISEWTVAGAPLGLHDQRILAVA  158



>ref|XP_009152224.1| PREDICTED: uncharacterized protein LOC103875455 [Brassica rapa]
 ref|XP_009152225.1| PREDICTED: uncharacterized protein LOC103875455 [Brassica rapa]
Length=294

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 111/162 (69%), Gaps = 16/162 (10%)
 Frame = +2

Query  89   HSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEVADE  268
            H VVN D L         +P   +  +  + E+    S+ VV DK + + ++++ +   E
Sbjct  10   HMVVNVDGL---------MPPVPSPPVNAEVENIREESTVVVNDKAIDISEDEEDQ---E  57

Query  269  EAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQ  448
              PLI   ECRICQ+E  +K LE+PCACSGSLKYAHRKCVQ WCNEKG+I CEICHQPYQ
Sbjct  58   NEPLIASAECRICQDECPIKTLESPCACSGSLKYAHRKCVQRWCNEKGNIICEICHQPYQ  117

Query  449  PGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PGYTA PP  QPEETTIDI GGW ISG  LDLHDPRLL IAE
Sbjct  118  PGYTAPPPPPQPEETTIDIGGGWTISG--LDLHDPRLLPIAE  157



>ref|XP_004155388.1| PREDICTED: uncharacterized protein LOC101228402 [Cucumis sativus]
Length=370

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 120/174 (69%), Gaps = 18/174 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGS---------GLPVDGAKHIEKKTESAGTSSSAVVEDKVVG  232
            M +H V+  D+L +   + S          LPVDG   ++  +  +  +S++ VE++   
Sbjct  76   MSDHLVLYVDRLARPPPLDSIPNPPEAVPLLPVDG--DLDSDSPLSSPTSASSVEER---  130

Query  233  MGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKG  412
             G+E +    ++++ LI   ECRICQ+ED ++ LETPCACSGSLKYAHRKC+Q WCNEKG
Sbjct  131  -GEENEGSDGEDDS-LIQTAECRICQDEDVIRKLETPCACSGSLKYAHRKCIQLWCNEKG  188

Query  413  DITCEICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            DI CEICHQPYQP YTA PP  + EET+IDI GGW I+GTPL+LHDPR LAIAE
Sbjct  189  DIICEICHQPYQPDYTAPPPPPRIEETSIDIGGGWTITGTPLNLHDPRFLAIAE  242



>ref|XP_007037351.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY21852.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
Length=289

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 86/104 (83%), Gaps = 2/104 (2%)
 Frame = +2

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            + EE PLI   ECRICQEED +KNLETPCACSGSLK+AHRKCVQ WCNEKGDITCEICHQ
Sbjct  55   SSEEEPLIQTVECRICQEEDCIKNLETPCACSGSLKFAHRKCVQRWCNEKGDITCEICHQ  114

Query  440  PYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            PYQPGYTA PP  Q E+ TIDI  GW I G PLDL DPR+LA+A
Sbjct  115  PYQPGYTAPPPPPQSEDATIDISEGWTIPGAPLDLRDPRILAMA  158



>ref|XP_007037352.1| RING/FYVE/PHD zinc finger superfamily protein isoform 3 [Theobroma 
cacao]
 ref|XP_007037353.1| RING/FYVE/PHD zinc finger superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY21853.1| RING/FYVE/PHD zinc finger superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY21854.1| RING/FYVE/PHD zinc finger superfamily protein isoform 3 [Theobroma 
cacao]
Length=286

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 86/104 (83%), Gaps = 2/104 (2%)
 Frame = +2

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            + EE PLI   ECRICQEED +KNLETPCACSGSLK+AHRKCVQ WCNEKGDITCEICHQ
Sbjct  55   SSEEEPLIQTVECRICQEEDCIKNLETPCACSGSLKFAHRKCVQRWCNEKGDITCEICHQ  114

Query  440  PYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            PYQPGYTA PP  Q E+ TIDI  GW I G PLDL DPR+LA+A
Sbjct  115  PYQPGYTAPPPPPQSEDATIDISEGWTIPGAPLDLRDPRILAMA  158



>ref|XP_004137411.1| PREDICTED: uncharacterized protein LOC101217964 [Cucumis sativus]
 ref|XP_004173576.1| PREDICTED: uncharacterized LOC101217964 [Cucumis sativus]
 gb|KGN64004.1| hypothetical protein Csa_1G033230 [Cucumis sativus]
Length=287

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 109/166 (66%), Gaps = 11/166 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGS--GLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI  253
            MG+H V+  D+L+  + + S  G    G+      ++++     A+  + V       D 
Sbjct  1    MGDHMVLCVDRLITPESLQSLQGTTAPGSSLESSSSQNSEPPVCAIAVEDV-------DE  53

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
                EE PLI   ECRICQEEDS+KNLE PCACSGSLKYAHRKCVQ WCNEKGDITCEIC
Sbjct  54   HDGSEEDPLIQTVECRICQEEDSIKNLEVPCACSGSLKYAHRKCVQRWCNEKGDITCEIC  113

Query  434  HQPYQPGYTAP-PRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            HQ YQPGYT P P  + E+ TID+  GW +S T LDL+DPRLLA+A
Sbjct  114  HQNYQPGYTLPVPPPRSEDATIDVSEGWAVSETALDLNDPRLLAMA  159



>ref|XP_008442459.1| PREDICTED: uncharacterized protein LOC103486295 [Cucumis melo]
 ref|XP_008442534.1| PREDICTED: uncharacterized protein LOC103486295 [Cucumis melo]
 ref|XP_008442612.1| PREDICTED: uncharacterized protein LOC103486295 [Cucumis melo]
Length=287

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 109/166 (66%), Gaps = 11/166 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGS--GLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI  253
            MG+H V+  D+L+  + + S  G    G+      ++++     A+  + V       D 
Sbjct  1    MGDHMVLCVDRLITPESLQSLQGTTAPGSSLESSSSQNSEPPVCAIAVEDV-------DE  53

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
                EE PLI   ECRICQEEDS+KNLE PCACSGSLKYAHRKCVQ WCNEKGDITCEIC
Sbjct  54   HDGSEEDPLIQTVECRICQEEDSIKNLEVPCACSGSLKYAHRKCVQRWCNEKGDITCEIC  113

Query  434  HQPYQPGYTAP-PRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            HQ YQPGYT P P  + E+ TID+  GW +S T LDL+DPRLLA+A
Sbjct  114  HQNYQPGYTLPVPPPRSEDATIDVSEGWAVSETALDLNDPRLLAMA  159



>gb|KJB39913.1| hypothetical protein B456_007G037500 [Gossypium raimondii]
Length=270

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 108/168 (64%), Gaps = 16/168 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTS---SSAVVEDKVVGMGKEKD  250
            M +H VV  D+L K + + S            + E AG S   SS V E  V  +  E+ 
Sbjct  1    MSDHLVVCVDRLTKPESLKSV----------NEPEVAGPSGEGSSVVAEPHVCAIDVEEV  50

Query  251  IE--VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITC  424
             E    DEE PLI   ECRICQ+ED++ NLETPC+CSGSLK+AHRKCVQ WCNEKGDITC
Sbjct  51   EEHGSCDEEEPLIQTVECRICQDEDNINNLETPCSCSGSLKFAHRKCVQRWCNEKGDITC  110

Query  425  EICHQPYQPGYTAPPRSQPEET-TIDIGGWQISGTPLDLHDPRLLAIA  565
            EICHQPYQPGYT PP     E  TIDI  W ++G PL LHD R+LA+A
Sbjct  111  EICHQPYQPGYTVPPPPPQPEVATIDISEWTVAGAPLGLHDQRILAVA  158



>gb|KFK34055.1| hypothetical protein AALP_AA5G096200 [Arabis alpina]
Length=326

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 106/167 (63%), Gaps = 10/167 (6%)
 Frame = +2

Query  65   LILV*MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKE  244
            L  + M +H  +  D+L+ +  + S           +  +S+G SS +   D       E
Sbjct  41   LSFLSMADHLSLCTDRLITSASLKSE---------SESPDSSGESSKSQGTDLASSSVNE  91

Query  245  KDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITC  424
            +   VADEE PL+   ECRICQEED+ KNLE PCAC+GSLKYAHRKCVQ WCNEKGDITC
Sbjct  92   EYYAVADEEEPLLLSVECRICQEEDTTKNLEAPCACNGSLKYAHRKCVQRWCNEKGDITC  151

Query  425  EICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            EICHQPYQ GYTAP    P+ET I IG    +G PLDL DPR+ A+A
Sbjct  152  EICHQPYQSGYTAPA-PPPDETIIHIGDEWENGVPLDLSDPRIRAMA  197



>gb|EAY86410.1| hypothetical protein OsI_07789 [Oryza sativa Indica Group]
Length=250

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +2

Query  263  DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQP  442
            +E   LIG+ ECRICQEED  KNLE+PCACSGSLKYAHR+CVQ WCNEKGDI CEICH  
Sbjct  21   EETGALIGMVECRICQEEDLAKNLESPCACSGSLKYAHRECVQRWCNEKGDIICEICHVS  80

Query  443  YQPGYTAPPRSQPEETTIDI--GGWQISGTPLDLHDPRLLAIA  565
            Y+PGYTAPP+   +ETTI+I  G W ISG  LDLHDPR+LA+A
Sbjct  81   YKPGYTAPPQVHHDETTIEISSGDWSISGNRLDLHDPRILAMA  123



>ref|XP_010502308.1| PREDICTED: uncharacterized protein LOC104779627 [Camelina sativa]
Length=273

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 88/113 (78%), Gaps = 4/113 (4%)
 Frame = +2

Query  224  VVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCN  403
            V     +K I+++DE  PLI   ECRIC ++  ++NLE+PCACSGSLKYAHRKCVQ WCN
Sbjct  39   VNNNNNDKAIDISDENEPLIASAECRICSDDSPIENLESPCACSGSLKYAHRKCVQRWCN  98

Query  404  EKGDITCEICHQPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLL  556
            EKG+I CEICHQPYQPGYTA PP  QPEETTIDI GGW ISG  LDLHD R L
Sbjct  99   EKGNILCEICHQPYQPGYTAPPPPFQPEETTIDIGGGWTISG--LDLHDRRYL  149



>ref|NP_001047219.1| Os02g0577100 [Oryza sativa Japonica Group]
 dbj|BAD34253.1| zinc finger (C3HC4-type RING finger)-like protein [Oryza sativa 
Japonica Group]
 dbj|BAF09133.1| Os02g0577100 [Oryza sativa Japonica Group]
 gb|EAZ23551.1| hypothetical protein OsJ_07249 [Oryza sativa Japonica Group]
Length=250

 Score =   160 bits (405),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 84/103 (82%), Gaps = 2/103 (2%)
 Frame = +2

Query  263  DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQP  442
            +E   LIG+ ECRICQEED  KNLE+PCACSGSLKYAHR+CVQ WCNEKGDI CEICH  
Sbjct  21   EETGALIGMVECRICQEEDLAKNLESPCACSGSLKYAHRECVQRWCNEKGDIICEICHVS  80

Query  443  YQPGYTAPPRSQPEETTIDI--GGWQISGTPLDLHDPRLLAIA  565
            Y+PGYTAPP+   +ETTI+I  G W ISG  LDLHDPR+LA+A
Sbjct  81   YKPGYTAPPQVHHDETTIEISSGDWSISGNRLDLHDPRILAMA  123



>ref|XP_006280868.1| hypothetical protein CARUB_v10026858mg [Capsella rubella]
 gb|EOA13766.1| hypothetical protein CARUB_v10026858mg [Capsella rubella]
Length=303

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +2

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            VADEE PLI   ECRICQEEDSVKNLE+PC+CSGSLKYAHRKCVQ WCNEKGDITCEICH
Sbjct  61   VADEEEPLIQSVECRICQEEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDITCEICH  120

Query  437  QPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            + YQPGYTAPP    +ET IDIG    +G P+DL+DPR+LA+A
Sbjct  121  KSYQPGYTAPPPPPADETVIDIGEDWANGVPIDLNDPRILAMA  163



>emb|CDY33757.1| BnaA09g45630D [Brassica napus]
Length=264

 Score =   160 bits (405),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 109/165 (66%), Gaps = 20/165 (12%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH VV+ D+L++        PV          ES     S ++ED  V + +    E 
Sbjct  1    MSEHMVVHVDRLMQ--------PVPS-----PPVESETPEPSCIMEDNAVDIYER---EG  44

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             +E+ PL+   ECRICQEE ++KNLE+PC+C+GSLKYAHRKCVQ WCNEKG+  CEICHQ
Sbjct  45   EEEKDPLVWWGECRICQEESAIKNLESPCSCNGSLKYAHRKCVQRWCNEKGNTICEICHQ  104

Query  440  PYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQ GYT+ PP  Q +ETTIDI GGW ISG  LDL DP LLAIAE
Sbjct  105  PYQAGYTSPPPPPQSDETTIDIGGGWTISG--LDLDDPNLLAIAE  147



>ref|XP_002876853.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53112.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=275

 Score =   160 bits (406),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 85/103 (83%), Gaps = 4/103 (4%)
 Frame = +2

Query  266  EEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPY  445
            E  PLI   ECRIC +E  V+NLE+PCACSGSLKYAHRKCVQ WCNEKG+I CEICHQ Y
Sbjct  37   ENEPLIVSAECRICSDESPVENLESPCACSGSLKYAHRKCVQRWCNEKGNIICEICHQSY  96

Query  446  QPGYTAPPRS-QPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            QPGYTAPP   QPEETTIDI GGW ISG  LD+HDPRLLAIAE
Sbjct  97   QPGYTAPPPPLQPEETTIDIGGGWTISG--LDVHDPRLLAIAE  137



>ref|XP_003575220.1| PREDICTED: uncharacterized protein LOC100838110 [Brachypodium 
distachyon]
Length=259

 Score =   160 bits (404),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +2

Query  263  DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQP  442
            +E   LIG+ ECRICQEED  KNLE+PCACSGSLKYAHR+CVQ WCNEKGDI CEICH+ 
Sbjct  28   EEVEALIGMVECRICQEEDLAKNLESPCACSGSLKYAHRECVQRWCNEKGDIICEICHEL  87

Query  443  YQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIA  565
            Y+PGYTAPP+   +ETTI+I G W ISG  LDLHDPR+LA+A
Sbjct  88   YKPGYTAPPQIHHDETTIEISGDWSISGNHLDLHDPRILAMA  129



>ref|XP_006306327.1| hypothetical protein CARUB_v10012202mg [Capsella rubella]
 gb|EOA39225.1| hypothetical protein CARUB_v10012202mg [Capsella rubella]
Length=261

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 110/165 (67%), Gaps = 23/165 (14%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M  H+VV  D L++        PV         TE+    S +  ++ V+ +    D   
Sbjct  1    MSNHTVVYVDGLIR--------PV--------LTEAESMRSESPEDNNVIDI---HDGVT  41

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             +EE  LI + ECRICQ+E ++KNLE+PCAC+GSLKYAHRKCVQ WCNEKG+  CEICHQ
Sbjct  42   TEEEDLLISLAECRICQDECAIKNLESPCACNGSLKYAHRKCVQRWCNEKGNTICEICHQ  101

Query  440  PYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQ GYT+ PP  Q E+TTIDI GGW+ISG  LDL+DPRLLAIAE
Sbjct  102  PYQAGYTSPPPPPQSEDTTIDIGGGWRISG--LDLNDPRLLAIAE  144



>ref|XP_007158651.1| hypothetical protein PHAVU_002G170900g [Phaseolus vulgaris]
 gb|ESW30645.1| hypothetical protein PHAVU_002G170900g [Phaseolus vulgaris]
Length=286

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 85/96 (89%), Gaps = 2/96 (2%)
 Frame = +2

Query  287  IRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGYTA-  463
            + ECRICQEEDS+ NLETPC+CSGSLKYAHRKCVQHWCNEKGDI CEICH+ Y+PGYTA 
Sbjct  65   LAECRICQEEDSINNLETPCSCSGSLKYAHRKCVQHWCNEKGDIICEICHKSYEPGYTAP  124

Query  464  PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PPR  PEETTIDI GGW ISG PLDL DPRLLAIAE
Sbjct  125  PPRPPPEETTIDIGGGWTISGMPLDLRDPRLLAIAE  160



>gb|KJB39911.1| hypothetical protein B456_007G037500 [Gossypium raimondii]
Length=354

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 108/168 (64%), Gaps = 16/168 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTS---SSAVVEDKVVGMGKEKD  250
            M +H VV  D+L K + + S            + E AG S   SS V E  V  +  E+ 
Sbjct  1    MSDHLVVCVDRLTKPESLKSV----------NEPEVAGPSGEGSSVVAEPHVCAIDVEEV  50

Query  251  IE--VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITC  424
             E    DEE PLI   ECRICQ+ED++ NLETPC+CSGSLK+AHRKCVQ WCNEKGDITC
Sbjct  51   EEHGSCDEEEPLIQTVECRICQDEDNINNLETPCSCSGSLKFAHRKCVQRWCNEKGDITC  110

Query  425  EICHQPYQPGYTAPPRSQPEET-TIDIGGWQISGTPLDLHDPRLLAIA  565
            EICHQPYQPGYT PP     E  TIDI  W ++G PL LHD R+LA+A
Sbjct  111  EICHQPYQPGYTVPPPPPQPEVATIDISEWTVAGAPLGLHDQRILAVA  158



>ref|XP_006647414.1| PREDICTED: uncharacterized protein LOC102704395 [Oryza brachyantha]
Length=255

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = +2

Query  278  LIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGY  457
            LIG+ ECRICQEED  KNLE+PCACSGSLKYAHR+CVQ WCNEKGDI CEICH  Y+PGY
Sbjct  31   LIGMVECRICQEEDLAKNLESPCACSGSLKYAHRECVQRWCNEKGDIVCEICHVSYKPGY  90

Query  458  TAPPRSQPEETTIDI--GGWQISGTPLDLHDPRLLAIA  565
            TAPP+   +ETTI+I  G W ISG  LDLHDPR+LA+A
Sbjct  91   TAPPQVHHDETTIEISSGDWSISGNRLDLHDPRILAMA  128



>gb|AFW62739.1| hypothetical protein ZEAMMB73_991282, partial [Zea mays]
Length=185

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = +2

Query  263  DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQP  442
            +E   L G+ ECRICQEED  KNLE+PCACSGSLKYAHR+CVQ WCNEKGDI CEICH+ 
Sbjct  29   EEMKALAGMVECRICQEEDLAKNLESPCACSGSLKYAHRECVQRWCNEKGDIICEICHES  88

Query  443  YQPGYTAPPRSQPEETTIDIGG--WQISGTPLDLHDPRLLAIA  565
            Y+PGYTAP +   +ETTI+I G  W ISG  LDLHDPR+LA+A
Sbjct  89   YKPGYTAPTQVHHDETTIEISGGDWTISGNRLDLHDPRILAMA  131



>ref|XP_009117914.1| PREDICTED: uncharacterized protein LOC103842978 [Brassica rapa]
Length=264

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 107/165 (65%), Gaps = 20/165 (12%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH VV  D+L++        PV          ES     S ++ED  V + + +  E 
Sbjct  1    MSEHLVVYVDRLMQ--------PVPS-----PPVESETPEPSCIMEDNAVDIYEREGEEE  47

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             D   PL+   ECRICQEE ++KNLE+PC+C+GSLKYAHRKCVQ WCNEKG+  CEICHQ
Sbjct  48   ED---PLVWWGECRICQEESAIKNLESPCSCNGSLKYAHRKCVQRWCNEKGNTICEICHQ  104

Query  440  PYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQ GYT+ PP  Q +ETTIDI GGW ISG  LDL DP LLAIAE
Sbjct  105  PYQAGYTSPPPPPQSDETTIDIGGGWTISG--LDLDDPNLLAIAE  147



>gb|EEE68755.1| hypothetical protein OsJ_27447 [Oryza sativa Japonica Group]
Length=299

 Score =   159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 108/190 (57%), Gaps = 42/190 (22%)
 Frame = +2

Query  80   MGEHSVVNFDQL---VKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKD  250
            M +H ++N   L   V+  E    LP            S G S   +     +   +E  
Sbjct  1    MKDHLMLNVSNLPESVEATEAAMNLP------------SGGVSLPPLSTTHTLLSVRES-  47

Query  251  IEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  430
              +  EE PLI   ECRICQEED++ NLE+PCAC+GSLKYAHR CVQ WC+EKGD+TCEI
Sbjct  48   --MGAEEEPLIQTVECRICQEEDNISNLESPCACTGSLKYAHRACVQRWCDEKGDLTCEI  105

Query  431  CHQPYQPGYTAPPRSQPEETTID------------------------IGGWQISGTPLDL  538
            CH+PY+ GYTA PR+ P+ETTID                        IGGW I+GT  DL
Sbjct  106  CHEPYKHGYTALPRAHPDETTIDIRQASILYYSHFFIYFNYLPVPITIGGWTITGTAFDL  165

Query  539  HDPRLLAIAE  568
            HDPR++A+A+
Sbjct  166  HDPRIIAMAQ  175



>ref|NP_001147728.1| protein binding protein [Zea mays]
 gb|ACG28504.1| protein binding protein [Zea mays]
Length=254

 Score =   157 bits (398),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = +2

Query  263  DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQP  442
            +E   L G+ ECRICQEED  KNLE+PCACSGSLKYAHR+CVQ WCNEKGDI CEICH+ 
Sbjct  29   EETKALAGMVECRICQEEDLAKNLESPCACSGSLKYAHRECVQRWCNEKGDIICEICHES  88

Query  443  YQPGYTAPPRSQPEETTIDIGG--WQISGTPLDLHDPRLLAIA  565
            Y+PGYTAP +   +ETTI+I G  W ISG  LDLHDPR+LA+A
Sbjct  89   YKPGYTAPTQVHHDETTIEISGGDWTISGNRLDLHDPRILAMA  131



>ref|NP_001152950.1| protein binding protein [Zea mays]
 ref|XP_008677189.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 ref|XP_008677190.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 ref|XP_008677191.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 gb|ACG44623.1| protein binding protein [Zea mays]
 gb|ACR33899.1| unknown [Zea mays]
 gb|AFW62736.1| protein binding protein isoform 1 [Zea mays]
 gb|AFW62737.1| protein binding protein isoform 2 [Zea mays]
 gb|AFW62738.1| protein binding protein isoform 3 [Zea mays]
Length=254

 Score =   157 bits (397),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = +2

Query  263  DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQP  442
            +E   L G+ ECRICQEED  KNLE+PCACSGSLKYAHR+CVQ WCNEKGDI CEICH+ 
Sbjct  29   EEMKALAGMVECRICQEEDLAKNLESPCACSGSLKYAHRECVQRWCNEKGDIICEICHES  88

Query  443  YQPGYTAPPRSQPEETTIDIGG--WQISGTPLDLHDPRLLAIA  565
            Y+PGYTAP +   +ETTI+I G  W ISG  LDLHDPR+LA+A
Sbjct  89   YKPGYTAPTQVHHDETTIEISGGDWTISGNRLDLHDPRILAMA  131



>emb|CDX81628.1| BnaC08g39730D [Brassica napus]
Length=262

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 105/165 (64%), Gaps = 22/165 (13%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH VV  D+L++        PV          ES     S ++ED  V +      E 
Sbjct  1    MSEHMVVYVDRLMQ--------PVPSTP-----VESETPEPSCIMEDNAVDI-----YEG  42

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE PL+   ECRICQEE ++KNLE+PC+C+GSLKYAHRKCVQ WCNEKG+  CEICHQ
Sbjct  43   EKEEDPLVWWGECRICQEESAIKNLESPCSCNGSLKYAHRKCVQRWCNEKGNTICEICHQ  102

Query  440  PYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            PYQ GYT+ PP  Q +ETTIDI GGW ISG  LDL  P LLAIAE
Sbjct  103  PYQAGYTSPPPPPQSDETTIDIGGGWTISG--LDLDHPNLLAIAE  145



>ref|NP_001131973.1| uncharacterized protein LOC100193371 [Zea mays]
 ref|XP_008676547.1| PREDICTED: uncharacterized protein LOC100193371 isoform X1 [Zea 
mays]
 gb|ACF80621.1| unknown [Zea mays]
Length=286

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 80/97 (82%), Gaps = 4/97 (4%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI   ECRICQEEDSVKNLE PCACSGSLKYAHR CVQ WCNEKGD TCEICH+ Y+PG
Sbjct  61   PLIQAAECRICQEEDSVKNLEKPCACSGSLKYAHRACVQRWCNEKGDTTCEICHEEYKPG  120

Query  455  YTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            YTAPPR QP+ETTIDI G  +    +DL DPR+LA+A
Sbjct  121  YTAPPRVQPDETTIDIDGDLV----MDLRDPRILAVA  153



>ref|XP_010426199.1| PREDICTED: uncharacterized protein LOC104711219 [Camelina sativa]
Length=282

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 84/105 (80%), Gaps = 1/105 (1%)
 Frame = +2

Query  254  EVADEEAPLI-GIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  430
            E  +EE PL+    ECRICQEED+ KNLE PCAC+GSLKYAHRKCVQ WCNEKGDITCEI
Sbjct  48   EAEEEEQPLLLQSVECRICQEEDTTKNLEAPCACNGSLKYAHRKCVQRWCNEKGDITCEI  107

Query  431  CHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            CHQPYQPGYTAPP   P+ET I IG    +G PLDL DPR+LA+A
Sbjct  108  CHQPYQPGYTAPPPPTPDETIIHIGDDWENGVPLDLTDPRILAMA  152



>ref|XP_006659438.1| PREDICTED: uncharacterized protein LOC102716520 isoform X3 [Oryza 
brachyantha]
Length=249

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 81/93 (87%), Gaps = 1/93 (1%)
 Frame = +2

Query  293  ECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGYTAPPR  472
            ECRICQEED+  NLE+PCAC+GSLKYAHR CVQ WC+EKGD+TCEICH+PY+ GYTA PR
Sbjct  25   ECRICQEEDNTSNLESPCACTGSLKYAHRVCVQRWCDEKGDLTCEICHEPYKHGYTALPR  84

Query  473  SQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            + P+ETTIDI GGW I+GT  DL DPR++A+A+
Sbjct  85   AHPDETTIDISGGWTITGTAFDLRDPRIIAMAQ  117



>ref|XP_008676546.1| PREDICTED: uncharacterized protein LOC100193371 isoform X2 [Zea 
mays]
 gb|AFW60448.1| hypothetical protein ZEAMMB73_249542 [Zea mays]
Length=382

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 80/97 (82%), Gaps = 4/97 (4%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI   ECRICQEEDSVKNLE PCACSGSLKYAHR CVQ WCNEKGD TCEICH+ Y+PG
Sbjct  157  PLIQAAECRICQEEDSVKNLEKPCACSGSLKYAHRACVQRWCNEKGDTTCEICHEEYKPG  216

Query  455  YTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            YTAPPR QP+ETTIDI G  +    +DL DPR+LA+A
Sbjct  217  YTAPPRVQPDETTIDIDGDLV----MDLRDPRILAVA  249



>ref|XP_004979617.1| PREDICTED: uncharacterized protein LOC101786150 isoform X1 [Setaria 
italica]
 ref|XP_004979618.1| PREDICTED: uncharacterized protein LOC101786150 isoform X2 [Setaria 
italica]
 ref|XP_004979619.1| PREDICTED: uncharacterized protein LOC101786150 isoform X3 [Setaria 
italica]
Length=285

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 80/97 (82%), Gaps = 4/97 (4%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI   ECRICQEEDSVKNLE PCACSGSLKYAHR CVQ WCNEKGD TCEICHQ Y+PG
Sbjct  57   PLIQAAECRICQEEDSVKNLEKPCACSGSLKYAHRACVQRWCNEKGDTTCEICHQEYKPG  116

Query  455  YTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            YTAPPR +P+ETTIDIG   I    +DL DPR+LA+A
Sbjct  117  YTAPPRVEPDETTIDIGEDLI----MDLRDPRILAVA  149



>gb|ABR16909.1| unknown [Picea sitchensis]
Length=287

 Score =   157 bits (396),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 106/171 (62%), Gaps = 17/171 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVV----EDKVVGMGKEK  247
            M +H V+  D+L+         P     H+E  ++SA   S A      E  ++  G  +
Sbjct  1    MSDHLVLYVDRLIT--------PSTFDTHVEIGSQSASDKSEASSLKDEELPLISDGPPQ  52

Query  248  ---DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDI  418
               D+   D+      + ECRICQEED  KN+ETPCACSGSLK+AHRKCVQ WCNEKG I
Sbjct  53   STFDLSGCDDGGAAFKLGECRICQEEDEEKNMETPCACSGSLKFAHRKCVQRWCNEKGSI  112

Query  419  TCEICHQPYQPGYTAPPR-SQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
             CEICHQPY PGYTAPP+ +  ++T ID+ G W + G  LDLHDPRLLA+A
Sbjct  113  ICEICHQPYSPGYTAPPQPAHSDDTAIDLSGSWGVPGAQLDLHDPRLLAMA  163



>ref|XP_002864796.1| hypothetical protein ARALYDRAFT_496422 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41055.1| hypothetical protein ARALYDRAFT_496422 [Arabidopsis lyrata subsp. 
lyrata]
Length=301

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 107/154 (69%), Gaps = 6/154 (4%)
 Frame = +2

Query  122  TDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE------VADEEAPLI  283
            TD + +   ++  +   +  ES+G SS A     +   GK ++ E      VA+EE PLI
Sbjct  9    TDRLVTPESLNSERGSNQSIESSGQSSKAQGSTSLSMDGKTEEDEATEQRDVAEEEEPLI  68

Query  284  GIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGYTA  463
               ECRICQEEDSVKNLE+PC+CSGSLKYAHRKCVQ WCNEKGD TCEICH+ YQPGYTA
Sbjct  69   QSVECRICQEEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDTTCEICHKSYQPGYTA  128

Query  464  PPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            PP    ++T IDIG    +G PLDL+DPR+LA+A
Sbjct  129  PPPPPADDTIIDIGEDWANGVPLDLNDPRILAMA  162



>ref|XP_006291602.1| hypothetical protein CARUB_v10017756mg [Capsella rubella]
 gb|EOA24500.1| hypothetical protein CARUB_v10017756mg [Capsella rubella]
Length=291

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +2

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            V++EE PL+   ECRICQEED+ KNLE PCAC+GSLKYAHRKCVQ WCNEKGDITCEICH
Sbjct  59   VSEEEEPLLQSVECRICQEEDTTKNLEAPCACNGSLKYAHRKCVQRWCNEKGDITCEICH  118

Query  437  QPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            QPYQPGYTAPP   P+ET I IG    +G PLDL DPR+LA+A
Sbjct  119  QPYQPGYTAPPPPPPDETIIHIGDDWENGVPLDLTDPRILAMA  161



>gb|AAM61387.1| nucleoside triphosphatase, putative [Arabidopsis thaliana]
Length=265

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 105/162 (65%), Gaps = 21/162 (13%)
 Frame = +2

Query  89   HSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEVADE  268
            H+VV  + LV+        PV        +TES   ++  + +          D    +E
Sbjct  5    HTVVYVNGLVR--------PVLAEAEYSMRTESPADNAIDIYD---------GDTTENEE  47

Query  269  EAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQ  448
            E PLI   ECRICQ+E  +KNLE+PCAC+GSLKYAHRKCVQ WCNEKG+  CEICHQPYQ
Sbjct  48   EDPLISSAECRICQDECDIKNLESPCACNGSLKYAHRKCVQRWCNEKGNTICEICHQPYQ  107

Query  449  PGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             GYT+ PP  Q EETTIDI GGW+ISG  LDL DPRLLAIAE
Sbjct  108  AGYTSPPPPPQSEETTIDIGGGWRISG--LDLDDPRLLAIAE  147



>ref|XP_007037350.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY21851.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
Length=304

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 86/122 (70%), Gaps = 20/122 (16%)
 Frame = +2

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            + EE PLI   ECRICQEED +KNLETPCACSGSLK+AHRKCVQ WCNEKGDITCEICHQ
Sbjct  55   SSEEEPLIQTVECRICQEEDCIKNLETPCACSGSLKFAHRKCVQRWCNEKGDITCEICHQ  114

Query  440  PYQPGYTA-PPRSQPEETTIDIG-------------------GWQISGTPLDLHDPRLLA  559
            PYQPGYTA PP  Q E+ TIDI                    GW I G PLDL DPR+LA
Sbjct  115  PYQPGYTAPPPPPQSEDATIDIRQVSTFSVCEDLSMSEAVCEGWTIPGAPLDLRDPRILA  174

Query  560  IA  565
            +A
Sbjct  175  MA  176



>ref|XP_008643782.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
 gb|ACL54097.1| unknown [Zea mays]
 gb|AFW71986.1| protein binding protein isoform 1 [Zea mays]
 gb|AFW71987.1| protein binding protein isoform 2 [Zea mays]
Length=259

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = +2

Query  263  DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQP  442
            +E   LIG+ ECRICQEED  KNLE+PCAC+GSLKYAHR+CVQ WCNEKGD  CEICH+ 
Sbjct  29   EETEALIGMVECRICQEEDLRKNLESPCACNGSLKYAHRECVQRWCNEKGDTICEICHEL  88

Query  443  YQPGYTAPPRSQPEETTIDIGG--WQISGTPLDLHDPRLLAIA  565
            Y+PGYTAP +   +ETTI+I G  W ISG  LDLHDPR+LA+A
Sbjct  89   YKPGYTAPTQVHHDETTIEISGGDWTISGNRLDLHDPRILAMA  131



>ref|NP_001150855.1| protein binding protein [Zea mays]
 gb|ACG35313.1| protein binding protein [Zea mays]
 gb|ACG40670.1| protein binding protein [Zea mays]
Length=258

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 83/103 (81%), Gaps = 2/103 (2%)
 Frame = +2

Query  263  DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQP  442
            +E   LIG+ ECRICQEED  KNLE+PCAC+GSLKYAHR+CVQ WCNEKGD  CEICH+ 
Sbjct  29   EETDALIGMVECRICQEEDLRKNLESPCACNGSLKYAHRECVQRWCNEKGDTICEICHEL  88

Query  443  YQPGYTAPPRSQPEETTIDIGG--WQISGTPLDLHDPRLLAIA  565
            Y+PGYTAP +   +ETTI+I G  W ISG  LDLHDPR+LA+A
Sbjct  89   YKPGYTAPTQVHHDETTIEISGGDWTISGNRLDLHDPRILAMA  131



>ref|XP_009771049.1| PREDICTED: uncharacterized protein LOC104221645 [Nicotiana sylvestris]
Length=301

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/102 (75%), Positives = 85/102 (83%), Gaps = 2/102 (2%)
 Frame = +2

Query  266  EEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPY  445
            EE PLI   ECRICQEEDS KNLE PC+CSGSLKYAHRKCVQ WCNEKGDITCEICHQ Y
Sbjct  48   EEEPLIQTVECRICQEEDSPKNLEIPCSCSGSLKYAHRKCVQRWCNEKGDITCEICHQTY  107

Query  446  QPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            +PGYTA PP    EET IDI GGW ++GT LD++DPRLL++A
Sbjct  108  RPGYTAPPPPPPSEETVIDISGGWTVAGTQLDINDPRLLSMA  149



>gb|EAZ18892.1| hypothetical protein OsJ_34434 [Oryza sativa Japonica Group]
Length=315

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 104/163 (64%), Gaps = 23/163 (14%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H VVN +          GL  DG   +EK +E+  +S   VV    +    +   E 
Sbjct  1    MGDHVVVNVE----------GLGNDGGA-VEKPSEAVNSS---VVAAASLSTTVDTVEEG  46

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE PLI   ECRICQEEDS+KNLE PCACSGSLKYAHR CVQ WCNEKGDITCEICH+
Sbjct  47   GGEEEPLIQAAECRICQEEDSIKNLEKPCACSGSLKYAHRACVQRWCNEKGDITCEICHE  106

Query  440  PYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIA  565
             Y+ GYTAPPR +P++T IDIGG W          DPR++A+A
Sbjct  107  QYKHGYTAPPRVEPDDTIIDIGGDWA--------RDPRIIAVA  141



>ref|NP_001068224.1| Os11g0600700 [Oryza sativa Japonica Group]
 gb|ABA94583.1| Zinc finger protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA94584.1| Zinc finger protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28587.1| Os11g0600700 [Oryza sativa Japonica Group]
 dbj|BAG92311.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87821.1| unnamed protein product [Oryza sativa Japonica Group]
Length=278

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 104/163 (64%), Gaps = 23/163 (14%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H VVN +          GL  DG   +EK +E+  +S   VV    +    +   E 
Sbjct  1    MGDHVVVNVE----------GLGNDGGA-VEKPSEAVNSS---VVAAASLSTTVDTVEEG  46

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE PLI   ECRICQEEDS+KNLE PCACSGSLKYAHR CVQ WCNEKGDITCEICH+
Sbjct  47   GGEEEPLIQAAECRICQEEDSIKNLEKPCACSGSLKYAHRACVQRWCNEKGDITCEICHE  106

Query  440  PYQPGYTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIA  565
             Y+ GYTAPPR +P++T IDIGG W          DPR++A+A
Sbjct  107  QYKHGYTAPPRVEPDDTIIDIGGDWA--------RDPRIIAVA  141



>ref|XP_006404365.1| hypothetical protein EUTSA_v10010967mg [Eutrema salsugineum]
 gb|ESQ45818.1| hypothetical protein EUTSA_v10010967mg [Eutrema salsugineum]
Length=290

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +2

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
            VA+EE  L  + ECRICQEED+ KNLE PCAC+GSLKYAHRKCVQ WCNEKGDITCEICH
Sbjct  58   VAEEEPFLQSVVECRICQEEDTTKNLEAPCACNGSLKYAHRKCVQRWCNEKGDITCEICH  117

Query  437  QPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            QPYQPGYTAPP    +ET I IG    +G PLDL DPR+LA+A
Sbjct  118  QPYQPGYTAPPPPPSDETIIHIGDDWENGVPLDLSDPRILAMA  160



>ref|XP_002875846.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52105.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=292

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 110/168 (65%), Gaps = 16/168 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE-  256
            M +H  +  D+L+ ++ + S          EK +ES+G SS       +     ++  E 
Sbjct  1    MADHLSLCTDRLITSESLNS----------EKDSESSGESSYRPQGTDLASSSVDEAEEP  50

Query  257  -----VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDIT  421
                 VA+EE PL+   ECRICQEED+ KNLE PCAC+GSLKYAHRKCVQ WCNEKGDIT
Sbjct  51   REYYAVAEEEEPLLQSVECRICQEEDTTKNLEAPCACNGSLKYAHRKCVQRWCNEKGDIT  110

Query  422  CEICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            CEICHQPYQPGYTAPP   P+ET I IG    +G PLDL DPR+LA+A
Sbjct  111  CEICHQPYQPGYTAPPPPPPDETIIHIGDDWENGVPLDLSDPRILAMA  158



>ref|NP_172878.1| RING-variant domain-containing protein [Arabidopsis thaliana]
 ref|NP_849660.1| RING-variant domain-containing protein [Arabidopsis thaliana]
 gb|AAY63562.1| RING domain protein [Arabidopsis thaliana]
 gb|ABD19667.1| At1g14260 [Arabidopsis thaliana]
 gb|AEE29132.1| RING-variant domain-containing protein [Arabidopsis thaliana]
 gb|AEE29133.1| RING-variant domain-containing protein [Arabidopsis thaliana]
Length=265

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 104/162 (64%), Gaps = 21/162 (13%)
 Frame = +2

Query  89   HSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEVADE  268
            H+VV  + LV+        PV        +TES          D  + +  + D    +E
Sbjct  5    HTVVYVNGLVR--------PVLAEAEYSMRTESPA--------DNAIDI-YDGDTTENEE  47

Query  269  EAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQ  448
            E  LI   ECRICQ+E  +KNLE+PCAC+GSLKYAHRKCVQ WCNEKG+  CEICHQPYQ
Sbjct  48   EDSLISSAECRICQDECDIKNLESPCACNGSLKYAHRKCVQRWCNEKGNTICEICHQPYQ  107

Query  449  PGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             GYT+ PP  Q EETTIDI GGW+ISG  LDL DPRLLAIAE
Sbjct  108  AGYTSPPPPPQSEETTIDIGGGWRISG--LDLDDPRLLAIAE  147



>dbj|BAC42747.1| unknown protein [Arabidopsis thaliana]
Length=265

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 104/162 (64%), Gaps = 21/162 (13%)
 Frame = +2

Query  89   HSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEVADE  268
            H+VV  + LV+        PV        +TES          D  + +  + D    +E
Sbjct  5    HTVVYVNGLVR--------PVLAEAEYSMRTESPA--------DNAIDI-YDGDTTENEE  47

Query  269  EAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQ  448
            E  LI   ECRICQ+E  +KNLE+PCAC+GSLKYAHRKCVQ WCNEKG+  CEICHQPYQ
Sbjct  48   EDSLISSAECRICQDECDIKNLESPCACNGSLKYAHRKCVQRWCNEKGNTICEICHQPYQ  107

Query  449  PGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             GYT+ PP  Q EETTIDI GGW+ISG  LDL DPRLLAIAE
Sbjct  108  AGYTSPPPPPQSEETTIDIGGGWRISG--LDLDDPRLLAIAE  147



>ref|XP_007210032.1| hypothetical protein PRUPE_ppa019151mg [Prunus persica]
 gb|EMJ11231.1| hypothetical protein PRUPE_ppa019151mg [Prunus persica]
Length=281

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 110/166 (66%), Gaps = 18/166 (11%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGS--GLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI  253
            MG+H V+  D+  K + + S  G    G+      ++SA   + A+    V G+G++   
Sbjct  1    MGDHLVLCVDRFTKPESLQSLQGNEAPGSSSEGSCSQSAELPTCAI---DVKGVGEKV--  55

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
             V +EE PLI   ECRICQEEDSVKNLE PCACSGSLK         WCNEKGDITCEIC
Sbjct  56   -VTEEEEPLIQTVECRICQEEDSVKNLEVPCACSGSLK--------RWCNEKGDITCEIC  106

Query  434  HQPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            HQPYQPGYTA PP  Q E+TTIDI  GW ISGTPLDL DPRLLA+A
Sbjct  107  HQPYQPGYTAPPPPPQSEDTTIDISEGWTISGTPLDLRDPRLLAMA  152



>ref|XP_010483957.1| PREDICTED: uncharacterized protein LOC104762381 [Camelina sativa]
 ref|XP_010483958.1| PREDICTED: uncharacterized protein LOC104762381 [Camelina sativa]
Length=301

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 110/166 (66%), Gaps = 5/166 (3%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESA----GTSSSAVVEDKVVGMGKEK  247
            M +H     D+LV T E  +       + IE   ES+     TS S  ++ K   +   +
Sbjct  1    MADHLSSCTDRLV-TPETLNPERRSSNETIESSGESSRAQGSTSLSTAMDLKTKEVEATE  59

Query  248  DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
              +V +EE PLI   ECRICQEEDSVKNLE+PC+CSGSLKYAHRKCVQ WCNEKGDITCE
Sbjct  60   QHDVDEEEEPLIQSVECRICQEEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDITCE  119

Query  428  ICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            ICH+ YQPGYTAPP    ++T IDIG    +G PLDL+DPR+ A+A
Sbjct  120  ICHKSYQPGYTAPPPPPADDTVIDIGEDWANGVPLDLNDPRIFAMA  165



>ref|XP_010444094.1| PREDICTED: uncharacterized protein LOC104726844 isoform X2 [Camelina 
sativa]
 ref|XP_010444095.1| PREDICTED: uncharacterized protein LOC104726844 isoform X2 [Camelina 
sativa]
Length=305

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 109/166 (66%), Gaps = 5/166 (3%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI--  253
            M +H     D+LV  + + S       + IE   ES+    S  +   +    KE++   
Sbjct  1    MADHLSSCTDRLVTPETLNSERGSSN-ETIESSGESSRAQGSTSLSTAMDLKTKEEEATE  59

Query  254  --EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
              +V +EE PLI   ECRICQEEDSVKNLE+PC+CSGSLKYAHRKCVQ WCNEKGDITCE
Sbjct  60   QHDVDEEEEPLIQSVECRICQEEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDITCE  119

Query  428  ICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            ICH+ YQPGYTAPP    ++T IDIG    +G PLDL+DPR+ A+A
Sbjct  120  ICHKSYQPGYTAPPPPPADDTVIDIGEDWANGVPLDLNDPRIFAMA  165



>ref|XP_010550603.1| PREDICTED: uncharacterized protein LOC104821422 [Tarenaya hassleriana]
Length=281

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  188  AGTSSSAVVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLK  367
            +G SS     D  V +   ++ +V++EE PLI   ECRICQEED+VKNLE PCACSGSLK
Sbjct  26   SGESSVPRPADPSVTVEAAREHDVSEEEEPLIQSVECRICQEEDTVKNLEAPCACSGSLK  85

Query  368  YAHRKCVQHWCNEKGDITCEICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDP  547
            YAHRKCVQ WCNEKGDITCEICHQ YQPGYTAPP   P++T IDIG    +G P DL+DP
Sbjct  86   YAHRKCVQRWCNEKGDITCEICHQTYQPGYTAPPPPPPDDTIIDIGNDWSNGGPFDLNDP  145

Query  548  RLLAIA  565
            RLLA+A
Sbjct  146  RLLAMA  151



>ref|XP_010503357.1| PREDICTED: uncharacterized protein LOC104780556 [Camelina sativa]
Length=281

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +2

Query  251  IEVADEEAPLI-GIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
            ++ ADEE PL+    ECRICQEED+ KNLE PCAC+GSLKYAHRKCVQ WCNEKGDITCE
Sbjct  46   VDEADEEEPLLLQSVECRICQEEDTTKNLEAPCACNGSLKYAHRKCVQRWCNEKGDITCE  105

Query  428  ICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            ICHQPYQPGYTAPP   P+ET I IG    +G PLDL DPR+LA+A
Sbjct  106  ICHQPYQPGYTAPPPPPPDETIIHIGDDWENGVPLDLTDPRILAMA  151



>ref|XP_010444093.1| PREDICTED: uncharacterized protein LOC104726844 isoform X1 [Camelina 
sativa]
Length=338

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 109/166 (66%), Gaps = 5/166 (3%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI--  253
            M +H     D+LV  + + S       + IE   ES+    S  +   +    KE++   
Sbjct  34   MADHLSSCTDRLVTPETLNSERGSSN-ETIESSGESSRAQGSTSLSTAMDLKTKEEEATE  92

Query  254  --EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
              +V +EE PLI   ECRICQEEDSVKNLE+PC+CSGSLKYAHRKCVQ WCNEKGDITCE
Sbjct  93   QHDVDEEEEPLIQSVECRICQEEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDITCE  152

Query  428  ICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            ICH+ YQPGYTAPP    ++T IDIG    +G PLDL+DPR+ A+A
Sbjct  153  ICHKSYQPGYTAPPPPPADDTVIDIGEDWANGVPLDLNDPRIFAMA  198



>gb|KHG30735.1| E3 ubiquitin-protein ligase MARCH2 [Gossypium arboreum]
Length=361

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 103/167 (62%), Gaps = 22/167 (13%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTS---SSAVVEDKVVGMGKEKD  250
            M +H VV  D L K + + S            + E AG S   SS V E  V  +  E+ 
Sbjct  1    MSDHLVVCVDHLTKPESLKSV----------NEPEVAGPSGEGSSIVAEPHVCAIDVEEV  50

Query  251  IEVA--DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITC  424
             E    DEE PLI   ECRICQ+ED++ NLETPC+CSGSLK+AHRKCVQ WCNEKGDITC
Sbjct  51   EEQGSCDEEEPLIQTVECRICQDEDNINNLETPCSCSGSLKFAHRKCVQRWCNEKGDITC  110

Query  425  EICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            EICHQPYQPGYT PP     E       W ++G PL LHD R+LA+A
Sbjct  111  EICHQPYQPGYTVPPPPPQPE-------WTVTGAPLGLHDQRILAVA  150



>emb|CDY47401.1| BnaCnng15100D [Brassica napus]
Length=286

 Score =   150 bits (380),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 104/162 (64%), Gaps = 7/162 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H  +  D+L+  + + S      +  ++ K + A +SS+   ED        K   V
Sbjct  1    MSDHLSLCTDRLITAESLESEKDSGESSRLQGK-DVASSSSADEAEDA------RKYYAV  53

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE PL+   ECRICQEED  KNLETPCAC+GSLKYAHRKCVQ WCNEKGDI CEICHQ
Sbjct  54   VAEEEPLLQSVECRICQEEDITKNLETPCACNGSLKYAHRKCVQRWCNEKGDIICEICHQ  113

Query  440  PYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            PYQ GYTAPP   P+ET I IG    +G  LDL DPR+LA+A
Sbjct  114  PYQSGYTAPPPPPPDETIIHIGDDWENGVHLDLSDPRILAMA  155



>emb|CDY00288.1| BnaA06g21890D [Brassica napus]
Length=298

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 92/119 (77%), Gaps = 1/119 (1%)
 Frame = +2

Query  209  VVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCV  388
             ++DK V + +E+D    +EE PLI   ECRICQ+EDSVKNLE+PC+CSGSLKYAHRKCV
Sbjct  42   AIDDKTVQV-EERDDVADEEEEPLIQSVECRICQDEDSVKNLESPCSCSGSLKYAHRKCV  100

Query  389  QHWCNEKGDITCEICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            Q WCNEKGD TCEICH+ YQPGYTAPP    ++T IDIG    +G PLD +DPR+ A+A
Sbjct  101  QRWCNEKGDTTCEICHKSYQPGYTAPPPPPADDTVIDIGEDWANGVPLDFNDPRIFAMA  159



>ref|XP_006394393.1| hypothetical protein EUTSA_v10004664mg [Eutrema salsugineum]
 gb|ESQ31679.1| hypothetical protein EUTSA_v10004664mg [Eutrema salsugineum]
Length=305

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 107/165 (65%), Gaps = 5/165 (3%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIE-  256
            M +H     D+LV +D + S      +     + +  GT+S +  +       +E+  E 
Sbjct  1    MADHLSSCTDRLVTSDHLNSERGSIESSGESSRAQ--GTTSLSTTKSMNHETEREEATEQ  58

Query  257  --VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  430
              V DEE PLI   ECRICQEEDSVKNLE+PC+CSGSLKYAHRKCVQ WCNEKGD  CEI
Sbjct  59   NDVDDEEEPLIQSVECRICQEEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDTICEI  118

Query  431  CHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            CH+ YQ GYTAPP    ++T IDIG    +G PLDL+DPR+LA+A
Sbjct  119  CHKSYQSGYTAPPPPPADDTVIDIGEDWANGVPLDLNDPRILAMA  163



>gb|KCW83611.1| hypothetical protein EUGRSUZ_B00506 [Eucalyptus grandis]
Length=147

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 93/145 (64%), Gaps = 13/145 (9%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH V+  D  +  +          ++ +EK  + AG  SS+   D      + +DI+V
Sbjct  1    MSEHLVLCVDHFITPER---------SQSLEKAAKPAGEGSSSHTADPATSAVEVEDIQV  51

Query  260  ---ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEI  430
                +EE PLI   ECRICQEEDS+KNLETPCACSGSLKYAHRKCVQ WCNEKGD+ CEI
Sbjct  52   INTCEEEEPLIQTVECRICQEEDSIKNLETPCACSGSLKYAHRKCVQRWCNEKGDVICEI  111

Query  431  CHQPYQPGYTAPPR-SQPEETTIDI  502
            CHQ Y+PGYTAPP     E+  IDI
Sbjct  112  CHQAYEPGYTAPPAPPNSEDAAIDI  136



>ref|XP_009151367.1| PREDICTED: uncharacterized protein LOC103874679 [Brassica rapa]
Length=301

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 110/163 (67%), Gaps = 2/163 (1%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSA-VVEDKVVGMGKEKDIE  256
            M +H     D+LV +D + S    + +      T S  +S++   ++DK V + +E+D  
Sbjct  1    MSDHLSSCTDRLVTSDHLNSDRGSNESSGESSGTTSLSSSTTTKAIDDKTVQV-EERDDV  59

Query  257  VADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH  436
              +EE PLI   ECRICQ+EDSVKNLE PC+CSGSLKYAHRKCVQ WCNEKGD TCEICH
Sbjct  60   ADEEEEPLIQSVECRICQDEDSVKNLECPCSCSGSLKYAHRKCVQRWCNEKGDTTCEICH  119

Query  437  QPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            + YQPGYTAPP    ++T IDIG    +G PLD +DPR+ A+A
Sbjct  120  KSYQPGYTAPPPPPADDTVIDIGEDWANGVPLDFNDPRIFAMA  162



>emb|CDY39330.1| BnaC05g10490D [Brassica napus]
Length=252

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 98/165 (59%), Gaps = 29/165 (18%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH VV  D+L                   ++   AG SS    ED  V +        
Sbjct  1    MSEHMVVYVDRL-------------------RRPVLAGPSSLTAKEDNAVYVYD------  35

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             D  A  +   ECRICQEE ++ NLE+PCAC+GSLKYAHRKCVQ WCNEKG+  CEICHQ
Sbjct  36   GDTFATEMWSAECRICQEESAIMNLESPCACNGSLKYAHRKCVQRWCNEKGNTICEICHQ  95

Query  440  PYQPGYTAPPRS-QPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             YQ GYT+PP   + EETTIDI GGW ISG  LDL DP LLAIAE
Sbjct  96   SYQAGYTSPPPPLRSEETTIDIGGGWTISG--LDLDDPHLLAIAE  138



>ref|NP_568953.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 dbj|BAB11496.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL31206.1| AT5g62460/K19B1_7 [Arabidopsis thaliana]
 gb|AAM98316.1| At5g62460/K19B1_7 [Arabidopsis thaliana]
 gb|AED97609.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
Length=307

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 109/169 (64%), Gaps = 9/169 (5%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDI--  253
            M +    + D+LVK + + S    +  + IE   ES+    S  +       GK+ +   
Sbjct  1    MADDQSSSTDRLVKPESLNSDRGSN--QSIESSGESSRAQGSTSLSTTKSMDGKKTEEEE  58

Query  254  -----EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDI  418
                 +V DEE PLI   ECRICQEEDSVKNLE+PC+CSGSLKYAHRKCVQ WCNEKGD 
Sbjct  59   TTEQRDVDDEEEPLIQSVECRICQEEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDT  118

Query  419  TCEICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            TCEICH+ YQPGYTAPP    ++T IDIG    +G  LDL+DPR+LA+A
Sbjct  119  TCEICHKSYQPGYTAPPPPPADDTIIDIGEDWGNGVHLDLNDPRILAMA  167



>ref|XP_010495897.1| PREDICTED: uncharacterized protein LOC104773043 [Camelina sativa]
 ref|XP_010495902.1| PREDICTED: uncharacterized protein LOC104773043 [Camelina sativa]
Length=245

 Score =   147 bits (371),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 92/122 (75%), Gaps = 6/122 (5%)
 Frame = +2

Query  209  VVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCV  388
            + ED V+ +     +     E  LI + ECRICQE+ +++NLE+PC+C+G+LKYAHRKCV
Sbjct  11   LAEDSVIDI--HDGVTTTTTEDSLISLAECRICQEDCAIENLESPCSCNGTLKYAHRKCV  68

Query  389  QHWCNEKGDITCEICHQPYQPGYTAPPRSQ-PEETTIDI-GGWQISGTPLDLHDPRLLAI  562
            Q WCNEKG+  CEICHQPYQ GYT+PP     EETTIDI GGW+ISG  LDL+DPRLLAI
Sbjct  69   QRWCNEKGNTLCEICHQPYQSGYTSPPPPPLSEETTIDIGGGWRISG--LDLNDPRLLAI  126

Query  563  AE  568
            AE
Sbjct  127  AE  128



>ref|XP_010458913.1| PREDICTED: uncharacterized protein LOC104740089 [Camelina sativa]
 ref|XP_010458914.1| PREDICTED: uncharacterized protein LOC104740089 [Camelina sativa]
Length=248

 Score =   147 bits (371),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 85/99 (86%), Gaps = 4/99 (4%)
 Frame = +2

Query  278  LIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGY  457
            LI + ECRICQE+ +++NLE+PC+C+G+LKYAHRKCVQ WCNEKG+  CEICHQPYQ GY
Sbjct  35   LISLAECRICQEDCAIENLESPCSCNGTLKYAHRKCVQRWCNEKGNTLCEICHQPYQAGY  94

Query  458  TA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            T+ PP  Q EETTIDI GGW+ISG  LDL+DPRLLAIAE
Sbjct  95   TSPPPPPQSEETTIDIGGGWRISG--LDLNDPRLLAIAE  131



>ref|XP_006663028.1| PREDICTED: uncharacterized protein LOC102719334, partial [Oryza 
brachyantha]
Length=276

 Score =   147 bits (372),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 78/98 (80%), Gaps = 9/98 (9%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI   ECRICQEEDSVKNLE PCACSGSLKYAHR CVQ WCNEKGDITCEICH+ Y+PG
Sbjct  52   PLIQGAECRICQEEDSVKNLEKPCACSGSLKYAHRACVQRWCNEKGDITCEICHEQYKPG  111

Query  455  YTAPPRSQPEETTIDIGG-WQISGTPLDLHDPRLLAIA  565
            YTAPPR +P++T IDIGG W          DPR++A+A
Sbjct  112  YTAPPRVEPDDTIIDIGGDWA--------RDPRIIAVA  141



>ref|XP_010515059.1| PREDICTED: uncharacterized protein LOC104790960 [Camelina sativa]
Length=276

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +2

Query  293  ECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGYTAPPR  472
            ECRICQEED+ KNLE PCAC+GSLKYAHRKCVQ WCNEKGDITCEICHQPYQPGYTAPP 
Sbjct  56   ECRICQEEDTTKNLEAPCACNGSLKYAHRKCVQRWCNEKGDITCEICHQPYQPGYTAPPP  115

Query  473  SQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
              P+ET I IG    +G PLDL DPR+LA+A
Sbjct  116  PPPDETIIHIGDDWENGVPLDLTDPRILAMA  146



>gb|KDO55564.1| hypothetical protein CISIN_1g039690mg, partial [Citrus sinensis]
Length=216

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 2/87 (2%)
 Frame = +2

Query  311  EEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGYTA-PPRSQPEE  487
            EEDS+KNLE PC+CSGSLKYAHRKCVQ WCNEKGD+TCEICHQPYQPGYTA PP  Q E+
Sbjct  1    EEDSIKNLEVPCSCSGSLKYAHRKCVQRWCNEKGDVTCEICHQPYQPGYTAPPPPPQSED  60

Query  488  TTIDIG-GWQISGTPLDLHDPRLLAIA  565
            TTIDI   W +SG PLDLHDPRL+A+A
Sbjct  61   TTIDISEAWTVSGAPLDLHDPRLVAMA  87



>tpg|DAA40085.1| TPA: hypothetical protein ZEAMMB73_046641 [Zea mays]
Length=263

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 93/141 (66%), Gaps = 10/141 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH ++N D L   +      P +    ++ K+     +    +   ++ +G+     +
Sbjct  1    MKEHLMLNIDDLSILE------PNEVIGTVKNKSSGETIAHPPSMAHAILAVGES----M  50

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              E  PL+ + ECRICQEEDS+KNLE+PCAC+GSLKYAHR CVQ WCNEKGD+TCEICH+
Sbjct  51   VSEAEPLLQVVECRICQEEDSIKNLESPCACTGSLKYAHRTCVQRWCNEKGDVTCEICHE  110

Query  440  PYQPGYTAPPRSQPEETTIDI  502
            PY+ GYTAPPR  P+ETTIDI
Sbjct  111  PYEHGYTAPPRGHPDETTIDI  131



>ref|XP_008352983.1| PREDICTED: E3 ubiquitin-protein ligase MARCH9-like [Malus domestica]
 ref|XP_008352984.1| PREDICTED: E3 ubiquitin-protein ligase MARCH9-like [Malus domestica]
 ref|XP_008352985.1| PREDICTED: E3 ubiquitin-protein ligase MARCH9-like [Malus domestica]
Length=133

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 90/142 (63%), Gaps = 9/142 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H V+  D+L++        P+      +   E+      A  E +    G       
Sbjct  1    MSDHLVLYVDRLLR--------PMAAQPPSQPAAEAGYVXEPAGPEPERDAAGPSS-SSS  51

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
            A+E+  LI   ECRICQ+EDS+ NLE+PCAC GSLKYAHRKCVQHWCNEKGDITCEICHQ
Sbjct  52   AEEDEXLIQTAECRICQDEDSISNLESPCACCGSLKYAHRKCVQHWCNEKGDITCEICHQ  111

Query  440  PYQPGYTAPPRSQPEETTIDIG  505
            PYQPGYTAPPR   +ETTI+ G
Sbjct  112  PYQPGYTAPPRPPSDETTIEFG  133



>emb|CDY21792.1| BnaA06g20610D [Brassica napus]
Length=284

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PL+   ECRICQEED+++NLE PCAC+GSLKYAHRKCVQ WCNEKGDITCEICHQ YQPG
Sbjct  58   PLLQSVECRICQEEDTIQNLEAPCACNGSLKYAHRKCVQRWCNEKGDITCEICHQAYQPG  117

Query  455  YTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            YTAPP   P+ET I IG    +G PLDL DPR+LA+A
Sbjct  118  YTAPPPPPPDETIIHIGDNWENGVPLDLSDPRILAMA  154



>gb|ADA67984.1| RING-type E3 ubiquitin ligase [Brassica napus]
Length=286

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 102/162 (63%), Gaps = 7/162 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H  +  D+L+  + + S      +  ++ K + A +SS+   ED        K   V
Sbjct  1    MSDHLSLCTDRLITAESLESEKDSGESSRLQGK-DVASSSSADEAEDA------RKYYAV  53

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE PL+   ECRICQEED  KNLETPCAC+GSLKYAHRKCVQ WCNEKGDI CEICHQ
Sbjct  54   VAEEEPLLQSVECRICQEEDITKNLETPCACNGSLKYAHRKCVQRWCNEKGDIICEICHQ  113

Query  440  PYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            PYQ GYTAPP   P+ET I IG     G  LD  DPR+LA+A
Sbjct  114  PYQSGYTAPPPPPPDETIIHIGDDWEDGVHLDSSDPRILAMA  155



>ref|XP_009149902.1| PREDICTED: uncharacterized protein LOC103873230 [Brassica rapa]
Length=286

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 100/162 (62%), Gaps = 7/162 (4%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M +H  +  D+L+  + + S     G     +  + A +SS    ED        K   V
Sbjct  1    MSDHLSLCTDRLITAESLESEKD-SGESSRPQGKDVASSSSGDEAEDA------RKYYAV  53

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE PL+   ECRICQEED   NLETPCAC+GSLKYAHRKCVQ WCNEKGDI CEICHQ
Sbjct  54   VAEEEPLLQAVECRICQEEDITNNLETPCACNGSLKYAHRKCVQRWCNEKGDIICEICHQ  113

Query  440  PYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            PYQ GYTAPP   P+ET I IG    +G  LDL DPR+LA+A
Sbjct  114  PYQSGYTAPPPPPPDETIIHIGDDWENGVHLDLSDPRILAMA  155



>emb|CDY65201.1| BnaCnng45990D [Brassica napus]
Length=302

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = +2

Query  212  VEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQ  391
            ++DK V + +E+D    +EE PLI   ECRICQ+EDS+KNLE+PC+CSGSLKYAHRKCVQ
Sbjct  46   IDDKNVQV-EERDDVADEEEEPLIQSVECRICQDEDSIKNLESPCSCSGSLKYAHRKCVQ  104

Query  392  HWCNEKGDITCEICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
             WCNEKGD  CEICH+ YQPGYTAPP    ++T IDIG    +G PLD +DPR+ A+A
Sbjct  105  RWCNEKGDTICEICHKSYQPGYTAPPPPPADDTVIDIGEDWANGVPLDFNDPRIFAMA  162



>emb|CDY08974.1| BnaC08g12040D [Brassica napus]
 emb|CDX82717.1| BnaC07g01490D [Brassica napus]
Length=191

 Score =   143 bits (361),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 88/129 (68%), Gaps = 10/129 (8%)
 Frame = +2

Query  188  AGTSSSAVVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLK  367
            AG SS    ED  V +         D  A  +   ECRICQEE ++ NLE+PCAC+GSLK
Sbjct  14   AGPSSLTAKEDNAVYVYD------GDTFATEMWSAECRICQEESAIMNLESPCACNGSLK  67

Query  368  YAHRKCVQHWCNEKGDITCEICHQPYQPGYTAPPRS-QPEETTIDI-GGWQISGTPLDLH  541
            YAHRKCVQ WCNEKG+  CEICHQ YQ GYT+PP   + EETTIDI GGW ISG  LDL 
Sbjct  68   YAHRKCVQRWCNEKGNTICEICHQSYQAGYTSPPPPLRSEETTIDIGGGWTISG--LDLD  125

Query  542  DPRLLAIAE  568
            DP LLAIAE
Sbjct  126  DPHLLAIAE  134



>ref|XP_004952874.1| PREDICTED: uncharacterized protein LOC101767233 isoform X1 [Setaria 
italica]
 ref|XP_004952875.1| PREDICTED: uncharacterized protein LOC101767233 isoform X2 [Setaria 
italica]
Length=308

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 86/152 (57%), Gaps = 51/152 (34%)
 Frame = +2

Query  263  DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQP  442
            +E   LIG+ ECRICQEED  KNLE+PCACSGSLKYAHR+CVQ WCNEKGDITCEICHQ 
Sbjct  29   EEAEALIGMVECRICQEEDLAKNLESPCACSGSLKYAHRECVQRWCNEKGDITCEICHQS  88

Query  443  YQPGYTAPPRSQPEETTIDI----------------------------------------  502
            Y+PGYTAPP+   +ETTI+I                                        
Sbjct  89   YKPGYTAPPQVHHDETTIEIRFVMFIREANRFPFHPGVLRELYFCMIKLFLYIIKFLLFL  148

Query  503  -----------GGWQISGTPLDLHDPRLLAIA  565
                       G W ISG  LDLHDPR+LA+A
Sbjct  149  MCVYFLNFFSGGDWTISGNHLDLHDPRILAMA  180



>gb|AAF43925.1|AC012188_2 Contains similarity to PIT1 from Arabidopsis thaliana gb|AF130849 
[Arabidopsis thaliana]
Length=274

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 104/173 (60%), Gaps = 30/173 (17%)
 Frame = +2

Query  83   GEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEVA  262
              H+VV  + LV+        PV        +TES   ++  + +          D    
Sbjct  3    NHHTVVYVNGLVR--------PVLAEAEYSMRTESPADNAIDIYD---------GDTTEN  45

Query  263  DEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICH--  436
            +EE  LI   ECRICQ+E  +KNLE+PCAC+GSLKYAHRKCVQ WCNEKG+  CEICH  
Sbjct  46   EEEDSLISSAECRICQDECDIKNLESPCACNGSLKYAHRKCVQRWCNEKGNTICEICHQL  105

Query  437  -------QPYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
                   QPYQ GYT+ PP  Q EETTIDI GGW+ISG  LDL DPRLLAIAE
Sbjct  106  KLNFLLFQPYQAGYTSPPPPPQSEETTIDIGGGWRISG--LDLDDPRLLAIAE  156



>ref|XP_002966474.1| hypothetical protein SELMODRAFT_67929, partial [Selaginella moellendorffii]
 ref|XP_002982046.1| hypothetical protein SELMODRAFT_57982, partial [Selaginella moellendorffii]
 gb|EFJ16714.1| hypothetical protein SELMODRAFT_57982, partial [Selaginella moellendorffii]
 gb|EFJ32501.1| hypothetical protein SELMODRAFT_67929, partial [Selaginella moellendorffii]
Length=183

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 77/94 (82%), Gaps = 3/94 (3%)
 Frame = +2

Query  293  ECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGYTAPPR  472
            ECRICQEED V NLE PCACSGS+KYAHRKCVQ WCNEKGD TCEIC +PYQPGYTAPPR
Sbjct  3    ECRICQEEDDVGNLEAPCACSGSVKYAHRKCVQRWCNEKGDTTCEICQKPYQPGYTAPPR  62

Query  473  S-QPEETTIDI-GGWQISGT-PLDLHDPRLLAIA  565
              +PE T ID+ G W I+G   LDL DPR+LA+A
Sbjct  63   PVEPEGTPIDLSGNWGITGPHQLDLRDPRILAMA  96



>emb|CDX77863.1| BnaC03g53560D [Brassica napus]
Length=256

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 89/122 (73%), Gaps = 2/122 (2%)
 Frame = +2

Query  206  AVVEDKVVGMGKEKDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKC  385
            ++  D+       + ++  +EE P +   ECRICQEED+++NLE PCAC+GSLKYAHRKC
Sbjct  6    SLCTDRADLASSSEGVDAVEEEEPHLQSVECRICQEEDTIQNLEAPCACNGSLKYAHRKC  65

Query  386  VQHWCNEKGDITCEICHQPYQPGYTA--PPRSQPEETTIDIGGWQISGTPLDLHDPRLLA  559
            VQ WCNEKGDITCEICHQ YQPGYTA  PP   P+ET I IG    +G PLDL DPR+LA
Sbjct  66   VQRWCNEKGDITCEICHQAYQPGYTAPPPPPPPPDETIIHIGDNWENGVPLDLSDPRILA  125

Query  560  IA  565
            +A
Sbjct  126  MA  127



>emb|CDY61272.1| BnaA06g38610D [Brassica napus]
Length=286

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  245  KDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITC  424
            K   V  EE PL+   ECRICQEED   NLETPC+C+GSLKYAHRKCVQ WCNEKGDI C
Sbjct  49   KYYAVVAEEEPLLQAVECRICQEEDITNNLETPCSCNGSLKYAHRKCVQRWCNEKGDIIC  108

Query  425  EICHQPYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
            EICHQPYQ GYTAPP   P+ET I IG    +G  LDL DPR+LA+A
Sbjct  109  EICHQPYQSGYTAPPPPPPDETIIHIGDDWENGVHLDLSDPRILAMA  155



>ref|XP_002890046.1| hypothetical protein ARALYDRAFT_471592 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66305.1| hypothetical protein ARALYDRAFT_471592 [Arabidopsis lyrata subsp. 
lyrata]
Length=253

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 79/94 (84%), Gaps = 4/94 (4%)
 Frame = +2

Query  293  ECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGYTA-PP  469
            ECRICQEE  +K LE+PC+C+GSLKYAHRKCVQ WCNEKG+  CEICHQPYQ GYT+ PP
Sbjct  45   ECRICQEECDIKTLESPCSCNGSLKYAHRKCVQRWCNEKGNTICEICHQPYQAGYTSPPP  104

Query  470  RSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
              Q EETTIDI GGW+ISG  LDL DPRLLAIAE
Sbjct  105  PPQSEETTIDIGGGWRISG--LDLDDPRLLAIAE  136



>ref|XP_010476475.1| PREDICTED: uncharacterized protein LOC104755722 [Camelina sativa]
Length=254

 Score =   142 bits (357),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/99 (70%), Positives = 83/99 (84%), Gaps = 4/99 (4%)
 Frame = +2

Query  278  LIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGY  457
            L+   ECRICQE+ +++NLE+PC+C+G+LKYAHRKC+Q WCNEKG+  CEICHQPYQ GY
Sbjct  41   LVSSAECRICQEDCAIENLESPCSCNGTLKYAHRKCIQRWCNEKGNTLCEICHQPYQAGY  100

Query  458  TAPPRSQ-PEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
            T+PP     EETTIDI GGW+ISG  LDL+DPRLLAIAE
Sbjct  101  TSPPPPPISEETTIDIGGGWRISG--LDLNDPRLLAIAE  137



>emb|CDY49102.1| BnaA06g09040D [Brassica napus]
Length=255

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 100/165 (61%), Gaps = 29/165 (18%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH +V  D++++        PV            A  SS  V ED  V +        
Sbjct  1    MSEHMLVYVDRVMR--------PV-----------LAEPSSLTVKEDNAVYVYD------  35

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             D  A  +   ECRICQEE ++ NLE+PCAC+GSLKYAHRKCVQ WCNEKG+  CEIC+Q
Sbjct  36   GDTFATEMWSAECRICQEESAIMNLESPCACNGSLKYAHRKCVQRWCNEKGNTICEICNQ  95

Query  440  PYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             YQ GYT+ PP  + EETTIDI GGW ISG  LDL DP L+AIAE
Sbjct  96   SYQAGYTSPPPPLRSEETTIDIGGGWTISG--LDLDDPHLMAIAE  138



>ref|XP_009148711.1| PREDICTED: uncharacterized protein LOC103872120 [Brassica rapa]
Length=255

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 100/165 (61%), Gaps = 29/165 (18%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            M EH +V  D++++        PV            A  SS  V ED  V +        
Sbjct  1    MSEHMLVYVDRVMR--------PV-----------LAEPSSLTVKEDNAVYVYD------  35

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             D  A  +   ECRICQEE ++ NLE+PCAC+GSLKYAHRKCVQ WCNEKG+  CEIC+Q
Sbjct  36   GDTFATEMWSAECRICQEESAIMNLESPCACNGSLKYAHRKCVQRWCNEKGNTICEICNQ  95

Query  440  PYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIAE  568
             YQ GYT+ PP  + EETTIDI GGW ISG  LDL DP L+AIAE
Sbjct  96   SYQAGYTSPPPPLRSEETTIDIGGGWTISG--LDLDDPHLMAIAE  138



>gb|ABR17862.1| unknown [Picea sitchensis]
Length=279

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 102/168 (61%), Gaps = 12/168 (7%)
 Frame = +2

Query  80   MGEHSVVNFDQLV--KTDEVGSGLPVDGAKHIEKK--TESAGTSSSAVVEDKVVGMGKEK  247
            MG+H V+  D+L+   T E  +   +  + + +K+    SA TSS           G  K
Sbjct  1    MGDHLVLYVDRLITASTFESANTANITSSSNHDKQDGVNSANTSSHFQHGLSSCHGGTSK  60

Query  248  DIEVAD-EEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITC  424
             I+ +  E    +   ECRICQEED  +++E PCACSGS+KYAHRKCVQ WCNEKGD TC
Sbjct  61   QIDSSGGERGEFV---ECRICQEEDEDRSMEIPCACSGSMKYAHRKCVQRWCNEKGDTTC  117

Query  425  EICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            EIC Q Y+PGYTAP R       IDI G W   G+ LDL+DPRLLA+A
Sbjct  118  EICQQTYKPGYTAPLRPLSGGIAIDISGNW---GSQLDLNDPRLLAMA  162



>gb|KHG30736.1| hypothetical protein F383_12635 [Gossypium arboreum]
Length=441

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 112/208 (54%), Gaps = 56/208 (27%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTS---SSAVVEDKVVGMGKE--  244
            M +H VV  D+L +++ +    PV+       + E AG S   S  V E  V  +  E  
Sbjct  1    MRDHLVVCVDRLTESESLK---PVN-------EPEVAGPSGEGSFIVAEPHVCAIDVEEV  50

Query  245  KDIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITC  424
            K+    DEE PLI + ECRICQ+ED++ NLETPC+CSGSLK+AHRKCVQ WCNEKGDITC
Sbjct  51   KEHSSCDEEEPLIQMVECRICQDEDNINNLETPCSCSGSLKFAHRKCVQRWCNEKGDITC  110

Query  425  EICHQPYQPGYTAPPRSQPEET-TIDIGG-------------------------------  508
            EICHQPYQPGYTAPP     E  TIDI                                 
Sbjct  111  EICHQPYQPGYTAPPPPPRPEVATIDIRQVFTIMHLPKYRHNEDWCRSNFACFVFPVCED  170

Query  509  ---------WQISGTPLDLHDPRLLAIA  565
                     W ++G PL LHD R+LAIA
Sbjct  171  LYMSEPVCEWTVTGAPLGLHDQRILAIA  198



>ref|XP_010546060.1| PREDICTED: E3 ubiquitin-protein ligase MARCH7 [Tarenaya hassleriana]
Length=302

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = +2

Query  275  PLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPG  454
            PLI   ECRICQEEDSVKNLE PCAC+GSLK+AHRKCVQ WCN KGD TCEICHQPY+PG
Sbjct  67   PLIHSVECRICQEEDSVKNLEVPCACNGSLKFAHRKCVQRWCNAKGDTTCEICHQPYRPG  126

Query  455  YTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAI  562
            YTAPP    ++T IDIG    +G   +L++ RLLA+
Sbjct  127  YTAPP-PPSDDTVIDIGDDWHNGATFELNEQRLLAM  161



>ref|XP_006578575.1| PREDICTED: uncharacterized protein LOC100805050 isoform X4 [Glycine 
max]
Length=209

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 107/166 (64%), Gaps = 17/166 (10%)
 Frame = +2

Query  80   MGEHSVVN-FDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKV-VGMGKEKDI  253
            MGEH V++  D L+     G+ LP  G           G +  +++E    V   KE D 
Sbjct  9    MGEHVVLSVLDPLIAP---GTLLPQHGGD---------GNALGSLIEGATHVNDVKECDT  56

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
             + +E+  LI + ECRICQE+D+++NL+ PCACSG+LK+AH KC+Q WC EKGD  CEIC
Sbjct  57   -LEEEKEDLIQMVECRICQEDDTLQNLDIPCACSGTLKFAHTKCIQLWCYEKGDTICEIC  115

Query  434  HQPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            ++P++PGYTA  P  QP +T+I I   W IS +PLDLH+ RLLAIA
Sbjct  116  NKPFKPGYTANSPVCQPGDTSIGISDDWAISSSPLDLHNARLLAIA  161



>gb|EPS64256.1| zinc finger family protein, partial [Genlisea aurea]
Length=121

 Score =   133 bits (335),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 79/110 (72%), Gaps = 12/110 (11%)
 Frame = +2

Query  191  GTSSSAVVEDKVVGMGKEKDIEVADEEA----PLIGIRECRICQEEDSVKNLETPCACSG  358
            G+SS    ED       +K + V D+EA    PLI + ECRICQEEDS+KNLE+PCAC G
Sbjct  19   GSSSGKSAED-------DKIVIVVDDEASEGTPLIRMEECRICQEEDSIKNLESPCACIG  71

Query  359  SLK-YAHRKCVQHWCNEKGDITCEICHQPYQPGYTAPPRSQPEETTIDIG  505
            SLK YAHRKCVQHWCNEKGDI CEICHQPYQP YTA P+   +ET  + G
Sbjct  72   SLKAYAHRKCVQHWCNEKGDIICEICHQPYQPDYTASPQRTSDETPFNFG  121



>ref|XP_006578574.1| PREDICTED: uncharacterized protein LOC100805050 isoform X3 [Glycine 
max]
Length=265

 Score =   137 bits (345),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 107/166 (64%), Gaps = 17/166 (10%)
 Frame = +2

Query  80   MGEHSVVN-FDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKV-VGMGKEKDI  253
            MGEH V++  D L+     G+ LP  G           G +  +++E    V   KE D 
Sbjct  9    MGEHVVLSVLDPLIAP---GTLLPQHGGD---------GNALGSLIEGATHVNDVKECDT  56

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
             + +E+  LI + ECRICQE+D+++NL+ PCACSG+LK+AH KC+Q WC EKGD  CEIC
Sbjct  57   -LEEEKEDLIQMVECRICQEDDTLQNLDIPCACSGTLKFAHTKCIQLWCYEKGDTICEIC  115

Query  434  HQPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            ++P++PGYTA  P  QP +T+I I   W IS +PLDLH+ RLLAIA
Sbjct  116  NKPFKPGYTANSPVCQPGDTSIGISDDWAISSSPLDLHNARLLAIA  161



>ref|XP_006578573.1| PREDICTED: uncharacterized protein LOC100805050 isoform X2 [Glycine 
max]
Length=267

 Score =   137 bits (344),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 107/166 (64%), Gaps = 17/166 (10%)
 Frame = +2

Query  80   MGEHSVVN-FDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKV-VGMGKEKDI  253
            MGEH V++  D L+     G+ LP  G           G +  +++E    V   KE D 
Sbjct  1    MGEHVVLSVLDPLIAP---GTLLPQHGGD---------GNALGSLIEGATHVNDVKECD-  47

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
             + +E+  LI + ECRICQE+D+++NL+ PCACSG+LK+AH KC+Q WC EKGD  CEIC
Sbjct  48   TLEEEKEDLIQMVECRICQEDDTLQNLDIPCACSGTLKFAHTKCIQLWCYEKGDTICEIC  107

Query  434  HQPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            ++P++PGYTA  P  QP +T+I I   W IS +PLDLH+ RLLAIA
Sbjct  108  NKPFKPGYTANSPVCQPGDTSIGISDDWAISSSPLDLHNARLLAIA  153



>ref|XP_006578572.1| PREDICTED: uncharacterized protein LOC100805050 isoform X1 [Glycine 
max]
Length=275

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 107/166 (64%), Gaps = 17/166 (10%)
 Frame = +2

Query  80   MGEHSVVN-FDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKV-VGMGKEKDI  253
            MGEH V++  D L+     G+ LP  G           G +  +++E    V   KE D 
Sbjct  9    MGEHVVLSVLDPLIAP---GTLLPQHGGD---------GNALGSLIEGATHVNDVKECD-  55

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
             + +E+  LI + ECRICQE+D+++NL+ PCACSG+LK+AH KC+Q WC EKGD  CEIC
Sbjct  56   TLEEEKEDLIQMVECRICQEDDTLQNLDIPCACSGTLKFAHTKCIQLWCYEKGDTICEIC  115

Query  434  HQPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            ++P++PGYTA  P  QP +T+I I   W IS +PLDLH+ RLLAIA
Sbjct  116  NKPFKPGYTANSPVCQPGDTSIGISDDWAISSSPLDLHNARLLAIA  161



>gb|KHN32528.1| hypothetical protein glysoja_041264 [Glycine soja]
Length=274

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 107/166 (64%), Gaps = 17/166 (10%)
 Frame = +2

Query  80   MGEHSVVN-FDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKV-VGMGKEKDI  253
            MGEH V++  D L+     G+ LP  G           G +  +++E    V   KE D 
Sbjct  1    MGEHVVLSVLDPLIAP---GTLLPQHGGD---------GNALGSLIEGATHVNDVKECD-  47

Query  254  EVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEIC  433
             + +E+  LI + ECRICQE+D+++NL+ PCACSG+LK+AH KC+Q WC EKGD  CEIC
Sbjct  48   TLEEEKEDLIQMVECRICQEDDTLQNLDIPCACSGTLKFAHTKCIQLWCYEKGDTICEIC  107

Query  434  HQPYQPGYTA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            ++P++PGYTA  P  QP +T+I I   W IS +PLDLH+ RLLAIA
Sbjct  108  NKPFKPGYTANSPVCQPGDTSIGISDDWAISSSPLDLHNARLLAIA  153



>gb|EPS73951.1| hypothetical protein M569_00809, partial [Genlisea aurea]
Length=165

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 69/82 (84%), Gaps = 2/82 (2%)
 Frame = +2

Query  290  RECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGYTA-P  466
            RECRICQEEDSV NLE+PCACSGSL YAHRKCVQ WCNEKG+ TCEICH+PYQ GYTA  
Sbjct  3    RECRICQEEDSVNNLESPCACSGSLNYAHRKCVQFWCNEKGNTTCEICHEPYQSGYTALS  62

Query  467  PRSQPEETTIDIGG-WQISGTP  529
            P S  +ETTI+IGG W I+G P
Sbjct  63   PPSAFDETTINIGGLWHITGNP  84



>ref|XP_010091521.1| E3 ubiquitin-protein ligase MARCH4 [Morus notabilis]
 gb|EXB44691.1| E3 ubiquitin-protein ligase MARCH4 [Morus notabilis]
Length=279

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 96/162 (59%), Gaps = 9/162 (6%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MG+H V+  D L+    + S    D +        S  T+    V   VV +   ++  +
Sbjct  1    MGDHLVLCADHLITAQSLESMQGSDSSGSSLGSPCSQKTTE---VSTCVVNVDGVEEQGM  57

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
              EE PLI   ECRICQEED++KNLE PCACSGSLK+AHRKCVQ WCNEKGD+TCEIC++
Sbjct  58   PGEEEPLIQTSECRICQEEDTLKNLEVPCACSGSLKFAHRKCVQRWCNEKGDVTCEICNK  117

Query  440  PYQPGYTAPPRSQPEETTIDIGGWQISGTPLDLHDPRLLAIA  565
                   +      E  T  I  W ISG P+DLHDPRLLA+A
Sbjct  118  ASHLILAS------EILTFIIEDWTISGAPIDLHDPRLLAVA  153



>ref|XP_008243441.1| PREDICTED: uncharacterized protein LOC103341682 [Prunus mume]
Length=190

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 98/164 (60%), Gaps = 15/164 (9%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGLPVDGAKHIEKKTESAGTSSSAVVEDKVVGMGKEKDIEV  259
            MGEH V+  D+L+    + +         IE +  S   +SSA+ + K+ G   +K I+V
Sbjct  1    MGEHFVLLVDRLITESTLEAA--------IESRNRSMQATSSAIDKAKIDGCC-QKIIDV  51

Query  260  ADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQ  439
             D  +    + ECRICQ+ED   N+ETPC+C GSLKYAHR+CVQ WCNEKGD  CEICHQ
Sbjct  52   QDISSLTGKLVECRICQDEDQDSNMETPCSCCGSLKYAHRRCVQRWCNEKGDTVCEICHQ  111

Query  440  PYQPGYTA-PPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
             ++PGYTA PP  Q     ++  G W+IS        PR++A+ 
Sbjct  112  QFKPGYTAPPPLFQFGRIPMNFRGNWEISQR----DSPRIIAMV  151



>ref|XP_006581971.1| PREDICTED: probable E3 ubiquitin ligase SUD1 [Glycine max]
Length=189

 Score =   130 bits (327),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +2

Query  278  LIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGY  457
            LI + ECRICQE+D+++NL+ PCACSG+LK+AH KCVQ WC EKGD  CEIC+QP++PGY
Sbjct  59   LIKMVECRICQEDDTLQNLDIPCACSGTLKFAHTKCVQIWCYEKGDTICEICNQPFKPGY  118

Query  458  TA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            TA  P   P +T+IDI   W  +  PLDLH+ RLLAIA
Sbjct  119  TANSPVCHPGDTSIDISDDWATTRNPLDLHNARLLAIA  156



>gb|KHN30844.1| hypothetical protein glysoja_034868 [Glycine soja]
Length=282

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +2

Query  278  LIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCEICHQPYQPGY  457
            LI + ECRICQE+D+++NL+ PCACSG+LK+AH KCVQ WC EKGD  CEIC+QP++PGY
Sbjct  64   LIKMVECRICQEDDTLQNLDIPCACSGTLKFAHTKCVQIWCYEKGDTICEICNQPFKPGY  123

Query  458  TA-PPRSQPEETTIDIG-GWQISGTPLDLHDPRLLAIA  565
            TA  P   P +T+IDI   W  +  PLDLH+ RLLAIA
Sbjct  124  TANSPVCHPGDTSIDISDDWATTRNPLDLHNARLLAIA  161



>ref|XP_006837217.1| hypothetical protein AMTR_s00105p00126340 [Amborella trichopoda]
 gb|ERN00071.1| hypothetical protein AMTR_s00105p00126340 [Amborella trichopoda]
Length=268

 Score =   132 bits (331),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 100/167 (60%), Gaps = 16/167 (10%)
 Frame = +2

Query  80   MGEHSVVNFDQLVKTDEVGSGL---PVDGAKHIEKKTESAGT-SSSAVVEDKVVGMGKEK  247
            MG+H V+  D+L+    + + +    +   + +   +E+ G  S + ++E+    MG   
Sbjct  1    MGDHFVLLVDRLITDSTLEAMIESRNLGQVRCLSGDSEALGQCSGNPIIEE----MG---  53

Query  248  DIEVADEEAPLIGIRECRICQEEDSVKNLETPCACSGSLKYAHRKCVQHWCNEKGDITCE  427
                 + +   + + ECRICQ+ED   N+ETPCAC GSLKYAHRKCVQ WCNEKG+  CE
Sbjct  54   ----INRKGSSLKVVECRICQDEDQACNMETPCACCGSLKYAHRKCVQRWCNEKGNTMCE  109

Query  428  ICHQPYQPGYTAPPRSQPEETTIDI-GGWQISGTPLDLHDPRLLAIA  565
            ICHQ +QPGYTAPP+        +  G W+IS  PLDL +P+ +A+ 
Sbjct  110  ICHQQFQPGYTAPPKMFHYGGLPNFRGSWEISRQPLDLQNPQFIAMV  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960