BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L03

Length=584
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603228.1|  PREDICTED: transcription factor bHLH35-like ...    181   5e-53   Nicotiana tomentosiformis
ref|XP_009760781.1|  PREDICTED: transcription factor bHLH35-like ...    179   2e-52   Nicotiana sylvestris
ref|XP_009603227.1|  PREDICTED: transcription factor bHLH35-like ...    177   3e-51   Nicotiana tomentosiformis
ref|XP_009760780.1|  PREDICTED: transcription factor bHLH35-like ...    175   1e-50   Nicotiana sylvestris
ref|XP_007223913.1|  hypothetical protein PRUPE_ppa010972mg             171   3e-49   
ref|XP_008223870.1|  PREDICTED: transcription factor bHLH35             170   7e-49   Prunus mume [ume]
ref|XP_008358594.1|  PREDICTED: transcription factor bHLH35-like        165   9e-47   
ref|XP_003595077.1|  Transcription factor bHLH                          164   1e-46   Medicago truncatula
gb|AFK39403.1|  unknown                                                 162   2e-46   Medicago truncatula
ref|XP_003595078.1|  Transcription factor bHLH                          162   2e-46   
ref|XP_006586714.1|  PREDICTED: uncharacterized protein LOC100817...    163   3e-46   
ref|NP_001239951.1|  uncharacterized protein LOC100817978               163   4e-46   Glycine max [soybeans]
ref|XP_009348093.1|  PREDICTED: transcription factor bHLH35-like        161   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_009359948.1|  PREDICTED: transcription factor bHLH35             161   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_004296498.1|  PREDICTED: transcription factor bHLH35             160   4e-45   Fragaria vesca subsp. vesca
ref|XP_003546437.1|  PREDICTED: transcription factor bHLH35-like        159   2e-44   Glycine max [soybeans]
ref|XP_004242918.1|  PREDICTED: transcription factor bHLH35             158   5e-44   Solanum lycopersicum
ref|XP_004487998.1|  PREDICTED: transcription factor bHLH35-like        158   6e-44   Cicer arietinum [garbanzo]
ref|XP_010048565.1|  PREDICTED: transcription factor bHLH35 isofo...    157   6e-44   Eucalyptus grandis [rose gum]
ref|XP_006344525.1|  PREDICTED: transcription factor bHLH35-like        157   8e-44   Solanum tuberosum [potatoes]
ref|XP_007138769.1|  hypothetical protein PHAVU_009G235700g             156   2e-43   Phaseolus vulgaris [French bean]
ref|XP_002325261.2|  hypothetical protein POPTR_0018s13860g             155   4e-43   Populus trichocarpa [western balsam poplar]
ref|XP_011017674.1|  PREDICTED: transcription factor bHLH35-like        155   4e-43   Populus euphratica
ref|XP_008388700.1|  PREDICTED: transcription factor bHLH35             154   2e-42   Malus domestica [apple tree]
ref|XP_007014435.1|  Basic helix-loop-helix DNA-binding superfami...    154   5e-42   
ref|XP_011094110.1|  PREDICTED: transcription factor bHLH35             152   5e-42   Sesamum indicum [beniseed]
ref|XP_002263999.1|  PREDICTED: transcription factor bHLH35             152   1e-41   Vitis vinifera
ref|XP_011020046.1|  PREDICTED: transcription factor bHLH35-like ...    150   3e-41   Populus euphratica
ref|XP_007014436.1|  Basic helix-loop-helix DNA-binding superfami...    150   7e-41   
gb|EYU18210.1|  hypothetical protein MIMGU_mgv1a022464mg                147   4e-40   Erythranthe guttata [common monkey flower]
ref|XP_006381154.1|  hypothetical protein POPTR_0006s07440g             147   5e-40   
gb|KJB83353.1|  hypothetical protein B456_013G242800                    145   6e-40   Gossypium raimondii
ref|XP_006453237.1|  hypothetical protein CICLE_v100092852mg            146   1e-39   Citrus clementina [clementine]
ref|XP_006453236.1|  hypothetical protein CICLE_v100092852mg            146   2e-39   
gb|KJB83352.1|  hypothetical protein B456_013G242800                    146   2e-39   Gossypium raimondii
gb|KDO61950.1|  hypothetical protein CISIN_1g025665mg                   146   2e-39   Citrus sinensis [apfelsine]
gb|KHG05269.1|  Transcription factor bHLH35 -like protein               145   2e-39   Gossypium arboreum [tree cotton]
ref|XP_010273597.1|  PREDICTED: transcription factor bHLH35             145   4e-39   Nelumbo nucifera [Indian lotus]
emb|CAN78766.1|  hypothetical protein VITISV_044397                     151   1e-38   Vitis vinifera
gb|KDP42524.1|  hypothetical protein JCGZ_02482                         143   2e-38   Jatropha curcas
ref|XP_011077906.1|  PREDICTED: transcription factor bHLH35-like        141   2e-37   Sesamum indicum [beniseed]
ref|XP_011094113.1|  PREDICTED: transcription factor bHLH35-like ...    140   4e-37   Sesamum indicum [beniseed]
ref|XP_010536890.1|  PREDICTED: transcription factor bHLH35 isofo...    137   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_007154705.1|  hypothetical protein PHAVU_003G1408001g            135   1e-35   Phaseolus vulgaris [French bean]
ref|XP_010927251.1|  PREDICTED: transcription factor bHLH35-like        136   2e-35   Elaeis guineensis
ref|XP_010929341.1|  PREDICTED: transcription factor bHLH35 isofo...    134   7e-35   Elaeis guineensis
ref|XP_008799483.1|  PREDICTED: transcription factor bHLH35-like        133   1e-34   Phoenix dactylifera
ref|XP_002518255.1|  DNA binding protein, putative                      132   2e-34   
ref|XP_008451133.1|  PREDICTED: transcription factor bHLH35-like ...    132   2e-34   Cucumis melo [Oriental melon]
ref|XP_010536889.1|  PREDICTED: transcription factor bHLH35 isofo...    132   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_010536888.1|  PREDICTED: transcription factor bHLH35 isofo...    132   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_008811438.1|  PREDICTED: transcription factor bHLH35             132   6e-34   Phoenix dactylifera
ref|XP_008451126.1|  PREDICTED: transcription factor bHLH35-like ...    130   2e-33   Cucumis melo [Oriental melon]
ref|XP_010548649.1|  PREDICTED: transcription factor bHLH27-like ...    130   2e-33   Tarenaya hassleriana [spider flower]
emb|CDP12676.1|  unnamed protein product                                130   2e-33   Coffea canephora [robusta coffee]
ref|XP_010048564.1|  PREDICTED: transcription factor bHLH35 isofo...    130   2e-33   Eucalyptus grandis [rose gum]
ref|XP_011094111.1|  PREDICTED: transcription factor bHLH35-like ...    130   8e-33   Sesamum indicum [beniseed]
ref|XP_009380730.1|  PREDICTED: transcription factor bHLH35-like        128   9e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409750.1|  PREDICTED: transcription factor bHLH35             129   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008453552.1|  PREDICTED: transcription factor bHLH35             129   1e-32   Cucumis melo [Oriental melon]
ref|XP_010046924.1|  PREDICTED: transcription factor bHLH35 isofo...    127   3e-32   Eucalyptus grandis [rose gum]
ref|XP_006593510.1|  PREDICTED: transcription factor bHLH35-like        126   4e-32   Glycine max [soybeans]
gb|KHN22657.1|  Transcription factor bHLH35                             127   5e-32   Glycine soja [wild soybean]
gb|ACU17597.1|  unknown                                                 125   8e-32   Glycine max [soybeans]
gb|KHN17635.1|  Transcription factor bHLH35                             125   2e-31   Glycine soja [wild soybean]
ref|XP_010046925.1|  PREDICTED: transcription factor bHLH35 isofo...    125   2e-31   Eucalyptus grandis [rose gum]
emb|CDP19017.1|  unnamed protein product                                125   2e-31   Coffea canephora [robusta coffee]
ref|XP_009120236.1|  PREDICTED: transcription factor bHLH35             124   5e-31   Brassica rapa
emb|CDY47924.1|  BnaA02g08320D                                          122   3e-30   Brassica napus [oilseed rape]
ref|XP_009126855.1|  PREDICTED: transcription factor bHLH35-like        122   3e-30   Brassica rapa
emb|CDY42237.1|  BnaC02g11780D                                          121   4e-30   Brassica napus [oilseed rape]
gb|KFK27270.1|  hypothetical protein AALP_AA8G360300                    120   1e-29   Arabis alpina [alpine rockcress]
ref|XP_004146337.1|  PREDICTED: transcription factor bHLH35-like        119   2e-29   Cucumis sativus [cucumbers]
ref|XP_009132143.1|  PREDICTED: transcription factor bHLH35-like        120   2e-29   Brassica rapa
emb|CDX88610.1|  BnaA03g10390D                                          119   2e-29   
ref|XP_010483214.1|  PREDICTED: transcription factor bHLH35-like ...    119   4e-29   
ref|XP_010443388.1|  PREDICTED: transcription factor bHLH35-like        119   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010483213.1|  PREDICTED: transcription factor bHLH35-like ...    119   4e-29   
ref|NP_001119080.1|  transcription factor bHLH27                        117   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451830.1|  PREDICTED: transcription factor bHLH35             119   5e-29   
ref|NP_001031752.1|  transcription factor bHLH27                        117   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011020045.1|  PREDICTED: transcription factor bHLH35-like ...    117   1e-28   Populus euphratica
ref|XP_010539408.1|  PREDICTED: transcription factor bHLH35-like        117   1e-28   Tarenaya hassleriana [spider flower]
ref|NP_194722.2|  transcription factor bHLH27                           118   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929342.1|  PREDICTED: transcription factor bHLH35 isofo...    117   1e-28   Elaeis guineensis
ref|XP_010436337.1|  PREDICTED: transcription factor bHLH27-like        115   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006412786.1|  hypothetical protein EUTSA_v10027332mg             117   1e-28   
ref|NP_001078471.1|  transcription factor bHLH27                        118   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568850.1|  transcription factor bHLH35                           117   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929340.1|  PREDICTED: transcription factor bHLH35 isofo...    118   3e-28   Elaeis guineensis
emb|CAB43668.1|  putative protein                                       117   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401237.1|  hypothetical protein EUTSA_v10014506mg             117   3e-28   Eutrema salsugineum [saltwater cress]
gb|KFK34607.1|  hypothetical protein AALP_AA5G167500                    117   3e-28   Arabis alpina [alpine rockcress]
ref|XP_002864502.1|  basic helix-loop-helix family protein              116   3e-28   Arabidopsis lyrata subsp. lyrata
emb|CDY30182.1|  BnaA03g49880D                                          115   6e-28   Brassica napus [oilseed rape]
ref|XP_009137878.1|  PREDICTED: transcription factor bHLH27             116   7e-28   Brassica rapa
ref|XP_006285089.1|  hypothetical protein CARUB_v10006422mg             115   8e-28   Capsella rubella
ref|XP_010438241.1|  PREDICTED: transcription factor bHLH27             115   8e-28   Camelina sativa [gold-of-pleasure]
ref|NP_974947.1|  transcription factor bHLH35                           114   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010913730.1|  PREDICTED: transcription factor bHLH35-like ...    115   1e-27   Elaeis guineensis
ref|NP_974948.1|  transcription factor bHLH35                           114   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63723.1|  unknown                                                 115   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010913729.1|  PREDICTED: transcription factor bHLH35-like ...    114   2e-27   Elaeis guineensis
sp|Q2HIV9.1|BH035_ARATH  RecName: Full=Transcription factor bHLH3...    114   2e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11882.1|  BnaC03g13080D                                          114   2e-27   Brassica napus [oilseed rape]
emb|CDY46719.1|  BnaC07g42240D                                          115   2e-27   Brassica napus [oilseed rape]
ref|XP_010447790.1|  PREDICTED: transcription factor bHLH27-like        114   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010541108.1|  PREDICTED: transcription factor bHLH27 isofo...    112   4e-27   
ref|XP_011017676.1|  PREDICTED: transcription factor bHLH35-like        113   5e-27   Populus euphratica
ref|XP_006372181.1|  hypothetical protein POPTR_0018s13830g             111   8e-27   
ref|XP_010667303.1|  PREDICTED: transcription factor bHLH35             113   8e-27   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX68608.1|  BnaC01g08450D                                          113   9e-27   
ref|XP_010541107.1|  PREDICTED: transcription factor bHLH27 isofo...    113   1e-26   Tarenaya hassleriana [spider flower]
emb|CDP20243.1|  unnamed protein product                                112   1e-26   Coffea canephora [robusta coffee]
ref|NP_001190556.1|  transcription factor bHLH35                        112   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010108742.1|  hypothetical protein L484_002994                   111   2e-26   
ref|XP_002324688.1|  hypothetical protein POPTR_0018s13830g             111   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006372183.1|  hypothetical protein POPTR_0018s13840g             110   3e-26   Populus trichocarpa [western balsam poplar]
emb|CDP21431.1|  unnamed protein product                                109   3e-26   Coffea canephora [robusta coffee]
ref|XP_009128255.1|  PREDICTED: transcription factor bHLH27-like ...    111   4e-26   Brassica rapa
ref|XP_002324689.2|  hypothetical protein POPTR_0018s13840g             110   5e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006372182.1|  hypothetical protein POPTR_0018s13830g             111   6e-26   
ref|XP_009128266.1|  PREDICTED: transcription factor bHLH27-like ...    110   7e-26   Brassica rapa
ref|XP_002869405.1|  basic helix-loop-helix family protein              110   8e-26   
ref|XP_008781924.1|  PREDICTED: uncharacterized protein LOC103701581    111   4e-25   
ref|XP_010320974.1|  PREDICTED: transcription factor bHLH35 isofo...    105   1e-24   Solanum lycopersicum
ref|XP_004239187.1|  PREDICTED: transcription factor bHLH35 isofo...    105   4e-24   Solanum lycopersicum
gb|KJB53715.1|  hypothetical protein B456_009G002200                    105   5e-24   Gossypium raimondii
gb|KJB53716.1|  hypothetical protein B456_009G002200                    105   5e-24   Gossypium raimondii
ref|XP_002308108.2|  hypothetical protein POPTR_0006s07430g             105   1e-23   
ref|XP_006341751.1|  PREDICTED: transcription factor bHLH35-like        102   5e-23   Solanum tuberosum [potatoes]
ref|XP_011017678.1|  PREDICTED: transcription factor bHLH35-like ...    102   7e-23   Populus euphratica
ref|XP_011017677.1|  PREDICTED: transcription factor bHLH35-like ...    102   1e-22   Populus euphratica
ref|XP_002324690.2|  hypothetical protein POPTR_0018s13850g             101   1e-22   
ref|XP_009407095.1|  PREDICTED: transcription factor bHLH35-like        101   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001291248.1|  transcription factor bHLH35-like                   101   2e-22   Populus euphratica
ref|XP_008451140.1|  PREDICTED: transcription factor bHLH35-like ...    100   4e-22   Cucumis melo [Oriental melon]
gb|AFW57244.1|  putative HLH DNA-binding domain superfamily protein     100   6e-22   
gb|ABK92754.1|  unknown                                               99.0    8e-22   Populus trichocarpa [western balsam poplar]
gb|AIB05458.1|  bHLH transcription factor                             99.8    9e-22   Zea mays [maize]
ref|XP_002308107.2|  hypothetical protein POPTR_0006s07420g           99.4    1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_004975234.1|  PREDICTED: transcription factor bHLH35-like ...  99.4    1e-21   Setaria italica
ref|XP_004975236.1|  PREDICTED: transcription factor bHLH35-like ...  99.0    2e-21   Setaria italica
gb|EMT28703.1|  hypothetical protein F775_52582                       99.4    2e-21   
ref|XP_002309008.1|  hypothetical protein POPTR_0006s07410g           99.0    2e-21   
ref|XP_004975237.1|  PREDICTED: transcription factor bHLH35-like ...  98.2    3e-21   
ref|XP_010667302.1|  PREDICTED: transcription factor bHLH35-like      97.8    4e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001151185.1|  DNA binding like                                 97.8    4e-21   
ref|XP_003579501.1|  PREDICTED: transcription factor bHLH35-like      97.1    8e-21   Brachypodium distachyon [annual false brome]
emb|CDM80372.1|  unnamed protein product                              96.7    1e-20   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004975235.1|  PREDICTED: transcription factor bHLH35-like ...  95.5    2e-20   
gb|EMS67977.1|  Transcription factor bHLH35                           95.1    4e-20   Triticum urartu
ref|XP_009418562.1|  PREDICTED: transcription factor bHLH35-like ...  94.7    6e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011020047.1|  PREDICTED: transcription factor bHLH35-like ...  94.0    9e-20   Populus euphratica
ref|XP_011020048.1|  PREDICTED: transcription factor bHLH35-like ...  93.2    1e-19   Populus euphratica
ref|XP_006845790.1|  hypothetical protein AMTR_s00019p00254380        93.2    2e-19   
ref|XP_002445107.1|  hypothetical protein SORBIDRAFT_07g004190        93.2    3e-19   Sorghum bicolor [broomcorn]
gb|EYU38740.1|  hypothetical protein MIMGU_mgv1a022559mg              92.4    3e-19   Erythranthe guttata [common monkey flower]
ref|NP_001147498.1|  DNA binding like                                 90.1    3e-18   Zea mays [maize]
ref|XP_008661887.1|  PREDICTED: DNA binding like isoform X1           90.1    3e-18   
dbj|BAJ91059.1|  predicted protein                                    89.7    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN33600.1|  unknown                                               89.4    4e-18   Zea mays [maize]
ref|XP_010548650.1|  PREDICTED: transcription factor bHLH27-like ...  87.8    5e-18   
gb|EMT06747.1|  Transcription factor bHLH35                           89.0    6e-18   
ref|XP_004165347.1|  PREDICTED: transcription factor bHLH35-like      84.3    1e-17   
ref|XP_011020357.1|  PREDICTED: transcription factor bHLH35-like      86.7    2e-17   Populus euphratica
ref|XP_004975232.1|  PREDICTED: transcription factor bHLH35-like ...  87.8    2e-17   
ref|XP_004975233.1|  PREDICTED: transcription factor bHLH35-like ...  87.8    2e-17   Setaria italica
ref|XP_002973583.1|  hypothetical protein SELMODRAFT_16039            85.9    2e-17   
ref|XP_002975607.1|  hypothetical protein SELMODRAFT_16038            85.9    2e-17   
emb|CDY52739.1|  BnaC09g53390D                                        83.2    3e-17   Brassica napus [oilseed rape]
ref|XP_009786139.1|  PREDICTED: transcription factor ABORTED MICR...  89.0    5e-17   Nicotiana sylvestris
gb|ACG33141.1|  DNA binding like                                      86.3    6e-17   Zea mays [maize]
gb|EEC76984.1|  hypothetical protein OsI_15289                        85.9    7e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_006653253.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  85.5    1e-16   
ref|NP_001173851.1|  Os04g0300600                                     85.5    1e-16   
ref|XP_001774796.1|  predicted protein                                85.1    1e-16   
gb|EEE60703.1|  hypothetical protein OsJ_14194                        85.1    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751559.1|  predicted protein                                85.5    2e-16   
tpg|DAA38307.1|  TPA: putative HLH DNA-binding domain superfamily...  84.3    3e-16   
ref|XP_003580572.1|  PREDICTED: transcription factor bHLH35-like      84.3    3e-16   Brachypodium distachyon [annual false brome]
ref|XP_008667200.1|  PREDICTED: uncharacterized protein LOC100193...  84.3    3e-16   
ref|XP_008667199.1|  PREDICTED: uncharacterized protein LOC100193...  84.3    3e-16   
ref|XP_008667198.1|  PREDICTED: uncharacterized protein LOC100193...  84.3    3e-16   Zea mays [maize]
ref|XP_001767113.1|  predicted protein                                82.4    4e-16   
gb|EMS46478.1|  Transcription factor bHLH35                           83.2    5e-16   Triticum urartu
ref|XP_008236126.1|  PREDICTED: transcription factor ABORTED MICR...  85.5    6e-16   
gb|EMT19490.1|  Transcription factor bHLH35                           82.0    7e-16   
tpg|DAA38308.1|  TPA: putative HLH DNA-binding domain superfamily...  84.0    9e-16   
ref|NP_001132214.1|  uncharacterized protein LOC100193646             84.0    9e-16   Zea mays [maize]
ref|XP_009616536.1|  PREDICTED: transcription factor ABORTED MICR...  85.1    1e-15   
emb|CBI28513.3|  unnamed protein product                              84.7    1e-15   Vitis vinifera
gb|EPS70613.1|  hypothetical protein M569_04147                       81.6    1e-15   Genlisea aurea
ref|XP_009393956.1|  PREDICTED: transcription factor ABORTED MICR...  82.8    2e-15   
ref|XP_007041798.1|  Basic helix-loop-helix DNA-binding superfami...  84.7    2e-15   
ref|XP_011046011.1|  PREDICTED: transcription factor ABORTED MICR...  84.3    2e-15   Populus euphratica
ref|XP_001773179.1|  predicted protein                                84.0    2e-15   
ref|XP_010941334.1|  PREDICTED: transcription factor ABORTED MICR...  84.0    3e-15   
gb|ACB69502.1|  ICE87                                                 83.2    3e-15   Triticum aestivum [Canadian hard winter wheat]
gb|KJB47688.1|  hypothetical protein B456_008G036900                  84.0    3e-15   Gossypium raimondii
ref|XP_009418560.1|  PREDICTED: transcription factor bHLH35-like ...  81.3    3e-15   
gb|EMT32961.1|  Transcription factor ICE1                             83.6    3e-15   
ref|XP_002991957.1|  hypothetical protein SELMODRAFT_430203           83.6    3e-15   Selaginella moellendorffii
ref|XP_009418559.1|  PREDICTED: transcription factor bHLH35-like ...  81.3    3e-15   
ref|XP_002985518.1|  hypothetical protein SELMODRAFT_451590           83.6    3e-15   Selaginella moellendorffii
ref|XP_006379291.1|  hypothetical protein POPTR_0009s13860g           83.6    4e-15   
ref|XP_004975230.1|  PREDICTED: transcription factor bHLH35-like ...  81.3    4e-15   Setaria italica
emb|CAH66073.1|  H0215E01.1                                           81.3    4e-15   Oryza sativa [red rice]
ref|XP_006351594.1|  PREDICTED: transcription factor ABORTED MICR...  83.6    4e-15   Solanum tuberosum [potatoes]
ref|XP_004975231.1|  PREDICTED: transcription factor bHLH35-like ...  81.3    4e-15   Setaria italica
ref|XP_001757044.1|  predicted protein                                80.1    4e-15   
gb|EMS57018.1|  Transcription factor ICE1                             82.8    4e-15   Triticum urartu
ref|XP_007201665.1|  hypothetical protein PRUPE_ppa022211mg           83.2    4e-15   
ref|XP_011458682.1|  PREDICTED: transcription factor ABORTED MICR...  83.2    4e-15   Fragaria vesca subsp. vesca
ref|XP_006351593.1|  PREDICTED: transcription factor ABORTED MICR...  83.2    5e-15   Solanum tuberosum [potatoes]
ref|XP_008789721.1|  PREDICTED: transcription factor bHLH35-like      80.5    5e-15   
ref|XP_009396705.1|  PREDICTED: transcription factor bHLH35-like      80.1    5e-15   
ref|NP_001052406.1|  Os04g0301500                                     80.5    6e-15   
dbj|BAC66785.1|  Transcription Factor                                 80.5    7e-15   Oryza sativa [red rice]
ref|XP_011045978.1|  PREDICTED: transcription factor ABORTED MICR...  82.4    9e-15   Populus euphratica
ref|XP_011046003.1|  PREDICTED: transcription factor ABORTED MICR...  82.4    9e-15   Populus euphratica
gb|KGN51291.1|  hypothetical protein Csa_5G514470                     82.0    9e-15   Cucumis sativus [cucumbers]
ref|XP_004245356.1|  PREDICTED: transcription factor ABORTED MICR...  82.4    9e-15   Solanum lycopersicum
ref|XP_009395602.1|  PREDICTED: transcription factor ABORTED MICR...  80.9    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006424447.1|  hypothetical protein CICLE_v10030052mg           79.3    2e-14   Citrus clementina [clementine]
emb|CAE04678.3|  OSJNBb0018A10.7                                      80.9    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004142831.1|  PREDICTED: transcription factor ABORTED MICR...  81.6    2e-14   
ref|XP_006488003.1|  PREDICTED: transcription factor FER-LIKE IRO...  79.3    2e-14   Citrus sinensis [apfelsine]
ref|XP_011458681.1|  PREDICTED: transcription factor ABORTED MICR...  80.9    3e-14   Fragaria vesca subsp. vesca
ref|XP_010928971.1|  PREDICTED: transcription factor bHLH35-like      78.6    3e-14   
ref|XP_002263966.2|  PREDICTED: transcription factor ABORTED MICR...  80.9    3e-14   Vitis vinifera
ref|XP_010651162.1|  PREDICTED: transcription factor ABORTED MICR...  80.5    4e-14   Vitis vinifera
emb|CDP16911.1|  unnamed protein product                              80.9    4e-14   Coffea canephora [robusta coffee]
ref|XP_004156739.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  80.1    5e-14   
dbj|BAJ88508.1|  predicted protein                                    77.4    5e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010262502.1|  PREDICTED: uncharacterized protein LOC104601018  80.9    5e-14   
ref|XP_008360009.1|  PREDICTED: transcription factor FER-LIKE IRO...  78.2    5e-14   
emb|CBI21285.3|  unnamed protein product                              78.2    6e-14   Vitis vinifera
ref|XP_006606881.1|  PREDICTED: transcription factor ABORTED MICR...  77.8    6e-14   
ref|XP_004509817.1|  PREDICTED: transcription factor ABORTED MICR...  78.6    7e-14   Cicer arietinum [garbanzo]
gb|EPS62935.1|  hypothetical protein M569_11853                       77.0    7e-14   Genlisea aurea
ref|XP_004509816.1|  PREDICTED: transcription factor ABORTED MICR...  78.6    7e-14   Cicer arietinum [garbanzo]
gb|ABR18316.1|  unknown                                               77.0    7e-14   Picea sitchensis
ref|XP_009372500.1|  PREDICTED: transcription factor FER-LIKE IRO...  77.8    8e-14   Pyrus x bretschneideri [bai li]
gb|ABA25897.1|  inducer of CBF expression 2                           76.3    8e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX98033.1|  BnaA06g07840D                                        76.3    8e-14   
gb|KJB61054.1|  hypothetical protein B456_009G337700                  78.2    8e-14   Gossypium raimondii
emb|CDY19416.1|  BnaC05g09250D                                        76.3    8e-14   Brassica napus [oilseed rape]
ref|XP_010107648.1|  hypothetical protein L484_008364                 79.3    9e-14   
gb|KHG16938.1|  transcription factor aborted microspores -like pr...  77.4    9e-14   Gossypium arboreum [tree cotton]
gb|AEZ56382.1|  inducer of CBF expression                             73.9    9e-14   Dimocarpus longan [longan]
gb|EMT15292.1|  Transcription factor ICE1                             77.8    1e-13   
gb|EMT13581.1|  Transcription factor bHLH35                           77.0    1e-13   
ref|XP_010646778.1|  PREDICTED: transcription factor ABORTED MICR...  79.3    1e-13   
gb|EYU21821.1|  hypothetical protein MIMGU_mgv1a004396mg              79.0    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_006844542.1|  hypothetical protein AMTR_s00016p00170610        79.0    1e-13   Amborella trichopoda
gb|KJB61053.1|  hypothetical protein B456_009G337700                  77.8    1e-13   Gossypium raimondii
ref|XP_010267235.1|  PREDICTED: transcription factor FER-LIKE IRO...  77.4    1e-13   Nelumbo nucifera [Indian lotus]
gb|AAZ99829.1|  inducer of CBF expression 2                           76.6    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABA25896.1|  inducer of CBF expression 2                           76.6    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010646771.1|  PREDICTED: transcription factor ABORTED MICR...  79.3    1e-13   
gb|ABK23019.1|  unknown                                               75.9    1e-13   Picea sitchensis
emb|CBI37859.3|  unnamed protein product                              79.0    1e-13   Vitis vinifera
gb|EEE55937.1|  hypothetical protein OsJ_04630                        75.9    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006424446.1|  hypothetical protein CICLE_v10029810mg           77.0    1e-13   
ref|XP_009133880.1|  PREDICTED: transcription factor FER-LIKE IRO...  76.6    2e-13   Brassica rapa
gb|AGQ03810.1|  inducer of CBF expression 1a                          78.6    2e-13   Vitis vinifera
emb|CDY31199.1|  BnaC03g46920D                                        76.6    2e-13   Brassica napus [oilseed rape]
emb|CDX83286.1|  BnaA03g22200D                                        76.6    2e-13   
ref|XP_007209976.1|  hypothetical protein PRUPE_ppa005038mg           78.2    2e-13   
gb|AIU47307.1|  inducer of CBF expression 1                           75.5    2e-13   Camellia sinensis [black tea]
ref|XP_009335983.1|  PREDICTED: transcription factor FER-LIKE IRO...  76.3    2e-13   Pyrus x bretschneideri [bai li]
gb|ACB69501.1|  ICE41                                                 77.4    2e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004297495.2|  PREDICTED: transcription factor ICE1             78.2    2e-13   Fragaria vesca subsp. vesca
ref|XP_002969654.1|  hypothetical protein SELMODRAFT_91237            75.5    2e-13   
gb|ACT90640.2|  inducer of CBF expression                             78.2    2e-13   Camellia sinensis [black tea]
dbj|BAJ86337.1|  predicted protein                                    77.4    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001770312.1|  predicted protein                                77.8    2e-13   
emb|CDM85876.1|  unnamed protein product                              77.4    2e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002970916.1|  hypothetical protein SELMODRAFT_94010            75.5    2e-13   
emb|CBI35667.3|  unnamed protein product                              76.3    2e-13   
gb|EMS66007.1|  Transcription factor ICE1                             75.9    2e-13   
gb|ABR17667.1|  unknown                                               75.5    2e-13   
gb|KHN13386.1|  Transcription factor ICE1                             75.9    2e-13   
gb|KJB50213.1|  hypothetical protein B456_008G159000                  77.4    2e-13   
ref|XP_009630561.1|  PREDICTED: transcription factor FER-LIKE IRO...  76.3    2e-13   
ref|NP_001131774.1|  uncharacterized protein LOC100193144             75.5    2e-13   
ref|XP_010251243.1|  PREDICTED: transcription factor ABORTED MICR...  76.6    2e-13   
gb|AHM24954.1|  inducer of CBF expression 2                           78.2    2e-13   
gb|ACN28180.1|  unknown                                               75.5    2e-13   
dbj|BAJ90332.1|  predicted protein                                    77.8    2e-13   
ref|XP_010251245.1|  PREDICTED: transcription factor ABORTED MICR...  76.6    2e-13   
ref|XP_002275711.1|  PREDICTED: transcription factor ICE1             78.2    2e-13   
gb|AFI49627.1|  inducer of CBF expression 1                           77.8    3e-13   
gb|AGP04218.1|  inducer of CBF expression 2                           77.8    3e-13   
gb|ABS50251.1|  bHLH transcriptional factor                           77.8    3e-13   
ref|XP_008377907.1|  PREDICTED: transcription factor FER-LIKE IRO...  75.9    3e-13   
gb|AIA58701.1|  inducer of CBF expression 2                           77.8    3e-13   
gb|EMT26157.1|  Transcription factor bHLH35                           75.9    3e-13   
ref|XP_008377909.1|  PREDICTED: transcription factor FER-LIKE IRO...  75.5    3e-13   
ref|XP_009373630.1|  PREDICTED: transcription factor ICE1-like        77.8    3e-13   
ref|XP_008239552.1|  PREDICTED: transcription factor ICE1-like        77.8    3e-13   
gb|KJB61052.1|  hypothetical protein B456_009G337700                  77.4    3e-13   
ref|NP_001280967.1|  transcription factor ICE1-like                   77.8    3e-13   
ref|XP_009355697.1|  PREDICTED: transcription factor ABORTED MICR...  77.8    3e-13   
gb|KJB50207.1|  hypothetical protein B456_008G159000                  77.4    3e-13   
ref|XP_008458897.1|  PREDICTED: transcription factor ABORTED MICR...  77.8    3e-13   
ref|XP_010690350.1|  PREDICTED: transcription factor ABORTED MICR...  77.8    3e-13   
emb|CAN62843.1|  hypothetical protein VITISV_021185                   77.8    3e-13   
ref|XP_004971151.1|  PREDICTED: transcription factor bHLH93-like ...  76.6    3e-13   
ref|XP_010690347.1|  PREDICTED: transcription factor ABORTED MICR...  77.8    4e-13   
ref|NP_001067987.2|  Os11g0523700                                     77.4    4e-13   
gb|ADY68771.1|  inducer of CBF expression 1 protein                   77.0    4e-13   
gb|EEC68265.1|  hypothetical protein OsI_36299                        77.4    4e-13   
ref|XP_002449578.1|  hypothetical protein SORBIDRAFT_05g019530        77.4    4e-13   
ref|XP_004979362.1|  PREDICTED: transcription factor ICE1-like        77.4    4e-13   
gb|KJB50214.1|  hypothetical protein B456_008G159000                  77.0    4e-13   
gb|KJB50208.1|  hypothetical protein B456_008G159000                  77.0    4e-13   
ref|XP_007016069.1|  Basic helix-loop-helix protein BHLH20, putative  75.5    4e-13   
gb|EEE52193.1|  hypothetical protein OsJ_34071                        77.0    4e-13   
ref|XP_010929663.1|  PREDICTED: transcription factor ICE1             77.4    4e-13   
gb|KEH35684.1|  BHLH transcriptional factor                           77.0    4e-13   
ref|XP_003535752.1|  PREDICTED: transcription factor ABORTED MICR...  77.4    4e-13   
ref|XP_009760157.1|  PREDICTED: transcription factor FER-LIKE IRO...  75.5    4e-13   
gb|KEH35685.1|  BHLH transcriptional factor                           77.0    4e-13   
gb|KDO51289.1|  hypothetical protein CISIN_1g047004mg                 77.0    5e-13   
ref|XP_009148560.1|  PREDICTED: transcription factor SCREAM2 isof...  76.6    5e-13   
gb|KHG28291.1|  Transcription factor bHLH90 -like protein             77.0    5e-13   
gb|KHN37398.1|  Transcription factor ABORTED MICROSPORES              77.0    5e-13   
ref|XP_010267257.1|  PREDICTED: transcription factor FER-LIKE IRO...  74.7    5e-13   
ref|XP_007142813.1|  hypothetical protein PHAVU_007G019000g           76.3    5e-13   
ref|XP_010557357.1|  PREDICTED: transcription factor FER-LIKE IRO...  75.1    5e-13   
ref|XP_009760156.1|  PREDICTED: transcription factor FER-LIKE IRO...  75.5    5e-13   
gb|KHN21484.1|  Transcription factor FER-LIKE IRON DEFICIENCY-IND...  75.5    5e-13   
ref|XP_006837946.1|  hypothetical protein AMTR_s00102p00046460        74.7    5e-13   
ref|XP_009148559.1|  PREDICTED: transcription factor SCREAM2 isof...  76.6    5e-13   
ref|XP_009769541.1|  PREDICTED: transcription factor ICE1-like        77.0    5e-13   
emb|CDP07031.1|  unnamed protein product                              75.1    5e-13   
gb|AFP25102.1|  ICE1                                                  77.0    5e-13   
ref|XP_002459022.1|  hypothetical protein SORBIDRAFT_03g044660        75.9    5e-13   
ref|XP_006837953.1|  hypothetical protein AMTR_s00102p00056000        74.7    5e-13   
gb|KJB11750.1|  hypothetical protein B456_001G2756002                 76.3    5e-13   
ref|XP_001758066.1|  predicted protein                                77.0    5e-13   
ref|XP_009625133.1|  PREDICTED: transcription factor ICE1-like        77.0    5e-13   
tpg|DAA56003.1|  TPA: putative HLH DNA-binding domain superfamily...  75.9    6e-13   
gb|ACG46593.1|  inducer of CBF expression 2                           75.9    6e-13   
ref|XP_004971150.1|  PREDICTED: transcription factor bHLH93-like ...  76.3    6e-13   
ref|XP_009383008.1|  PREDICTED: transcription factor ICE1-like        77.0    6e-13   
gb|KDP22547.1|  hypothetical protein JCGZ_26378                       76.6    6e-13   
ref|XP_010910115.1|  PREDICTED: transcription factor ICE1-like        77.0    6e-13   
gb|KCW64130.1|  hypothetical protein EUGRSUZ_G01783                   77.0    6e-13   
ref|XP_001779375.1|  predicted protein                                71.2    6e-13   
ref|XP_010068596.1|  PREDICTED: transcription factor ABORTED MICR...  76.6    6e-13   
gb|KHG14817.1|  Transcription factor ICE1 -like protein               76.6    6e-13   
ref|XP_004501748.1|  PREDICTED: transcription factor ICE1-like        76.6    6e-13   
gb|KDO60282.1|  hypothetical protein CISIN_1g042663mg                 74.7    6e-13   
ref|XP_002511101.1|  Transcription factor ICE1, putative              76.6    6e-13   
ref|NP_001045272.1|  Os01g0928000                                     75.9    6e-13   
gb|AGP04217.1|  inducer of CBF expression 1                           76.6    7e-13   
ref|XP_011015021.1|  PREDICTED: transcription factor FER-LIKE IRO...  74.7    7e-13   
gb|KDO60281.1|  hypothetical protein CISIN_1g042465mg                 75.1    7e-13   
gb|AHM24953.1|  inducer of CBF expression 1                           76.6    7e-13   
ref|XP_008347583.1|  PREDICTED: transcription factor FER-LIKE IRO...  74.3    7e-13   
ref|XP_003541980.1|  PREDICTED: transcription factor FER-LIKE IRO...  75.1    7e-13   
gb|EYU36128.1|  hypothetical protein MIMGU_mgv1a018649mg              74.7    7e-13   
ref|XP_006417183.1|  hypothetical protein EUTSA_v10007566mg           75.9    7e-13   
gb|AGG34703.1|  inducer of CBF expression 1                           76.6    7e-13   
ref|XP_010249206.1|  PREDICTED: transcription factor ICE1-like        76.6    7e-13   
ref|XP_006424445.1|  hypothetical protein CICLE_v10029784mg           74.7    7e-13   
emb|CDP13410.1|  unnamed protein product                              74.3    8e-13   
ref|XP_010656833.1|  PREDICTED: transcription factor ICE1-like is...  76.3    8e-13   
ref|XP_008811619.1|  PREDICTED: transcription factor ABORTED MICR...  76.6    8e-13   
ref|XP_009335984.1|  PREDICTED: transcription factor FER-LIKE IRO...  74.3    8e-13   
gb|AIZ78178.1|  inducer of CBF expression 1                           76.6    8e-13   
gb|AFW60881.1|  putative HLH DNA-binding domain superfamily protein   76.3    8e-13   
ref|XP_009152022.1|  PREDICTED: transcription factor ICE1-like        76.3    8e-13   
ref|XP_006485105.1|  PREDICTED: transcription factor ICE1-like        76.3    8e-13   
ref|XP_008358727.1|  PREDICTED: transcription factor DYSFUNCTIONA...  73.2    8e-13   
gb|ADZ48234.1|  ICE-like protein                                      76.3    9e-13   
ref|XP_011085914.1|  PREDICTED: transcription factor ABORTED MICR...  76.6    9e-13   
gb|AEB97375.2|  inducer of CBF expression 1                           76.3    9e-13   
ref|XP_002453206.1|  hypothetical protein SORBIDRAFT_04g001650        75.9    9e-13   
gb|AEL33687.1|  ICE1                                                  76.3    9e-13   
emb|CDP19764.1|  unnamed protein product                              76.6    9e-13   
ref|XP_010243208.1|  PREDICTED: transcription factor FER-LIKE IRO...  74.7    9e-13   
ref|XP_008670746.1|  PREDICTED: transcription factor SCREAM2-like     76.3    9e-13   
dbj|BAK06269.1|  predicted protein                                    76.3    9e-13   
gb|KDO47348.1|  hypothetical protein CISIN_1g011370mg                 75.5    9e-13   
ref|XP_010045304.1|  PREDICTED: transcription factor FER-LIKE IRO...  74.7    9e-13   
gb|AIA58695.1|  intron 2-retained inducer of CBF expression 2         75.9    9e-13   
ref|XP_009142421.1|  PREDICTED: transcription factor ABA-INDUCIBL...  75.9    9e-13   
gb|ACB70963.1|  ICE1                                                  76.3    9e-13   
emb|CDX80023.1|  BnaA05g01330D                                        75.9    1e-12   
ref|XP_007150142.1|  hypothetical protein PHAVU_005G130500g           74.7    1e-12   
gb|AGF25261.1|  inducer of CBF expression 1-3                         76.3    1e-12   
ref|XP_002961722.1|  hypothetical protein SELMODRAFT_77288            73.2    1e-12   
ref|XP_010243207.1|  PREDICTED: transcription factor FER-LIKE IRO...  74.7    1e-12   
emb|CDY66312.1|  BnaA04g29670D                                        75.9    1e-12   
ref|XP_009403789.1|  PREDICTED: transcription factor ICE1-like        76.3    1e-12   
emb|CDY56874.1|  BnaC04g52120D                                        75.9    1e-12   
ref|XP_009142636.1|  PREDICTED: transcription factor ABA-INDUCIBL...  75.9    1e-12   
gb|AAW22875.1|  bHLH transcriptional regulator                        74.3    1e-12   
ref|XP_009368799.1|  PREDICTED: transcription factor ICE1-like        76.3    1e-12   
ref|XP_001761839.1|  predicted protein                                75.9    1e-12   
gb|AGF25262.1|  inducer of CBF expression 1-4                         75.9    1e-12   
ref|XP_011015019.1|  PREDICTED: transcription factor FER-LIKE IRO...  74.3    1e-12   
ref|XP_008678166.1|  PREDICTED: transcription factor SCREAM2-like     76.3    1e-12   
ref|XP_008374176.1|  PREDICTED: transcription factor ICE1-like        75.9    1e-12   
gb|AIY30330.1|  inducer of CBF expression 1-b                         75.9    1e-12   
gb|AIY30329.1|  inducer of CBF expression 1-a                         75.9    1e-12   
ref|XP_006409372.1|  hypothetical protein EUTSA_v10022620mg           76.3    1e-12   
ref|NP_001234654.1|  bHLH transcriptional regulator                   73.9    1e-12   
ref|XP_004145143.1|  PREDICTED: transcription factor ICE1-like        75.9    1e-12   
gb|ACN21648.1|  putative basic helix-loop-helix protein BHLH23        75.9    1e-12   
gb|ADX86750.1|  inducer of CBF expression 1 protein                   75.9    1e-12   
ref|XP_004168725.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  75.9    1e-12   
ref|XP_009129484.1|  PREDICTED: transcription factor ICE1             75.5    1e-12   
ref|XP_007216087.1|  hypothetical protein PRUPE_ppa018220mg           75.5    1e-12   
gb|AFK44043.1|  unknown                                               75.5    1e-12   
ref|XP_010239154.1|  PREDICTED: transcription factor SCREAM2-like     75.9    1e-12   
ref|NP_001238591.1|  inducer of CBF expression 3                      74.7    1e-12   
ref|NP_001241268.1|  transcription factor ICE1-like                   75.5    1e-12   
ref|XP_004497179.1|  PREDICTED: transcription factor ABORTED MICR...  75.9    1e-12   
gb|KEH38875.1|  transcription factor                                  74.3    1e-12   
ref|XP_004487563.1|  PREDICTED: transcription factor FER-LIKE IRO...  74.3    1e-12   
gb|KGN58244.1|  hypothetical protein Csa_3G598900                     75.9    1e-12   
gb|KEH44367.1|  transcription factor aborted microspores-like pro...  75.9    1e-12   
ref|XP_009354965.1|  PREDICTED: transcription factor bHLH3-like       72.4    1e-12   
gb|ADV36253.1|  ICEb                                                  75.5    1e-12   
gb|AAS79350.1|  inducer of CBF expression 1 protein                   75.5    1e-12   
ref|XP_010678348.1|  PREDICTED: transcription factor ICE1-like        75.9    1e-12   
gb|KHN31262.1|  Transcription factor ICE1                             75.5    1e-12   
emb|CDY28529.1|  BnaC02g36310D                                        75.5    1e-12   
ref|XP_002876989.1|  hypothetical protein ARALYDRAFT_484449           75.5    1e-12   
emb|CDY48974.1|  BnaA02g28220D                                        75.5    1e-12   
ref|NP_001238707.1|  inducer of CBF expression 4                      75.5    1e-12   
gb|AGQ03811.1|  inducer of CBF expression 1b                          75.9    1e-12   
emb|CDY34601.1|  BnaC03g57010D                                        75.5    1e-12   
gb|AFG29442.1|  inducer of CBF expression 1 protein                   75.5    1e-12   
ref|XP_009378034.1|  PREDICTED: transcription factor ICE1-like        75.5    1e-12   
gb|AHM24955.1|  inducer of CBF expression 3                           75.9    1e-12   
ref|NP_172746.2|  transcription factor SCREAM2                        75.5    1e-12   
ref|XP_008450018.1|  PREDICTED: transcription factor ICE1             75.9    1e-12   
gb|KHN09719.1|  Transcription factor ICE1                             75.5    1e-12   
ref|XP_008440093.1|  PREDICTED: transcription factor ICE1-like        75.9    1e-12   
gb|AEE00745.1|  inducer of CBF expression                             75.5    1e-12   
gb|KJB40649.1|  hypothetical protein B456_007G072600                  75.5    1e-12   
gb|ADV36254.1|  ICEd                                                  75.1    1e-12   
ref|XP_006290983.1|  hypothetical protein CARUB_v10017099mg           75.5    1e-12   
gb|ADK91821.1|  inducer of CBF expression 2 protein                   75.9    1e-12   
emb|CBI15748.3|  unnamed protein product                              75.5    1e-12   
gb|AIU34717.1|  inducer of CBF expression 2                           75.5    1e-12   
ref|XP_010514336.1|  PREDICTED: transcription factor ICE1             75.5    1e-12   
gb|ADZ24264.1|  inducer of CBF expression 1 protein                   75.5    1e-12   
gb|AIA58702.1|  inducer of CBF expression 3                           75.9    1e-12   
ref|XP_010502614.1|  PREDICTED: transcription factor ICE1-like        75.5    1e-12   
ref|XP_006417184.1|  hypothetical protein EUTSA_v10007566mg           75.5    1e-12   
ref|XP_002284528.1|  PREDICTED: transcription factor ICE1-like        75.9    1e-12   
ref|NP_189309.2|  transcription factor ICE1                           75.5    1e-12   
gb|AGF25263.1|  inducer of CBF expression 1-5                         75.5    1e-12   
gb|KFK37416.1|  hypothetical protein AALP_AA4G254100                  75.5    1e-12   
gb|AIA58706.1|  inducer of CBF expression 3                           75.5    1e-12   
ref|XP_010430772.1|  PREDICTED: transcription factor ICE1-like        75.1    1e-12   
ref|XP_006374570.1|  hypothetical protein POPTR_0015s11650g           75.5    2e-12   
ref|XP_007032010.1|  Basic helix-loop-helix DNA-binding superfami...  75.5    2e-12   
gb|ABN58427.1|  inducer of CBF expression 1                           75.5    2e-12   
ref|XP_004952100.1|  PREDICTED: transcription factor ABORTED MICR...  75.5    2e-12   
gb|AAC64222.1|  bHLH transcription factor                             75.5    2e-12   
ref|XP_003606331.1|  BHLH transcription factor                        73.9    2e-12   
ref|XP_002321747.2|  hypothetical protein POPTR_0015s11650g           75.5    2e-12   
ref|XP_002960124.1|  hypothetical protein SELMODRAFT_75047            72.8    2e-12   
ref|XP_006395527.1|  hypothetical protein EUTSA_v10004059mg           75.5    2e-12   
gb|AIT55912.1|  ICE1 protein                                          75.5    2e-12   
ref|XP_003567427.1|  PREDICTED: transcription factor ICE1-like        74.7    2e-12   
ref|XP_006338844.1|  PREDICTED: transcription factor FER-LIKE IRO...  73.9    2e-12   
gb|AES88528.2|  transcription factor                                  74.3    2e-12   
ref|XP_011040262.1|  PREDICTED: transcription factor ICE1-like        75.5    2e-12   
gb|AIT39765.1|  inducer of CBF expression 1 protein                   75.5    2e-12   
ref|NP_001238560.1|  inducer of CBF expression 1                      75.1    2e-12   
ref|XP_002272647.1|  PREDICTED: transcription factor FER-LIKE IRO...  73.9    2e-12   
gb|KJB40045.1|  hypothetical protein B456_007G044800                  75.5    2e-12   
ref|XP_010096038.1|  hypothetical protein L484_008694                 75.5    2e-12   
ref|XP_008379053.1|  PREDICTED: transcription factor ICE1             75.5    2e-12   
gb|KJB40044.1|  hypothetical protein B456_007G044800                  75.5    2e-12   
gb|AGF25259.1|  inducer of CBF expression 1-1                         75.5    2e-12   
dbj|BAJ96398.1|  predicted protein                                    73.2    2e-12   
ref|XP_007032009.1|  Basic helix-loop-helix DNA-binding superfami...  75.5    2e-12   
ref|XP_007032008.1|  Basic helix-loop-helix DNA-binding superfami...  75.5    2e-12   
emb|CDY21073.1|  BnaA08g24520D                                        75.1    2e-12   
gb|AFY17139.1|  bHLH                                                  75.1    2e-12   
ref|NP_001142164.1|  putative HLH DNA-binding domain superfamily ...  75.5    2e-12   
ref|XP_002984017.1|  hypothetical protein SELMODRAFT_119431           72.4    2e-12   
gb|ACI96103.2|  ICE73 transcription factor                            75.5    2e-12   
ref|XP_011470675.1|  PREDICTED: transcription factor FER-LIKE IRO...  73.9    2e-12   
gb|KHG02428.1|  Transcription factor ICE1 -like protein               75.5    2e-12   
ref|XP_010554140.1|  PREDICTED: transcription factor ICE1-like is...  74.7    2e-12   
ref|XP_009380116.1|  PREDICTED: transcription factor ICE1-like        75.5    2e-12   
gb|AGF25260.1|  inducer of CBF expression 1-2                         75.5    2e-12   
gb|AIE56161.1|  inducer of CBF expression 1                           75.5    2e-12   
ref|XP_009421033.1|  PREDICTED: transcription factor ICE1             75.5    2e-12   



>ref|XP_009603228.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Nicotiana 
tomentosiformis]
Length=250

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 114/129 (88%), Gaps = 5/129 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            MENIGDEYK+YWET  FLQ+EELDSYF+EAISAYYDSSSPDG+QSS ASKNIVSERNRRK
Sbjct  1    MENIGDEYKNYWETNMFLQNEELDSYFDEAISAYYDSSSPDGAQSSLASKNIVSERNRRK  60

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLNERLFALRAVVP ISKMDKASIIKDAIEYIQEL EQER IQAEI ELESG    RSK 
Sbjct  61   KLNERLFALRAVVPNISKMDKASIIKDAIEYIQELHEQERRIQAEISELESG----RSKK  116

Query  557  NNGIFEFDQ  583
            N  + EFDQ
Sbjct  117  NTSL-EFDQ  124



>ref|XP_009760781.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Nicotiana 
sylvestris]
Length=250

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 114/129 (88%), Gaps = 5/129 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            MENIGDEYK+YWET  FLQ+EELDSYF+EAISAYYDSSSPDG+QSS ASKNIVSERNRRK
Sbjct  1    MENIGDEYKNYWETNMFLQNEELDSYFDEAISAYYDSSSPDGAQSSLASKNIVSERNRRK  60

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLNERLFALRAVVP ISKMDKASIIKDAI+YIQEL +QER IQAEI ELESG    RSK 
Sbjct  61   KLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHDQERRIQAEISELESG----RSKK  116

Query  557  NNGIFEFDQ  583
            N  + EFDQ
Sbjct  117  NTSV-EFDQ  124



>ref|XP_009603227.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Nicotiana 
tomentosiformis]
Length=251

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 114/130 (88%), Gaps = 6/130 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDS-YFEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            MENIGDEYK+YWET  FLQ+EELDS YF+EAISAYYDSSSPDG+QSS ASKNIVSERNRR
Sbjct  1    MENIGDEYKNYWETNMFLQNEELDSSYFDEAISAYYDSSSPDGAQSSLASKNIVSERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            KKLNERLFALRAVVP ISKMDKASIIKDAIEYIQEL EQER IQAEI ELESG    RSK
Sbjct  61   KKLNERLFALRAVVPNISKMDKASIIKDAIEYIQELHEQERRIQAEISELESG----RSK  116

Query  554  NNNGIFEFDQ  583
             N  + EFDQ
Sbjct  117  KNTSL-EFDQ  125



>ref|XP_009760780.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Nicotiana 
sylvestris]
Length=251

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 114/130 (88%), Gaps = 6/130 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDS-YFEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            MENIGDEYK+YWET  FLQ+EELDS YF+EAISAYYDSSSPDG+QSS ASKNIVSERNRR
Sbjct  1    MENIGDEYKNYWETNMFLQNEELDSSYFDEAISAYYDSSSPDGAQSSLASKNIVSERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            KKLNERLFALRAVVP ISKMDKASIIKDAI+YIQEL +QER IQAEI ELESG    RSK
Sbjct  61   KKLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHDQERRIQAEISELESG----RSK  116

Query  554  NNNGIFEFDQ  583
             N  + EFDQ
Sbjct  117  KNTSV-EFDQ  125



>ref|XP_007223913.1| hypothetical protein PRUPE_ppa010972mg [Prunus persica]
 gb|EMJ25112.1| hypothetical protein PRUPE_ppa010972mg [Prunus persica]
Length=228

 Score =   171 bits (433),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 109/130 (84%), Gaps = 6/130 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            M+NIGDEYKHYWET  FLQSEELDS+  +EA S YYDSSSPDG  SS ASKNIVSERNRR
Sbjct  1    MDNIGDEYKHYWETNMFLQSEELDSWGLDEAFSGYYDSSSPDGGASSMASKNIVSERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            KKLNERLFALRAVVPKISKMDKASIIKDAI+YIQEL EQER IQ EI ELESG    RSK
Sbjct  61   KKLNERLFALRAVVPKISKMDKASIIKDAIDYIQELHEQERRIQTEIGELESG----RSK  116

Query  554  NNNGIFEFDQ  583
             N G  EFDQ
Sbjct  117  KNLG-SEFDQ  125



>ref|XP_008223870.1| PREDICTED: transcription factor bHLH35 [Prunus mume]
Length=242

 Score =   170 bits (431),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 109/130 (84%), Gaps = 6/130 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            M+NIGDEYKHYWET  FLQ+EELDS+  +EA S YYDSSSPDG  SS ASKNIVSERNRR
Sbjct  1    MDNIGDEYKHYWETNMFLQTEELDSWGLDEAFSGYYDSSSPDGGASSMASKNIVSERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            KKLNERLFALRAVVPKISKMDKASIIKDAI+YIQEL EQER IQ EI ELESG    RSK
Sbjct  61   KKLNERLFALRAVVPKISKMDKASIIKDAIDYIQELHEQERRIQTEIGELESG----RSK  116

Query  554  NNNGIFEFDQ  583
             N G  EFDQ
Sbjct  117  KNLG-SEFDQ  125



>ref|XP_008358594.1| PREDICTED: transcription factor bHLH35-like [Malus domestica]
Length=242

 Score =   165 bits (417),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 106/129 (82%), Gaps = 4/129 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            M+NIGDEYKHYWET  FLQ+EELDS+  +EA S YYDSSSPDG+ SS ASKNIVSERNRR
Sbjct  1    MDNIGDEYKHYWETNMFLQTEELDSWGLDEAFSGYYDSSSPDGAASSMASKNIVSERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            KKLNERLFALRAVVP ISKMDKASIIKDAIEYIQEL EQER IQ EI ELESG     +K
Sbjct  61   KKLNERLFALRAVVPNISKMDKASIIKDAIEYIQELHEQERRIQTEIVELESGKS---NK  117

Query  554  NNNGIFEFD  580
            N    FE D
Sbjct  118  NQGSDFEQD  126



>ref|XP_003595077.1| Transcription factor bHLH [Medicago truncatula]
 gb|AES65328.1| transcription factor [Medicago truncatula]
Length=244

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 6/131 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqss-aasKNIVSERNR  370
            MENIGDEYKHYWET  F Q++ELDS+  +EA+SAYYDSSSPDG+ SS  +SKNIVSERNR
Sbjct  1    MENIGDEYKHYWETNMFFQTQELDSWGLDEALSAYYDSSSPDGAASSGVSSKNIVSERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARS  550
            RKKLNERLFALRAVVP ISKMDKASIIKDAIEYIQ L EQE++IQAEI ELESG      
Sbjct  61   RKKLNERLFALRAVVPNISKMDKASIIKDAIEYIQLLHEQEKVIQAEIMELESG----MP  116

Query  551  KNNNGIFEFDQ  583
             N N  ++FDQ
Sbjct  117  NNINPSYDFDQ  127



>gb|AFK39403.1| unknown [Medicago truncatula]
Length=175

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 6/131 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqss-aasKNIVSERNR  370
            MENIGDEYKHYWET  F Q++ELDS+  +EA+SAYYDSSSPDG+ SS  +SKNIVSERNR
Sbjct  1    MENIGDEYKHYWETNMFFQTQELDSWGLDEALSAYYDSSSPDGAASSGVSSKNIVSERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARS  550
            RKKLNERLFALRAVVP ISKMDKASIIKDAIEYIQ L EQE++IQAEI ELESG      
Sbjct  61   RKKLNERLFALRAVVPNISKMDKASIIKDAIEYIQLLHEQEKVIQAEIMELESG----MP  116

Query  551  KNNNGIFEFDQ  583
             N N  ++FDQ
Sbjct  117  NNINPSYDFDQ  127



>ref|XP_003595078.1| Transcription factor bHLH [Medicago truncatula]
Length=185

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 6/131 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqss-aasKNIVSERNR  370
            MENIGDEYKHYWET  F Q++ELDS+  +EA+SAYYDSSSPDG+ SS  +SKNIVSERNR
Sbjct  1    MENIGDEYKHYWETNMFFQTQELDSWGLDEALSAYYDSSSPDGAASSGVSSKNIVSERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARS  550
            RKKLNERLFALRAVVP ISKMDKASIIKDAIEYIQ L EQE++IQAEI ELESG      
Sbjct  61   RKKLNERLFALRAVVPNISKMDKASIIKDAIEYIQLLHEQEKVIQAEIMELESG----MP  116

Query  551  KNNNGIFEFDQ  583
             N N  ++FDQ
Sbjct  117  NNINPSYDFDQ  127



>ref|XP_006586714.1| PREDICTED: uncharacterized protein LOC100817978 isoform X1 [Glycine 
max]
Length=217

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 103/113 (91%), Gaps = 1/113 (1%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            MENIG+EYKHYWET  FLQ++ELDS+  +EA+S YYDSSSPDG+ SSAASKNIVSERNRR
Sbjct  1    MENIGEEYKHYWETNMFLQTQELDSWGLDEALSGYYDSSSPDGAASSAASKNIVSERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            KKLNERLFALR+VVP ISKMDKASIIKDAIEYIQ L EQE+IIQAEI ELESG
Sbjct  61   KKLNERLFALRSVVPNISKMDKASIIKDAIEYIQHLHEQEKIIQAEIMELESG  113



>ref|NP_001239951.1| uncharacterized protein LOC100817978 [Glycine max]
 gb|ACU20892.1| unknown [Glycine max]
 gb|KHN35816.1| Transcription factor bHLH35 [Glycine soja]
Length=244

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 103/113 (91%), Gaps = 1/113 (1%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            MENIG+EYKHYWET  FLQ++ELDS+  +EA+S YYDSSSPDG+ SSAASKNIVSERNRR
Sbjct  1    MENIGEEYKHYWETNMFLQTQELDSWGLDEALSGYYDSSSPDGAASSAASKNIVSERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            KKLNERLFALR+VVP ISKMDKASIIKDAIEYIQ L EQE+IIQAEI ELESG
Sbjct  61   KKLNERLFALRSVVPNISKMDKASIIKDAIEYIQHLHEQEKIIQAEIMELESG  113



>ref|XP_009348093.1| PREDICTED: transcription factor bHLH35-like [Pyrus x bretschneideri]
Length=242

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 106/129 (82%), Gaps = 4/129 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            M+NIG+EYKHYWET  FLQ+EELDS+  +EA S YYDSSSPDG+ SS ASKNIVSERNRR
Sbjct  1    MDNIGEEYKHYWETNMFLQTEELDSWGLDEAFSGYYDSSSPDGAASSMASKNIVSERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            KKLNERLFALRAVVP ISKMDKASIIKDAIEYIQEL EQE+ IQ EI ELESG     +K
Sbjct  61   KKLNERLFALRAVVPNISKMDKASIIKDAIEYIQELHEQEKRIQTEIVELESGKS---NK  117

Query  554  NNNGIFEFD  580
            N    FE D
Sbjct  118  NPGSDFEQD  126



>ref|XP_009359948.1| PREDICTED: transcription factor bHLH35 [Pyrus x bretschneideri]
Length=242

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            M+NIGDEYKHYWET  FLQ+EELDS+  +EA S YYDSSSPDG+ S  ASKNIVSERNRR
Sbjct  1    MDNIGDEYKHYWETNMFLQTEELDSWGLDEAFSGYYDSSSPDGAASFMASKNIVSERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            KKLNERLFALRAVVP ISKMDKASIIKDAI+YIQEL EQER IQ EI ELESG    +
Sbjct  61   KKLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHEQERRIQTEIVELESGKSNKK  118



>ref|XP_004296498.1| PREDICTED: transcription factor bHLH35 [Fragaria vesca subsp. 
vesca]
Length=244

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 108/131 (82%), Gaps = 5/131 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY--FEEAISAYYdssspdgsqssaasKNIVSERNR  370
            M+NIGDEY+HYWET  FLQ+EELDS+   EEA S YYDSSSPDG+ SS ASKNIVSERNR
Sbjct  1    MDNIGDEYQHYWETNMFLQTEELDSWKLGEEAFSGYYDSSSPDGAASSMASKNIVSERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARS  550
            RKKLNERLFALRAVVP ISKMDKASIIKDAI+YIQEL +QER IQAEI +LESG      
Sbjct  61   RKKLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHDQERRIQAEIMDLESGKS---K  117

Query  551  KNNNGIFEFDQ  583
            K+  G  +F+Q
Sbjct  118  KSVMGSSDFEQ  128



>ref|XP_003546437.1| PREDICTED: transcription factor bHLH35-like [Glycine max]
 gb|KHN15341.1| Transcription factor bHLH35 [Glycine soja]
Length=243

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 102/113 (90%), Gaps = 1/113 (1%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            MENIG+EYKHYWET  FLQ++EL S+  +EA+S YYDSSSPDG+ SSAASKNIVSERNRR
Sbjct  1    MENIGEEYKHYWETNMFLQTQELGSWGLDEALSGYYDSSSPDGAASSAASKNIVSERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            KKLNERLFALR+VVP ISKMDKASIIKDAI+YIQ L EQE+IIQAEI ELESG
Sbjct  61   KKLNERLFALRSVVPNISKMDKASIIKDAIDYIQHLHEQEKIIQAEIMELESG  113



>ref|XP_004242918.1| PREDICTED: transcription factor bHLH35 [Solanum lycopersicum]
Length=253

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            M+NIGDEYK+YWET  FLQSEELDSYF+E IS+YYDSSSPDGSQSS ASKNIVSERNRRK
Sbjct  1    MDNIGDEYKNYWETTMFLQSEELDSYFDEPISSYYDSSSPDGSQSSMASKNIVSERNRRK  60

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLNERLFALRAVVP ISKMDKASIIKDAI+YI+EL  QER I+ EI ELESG   ++  +
Sbjct  61   KLNERLFALRAVVPNISKMDKASIIKDAIDYIEELHNQERRIRGEISELESGRSSSKKNS  120

Query  557  NNGIFEFDQ  583
            N+  FE D+
Sbjct  121  NDVEFEQDE  129



>ref|XP_004487998.1| PREDICTED: transcription factor bHLH35-like [Cicer arietinum]
Length=249

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 2/114 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspd-gsqssaasKNIVSERNR  370
            MENIG+EYKHYWET  FLQ++ELDS+  +EA S YYDSSSPD  + S+ +SKNIVSERNR
Sbjct  1    MENIGEEYKHYWETNMFLQTQELDSWGLDEAFSGYYDSSSPDGAASSAVSSKNIVSERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            RKKLNERLFALR+VVP ISKMDKASIIKDAIEYIQ L EQE+IIQAEI ELESG
Sbjct  61   RKKLNERLFALRSVVPNISKMDKASIIKDAIEYIQHLHEQEKIIQAEIMELESG  114



>ref|XP_010048565.1| PREDICTED: transcription factor bHLH35 isoform X2 [Eucalyptus 
grandis]
 gb|KCW80843.1| hypothetical protein EUGRSUZ_C02208 [Eucalyptus grandis]
Length=242

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 4/129 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            M+N  +EY++YWET  F Q+EELDS+ +EAIS YYDSSSPDG+ S+AASKNIVSERNRRK
Sbjct  1    MDNNVEEYQNYWETTMFYQNEELDSWVDEAISGYYDSSSPDGAASTAASKNIVSERNRRK  60

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLNERLFALRAVVP ISKMDKASIIKDAI+YIQEL +QER IQAEI ELESG    + K 
Sbjct  61   KLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHDQERRIQAEILELESG----KLKK  116

Query  557  NNGIFEFDQ  583
             +G ++FDQ
Sbjct  117  GSGGYDFDQ  125



>ref|XP_006344525.1| PREDICTED: transcription factor bHLH35-like [Solanum tuberosum]
Length=252

 Score =   157 bits (398),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 111/129 (86%), Gaps = 3/129 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            M+NIGDEYK+YWET  FLQSEELDSYF+E IS+YYDSSSPDGSQSS ASKNIVSERNRRK
Sbjct  1    MDNIGDEYKNYWETTMFLQSEELDSYFDEPISSYYDSSSPDGSQSSMASKNIVSERNRRK  60

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLNERLFALRAVVP ISKMDKASIIKDAI+YI+EL +QER I+ EI ELESG     SK 
Sbjct  61   KLNERLFALRAVVPNISKMDKASIIKDAIDYIEELHKQERRIRGEISELESGRS---SKK  117

Query  557  NNGIFEFDQ  583
            N+   EF+Q
Sbjct  118  NSTDLEFEQ  126



>ref|XP_007138769.1| hypothetical protein PHAVU_009G235700g [Phaseolus vulgaris]
 gb|ESW10763.1| hypothetical protein PHAVU_009G235700g [Phaseolus vulgaris]
Length=244

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 2/113 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            MENI +EYKHYWET  FLQ+++LDS+ F+EA+S YYDSSSPDG+ SSAASKNIVSERNRR
Sbjct  1    MENI-EEYKHYWETTMFLQTQDLDSWGFDEALSGYYDSSSPDGAASSAASKNIVSERNRR  59

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            KKLNERLFALR+VVP ISKMDKASIIKDAIEYIQEL E+E+IIQAEI +LESG
Sbjct  60   KKLNERLFALRSVVPNISKMDKASIIKDAIEYIQELHEKEKIIQAEIMDLESG  112



>ref|XP_002325261.2| hypothetical protein POPTR_0018s13860g [Populus trichocarpa]
 gb|EEF03826.2| hypothetical protein POPTR_0018s13860g [Populus trichocarpa]
Length=249

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 5/126 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            +ENIG+EY++YWET+ FLQ+EELDS+  +EA S YYDSSSPDG+ SSAA+KNIVSERNRR
Sbjct  4    IENIGEEYQNYWETKMFLQNEELDSWAIDEAFSGYYDSSSPDGAASSAATKNIVSERNRR  63

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            KKLNERLFALRAVVP ISKMDKASIIKDAI+YIQEL +QE+ IQAE+ ELESG    +SK
Sbjct  64   KKLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHDQEKQIQAELSELESG----KSK  119

Query  554  NNNGIF  571
             N G F
Sbjct  120  KNQGGF  125



>ref|XP_011017674.1| PREDICTED: transcription factor bHLH35-like [Populus euphratica]
Length=249

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 5/126 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            +ENIG+EY++YWET+ FLQ+EELDS+  +EA S YYDSSSPDG+ SSAASKNIVSERNRR
Sbjct  4    IENIGEEYQNYWETKMFLQNEELDSWAIDEAFSGYYDSSSPDGAASSAASKNIVSERNRR  63

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            KKLNERLFALRAVVP ISKMDKASIIKDAI+YIQEL +QE+ IQAE+ ELESG    +SK
Sbjct  64   KKLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHDQEKKIQAELIELESG----KSK  119

Query  554  NNNGIF  571
             N G F
Sbjct  120  KNQGGF  125



>ref|XP_008388700.1| PREDICTED: transcription factor bHLH35 [Malus domestica]
Length=244

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 104/124 (84%), Gaps = 3/124 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqs-saasKNIVSERNR  370
            M+NIGDEYKHYWET  FLQ+EELDS+  +EA S YYDSSSPDG+ S  A+SKN+VSERNR
Sbjct  1    MDNIGDEYKHYWETNMFLQTEELDSWDLDEAFSGYYDSSSPDGAASFMASSKNVVSERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL-ESGNGGAR  547
            RKKLNERLFALRAVVP ISKMDKAS+IKDAI+YIQEL EQER IQ EI EL ESG    +
Sbjct  61   RKKLNERLFALRAVVPNISKMDKASVIKDAIDYIQELHEQERRIQTEIVELIESGKSNKK  120

Query  548  SKNN  559
            S ++
Sbjct  121  SGSD  124



>ref|XP_007014435.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY32054.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
1 [Theobroma cacao]
Length=317

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 108/129 (84%), Gaps = 5/129 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            +ENIGDEYK+YWET+ FL++EE  S+  +  S YYDSSSPDG+ SSAASKNIVSERNRRK
Sbjct  7    IENIGDEYKNYWETKYFLENEEYSSWAIDEFSGYYDSSSPDGAASSAASKNIVSERNRRK  66

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLNERLF+LRAVVP ISKMDKASIIKDAI+YIQEL EQER IQAEI ELESG    + K 
Sbjct  67   KLNERLFSLRAVVPNISKMDKASIIKDAIDYIQELHEQERRIQAEILELESG----KLKK  122

Query  557  NNGIFEFDQ  583
            N G +EFDQ
Sbjct  123  NPG-YEFDQ  130



>ref|XP_011094110.1| PREDICTED: transcription factor bHLH35 [Sesamum indicum]
Length=240

 Score =   152 bits (385),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 8/124 (6%)
 Frame = +2

Query  212  DEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRKKLNER  391
            D+YK+YWET  FLQ+EELDSYF+E ISAYYDSSSP+G+QSS ASKNIVSERNRRKKLNER
Sbjct  5    DDYKNYWETGMFLQTEELDSYFDEHISAYYDSSSPEGTQSSLASKNIVSERNRRKKLNER  64

Query  392  LFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKNNNGIF  571
            L+ALRAVVP I+KMDKASII+DAIEYIQ L ++ER IQAEI ELESG    R+ N    F
Sbjct  65   LYALRAVVPNITKMDKASIIRDAIEYIQALHDEERRIQAEISELESG----RATN----F  116

Query  572  EFDQ  583
            E++Q
Sbjct  117  EYEQ  120



>ref|XP_002263999.1| PREDICTED: transcription factor bHLH35 [Vitis vinifera]
 emb|CBI17910.3| unnamed protein product [Vitis vinifera]
Length=244

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 108/131 (82%), Gaps = 7/131 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY--FEEAISAYYdssspdgsqssaasKNIVSERNR  370
            M+N  +E+K+YWET  FLQSEE DS+   +EA S YYDSSSPDG+ SSAASKNIVSERNR
Sbjct  1    MDNT-EEFKNYWETNMFLQSEEFDSWGGLDEAFSGYYDSSSPDGAASSAASKNIVSERNR  59

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARS  550
            RKKLNERLFALRAVVP ISKMDKASIIKDAI+YIQ+L EQER IQAEI ELESG    +S
Sbjct  60   RKKLNERLFALRAVVPNISKMDKASIIKDAIDYIQDLHEQERRIQAEISELESG----KS  115

Query  551  KNNNGIFEFDQ  583
            K +   +EFDQ
Sbjct  116  KKSPPGYEFDQ  126



>ref|XP_011020046.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 109/130 (84%), Gaps = 5/130 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            +ENIG+EY++YWET+ FLQ+EE DS+  +EA S YYDSSSPDG+ SSAASKNIVSERNRR
Sbjct  4    IENIGEEYQNYWETKMFLQNEEFDSWAIDEAFSGYYDSSSPDGAASSAASKNIVSERNRR  63

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            K+LNERLFALRAVVP I+KMDKASIIKDAI+YIQEL EQER IQAEI ELES     + K
Sbjct  64   KRLNERLFALRAVVPNITKMDKASIIKDAIDYIQELHEQERRIQAEILELES----VKLK  119

Query  554  NNNGIFEFDQ  583
             + G+  F+Q
Sbjct  120  KDPGLNVFEQ  129



>ref|XP_007014436.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY32055.1| Basic helix-loop-helix DNA-binding superfamily protein isoform 
2 [Theobroma cacao]
Length=246

 Score =   150 bits (378),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 107/129 (83%), Gaps = 6/129 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            +ENIGDEYK+YWET+ FL++EE     +E  S YYDSSSPDG+ SSAASKNIVSERNRRK
Sbjct  7    IENIGDEYKNYWETKYFLENEEYSWAIDE-FSGYYDSSSPDGAASSAASKNIVSERNRRK  65

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLNERLF+LRAVVP ISKMDKASIIKDAI+YIQEL EQER IQAEI ELESG    + K 
Sbjct  66   KLNERLFSLRAVVPNISKMDKASIIKDAIDYIQELHEQERRIQAEILELESG----KLKK  121

Query  557  NNGIFEFDQ  583
            N G +EFDQ
Sbjct  122  NPG-YEFDQ  129



>gb|EYU18210.1| hypothetical protein MIMGU_mgv1a022464mg [Erythranthe guttata]
Length=233

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 95/119 (80%), Gaps = 6/119 (5%)
 Frame = +2

Query  188  INIMENIGDEYKHYWETQTFLQSEELD----SYFEEAISAYYdssspdgsqssaasKNIV  355
            + ++ENIGDEYK+YWET  FLQSEELD    SY EEAIS  Y  SS     + +  KNIV
Sbjct  1    MEMLENIGDEYKNYWETNMFLQSEELDAYSHSYIEEAISGGYYDSSSPDGTTQS--KNIV  58

Query  356  SERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            SERNRRKKLN+RL+ALR+VVP I+KMDKASIIKDAIEYI+ L+EQE+ +QAEI ELESG
Sbjct  59   SERNRRKKLNQRLYALRSVVPNITKMDKASIIKDAIEYIKTLQEQEKRMQAEISELESG  117



>ref|XP_006381154.1| hypothetical protein POPTR_0006s07440g, partial [Populus trichocarpa]
 gb|ERP58951.1| hypothetical protein POPTR_0006s07440g, partial [Populus trichocarpa]
Length=217

 Score =   147 bits (370),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 107/129 (83%), Gaps = 5/129 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            +ENIG+EY++YWET+ FLQ+EE D Y   ++  YYDSSSPDG+ SSAASKNIVSERNRRK
Sbjct  4    IENIGEEYQNYWETKMFLQNEEFDRY-TFSMHGYYDSSSPDGAASSAASKNIVSERNRRK  62

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            +LNERLFALRAVVP ISKMDKASIIKDAI+YIQEL +QER IQAEI ELESG    + K 
Sbjct  63   RLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHKQERRIQAEILELESG----KLKK  118

Query  557  NNGIFEFDQ  583
            + G+  F+Q
Sbjct  119  DPGVDVFEQ  127



>gb|KJB83353.1| hypothetical protein B456_013G242800 [Gossypium raimondii]
Length=173

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 105/129 (81%), Gaps = 6/129 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            +ENIGDEYK+YWET+ FL++EE     +E  S YYDSSSPDG+ SS A+KNIVSERNRRK
Sbjct  7    IENIGDEYKNYWETKYFLENEEYSWPIDE-FSGYYDSSSPDGAASSVAAKNIVSERNRRK  65

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLNERLFALRAVVP ISKMDKASIIKDAI+YIQEL +QE  IQAEI ELESG    + K 
Sbjct  66   KLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHDQEGRIQAEISELESG----KLKK  121

Query  557  NNGIFEFDQ  583
            N G FE+DQ
Sbjct  122  NPG-FEYDQ  129



>ref|XP_006453237.1| hypothetical protein CICLE_v100092852mg [Citrus clementina]
 ref|XP_006474281.1| PREDICTED: transcription factor bHLH35-like [Citrus sinensis]
 gb|ESR66477.1| hypothetical protein CICLE_v100092852mg [Citrus clementina]
Length=246

 Score =   146 bits (369),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 111/134 (83%), Gaps = 10/134 (7%)
 Frame = +2

Query  197  MENIGD----EYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSE  361
            MEN+G+    EY++YWET+ FLQ+EE D++  +EA S YYDSSSPDG+ SSAASKNIVSE
Sbjct  1    MENLGEDYQQEYQNYWETKMFLQNEEFDTWPLDEAFSGYYDSSSPDGAASSAASKNIVSE  60

Query  362  RNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGG  541
            RNRRKKLNERLFALR+VVP ISKMDKASIIKDAI+YIQEL EQE+ I+ EI ELESG   
Sbjct  61   RNRRKKLNERLFALRSVVPNISKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESG---  117

Query  542  ARSKNNNGIFEFDQ  583
             +SK N G F+F+Q
Sbjct  118  -KSKKNFG-FDFEQ  129



>ref|XP_006453236.1| hypothetical protein CICLE_v100092852mg [Citrus clementina]
 gb|ESR66476.1| hypothetical protein CICLE_v100092852mg [Citrus clementina]
Length=250

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 111/134 (83%), Gaps = 10/134 (7%)
 Frame = +2

Query  197  MENIGD----EYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSE  361
            MEN+G+    EY++YWET+ FLQ+EE D++  +EA S YYDSSSPDG+ SSAASKNIVSE
Sbjct  1    MENLGEDYQQEYQNYWETKMFLQNEEFDTWPLDEAFSGYYDSSSPDGAASSAASKNIVSE  60

Query  362  RNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGG  541
            RNRRKKLNERLFALR+VVP ISKMDKASIIKDAI+YIQEL EQE+ I+ EI ELESG   
Sbjct  61   RNRRKKLNERLFALRSVVPNISKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESG---  117

Query  542  ARSKNNNGIFEFDQ  583
             +SK N G F+F+Q
Sbjct  118  -KSKKNFG-FDFEQ  129



>gb|KJB83352.1| hypothetical protein B456_013G242800 [Gossypium raimondii]
Length=245

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 105/129 (81%), Gaps = 6/129 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            +ENIGDEYK+YWET+ FL++EE     +E  S YYDSSSPDG+ SS A+KNIVSERNRRK
Sbjct  7    IENIGDEYKNYWETKYFLENEEYSWPIDE-FSGYYDSSSPDGAASSVAAKNIVSERNRRK  65

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLNERLFALRAVVP ISKMDKASIIKDAI+YIQEL +QE  IQAEI ELESG    + K 
Sbjct  66   KLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHDQEGRIQAEISELESG----KLKK  121

Query  557  NNGIFEFDQ  583
            N G FE+DQ
Sbjct  122  NPG-FEYDQ  129



>gb|KDO61950.1| hypothetical protein CISIN_1g025665mg [Citrus sinensis]
 gb|KDO61951.1| hypothetical protein CISIN_1g025665mg [Citrus sinensis]
Length=249

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 111/134 (83%), Gaps = 10/134 (7%)
 Frame = +2

Query  197  MENIGD----EYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSE  361
            MEN+G+    EY++YWET+ FLQ+EE D++  +EA S YYDSSSPDG+ SSAASKNIVSE
Sbjct  1    MENLGEDYQQEYQNYWETKMFLQNEEFDTWPLDEAFSGYYDSSSPDGAASSAASKNIVSE  60

Query  362  RNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGG  541
            RNRRKKLNERLFALR+VVP ISKMDKASIIKDAI+YIQEL EQE+ I+ EI ELESG   
Sbjct  61   RNRRKKLNERLFALRSVVPNISKMDKASIIKDAIDYIQELHEQEKRIRDEIMELESG---  117

Query  542  ARSKNNNGIFEFDQ  583
             +SK N G F+F+Q
Sbjct  118  -KSKKNFG-FDFEQ  129



>gb|KHG05269.1| Transcription factor bHLH35 -like protein [Gossypium arboreum]
Length=245

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 105/129 (81%), Gaps = 6/129 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            +ENIGDEYK+YWET+ FL++EE     +E  S YYDSSSPDG+ SS A+KNIVSERNRRK
Sbjct  7    IENIGDEYKNYWETKYFLENEEYSWPIDE-FSGYYDSSSPDGAASSVAAKNIVSERNRRK  65

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLNERLFALRAVVP ISKMDKASIIKDAI+YIQEL +QE  IQAEI ELESG    + K 
Sbjct  66   KLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHDQEGRIQAEIRELESG----KLKK  121

Query  557  NNGIFEFDQ  583
            N G FE+DQ
Sbjct  122  NPG-FEYDQ  129



>ref|XP_010273597.1| PREDICTED: transcription factor bHLH35 [Nelumbo nucifera]
Length=252

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 3/110 (3%)
 Frame = +2

Query  212  DEYKHYWETQTFLQSEELDSY-FEEAISAYYdsssp--dgsqssaasKNIVSERNRRKKL  382
            DEY HYWET+ F+Q+EELDS+  +EA S+YYDSSSP    + SS A+KNI+SERNRRKKL
Sbjct  14   DEYSHYWETKRFIQNEELDSWALDEAFSSYYDSSSPEGTATASSIAAKNILSERNRRKKL  73

Query  383  NERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            NERLFALR+VVP ISKMDKASIIKDAIEYIQ+L EQER IQAEI ELESG
Sbjct  74   NERLFALRSVVPNISKMDKASIIKDAIEYIQQLHEQERTIQAEILELESG  123



>emb|CAN78766.1| hypothetical protein VITISV_044397 [Vitis vinifera]
Length=805

 Score =   151 bits (382),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 96/131 (73%), Positives = 108/131 (82%), Gaps = 7/131 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY--FEEAISAYYdssspdgsqssaasKNIVSERNR  370
            M+N  +E+K+YWET  FLQSEE DS+   +EA S YYDSSSPDG+ SSAASKNIVSERNR
Sbjct  1    MDNT-EEFKNYWETNMFLQSEEFDSWGGLDEAFSGYYDSSSPDGAASSAASKNIVSERNR  59

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARS  550
            RKKLNERLFALRAVVP ISKMDKASIIKDAI+YIQ+L EQER IQAEI ELESG    +S
Sbjct  60   RKKLNERLFALRAVVPNISKMDKASIIKDAIDYIQDLHEQERRIQAEISELESG----KS  115

Query  551  KNNNGIFEFDQ  583
            K +   +EFDQ
Sbjct  116  KKSPPGYEFDQ  126



>gb|KDP42524.1| hypothetical protein JCGZ_02482 [Jatropha curcas]
Length=253

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 110/142 (77%), Gaps = 19/142 (13%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELD-----SY--------FEEAISAYYdssspdgsqssa  337
            +ENIG EY +YWET+ FL++EELD     +Y         +EA S YYDSSSPDG+ SSA
Sbjct  4    IENIG-EYHNYWETKRFLETEELDRAEFATYKLILSSWAMDEAFSGYYDSSSPDGAASSA  62

Query  338  asKNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIW  517
            ASKNIVSERNRRKKLNERLFALRAVVP ISKMDKASIIKDAI+YIQEL EQER IQAEI 
Sbjct  63   ASKNIVSERNRRKKLNERLFALRAVVPNISKMDKASIIKDAIDYIQELHEQERRIQAEIM  122

Query  518  ELESGNGGARSKNNNGIFEFDQ  583
            ELESG    + K N+G  EF+Q
Sbjct  123  ELESG----KLKKNSG-SEFEQ  139



>ref|XP_011077906.1| PREDICTED: transcription factor bHLH35-like [Sesamum indicum]
Length=250

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 102/130 (78%), Gaps = 4/130 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspd-gsqssaasKNIVSERNRR  373
            MENI  EY +YWET  FLQ+EE D +F+EA+SAYYDSSSPD  + +S ASKNIVSERNRR
Sbjct  1    MENIDYEYANYWETNMFLQTEEFDGFFDEALSAYYDSSSPDGANSASLASKNIVSERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            KKLN+RL+ALR+VVP I+KMDKASII+DAIEYI+ L+ +ER I  EI ELESG   +   
Sbjct  61   KKLNQRLYALRSVVPNITKMDKASIIRDAIEYIKSLQNEERRIHDEISELESGMSLS---  117

Query  554  NNNGIFEFDQ  583
             N+G  E D+
Sbjct  118  PNSGKLEIDE  127



>ref|XP_011094113.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Sesamum 
indicum]
Length=269

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 105/136 (77%), Gaps = 12/136 (9%)
 Frame = +2

Query  122  NPLPSHFTFTT*LAS*LAYKFQINIMENIGDEYKHYWETQTFLQSEELDSYFEEAISAYY  301
            +P  SHF+    L            ME+  D+Y +YWET  FLQ+EELDSYF+E ISAYY
Sbjct  16   SPFISHFSSQPKLT-----------MEDF-DDYNNYWETGMFLQTEELDSYFDEHISAYY  63

Query  302  dssspdgsqssaasKNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQEL  481
            DSSSPDG+QSS ASKNI++E+NRRKKLNERL+ALRAVVP ISKMDK SI++DAI+YIQ L
Sbjct  64   DSSSPDGAQSSLASKNIIAEKNRRKKLNERLYALRAVVPNISKMDKISIVRDAIDYIQAL  123

Query  482  REQERIIQAEIWELES  529
             ++ER IQAEI ELES
Sbjct  124  HDEERRIQAEISELES  139



>ref|XP_010536890.1| PREDICTED: transcription factor bHLH35 isoform X3 [Tarenaya hassleriana]
Length=243

 Score =   137 bits (346),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 102/123 (83%), Gaps = 4/123 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            MENI +EYK+YWET TF Q+EELD   +EA+S  YDSSSPDG+ SS ASKNI+SERNRR+
Sbjct  1    MENIDEEYKNYWETTTFFQNEELDWPLDEAVSGSYDSSSPDGAASSPASKNILSERNRRQ  60

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLN+RLFALR+VVP I+KMDKASIIKDAI+YIQEL+++E+ ++ EI ELES     RSK+
Sbjct  61   KLNQRLFALRSVVPNITKMDKASIIKDAIDYIQELQKEEKRLEVEIRELES----IRSKS  116

Query  557  NNG  565
             N 
Sbjct  117  LNS  119



>ref|XP_007154705.1| hypothetical protein PHAVU_003G1408001g, partial [Phaseolus vulgaris]
 gb|ESW26699.1| hypothetical protein PHAVU_003G1408001g, partial [Phaseolus vulgaris]
Length=211

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 100/131 (76%), Gaps = 10/131 (8%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYF--EEAISAYYdssspdgsqssaasKNIVSERNR  370
            M+NI ++Y H+ ++  F Q+EELDS+   E A+S YYDSSSPDG  SS ASKNIVSERNR
Sbjct  1    MDNIVEDYDHFLDS--FFQNEELDSWAMDEAALSGYYDSSSPDGGASSVASKNIVSERNR  58

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARS  550
            RKKLNERLFALRAVVP ISKMDKASIIKDAIEYIQ L EQE+ I+AEI  LESG      
Sbjct  59   RKKLNERLFALRAVVPNISKMDKASIIKDAIEYIQNLHEQEKRIKAEILNLESG------  112

Query  551  KNNNGIFEFDQ  583
            K  N  +EFD 
Sbjct  113  KLKNPTYEFDH  123



>ref|XP_010927251.1| PREDICTED: transcription factor bHLH35-like [Elaeis guineensis]
Length=246

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +2

Query  218  YKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRRKKLNERL  394
            Y  YWET+ FL+SEELDS+  +EAIS YYDSSSPD + SS A+KN+V ERNRR+KLNERL
Sbjct  7    YNSYWETKRFLESEELDSWGLDEAISTYYDSSSPDNAASSTATKNLVMERNRRRKLNERL  66

Query  395  FALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            +ALR+VVP I+KMDKASI+KDAI+YIQEL+EQER I AEI ELESG
Sbjct  67   YALRSVVPNITKMDKASIVKDAIDYIQELQEQERRILAEISELESG  112



>ref|XP_010929341.1| PREDICTED: transcription factor bHLH35 isoform X2 [Elaeis guineensis]
Length=248

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY--FEEAISAYYdssspdgsqssaasKNIVSERNR  370
            M+++  EY  YWET+ F +SEELDS    +EA+S YYDSSSP+ + SS A+KNIV ERNR
Sbjct  1    MDDMEAEYNFYWETKRFFESEELDSGWGLDEALSGYYDSSSPENAASSTAAKNIVMERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            R+KLNERL+ALR+VVP I+KMDKASIIKDAI+YIQEL+EQER +QAEI ELE+
Sbjct  61   RRKLNERLYALRSVVPNITKMDKASIIKDAIDYIQELQEQERRMQAEISELET  113



>ref|XP_008799483.1| PREDICTED: transcription factor bHLH35-like [Phoenix dactylifera]
Length=241

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            M+++  EY  YWET+ FL+SEELDS+  +EAIS YYDSSSPD + S+AA KN+V ERNRR
Sbjct  1    MDDMEAEYNFYWETRRFLESEELDSWGLDEAISGYYDSSSPDVASSTAA-KNLVMERNRR  59

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGG  541
            +++NERL+ALR+VVP I+KMDKASIIKDAI YIQEL+EQER I AEI ELESG  G
Sbjct  60   RQINERLYALRSVVPNITKMDKASIIKDAISYIQELQEQERRILAEISELESGKQG  115



>ref|XP_002518255.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF44141.1| DNA binding protein, putative [Ricinus communis]
Length=213

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 95/113 (84%), Gaps = 3/113 (3%)
 Frame = +2

Query  245  FLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRKKLNERLFALRAVVPKI  424
            FLQ+EELDS+  +   +YYDSSSPDG+ SSAASKNIVSERNRRKKLNERLFALRAVVP I
Sbjct  2    FLQNEELDSWAMDEAFSYYDSSSPDGAASSAASKNIVSERNRRKKLNERLFALRAVVPNI  61

Query  425  SKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKNNNGIFEFDQ  583
            SKMDKASIIKDAI+YIQ+L EQER IQAEI ELESG      KNNN  ++F+Q
Sbjct  62   SKMDKASIIKDAIDYIQDLHEQERRIQAEIMELESGK---LKKNNNLGYDFEQ  111



>ref|XP_008451133.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Cucumis 
melo]
Length=245

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 90/122 (74%), Gaps = 2/122 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAI-SAYYdssspdgsqssaasKNIVSERNR  370
            MENI DEY++YWET  FLQ+EE DS+  +EA   +Y  SS      S  ASKNI+SERNR
Sbjct  1    MENILDEYRYYWETNMFLQTEEFDSWGLDEAFYGSYDSSSPDGTMSSLEASKNILSERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARS  550
            RKKLN+RL ALRAVVP I+KMDKASIIKDAIEYIQELR +E  I+ EI  LESG   + +
Sbjct  61   RKKLNDRLLALRAVVPNITKMDKASIIKDAIEYIQELRSEENRIETEISNLESGKFKSTT  120

Query  551  KN  556
             N
Sbjct  121  SN  122



>ref|XP_010536889.1| PREDICTED: transcription factor bHLH35 isoform X2 [Tarenaya hassleriana]
Length=244

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 104/126 (83%), Gaps = 7/126 (6%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            MENI +EYK+YWET TF Q+EEL  DS+  +EA+S  YDSSSPDG+ SS ASKNI+SERN
Sbjct  1    MENIDEEYKNYWETTTFFQNEELEYDSWPLDEAVSGSYDSSSPDGAASSPASKNILSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RR+KLN+RLFALR+VVP I+KMDKASIIKDAI+YIQEL+++E+ ++ EI ELES     R
Sbjct  61   RRQKLNQRLFALRSVVPNITKMDKASIIKDAIDYIQELQKEEKRLEVEIRELES----IR  116

Query  548  SKNNNG  565
            SK+ N 
Sbjct  117  SKSLNS  122



>ref|XP_010536888.1| PREDICTED: transcription factor bHLH35 isoform X1 [Tarenaya hassleriana]
Length=246

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 104/126 (83%), Gaps = 7/126 (6%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            MENI +EYK+YWET TF Q+EEL  DS+  +EA+S  YDSSSPDG+ SS ASKNI+SERN
Sbjct  1    MENIDEEYKNYWETTTFFQNEELEYDSWPLDEAVSGSYDSSSPDGAASSPASKNILSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RR+KLN+RLFALR+VVP I+KMDKASIIKDAI+YIQEL+++E+ ++ EI ELES     R
Sbjct  61   RRQKLNQRLFALRSVVPNITKMDKASIIKDAIDYIQELQKEEKRLEVEIRELES----IR  116

Query  548  SKNNNG  565
            SK+ N 
Sbjct  117  SKSLNS  122



>ref|XP_008811438.1| PREDICTED: transcription factor bHLH35 [Phoenix dactylifera]
Length=248

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 94/114 (82%), Gaps = 2/114 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY--FEEAISAYYdssspdgsqssaasKNIVSERNR  370
            M+++  EY  YWET+ F +SEELDS    +EA+S YYDSSSP+ + SS A+KNIV ERNR
Sbjct  1    MDDMEAEYNFYWETKRFFESEELDSGWGLDEALSGYYDSSSPENAASSVAAKNIVMERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            R+KLNERL+ALR+VVP I+KMDKASIIKDAI+YIQEL+EQER +QAE+  LE G
Sbjct  61   RRKLNERLYALRSVVPNITKMDKASIIKDAIDYIQELQEQERKMQAEMPALELG  114



>ref|XP_008451126.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Cucumis 
melo]
Length=248

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYF----EEAI-SAYYdssspdgsqssaasKNIVSE  361
            MENI DEY++YWET  FLQ+EE D  F    +EA   +Y  SS      S  ASKNI+SE
Sbjct  1    MENILDEYRYYWETNMFLQTEEFDRNFSWGLDEAFYGSYDSSSPDGTMSSLEASKNILSE  60

Query  362  RNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGG  541
            RNRRKKLN+RL ALRAVVP I+KMDKASIIKDAIEYIQELR +E  I+ EI  LESG   
Sbjct  61   RNRRKKLNDRLLALRAVVPNITKMDKASIIKDAIEYIQELRSEENRIETEISNLESGKFK  120

Query  542  ARSKN  556
            + + N
Sbjct  121  STTSN  125



>ref|XP_010548649.1| PREDICTED: transcription factor bHLH27-like isoform X1 [Tarenaya 
hassleriana]
Length=245

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            MEN GDEYK+YWET  F Q+EEL  DS+ FEEA+S   +SSSPDG+ +S ASKN++SERN
Sbjct  1    MENFGDEYKNYWETTMFFQNEELEYDSWAFEEALSGSGESSSPDGAATSPASKNVLSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RR +LN+RL ALR+VVP ISK+DKAS+I+D+I YI+ELREQE+ ++AEI ELES     R
Sbjct  61   RRHRLNQRLLALRSVVPNISKLDKASVIRDSIAYIEELREQEKRLEAEIRELESLASSYR  120

Query  548  SKNN  559
            +  N
Sbjct  121  NPTN  124



>emb|CDP12676.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +2

Query  230  WETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRKKLNERLFALRA  409
            WE   FLQ++ELDSY +E+ S YYDSSSP+G+QSSAASKNIVSERNRRKKLNERLFALRA
Sbjct  5    WENM-FLQTDELDSYLDESFS-YYDSSSPEGAQSSAASKNIVSERNRRKKLNERLFALRA  62

Query  410  VVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            VVP ISKMDKASIIKDAI+YIQEL  QER+IQAEI ELES
Sbjct  63   VVPNISKMDKASIIKDAIDYIQELHNQERMIQAEISELES  102



>ref|XP_010048564.1| PREDICTED: transcription factor bHLH35 isoform X1 [Eucalyptus 
grandis]
 gb|KCW80844.1| hypothetical protein EUGRSUZ_C02208 [Eucalyptus grandis]
Length=251

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 91/109 (83%), Gaps = 4/109 (4%)
 Frame = +2

Query  257  EELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRKKLNERLFALRAVVPKISKMD  436
            E   S+ +EAIS YYDSSSPDG+ S+AASKNIVSERNRRKKLNERLFALRAVVP ISKMD
Sbjct  30   ENYGSWVDEAISGYYDSSSPDGAASTAASKNIVSERNRRKKLNERLFALRAVVPNISKMD  89

Query  437  KASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKNNNGIFEFDQ  583
            KASIIKDAI+YIQEL +QER IQAEI ELESG    + K  +G ++FDQ
Sbjct  90   KASIIKDAIDYIQELHDQERRIQAEILELESG----KLKKGSGGYDFDQ  134



>ref|XP_011094111.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Sesamum 
indicum]
 ref|XP_011094112.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Sesamum 
indicum]
Length=287

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 105/154 (68%), Gaps = 30/154 (19%)
 Frame = +2

Query  122  NPLPSHFTFTT*LAS*LAYKFQINIMENIGDEYKHYWETQTFLQSEELDSYFEEAISAYY  301
            +P  SHF+    L            ME+  D+Y +YWET  FLQ+EELDSYF+E ISAYY
Sbjct  16   SPFISHFSSQPKLT-----------MEDF-DDYNNYWETGMFLQTEELDSYFDEHISAYY  63

Query  302  ds------------------sspdgsqssaasKNIVSERNRRKKLNERLFALRAVVPKIS  427
            DS                  SSPDG+QSS ASKNI++E+NRRKKLNERL+ALRAVVP IS
Sbjct  64   DSGSNGCSYFDEHISAYYDSSSPDGAQSSLASKNIIAEKNRRKKLNERLYALRAVVPNIS  123

Query  428  KMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            KMDK SI++DAI+YIQ L ++ER IQAEI ELES
Sbjct  124  KMDKISIVRDAIDYIQALHDEERRIQAEISELES  157



>ref|XP_009380730.1| PREDICTED: transcription factor bHLH35-like [Musa acuminata subsp. 
malaccensis]
Length=218

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISA-YYdssspdgsqssaasKNIVSERNR  370
            ME++  EY  YWET+ F+ SEEL+S+ FEEAIS  YYDSSSP+G+ SS  +KNI  ERNR
Sbjct  1    MEDMEAEYSLYWETKRFIDSEELESWGFEEAISGGYYDSSSPEGTTSSTTAKNIAMERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            RKKLNE+L+ALR+VVP I+KMDKASIIKDAI+YI++L+EQE+++ AEI ELES
Sbjct  61   RKKLNEKLYALRSVVPNITKMDKASIIKDAIDYIKQLQEQEKVMLAEISELES  113



>ref|XP_009409750.1| PREDICTED: transcription factor bHLH35 [Musa acuminata subsp. 
malaccensis]
Length=260

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 101/130 (78%), Gaps = 5/130 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISA-YYdssspdgsqssaasKNIVSERNR  370
            M+++  EY HYWET+ F+ +EE +S+ FEEAIS  YYDSSSP+G+ SSA  KNI  ERNR
Sbjct  1    MDDMEAEYSHYWETKRFIDAEEFESWGFEEAISGGYYDSSSPEGTTSSATVKNIAMERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARS  550
            RKKLNE+L+ALR+VVP I+KMDKASIIKDAI+YIQ+L+EQER + AE+ ELE        
Sbjct  61   RKKLNEKLYALRSVVPNITKMDKASIIKDAIDYIQQLQEQERKMMAEMSELEPLR---EE  117

Query  551  KNNNGIFEFD  580
            K + G FE+D
Sbjct  118  KMSMGDFEYD  127



>ref|XP_008453552.1| PREDICTED: transcription factor bHLH35 [Cucumis melo]
Length=278

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 10/130 (8%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            M++IGD+Y +   T  F+  EELDS+  EE +SAYYDSSSPDGS +S   KNIVSERNRR
Sbjct  1    MDSIGDDYLNSLGTDIFI-GEELDSWALEEPLSAYYDSSSPDGSAAS---KNIVSERNRR  56

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            +KLNERLFALR+VVP I+KMDKASIIKDAI+YI +L +QER IQAEI+ELESG      K
Sbjct  57   RKLNERLFALRSVVPNITKMDKASIIKDAIDYIHDLHDQERRIQAEIYELESGT----LK  112

Query  554  NNNGIFEFDQ  583
               G +EFDQ
Sbjct  113  KITG-YEFDQ  121



>ref|XP_010046924.1| PREDICTED: transcription factor bHLH35 isoform X1 [Eucalyptus 
grandis]
 gb|KCW78641.1| hypothetical protein EUGRSUZ_C00105 [Eucalyptus grandis]
Length=258

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSYFEEAISAYYdssspdgsqssaasKNIVSERNR  370
            ME+I +E+++YWET  F QSEEL  +S   E IS +   SSPD +    ASK+I  ERNR
Sbjct  1    MESIDEEFRNYWETLMFFQSEELLHNSCVSEVISRFNGPSSPDAAALPVASKSIDLERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            RKKLNERLFALRA+VPKISKMDKASI+KDAI+YIQ+LREQE  I+AEI ELES
Sbjct  61   RKKLNERLFALRALVPKISKMDKASIVKDAIDYIQDLREQEGKIRAEIAELES  113



>ref|XP_006593510.1| PREDICTED: transcription factor bHLH35-like [Glycine max]
Length=231

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 100/135 (74%), Gaps = 11/135 (8%)
 Frame = +2

Query  197  MENIG-DEYKHYWETQTFLQSEELDSYF---EEAISAYYdsssp--dgsqssaasKNIVS  358
            MENIG D+Y +  ET  F  +E+L S+     EA+S YYDSSSP   G+ SS ASKNIVS
Sbjct  1    MENIGEDQYGYLPETDLFFPNEDLGSWAIMDGEAVSWYYDSSSPDGTGASSSVASKNIVS  60

Query  359  ERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNG  538
            ERNRRKKLN+RL ALRAVVP I+KMDKASIIKDAIEYIQ L EQE+ IQAEI +LES   
Sbjct  61   ERNRRKKLNDRLLALRAVVPNITKMDKASIIKDAIEYIQHLHEQEKRIQAEILDLES---  117

Query  539  GARSKNNNGIFEFDQ  583
              R+K  N  +EFDQ
Sbjct  118  --RNKFKNPTYEFDQ  130



>gb|KHN22657.1| Transcription factor bHLH35 [Glycine soja]
Length=249

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 100/135 (74%), Gaps = 11/135 (8%)
 Frame = +2

Query  197  MENIG-DEYKHYWETQTFLQSEELDSYF---EEAISAYYdsssp--dgsqssaasKNIVS  358
            MENIG D+Y +  ET  F  +E+L S+     EA+S YYDSSSP   G+ SS ASKNIVS
Sbjct  1    MENIGEDQYGYLPETDLFFPNEDLGSWAIMDGEAVSWYYDSSSPDGTGASSSVASKNIVS  60

Query  359  ERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNG  538
            ERNRRKKLN+RL ALRAVVP I+KMDKASIIKDAIEYIQ L EQE+ IQAEI +LES   
Sbjct  61   ERNRRKKLNDRLLALRAVVPNITKMDKASIIKDAIEYIQHLHEQEKRIQAEILDLES---  117

Query  539  GARSKNNNGIFEFDQ  583
              R+K  N  +EFDQ
Sbjct  118  --RNKFKNPTYEFDQ  130



>gb|ACU17597.1| unknown [Glycine max]
Length=220

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 94/136 (69%), Gaps = 12/136 (9%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY--FEEAI-----SAYYdssspdgsqssaasKNIV  355
            MENIG+EY ++ E     Q+E+L S+   +EA           S    G+ SS ASKNIV
Sbjct  1    MENIGEEYGYWPENDMLFQNEDLGSWAIMDEAALSGSGYYDSSSPDGTGASSSVASKNIV  60

Query  356  SERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGN  535
            SERNRRKKLN+RLFALRAVVP I+KMDKASIIKDAIEYIQ L +QE+ IQAEI +LESGN
Sbjct  61   SERNRRKKLNDRLFALRAVVPNITKMDKASIIKDAIEYIQHLHDQEKRIQAEILDLESGN  120

Query  536  GGARSKNNNGIFEFDQ  583
                 K  N  +EFDQ
Sbjct  121  -----KLKNPTYEFDQ  131



>gb|KHN17635.1| Transcription factor bHLH35 [Glycine soja]
Length=248

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 94/136 (69%), Gaps = 12/136 (9%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY--FEEA-----ISAYYdssspdgsqssaasKNIV  355
            MENIG+EY ++ E     Q+E+L S+   +EA           S    G+ SS ASKNIV
Sbjct  1    MENIGEEYGYWPENDMLFQNEDLGSWAIMDEAALSGSGYYDSSSPDGTGASSSVASKNIV  60

Query  356  SERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGN  535
            SERNRRKKLN+RLFALRAVVP I+KMDKASIIKDAIEYIQ L +QE+ IQAEI +LESGN
Sbjct  61   SERNRRKKLNDRLFALRAVVPNITKMDKASIIKDAIEYIQHLHDQEKRIQAEILDLESGN  120

Query  536  GGARSKNNNGIFEFDQ  583
                 K  N  +EFDQ
Sbjct  121  -----KLKNPTYEFDQ  131



>ref|XP_010046925.1| PREDICTED: transcription factor bHLH35 isoform X2 [Eucalyptus 
grandis]
 gb|KCW78642.1| hypothetical protein EUGRSUZ_C00105 [Eucalyptus grandis]
Length=257

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL-DSYFEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            ME+I +E+++YWET  F QSEEL  +   E IS +   SSPD +    ASK+I  ERNRR
Sbjct  1    MESIDEEFRNYWETLMFFQSEELLHNCVSEVISRFNGPSSPDAAALPVASKSIDLERNRR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            KKLNERLFALRA+VPKISKMDKASI+KDAI+YIQ+LREQE  I+AEI ELES
Sbjct  61   KKLNERLFALRALVPKISKMDKASIVKDAIDYIQDLREQEGKIRAEIAELES  112



>emb|CDP19017.1| unnamed protein product [Coffea canephora]
Length=236

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            M +I   YK+YWE   FLQ+E+L SYF+E+ S ++DS+SPDG+QSSAASKNI SER RRK
Sbjct  1    MADIDVAYKYYWENM-FLQTEQLASYFDESFS-FHDSNSPDGAQSSAASKNIESERKRRK  58

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            KL ERL A+RAVVP ISKMDKASIIKDAI+YIQEL  QER+IQAEI ELES
Sbjct  59   KLTERLHAVRAVVPNISKMDKASIIKDAIDYIQELHNQERVIQAEISELES  109



>ref|XP_009120236.1| PREDICTED: transcription factor bHLH35 [Brassica rapa]
 emb|CDY38270.1| BnaA10g11180D [Brassica napus]
Length=246

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 94/114 (82%), Gaps = 3/114 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSE--ELDSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            M+N+  E+ +YWET +FLQ+E  E DS+  EEAIS  YDSSSPDG+ SS ASKNIVSERN
Sbjct  1    MDNVDQEFNNYWETNSFLQNEDFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            RR+KLN+RLFALR+VVP I+KMDKASIIKDAI YIQ L+ +E  ++AEI ELES
Sbjct  61   RRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIQGLQYEESKLEAEIRELES  114



>emb|CDY47924.1| BnaA02g08320D [Brassica napus]
Length=246

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 94/121 (78%), Gaps = 3/121 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSE--ELDSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            MENI  E+ +YWE  +FLQ+E  E DS+  EEAIS  YDSSSPDG+ SS ASKNIVSERN
Sbjct  1    MENIDQEFNNYWEHNSFLQNEDFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RR+KLN+RLFALR+VVP I+KMDKASIIKDAI YIQ L+ +E  ++AEI ELES      
Sbjct  61   RRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIQGLQYEESKLEAEIRELESTPKSCL  120

Query  548  S  550
            S
Sbjct  121  S  121



>ref|XP_009126855.1| PREDICTED: transcription factor bHLH35-like [Brassica rapa]
Length=246

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 94/121 (78%), Gaps = 3/121 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSE--ELDSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            MENI  E+ +YWE  +FLQ+E  E DS+  EEAIS  YDSSSPDG+ SS ASKNIVSERN
Sbjct  1    MENIDQEFNNYWEHNSFLQNEDFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RR+KLN+RLFALR+VVP I+KMDKASIIKDAI YIQ L+ +E  ++AEI ELES      
Sbjct  61   RRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIQGLQYEESKLEAEIRELESTPKSCL  120

Query  548  S  550
            S
Sbjct  121  S  121



>emb|CDY42237.1| BnaC02g11780D [Brassica napus]
Length=242

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 95/121 (79%), Gaps = 3/121 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSE--ELDSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            MENI  E+ +YWE  +FLQ+E  E DS+  EEAIS  YDSSSPDG+ SS ASKNIVSERN
Sbjct  1    MENIDQEFNNYWEHNSFLQNEDFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RR+KLN+RLFALR+VVP I+KMDKASIIKDAI YIQ L+ +E  ++A+I ELES    + 
Sbjct  61   RRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIQGLQNEESKLEAKIRELESTPKSSL  120

Query  548  S  550
            S
Sbjct  121  S  121



>gb|KFK27270.1| hypothetical protein AALP_AA8G360300 [Arabis alpina]
Length=246

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 95/121 (79%), Gaps = 3/121 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSE--ELDSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            ME+I  E+ +YWE  +FLQ+E  E DS+  EEAIS  YDSSSPDG+ SS ASKNIVSERN
Sbjct  1    MEHIDQEFNNYWEPNSFLQNEDFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RR+KLN+RLFALR+VVP I+KMDKASIIKDAI YIQ L+ +E  ++AEI ELES    + 
Sbjct  61   RRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIQGLQYEEGKLEAEIRELESTPKSSL  120

Query  548  S  550
            S
Sbjct  121  S  121



>ref|XP_004146337.1| PREDICTED: transcription factor bHLH35-like [Cucumis sativus]
 ref|XP_004161793.1| PREDICTED: transcription factor bHLH35-like [Cucumis sativus]
 gb|KGN65490.1| hypothetical protein Csa_1G425940 [Cucumis sativus]
Length=241

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 98/130 (75%), Gaps = 10/130 (8%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            M+ IGD+Y + +  + F+  EELDS+  EE  S  YDSSSPDGS +S   KN+ SERNRR
Sbjct  1    MDIIGDDYLNPFGNEIFI-GEELDSWGLEEPFSGDYDSSSPDGSAAS---KNVASERNRR  56

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            +KLNERLFALR+VVP ISKMDKASIIKDAI+YI +L +QER IQAEI+ELESG    + K
Sbjct  57   RKLNERLFALRSVVPNISKMDKASIIKDAIDYIHDLHDQERRIQAEIYELESG----KLK  112

Query  554  NNNGIFEFDQ  583
               G +EFDQ
Sbjct  113  KITG-YEFDQ  121



>ref|XP_009132143.1| PREDICTED: transcription factor bHLH35-like [Brassica rapa]
Length=246

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 3/114 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            M++I  E+ +YWE  +FLQ+EE   DS+  EEAIS  YDSSSPDG+ SS ASKNIV ERN
Sbjct  1    MDDINQEFSNYWEPNSFLQNEEFKYDSWPLEEAISGSYDSSSPDGAASSPASKNIVLERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            RR+KLN+RLFALRAVVP I+KMDKASIIKDAI YIQ L+ +E  ++AEI ELES
Sbjct  61   RRQKLNQRLFALRAVVPNITKMDKASIIKDAISYIQGLQYEETKLEAEIRELES  114



>emb|CDX88610.1| BnaA03g10390D [Brassica napus]
Length=246

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 92/114 (81%), Gaps = 3/114 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            M++I  E+ +YWE  +FLQ+EE   DS+  EEAIS  YDSSSPDG+ SS ASKNIV ERN
Sbjct  1    MDDINQEFSNYWEPNSFLQNEEFKYDSWPLEEAISGSYDSSSPDGAASSPASKNIVLERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            RR+KLN+RLFALRAVVP I+KMDKASIIKDAI YIQ L+ +E  ++AEI ELES
Sbjct  61   RRQKLNQRLFALRAVVPNITKMDKASIIKDAISYIQGLQYEETKLEAEIRELES  114



>ref|XP_010483214.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Camelina 
sativa]
Length=245

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 4/122 (3%)
 Frame = +2

Query  197  MEN-IGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspdgsqssaasKNIVSER  364
            MEN I  E+ +YWE  +FLQ+EE   DS+  EEAIS  YDSSSPDG+ SS ASKNIVSER
Sbjct  1    MENTIDQEFSNYWEPSSFLQNEEFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGA  544
            NRR+KLN+RLFALR+VVP I+KMDKASIIKDAI YIQ L+ +E  ++AEI ELES    +
Sbjct  61   NRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIQGLQYEEGKLEAEIRELESTPKSS  120

Query  545  RS  550
             S
Sbjct  121  LS  122



>ref|XP_010443388.1| PREDICTED: transcription factor bHLH35-like [Camelina sativa]
 ref|XP_010443389.1| PREDICTED: transcription factor bHLH35-like [Camelina sativa]
Length=247

 Score =   119 bits (298),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 4/122 (3%)
 Frame = +2

Query  197  MEN-IGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspdgsqssaasKNIVSER  364
            MEN I  E+ +YWE  +FLQ+EE   DS+  EEAIS  YDSSSPDG+ SS ASKNIVSER
Sbjct  1    MENTIDQEFSNYWEPSSFLQNEEFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGA  544
            NRR+KLN+RLFALR+VVP I+KMDKASIIKDAI YIQ L+ +E  ++AEI ELES    +
Sbjct  61   NRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIQGLQYEEGKLEAEIRELESTPKSS  120

Query  545  RS  550
             S
Sbjct  121  LS  122



>ref|XP_010483213.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Camelina 
sativa]
Length=247

 Score =   119 bits (297),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 4/122 (3%)
 Frame = +2

Query  197  MEN-IGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspdgsqssaasKNIVSER  364
            MEN I  E+ +YWE  +FLQ+EE   DS+  EEAIS  YDSSSPDG+ SS ASKNIVSER
Sbjct  1    MENTIDQEFSNYWEPSSFLQNEEFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGA  544
            NRR+KLN+RLFALR+VVP I+KMDKASIIKDAI YIQ L+ +E  ++AEI ELES    +
Sbjct  61   NRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIQGLQYEEGKLEAEIRELESTPKSS  120

Query  545  RS  550
             S
Sbjct  121  LS  122



>ref|NP_001119080.1| transcription factor bHLH27 [Arabidopsis thaliana]
 gb|AEE85697.1| transcription factor bHLH27 [Arabidopsis thaliana]
Length=184

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++  EYK+YWET  F Q++EL  DS+  EEA S   +SSSPD  + S A+SKN+VSER
Sbjct  1    MEDLDHEYKNYWETTMFFQNQELEFDSWPMEEAFSGSGESSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP ISK+DKAS+IKD+I+Y+QEL +QE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNISKLDKASVIKDSIDYMQELIDQEKTLEAEIRELES  115



>ref|XP_010451830.1| PREDICTED: transcription factor bHLH35 [Camelina sativa]
Length=247

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 4/122 (3%)
 Frame = +2

Query  197  MEN-IGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspdgsqssaasKNIVSER  364
            MEN I  E+ +YWE  +FLQ+EE   DS+  EEAIS  YDSSSPDG+ SS ASKNIVSER
Sbjct  1    MENTIDQEFSNYWEPSSFLQNEEFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGA  544
            NRR+KLN+RLFALR+VVP I+KMDKASIIKDAI YIQ L+ +E  ++AEI ELES    +
Sbjct  61   NRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIQGLQYEEGKLEAEIRELESTPKSS  120

Query  545  RS  550
             S
Sbjct  121  LS  122



>ref|NP_001031752.1| transcription factor bHLH27 [Arabidopsis thaliana]
 dbj|BAD44437.1| bHLH transcription factor (bHLH027) - like protein [Arabidopsis 
thaliana]
 dbj|BAD95372.1| bHLH transcription factor - like protein [Arabidopsis thaliana]
 gb|AEE85695.1| transcription factor bHLH27 [Arabidopsis thaliana]
Length=225

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++  EYK+YWET  F Q++EL  DS+  EEA S   +SSSPD  + S A+SKN+VSER
Sbjct  1    MEDLDHEYKNYWETTMFFQNQELEFDSWPMEEAFSGSGESSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP ISK+DKAS+IKD+I+Y+QEL +QE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNISKLDKASVIKDSIDYMQELIDQEKTLEAEIRELES  115



>ref|XP_011020045.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Populus 
euphratica]
Length=227

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 85/103 (83%), Gaps = 4/103 (4%)
 Frame = +2

Query  275  FEEAISAYYdssspdgsqssaasKNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIK  454
             +EA S YYDSSSPDG+ SSAASKNIVSERNRRK+LNERLFALRAVVP I+KMDKASIIK
Sbjct  10   IDEAFSGYYDSSSPDGAASSAASKNIVSERNRRKRLNERLFALRAVVPNITKMDKASIIK  69

Query  455  DAIEYIQELREQERIIQAEIWELESGNGGARSKNNNGIFEFDQ  583
            DAI+YIQEL EQER IQAEI ELES     + K + G+  F+Q
Sbjct  70   DAIDYIQELHEQERRIQAEILELES----VKLKKDPGLNVFEQ  108



>ref|XP_010539408.1| PREDICTED: transcription factor bHLH35-like [Tarenaya hassleriana]
 ref|XP_010539409.1| PREDICTED: transcription factor bHLH35-like [Tarenaya hassleriana]
 ref|XP_010539410.1| PREDICTED: transcription factor bHLH35-like [Tarenaya hassleriana]
Length=246

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 93/114 (82%), Gaps = 3/114 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDS---YFEEAISAYYdssspdgsqssaasKNIVSERN  367
            MENI +E  +YWE+ TF Q+EEL+      +EA+   YDSSSP+G+ SS ASKNI+SERN
Sbjct  1    MENIDEECNNYWESTTFFQNEELEYNSWPLDEAVYGSYDSSSPEGAASSPASKNILSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            RR+KLN+RLFALR+VVP I+KMDKASII+DAI+YIQEL+++E  ++ E+ ELES
Sbjct  61   RRRKLNQRLFALRSVVPNITKMDKASIIRDAIDYIQELQKEENRLEIEVRELES  114



>ref|NP_194722.2| transcription factor bHLH27 [Arabidopsis thaliana]
 dbj|BAC42379.1| putative bHLH transcription factor bHLH027 [Arabidopsis thaliana]
 gb|AAO64804.1| At4g29930 [Arabidopsis thaliana]
 dbj|BAD43964.1| bHLH transcription factor (bHLH027) - like protein [Arabidopsis 
thaliana]
 dbj|BAD44039.1| bHLH transcription factor (bHLH027) - like protein [Arabidopsis 
thaliana]
 dbj|BAF00155.1| bHLH transcription factor (bHLH027) - like protein [Arabidopsis 
thaliana]
 gb|AEE85694.1| transcription factor bHLH27 [Arabidopsis thaliana]
Length=254

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++  EYK+YWET  F Q++EL  DS+  EEA S   +SSSPD  + S A+SKN+VSER
Sbjct  1    MEDLDHEYKNYWETTMFFQNQELEFDSWPMEEAFSGSGESSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP ISK+DKAS+IKD+I+Y+QEL +QE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNISKLDKASVIKDSIDYMQELIDQEKTLEAEIRELES  115



>ref|XP_010929342.1| PREDICTED: transcription factor bHLH35 isoform X3 [Elaeis guineensis]
Length=234

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 95/156 (61%), Gaps = 45/156 (29%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY----------------------------------  274
            M+++  EY  YWET+ F +SEELD +                                  
Sbjct  1    MDDMEAEYNFYWETKRFFESEELDRFSLSLHSYTIYTILHAFFPRPTPPPFYRSSKQQAI  60

Query  275  -----------FEEAISAYYdssspdgsqssaasKNIVSERNRRKKLNERLFALRAVVPK  421
                        +EA+S YYDSSSP+ + SS A+KNIV ERNRR+KLNERL+ALR+VVP 
Sbjct  61   KLSYCFSCGWGLDEALSGYYDSSSPENAASSTAAKNIVMERNRRRKLNERLYALRSVVPN  120

Query  422  ISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            I+KMDKASIIKDAI+YIQEL+EQER +QAEI ELE+
Sbjct  121  ITKMDKASIIKDAIDYIQELQEQERRMQAEISELET  156



>ref|XP_010436337.1| PREDICTED: transcription factor bHLH27-like, partial [Camelina 
sativa]
Length=170

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++  EYK+YWET  F Q++EL  DS+  EEA S   +SSSPD  + S A+SKN+VSER
Sbjct  1    MEDLEQEYKNYWETTMFFQNQELEFDSWPMEEAFSGSGESSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP I+K+DKAS+IKD+I+Y+QEL EQE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNITKLDKASVIKDSIDYMQELIEQEKKLEAEIRELES  115



>ref|XP_006412786.1| hypothetical protein EUTSA_v10027332mg [Eutrema salsugineum]
 gb|ESQ54239.1| hypothetical protein EUTSA_v10027332mg [Eutrema salsugineum]
Length=250

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++ DEYK+YWET  F Q++EL  DS+  EEA S   ++SSPD  + S  +SKN+VSER
Sbjct  1    MEDLEDEYKNYWETTMFFQNQELEFDSWPLEEAFSGSGETSSPDGAATSPVSSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP I+K+DKAS+IKD+I+Y+QEL +QE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNITKLDKASVIKDSIDYMQELIDQEKRLEAEIRELES  115



>ref|NP_001078471.1| transcription factor bHLH27 [Arabidopsis thaliana]
 sp|Q700E3.1|BH027_ARATH RecName: Full=Transcription factor bHLH27; AltName: Full=Basic 
helix-loop-helix protein 27; Short=AtbHLH27; Short=bHLH 27; 
AltName: Full=Transcription factor EN 42; AltName: Full=bHLH 
transcription factor bHLH027 [Arabidopsis thaliana]
 gb|AAS79544.1| At4g29930 [Arabidopsis thaliana]
 emb|CAG25855.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85696.1| transcription factor bHLH27 [Arabidopsis thaliana]
Length=263

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++  EYK+YWET  F Q++EL  DS+  EEA S   +SSSPD  + S A+SKN+VSER
Sbjct  1    MEDLDHEYKNYWETTMFFQNQELEFDSWPMEEAFSGSGESSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP ISK+DKAS+IKD+I+Y+QEL +QE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNISKLDKASVIKDSIDYMQELIDQEKTLEAEIRELES  115



>ref|NP_568850.1| transcription factor bHLH35 [Arabidopsis thaliana]
 gb|AED96853.1| transcription factor bHLH35 [Arabidopsis thaliana]
Length=247

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 96/122 (79%), Gaps = 4/122 (3%)
 Frame = +2

Query  197  MENIGD-EYKHYWETQTFLQSE--ELDSY-FEEAISAYYdssspdgsqssaasKNIVSER  364
            ME+I D E  +YWE  +FLQ+E  E DS+  EEAIS  YDSSSPDG+ SS ASKNIVSER
Sbjct  1    MEDIVDQELSNYWEPSSFLQNEDFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGA  544
            NRR+KLN+RLFALR+VVP I+KMDKASIIKDAI YI+ L+ +E+ ++AEI ELES    +
Sbjct  61   NRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIEGLQYEEKKLEAEIRELESTPKSS  120

Query  545  RS  550
             S
Sbjct  121  LS  122



>ref|XP_010929340.1| PREDICTED: transcription factor bHLH35 isoform X1 [Elaeis guineensis]
Length=291

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 95/156 (61%), Gaps = 45/156 (29%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY----------------------------------  274
            M+++  EY  YWET+ F +SEELD +                                  
Sbjct  1    MDDMEAEYNFYWETKRFFESEELDRFSLSLHSYTIYTILHAFFPRPTPPPFYRSSKQQAI  60

Query  275  -----------FEEAISAYYdssspdgsqssaasKNIVSERNRRKKLNERLFALRAVVPK  421
                        +EA+S YYDSSSP+ + SS A+KNIV ERNRR+KLNERL+ALR+VVP 
Sbjct  61   KLSYCFSCGWGLDEALSGYYDSSSPENAASSTAAKNIVMERNRRRKLNERLYALRSVVPN  120

Query  422  ISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            I+KMDKASIIKDAI+YIQEL+EQER +QAEI ELE+
Sbjct  121  ITKMDKASIIKDAIDYIQELQEQERRMQAEISELET  156



>emb|CAB43668.1| putative protein [Arabidopsis thaliana]
 emb|CAB79751.1| putative protein [Arabidopsis thaliana]
Length=277

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++  EYK+YWET  F Q++EL  DS+  EEA S   +SSSPD  + S A+SKN+VSER
Sbjct  1    MEDLDHEYKNYWETTMFFQNQELEFDSWPMEEAFSGSGESSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP ISK+DKAS+IKD+I+Y+QEL +QE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNISKLDKASVIKDSIDYMQELIDQEKTLEAEIRELES  115



>ref|XP_006401237.1| hypothetical protein EUTSA_v10014506mg [Eutrema salsugineum]
 gb|ESQ42690.1| hypothetical protein EUTSA_v10014506mg [Eutrema salsugineum]
Length=246

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 93/121 (77%), Gaps = 3/121 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSE--ELDSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            ME+I  E  +YWE  +FL +E  E DS+  EEAIS  YDSSSPDG+ SS ASKNIVSERN
Sbjct  1    MESIEQEINNYWEPSSFLPNEDFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RR+KLN+RLFALR+VVP I+KMDKASIIKDAI YIQ L+ +E  ++AEI ELES    + 
Sbjct  61   RRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIQGLQYEETKLEAEIRELESTPKSSL  120

Query  548  S  550
            S
Sbjct  121  S  121



>gb|KFK34607.1| hypothetical protein AALP_AA5G167500 [Arabis alpina]
Length=265

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++ DEYK+YWET  F  ++EL  DS+  EEA S   +SSSPD  + S A+SKN+VSER
Sbjct  1    MEDLEDEYKNYWETTMFFHNQELEFDSWPLEEAFSGSGESSSPDGTAMSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP I+K+DKAS+IKD+I+Y+QEL EQE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNITKLDKASVIKDSIDYMQELIEQEKRLEAEIKELES  115



>ref|XP_002864502.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40761.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=247

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 96/122 (79%), Gaps = 4/122 (3%)
 Frame = +2

Query  197  MENIGD-EYKHYWETQTFLQSE--ELDSY-FEEAISAYYdssspdgsqssaasKNIVSER  364
            ME+I D E+ +YWE  +FLQ+E  E DS+  EEAIS  YDSSSPDG+ SS ASKNIVSER
Sbjct  1    MEDIVDQEFSNYWEPNSFLQNEDFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGA  544
            NRR+KLN+RLFALR+VVP I+KMDKASIIKDAI YI+ L+ +E  ++AEI ELES    +
Sbjct  61   NRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIKGLQYEEGKLEAEIRELESTPKSS  120

Query  545  RS  550
             S
Sbjct  121  LS  122



>emb|CDY30182.1| BnaA03g49880D [Brassica napus]
Length=244

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++ DEYK+YWET  F Q++EL  DS+  EEA S   DSSSPD  + S A+SKN+VSER
Sbjct  1    MEDLEDEYKNYWETTMFFQNQELEFDSWPLEEAFSGSGDSSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP I+K+DKASI+KD+I+Y+Q+L +QER ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNITKLDKASIVKDSIDYMQKLIDQERRLEAEIRELES  115



>ref|XP_009137878.1| PREDICTED: transcription factor bHLH27 [Brassica rapa]
Length=263

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 95/115 (83%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++ DEYK+YWET  F Q++EL  DS+  EEA S   DSSSPD  + S A+SKN+VSER
Sbjct  1    MEDLEDEYKNYWETTMFFQNQELEFDSWPLEEAFSGSGDSSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP I+K+DKASI+KD+I+Y+Q+L +QER ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNITKLDKASIVKDSIDYMQKLIDQERRLEAEIRELES  115



>ref|XP_006285089.1| hypothetical protein CARUB_v10006422mg [Capsella rubella]
 gb|EOA17987.1| hypothetical protein CARUB_v10006422mg [Capsella rubella]
Length=257

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++  EYK+YWET  F Q++EL  DS+  EEA S   +SSSPD  + S A+SKN+VSER
Sbjct  1    MEDLEHEYKNYWETTMFFQNQELEFDSWPMEEAFSGSGESSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP I+K+DKAS+IKD+I+Y+QEL EQE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNITKLDKASVIKDSIDYMQELIEQEKRLEAEIRELES  115



>ref|XP_010438241.1| PREDICTED: transcription factor bHLH27 [Camelina sativa]
Length=256

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++  EYK+YWET  F Q++EL  DS+  EEA S   +SSSPD  + S A+SKN+VSER
Sbjct  1    MEDLEQEYKNYWETTMFFQNQELEFDSWPMEEAFSGSGESSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP I+K+DKAS+IKD+I+Y+QEL EQE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNITKLDKASVIKDSIDYMQELIEQEKRLEAEIRELES  115



>ref|NP_974947.1| transcription factor bHLH35 [Arabidopsis thaliana]
 gb|AAL24180.1| AT5g57150/MUL3_10 [Arabidopsis thaliana]
 gb|AED96854.1| transcription factor bHLH35 [Arabidopsis thaliana]
Length=219

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 94/123 (76%), Gaps = 5/123 (4%)
 Frame = +2

Query  197  MENIGD-EYKHYWETQTFLQSEELDS----YFEEAISAYYdssspdgsqssaasKNIVSE  361
            ME+I D E  +YWE  +FLQ+E+ +       EEAIS  YDSSSPDG+ SS ASKNIVSE
Sbjct  1    MEDIVDQELSNYWEPSSFLQNEDFEYDRSWPLEEAISGSYDSSSPDGAASSPASKNIVSE  60

Query  362  RNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGG  541
            RNRR+KLN+RLFALR+VVP I+KMDKASIIKDAI YI+ L+ +E+ ++AEI ELES    
Sbjct  61   RNRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIEGLQYEEKKLEAEIRELESTPKS  120

Query  542  ARS  550
            + S
Sbjct  121  SLS  123



>ref|XP_010913730.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Elaeis 
guineensis]
Length=235

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDS--YFEEAISAYYdssspdgsqssaasKNIVSERNR  370
            M+ +  EYK+YWET+TFL++EEL S    +EA+S  +  SS   + SS   K +V ERNR
Sbjct  1    MDAMDCEYKNYWETKTFLEAEELHSSWIIDEAMSQCFSCSSSLAATSSTPPKYLVMERNR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGN  535
            RKK+ E+L+ALR+VVP I+KMD+ASIIKDAI+YIQ+L+EQE+++ +EI ELE  N
Sbjct  61   RKKVQEKLYALRSVVPNITKMDRASIIKDAIDYIQQLQEQEKMLLSEISELELFN  115



>ref|NP_974948.1| transcription factor bHLH35 [Arabidopsis thaliana]
 dbj|BAA97365.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96855.1| transcription factor bHLH35 [Arabidopsis thaliana]
Length=226

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 94/123 (76%), Gaps = 5/123 (4%)
 Frame = +2

Query  197  MENIGD-EYKHYWETQTFLQSEELDS----YFEEAISAYYdssspdgsqssaasKNIVSE  361
            ME+I D E  +YWE  +FLQ+E+ +       EEAIS  YDSSSPDG+ SS ASKNIVSE
Sbjct  1    MEDIVDQELSNYWEPSSFLQNEDFEYDRSWPLEEAISGSYDSSSPDGAASSPASKNIVSE  60

Query  362  RNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGG  541
            RNRR+KLN+RLFALR+VVP I+KMDKASIIKDAI YI+ L+ +E+ ++AEI ELES    
Sbjct  61   RNRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIEGLQYEEKKLEAEIRELESTPKS  120

Query  542  ARS  550
            + S
Sbjct  121  SLS  123



>gb|AAM63723.1| unknown [Arabidopsis thaliana]
Length=247

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 95/122 (78%), Gaps = 4/122 (3%)
 Frame = +2

Query  197  MENIGD-EYKHYWETQTFLQSE--ELDSY-FEEAISAYYdssspdgsqssaasKNIVSER  364
            ME+I D E  +YWE  + LQ+E  E DS+  EEAIS  YDSSSPDG+ SS ASKNIVSER
Sbjct  1    MEDIVDQELSNYWEPSSLLQNEYFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGA  544
            NRR+KLN+RLFALR+VVP I+KMDKASIIKDAI YI+ L+ +E+ ++AEI ELES    +
Sbjct  61   NRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIEGLQYEEKKLEAEIRELESTPKSS  120

Query  545  RS  550
             S
Sbjct  121  LS  122



>ref|XP_010913729.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Elaeis 
guineensis]
Length=236

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 88/116 (76%), Gaps = 3/116 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDS---YFEEAISAYYdssspdgsqssaasKNIVSERN  367
            M+ +  EYK+YWET+TFL++EEL S     +EA+S  +  SS   + SS   K +V ERN
Sbjct  1    MDAMDCEYKNYWETKTFLEAEELHSSSWIIDEAMSQCFSCSSSLAATSSTPPKYLVMERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGN  535
            RRKK+ E+L+ALR+VVP I+KMD+ASIIKDAI+YIQ+L+EQE+++ +EI ELE  N
Sbjct  61   RRKKVQEKLYALRSVVPNITKMDRASIIKDAIDYIQQLQEQEKMLLSEISELELFN  116



>sp|Q2HIV9.1|BH035_ARATH RecName: Full=Transcription factor bHLH35; AltName: Full=Basic 
helix-loop-helix protein 35; Short=AtbHLH35; Short=bHLH 35; 
AltName: Full=Transcription factor EN 41; AltName: Full=bHLH 
transcription factor bHLH035 [Arabidopsis thaliana]
 gb|ABD19653.1| At5g57150 [Arabidopsis thaliana]
Length=248

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 94/123 (76%), Gaps = 5/123 (4%)
 Frame = +2

Query  197  MENIGD-EYKHYWETQTFLQSEELDS----YFEEAISAYYdssspdgsqssaasKNIVSE  361
            ME+I D E  +YWE  +FLQ+E+ +       EEAIS  YDSSSPDG+ SS ASKNIVSE
Sbjct  1    MEDIVDQELSNYWEPSSFLQNEDFEYDRSWPLEEAISGSYDSSSPDGAASSPASKNIVSE  60

Query  362  RNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGG  541
            RNRR+KLN+RLFALR+VVP I+KMDKASIIKDAI YI+ L+ +E+ ++AEI ELES    
Sbjct  61   RNRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIEGLQYEEKKLEAEIRELESTPKS  120

Query  542  ARS  550
            + S
Sbjct  121  SLS  123



>emb|CDY11882.1| BnaC03g13080D [Brassica napus]
Length=246

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 3/114 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            M++I  E+ +YWE  +FLQ++E   DS+  EEAIS  YDSSSPDG+ SS ASKNIV ERN
Sbjct  1    MDDINQEFNNYWEPSSFLQNKEFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVLERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            RR+KLN+RLFALR+VVP I+KMDKASIIKDAI YIQ L+  E  +++EI ELES
Sbjct  61   RRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIQGLQFDETKLESEIRELES  114



>emb|CDY46719.1| BnaC07g42240D [Brassica napus]
Length=264

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 95/115 (83%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++ DEYK+YWET  F Q++EL  DS+  EEA S   DSSSPD  + S A+SKN+VSER
Sbjct  1    MEDLEDEYKNYWETTMFFQNQELEFDSWPLEEAFSGSGDSSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP I+K+DKASI+KD+I+Y+Q+L +QE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNITKLDKASIVKDSIDYMQKLIDQEKRLEAEIQELES  115



>ref|XP_010447790.1| PREDICTED: transcription factor bHLH27-like [Camelina sativa]
Length=258

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 94/115 (82%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            M+++  EYK+YWET  F Q++EL  DS+  EEA S   +SSSPD  + S A+SKN+VSER
Sbjct  1    MDDLEQEYKNYWETTMFFQNQELEFDSWPMEEAFSGSGESSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+RLFALR+VVP I+K+DKAS+IKD+I+Y+QEL EQE+ ++AEI ELES
Sbjct  61   NRRQKLNQRLFALRSVVPNITKLDKASVIKDSIDYMQELIEQEKRLEAEIRELES  115



>ref|XP_010541108.1| PREDICTED: transcription factor bHLH27 isoform X2 [Tarenaya hassleriana]
Length=200

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 6/118 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDS---YFEEAISAYYdssspd---gsqssaasKNIVS  358
            MEN+GDEY +YWET  F ++EEL+     FEEA+S      S        S +ASK +VS
Sbjct  1    MENLGDEYNNYWETTMFFRNEELEYSSWAFEEALSGGSGGLSSPDVGTVTSPSASKTVVS  60

Query  359  ERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            E+NRR++ N+RLFALR+VVPKISK+D+ S+IKD+I YI+EL+EQE+ ++AEI ELES 
Sbjct  61   EKNRRRRFNQRLFALRSVVPKISKLDRTSVIKDSIAYIKELQEQEKKLEAEIRELESS  118



>ref|XP_011017676.1| PREDICTED: transcription factor bHLH35-like [Populus euphratica]
Length=244

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 98/132 (74%), Gaps = 8/132 (6%)
 Frame = +2

Query  197  MENIGD--EYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            ME+  D  EY+ YWE  +   ++EL S+  ++A S YYDSSSPD + S+ ASKN VSERN
Sbjct  1    MESFEDISEYQKYWEMTSMFLNDELKSWAMDQASSQYYDSSSPDEAASAVASKNTVSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RRKKLN++L  LR  VPKISK+DKASIIKDAI+YIQ+L+EQE  +QAEI ELES     R
Sbjct  61   RRKKLNDKLLELRQAVPKISKLDKASIIKDAIDYIQDLQEQETRLQAEIMELES----ER  116

Query  548  SKNNNGIFEFDQ  583
            S+ + G +EF++
Sbjct  117  SEKDKG-YEFER  127



>ref|XP_006372181.1| hypothetical protein POPTR_0018s13830g [Populus trichocarpa]
 gb|ERP49978.1| hypothetical protein POPTR_0018s13830g [Populus trichocarpa]
Length=187

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 98/132 (74%), Gaps = 8/132 (6%)
 Frame = +2

Query  197  MENIGD--EYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            ME+  D  EY++YWE  +   ++EL S+  ++A S YYDSSSPD + S+ ASKN VSERN
Sbjct  1    MESFEDISEYQNYWEMTSMFLNDELKSWAMDQASSHYYDSSSPDEAASAIASKNTVSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RRKKLN++L  LR  VPKISK+DKAS IKDAI+YIQ+L+EQE  +QAEI ELES     R
Sbjct  61   RRKKLNDKLLELRQAVPKISKLDKASTIKDAIDYIQDLQEQETRLQAEIMELES----ER  116

Query  548  SKNNNGIFEFDQ  583
            S+ + G +EF++
Sbjct  117  SEKDKG-YEFER  127



>ref|XP_010667303.1| PREDICTED: transcription factor bHLH35 [Beta vulgaris subsp. 
vulgaris]
Length=269

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 89/116 (77%), Gaps = 6/116 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQ--TFLQSEELDS--YFEEAISAYYdssspdgsqss--aasKNIVS  358
            M+++ DEY  YWE+    + QS+ELD+   FE+ IS+YYD  S     S+   ASKNIVS
Sbjct  1    MDSLIDEYPIYWESDIGMYFQSQELDNSWAFEDTISSYYDYDSSSPDGSASSMASKNIVS  60

Query  359  ERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELE  526
            ERNRRKKLNERLFALRAVVP ISKMDKASIIKDAI YI+EL EQER I+A+I +LE
Sbjct  61   ERNRRKKLNERLFALRAVVPNISKMDKASIIKDAINYIKELHEQERRIKADISDLE  116



>emb|CDX68608.1| BnaC01g08450D [Brassica napus]
Length=263

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 90/115 (78%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++ DEYK+YWET  F Q++EL  DS+  EEA S   +SSSPD  + S   SKN+ SER
Sbjct  1    MEDLDDEYKNYWETTMFFQNQELEFDSWPLEEAFSGSGESSSPDGAATSPVTSKNVASER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
             RR+KLN+RLFALR+VVP ISK+DKAS+I+D+I Y+Q+L +QE+ ++AEI ELES
Sbjct  61   KRREKLNQRLFALRSVVPNISKLDKASVIRDSINYLQDLIDQEKKLEAEIRELES  115



>ref|XP_010541107.1| PREDICTED: transcription factor bHLH27 isoform X1 [Tarenaya hassleriana]
Length=258

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (74%), Gaps = 6/118 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDS---YFEEAISAYYdssspd---gsqssaasKNIVS  358
            MEN+GDEY +YWET  F ++EEL+     FEEA+S      S        S +ASK +VS
Sbjct  1    MENLGDEYNNYWETTMFFRNEELEYSSWAFEEALSGGSGGLSSPDVGTVTSPSASKTVVS  60

Query  359  ERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            E+NRR++ N+RLFALR+VVPKISK+D+ S+IKD+I YI+EL+EQE+ ++AEI ELES 
Sbjct  61   EKNRRRRFNQRLFALRSVVPKISKLDRTSVIKDSIAYIKELQEQEKKLEAEIRELESS  118



>emb|CDP20243.1| unnamed protein product [Coffea canephora]
Length=235

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 89/111 (80%), Gaps = 3/111 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            M+++ D YK YWE    LQ+E+L   F+E+ S +YDSSSPDG+QSSAASKNI SER RR+
Sbjct  1    MDDV-DVYKDYWENM-ILQTEQLGRNFDESFS-FYDSSSPDGAQSSAASKNIESERKRRQ  57

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            KL E L ALRAVVP ISKMDKASIIKDAI YIQEL  QER+IQAEI ELES
Sbjct  58   KLTETLHALRAVVPNISKMDKASIIKDAIGYIQELHNQERMIQAEISELES  108



>ref|NP_001190556.1| transcription factor bHLH35 [Arabidopsis thaliana]
 gb|AED96856.1| transcription factor bHLH35 [Arabidopsis thaliana]
Length=264

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 96/123 (78%), Gaps = 5/123 (4%)
 Frame = +2

Query  197  MENIGD-EYKHYWETQTFLQSEELD---SY-FEEAISAYYdssspdgsqssaasKNIVSE  361
            ME+I D E  +YWE  +FLQ+E+ +   S+  EEAIS  YDSSSPDG+ SS ASKNIVSE
Sbjct  1    MEDIVDQELSNYWEPSSFLQNEDFEYDRSWPLEEAISGSYDSSSPDGAASSPASKNIVSE  60

Query  362  RNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGG  541
            RNRR+KLN+RLFALR+VVP I+KMDKASIIKDAI YI+ L+ +E+ ++AEI ELES    
Sbjct  61   RNRRQKLNQRLFALRSVVPNITKMDKASIIKDAISYIEGLQYEEKKLEAEIRELESTPKS  120

Query  542  ARS  550
            + S
Sbjct  121  SLS  123



>ref|XP_010108742.1| hypothetical protein L484_002994 [Morus notabilis]
 gb|EXC20104.1| hypothetical protein L484_002994 [Morus notabilis]
Length=230

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 77/104 (74%), Gaps = 4/104 (4%)
 Frame = +2

Query  275  FEEAISAYY-dssspdgsqssaasKNIVSERNRRKKLNERLFALRAVVPKISKMDKASII  451
             +EA S YY  SS    + SSAASKNIVSERNRRKKLNERLFALRAVVP ISKMDKASII
Sbjct  7    LDEAFSGYYDSSSPDGAASSSAASKNIVSERNRRKKLNERLFALRAVVPNISKMDKASII  66

Query  452  KDAIEYIQELREQERIIQAEIWELESGNGGARSKNNNGIFEFDQ  583
            KDAI+YIQEL EQER IQAEI +LES       K N G +  D 
Sbjct  67   KDAIDYIQELHEQERRIQAEIMDLESNK---TKKINPGYYHQDH  107



>ref|XP_002324688.1| hypothetical protein POPTR_0018s13830g [Populus trichocarpa]
 gb|EEF03253.1| hypothetical protein POPTR_0018s13830g [Populus trichocarpa]
Length=244

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 98/132 (74%), Gaps = 8/132 (6%)
 Frame = +2

Query  197  MENIGD--EYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            ME+  D  EY++YWE  +   ++EL S+  ++A S YYDSSSPD + S+ ASKN VSERN
Sbjct  1    MESFEDISEYQNYWEMTSMFLNDELKSWAMDQASSHYYDSSSPDEAASAIASKNTVSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RRKKLN++L  LR  VPKISK+DKAS IKDAI+YIQ+L+EQE  +QAEI ELES     R
Sbjct  61   RRKKLNDKLLELRQAVPKISKLDKASTIKDAIDYIQDLQEQETRLQAEIMELES----ER  116

Query  548  SKNNNGIFEFDQ  583
            S+ + G +EF++
Sbjct  117  SEKDKG-YEFER  127



>ref|XP_006372183.1| hypothetical protein POPTR_0018s13840g [Populus trichocarpa]
 gb|ERP49980.1| hypothetical protein POPTR_0018s13840g [Populus trichocarpa]
Length=216

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 100/128 (78%), Gaps = 7/128 (5%)
 Frame = +2

Query  200  ENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            +NI  EY++YWE  +   ++EL S+  ++A S  YDSSSPDG+ S++AS+N VSERNRRK
Sbjct  5    QNIS-EYQNYWEMPSMFWNDELTSWEMDQASSQIYDSSSPDGAASASASRNTVSERNRRK  63

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLN++L+ALR  VP+ISK+DKASIIKDAI+YIQ+L+EQE  +QAEI ELES     RS+ 
Sbjct  64   KLNDKLYALREAVPRISKLDKASIIKDAIDYIQDLQEQETRLQAEIMELES----ERSEK  119

Query  557  NNGIFEFD  580
            + G +EF+
Sbjct  120  DKG-YEFE  126



>emb|CDP21431.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 88/111 (79%), Gaps = 2/111 (2%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            M+++   YK+YWE    LQ+E+L   F+E+ S +YDSSSPDG+QSSAASKNI SER RR+
Sbjct  1    MDDMDVVYKYYWEN-MILQTEQLGRNFDESFS-FYDSSSPDGAQSSAASKNIESERKRRQ  58

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            KL E L ALRAVVP ISKMDKASIIKDAI YIQ+   QER+IQAEI ELES
Sbjct  59   KLTETLHALRAVVPNISKMDKASIIKDAICYIQQFHNQERMIQAEISELES  109



>ref|XP_009128255.1| PREDICTED: transcription factor bHLH27-like isoform X1 [Brassica 
rapa]
Length=267

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 89/119 (75%), Gaps = 8/119 (7%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-----FEEAISAYYdssspd-gsqssaasKNI  352
            ME++  EYK+YWET  F Q++EL  DSY      EEA S   +SSSPD  + S   SKN+
Sbjct  1    MEDLDHEYKNYWETTMFFQNQELEFDSYKFSWPLEEAFSGSGESSSPDGAATSPVTSKNV  60

Query  353  VSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
             SER RR+KLN+RLFALR+VVP ISK+DKASII+D+I Y+Q+L +QE+ ++AEI ELES
Sbjct  61   ASERKRREKLNQRLFALRSVVPNISKLDKASIIRDSINYLQDLIDQEKKLEAEIRELES  119



>ref|XP_002324689.2| hypothetical protein POPTR_0018s13840g [Populus trichocarpa]
 gb|EEF03254.2| hypothetical protein POPTR_0018s13840g [Populus trichocarpa]
Length=244

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 100/128 (78%), Gaps = 7/128 (5%)
 Frame = +2

Query  200  ENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            +NI  EY++YWE  +   ++EL S+  ++A S  YDSSSPDG+ S++AS+N VSERNRRK
Sbjct  5    QNIS-EYQNYWEMPSMFWNDELTSWEMDQASSQIYDSSSPDGAASASASRNTVSERNRRK  63

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKN  556
            KLN++L+ALR  VP+ISK+DKASIIKDAI+YIQ+L+EQE  +QAEI ELES     RS+ 
Sbjct  64   KLNDKLYALREAVPRISKLDKASIIKDAIDYIQDLQEQETRLQAEIMELES----ERSEK  119

Query  557  NNGIFEFD  580
            + G +EF+
Sbjct  120  DKG-YEFE  126



>ref|XP_006372182.1| hypothetical protein POPTR_0018s13830g [Populus trichocarpa]
 gb|ERP49979.1| hypothetical protein POPTR_0018s13830g [Populus trichocarpa]
Length=274

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 98/132 (74%), Gaps = 8/132 (6%)
 Frame = +2

Query  197  MENIGD--EYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            ME+  D  EY++YWE  +   ++EL S+  ++A S YYDSSSPD + S+ ASKN VSERN
Sbjct  1    MESFEDISEYQNYWEMTSMFLNDELKSWAMDQASSHYYDSSSPDEAASAIASKNTVSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGAR  547
            RRKKLN++L  LR  VPKISK+DKAS IKDAI+YIQ+L+EQE  +QAEI ELES     R
Sbjct  61   RRKKLNDKLLELRQAVPKISKLDKASTIKDAIDYIQDLQEQETRLQAEIMELES----ER  116

Query  548  SKNNNGIFEFDQ  583
            S+ + G +EF++
Sbjct  117  SEKDKG-YEFER  127



>ref|XP_009128266.1| PREDICTED: transcription factor bHLH27-like isoform X2 [Brassica 
rapa]
 emb|CDY43542.1| BnaA01g07020D [Brassica napus]
Length=263

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 89/115 (77%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            ME++  EYK+YWET  F Q++EL  DS+  EEA S   +SSSPD  + S   SKN+ SER
Sbjct  1    MEDLDHEYKNYWETTMFFQNQELEFDSWPLEEAFSGSGESSSPDGAATSPVTSKNVASER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
             RR+KLN+RLFALR+VVP ISK+DKASII+D+I Y+Q+L +QE+ ++AEI ELES
Sbjct  61   KRREKLNQRLFALRSVVPNISKLDKASIIRDSINYLQDLIDQEKKLEAEIRELES  115



>ref|XP_002869405.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45664.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=256

 Score =   110 bits (275),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 93/115 (81%), Gaps = 4/115 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspd-gsqssaasKNIVSER  364
            M+++  EYK+YWET  F Q++EL  DS+  EEA S   DSSSPD  + S A+SKN+VSER
Sbjct  1    MDDLDHEYKNYWETTMFFQNQELEFDSWPMEEAFSGSGDSSSPDGAATSPASSKNVVSER  60

Query  365  NRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            NRR+KLN+ LFALR+VVP ISK+DKAS+IKD+I+Y+QEL +QE+ ++AEI ELES
Sbjct  61   NRRQKLNQTLFALRSVVPNISKLDKASVIKDSIDYMQELIDQEKRLEAEIRELES  115



>ref|XP_008781924.1| PREDICTED: uncharacterized protein LOC103701581 [Phoenix dactylifera]
Length=486

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 90/120 (75%), Gaps = 2/120 (2%)
 Frame = +2

Query  170  LAYKFQINIMENIGDEYKHYWETQTFLQSEELDSYFE-EAISAYYdssspdgsqssaasK  346
            LA    +++ E  G EY +YWET+TFL++EEL S+   EA S  Y SSS   + S    K
Sbjct  245  LAAICSMDLTEGEG-EYNNYWETRTFLEAEELRSWITGEASSQCYFSSSSIVATSPTPPK  303

Query  347  NIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELE  526
             +V+E+NRR+KL E+L+ALR+VVP I+KMDKASIIKDAI YIQ+L+EQE+++Q+EI ELE
Sbjct  304  YLVTEKNRREKLKEKLYALRSVVPNITKMDKASIIKDAINYIQQLQEQEKMLQSEISELE  363



>ref|XP_010320974.1| PREDICTED: transcription factor bHLH35 isoform X2 [Solanum lycopersicum]
Length=174

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 93/129 (72%), Gaps = 8/129 (6%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAI-SAYYdssspdgsqssaasKNIVSERNRR  373
            MEN+ +E  +Y ET    Q    DSY +E I S+YYDS+SP+GSQSS   KNIVSER RR
Sbjct  1    MENMVEENNNYLETTILFQQ---DSYLDEPIMSSYYDSTSPEGSQSS---KNIVSERIRR  54

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
             KL E+LFALRA+VPKI+KMDKASI+KDAIEYI +L++Q+R I+ EI +LES      S 
Sbjct  55   NKLKEKLFALRALVPKITKMDKASIVKDAIEYIVKLQKQDRRIRGEISKLESETSNKNST  114

Query  554  N-NNGIFEF  577
            +  +  F+F
Sbjct  115  HLQHETFDF  123



>ref|XP_004239187.1| PREDICTED: transcription factor bHLH35 isoform X1 [Solanum lycopersicum]
Length=231

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 93/129 (72%), Gaps = 8/129 (6%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAI-SAYYdssspdgsqssaasKNIVSERNRR  373
            MEN+ +E  +Y ET    Q    DSY +E I S+YYDS+SP+GSQSS   KNIVSER RR
Sbjct  1    MENMVEENNNYLETTILFQQ---DSYLDEPIMSSYYDSTSPEGSQSS---KNIVSERIRR  54

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
             KL E+LFALRA+VPKI+KMDKASI+KDAIEYI +L++Q+R I+ EI +LES      S 
Sbjct  55   NKLKEKLFALRALVPKITKMDKASIVKDAIEYIVKLQKQDRRIRGEISKLESETSNKNST  114

Query  554  N-NNGIFEF  577
            +  +  F+F
Sbjct  115  HLQHETFDF  123



>gb|KJB53715.1| hypothetical protein B456_009G002200 [Gossypium raimondii]
Length=237

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 81/115 (70%), Gaps = 7/115 (6%)
 Frame = +2

Query  197  MENIGDEY-KHYWETQTFLQSEE----LDSYFEEAISAYYdssspdgsqssaasKNIVSE  361
            MEN+ +EY ++ WE     ++EE    +D  ++   S+         S S + S NI+SE
Sbjct  7    MENVSEEYNQNIWEPNYVFENEEYSWAMDELYDNDCSS--SPDGAPASASLSNSNNILSE  64

Query  362  RNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELE  526
            RNRRKKLN+RLFALRA+VP I+KMDKASIIKDAI+YIQ+L+EQE  +QA+I ELE
Sbjct  65   RNRRKKLNQRLFALRALVPNITKMDKASIIKDAIDYIQQLQEQEATLQADIMELE  119



>gb|KJB53716.1| hypothetical protein B456_009G002200 [Gossypium raimondii]
Length=224

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 81/115 (70%), Gaps = 7/115 (6%)
 Frame = +2

Query  197  MENIGDEY-KHYWETQTFLQSEE----LDSYFEEAISAYYdssspdgsqssaasKNIVSE  361
            MEN+ +EY ++ WE     ++EE    +D  ++   S+         S S + S NI+SE
Sbjct  7    MENVSEEYNQNIWEPNYVFENEEYSWAMDELYDNDCSS--SPDGAPASASLSNSNNILSE  64

Query  362  RNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELE  526
            RNRRKKLN+RLFALRA+VP I+KMDKASIIKDAI+YIQ+L+EQE  +QA+I ELE
Sbjct  65   RNRRKKLNQRLFALRALVPNITKMDKASIIKDAIDYIQQLQEQEATLQADIMELE  119



>ref|XP_002308108.2| hypothetical protein POPTR_0006s07430g [Populus trichocarpa]
 gb|EEE91631.2| hypothetical protein POPTR_0006s07430g [Populus trichocarpa]
Length=261

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 89/117 (76%), Gaps = 5/117 (4%)
 Frame = +2

Query  188  INIMENIGDEYKHYWETQTFLQSEELD---SYFEEAISAYYdssspdgsqssaasKNIVS  358
            ++I+ENIG EY++YWET  F  +EEL+   +  +++   YY SS P+G+ S   +KNI  
Sbjct  1    MDIIENIG-EYQNYWETSLFW-NEELNYSWATNQQSNLGYYASSLPEGTASPIRTKNIAL  58

Query  359  ERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            E N+RK+LN++L ALR  VPKISK+DKASIIKDAI YIQ+L+EQERI+QAEI E ES
Sbjct  59   ETNKRKELNDKLLALREAVPKISKLDKASIIKDAIGYIQDLQEQERILQAEIREHES  115



>ref|XP_006341751.1| PREDICTED: transcription factor bHLH35-like [Solanum tuberosum]
Length=234

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 75/118 (64%), Gaps = 5/118 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSYFEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            MEN+ +E  +Y ET  F Q    DSY +E              + + +SKNIVSER RR 
Sbjct  1    MENMVEENNNYLETTMFFQP---DSYLDEP--IISSYYDSSSPEGAQSSKNIVSERIRRN  55

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARS  550
            KL E+LFALRA VPKI+KMDKASI+KDAI YI+EL+ Q+R IQ EI ELES      S
Sbjct  56   KLKEKLFALRAHVPKITKMDKASIVKDAIAYIEELQNQDRRIQGEISELESETSNKNS  113



>ref|XP_011017678.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Populus 
euphratica]
Length=216

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +2

Query  200  ENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            +NI  E+++YWE  +   ++EL S+   +     YDSSSPDG+ S+ AS+N VSERNRRK
Sbjct  5    QNIS-EHQNYWEMPSMFWNDELTSWEMNQTSCQIYDSSSPDGAASALASRNTVSERNRRK  63

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            KLN++L+ALR  VP+ISK+DKASIIKDAI+YIQ+L++QE  +QAEI ELES
Sbjct  64   KLNDKLYALREAVPRISKLDKASIIKDAIDYIQDLQKQETRLQAEIMELES  114



>ref|XP_011017677.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Populus 
euphratica]
Length=244

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +2

Query  200  ENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRRK  376
            +NI  E+++YWE  +   ++EL S+   +     YDSSSPDG+ S+ AS+N VSERNRRK
Sbjct  5    QNIS-EHQNYWEMPSMFWNDELTSWEMNQTSCQIYDSSSPDGAASALASRNTVSERNRRK  63

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            KLN++L+ALR  VP+ISK+DKASIIKDAI+YIQ+L++QE  +QAEI ELES
Sbjct  64   KLNDKLYALREAVPRISKLDKASIIKDAIDYIQDLQKQETRLQAEIMELES  114



>ref|XP_002324690.2| hypothetical protein POPTR_0018s13850g [Populus trichocarpa]
 gb|EEF03255.2| hypothetical protein POPTR_0018s13850g [Populus trichocarpa]
Length=225

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = +2

Query  215  EYKHYWETQTFLQSEELDSYFE---EAISAYYdssspdgsqssaasKNIVSERNRRKKLN  385
            EY++YWET  F  +E+LD  +E   +    YYDSSS DG+  + ASKNIVSER+RR+KL+
Sbjct  9    EYQNYWETNRFW-NEDLDYSWEMNQQFNVGYYDSSSLDGNTQTIASKNIVSERSRRQKLS  67

Query  386  ERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            ++L ALR  VPKISK+DKAS+IKDAI+YIQ+L+EQER +QA+I ELES
Sbjct  68   DKLLALREAVPKISKLDKASVIKDAIKYIQDLQEQERRLQADIRELES  115



>ref|XP_009407095.1| PREDICTED: transcription factor bHLH35-like [Musa acuminata subsp. 
malaccensis]
Length=241

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 93/130 (72%), Gaps = 5/130 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISA-YYdssspdgsqssaasKNIVSERNR  370
            M ++  EY  Y + + F+ + EL+S+  EE +S  Y +SS P+ + S AA++NI  ER+R
Sbjct  1    MNDMETEYNLYGKIKGFIDANELESWGLEEVMSGGYCESSFPEAATSLAATRNISMERSR  60

Query  371  RKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARS  550
            R+KLNE+L+ALR+VVP I+K+DKASIIKDAI+YIQ+L+EQER + AE+ +LES       
Sbjct  61   RRKLNEKLYALRSVVPNITKLDKASIIKDAIDYIQQLQEQERTVLAELSQLESLR---EK  117

Query  551  KNNNGIFEFD  580
            K + G  EFD
Sbjct  118  KASLGELEFD  127



>ref|NP_001291248.1| transcription factor bHLH35-like [Populus euphratica]
 gb|AIG53906.1| bHLH35 protein [Populus euphratica]
Length=247

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = +2

Query  215  EYKHYWETQTFLQSEELDSYFE---EAISAYYdssspdgsqssaasKNIVSERNRRKKLN  385
            EY++YWET  F  +E+LD  +E   +    YYDSSSPDG+  + ASKNIVSER+RR+KL+
Sbjct  9    EYQNYWETNRFW-NEDLDYSWEMNQQFNVGYYDSSSPDGNTQTIASKNIVSERSRRQKLS  67

Query  386  ERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            ++L ALR  VPKISK+DKAS+IKDAI+YIQ+L+EQER +QA+I ELES
Sbjct  68   DKLLALREAVPKISKLDKASVIKDAIKYIQDLQEQERRLQADIRELES  115



>ref|XP_008451140.1| PREDICTED: transcription factor bHLH35-like isoform X3 [Cucumis 
melo]
Length=244

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KNI+SERNRRKKLN+RL ALRAVVP I+KMDKASIIKDAIEYIQELR +E  I+ EI  L
Sbjct  51   KNILSERNRRKKLNDRLLALRAVVPNITKMDKASIIKDAIEYIQELRSEENRIETEISNL  110

Query  524  ESG  532
            ESG
Sbjct  111  ESG  113



>gb|AFW57244.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=258

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 90/146 (62%), Gaps = 30/146 (21%)
 Frame = +2

Query  206  IGDEYKHYWETQTFLQSEELDSYF---EEAISAYYdssspdgsq----------------  328
            +GD +++YWE Q +L+SEEL  Y    ++A+S Y  SS                      
Sbjct  3    MGDSFEYYWEMQQYLESEELSLYMGTQDDALSCYDSSSPDGSISNSSWAPAGVAATASEK  62

Query  329  ------ssaasKNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQ  490
                  ++AA+KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYI++L+ +
Sbjct  63   REGPGGAAAANKNILMERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIEQLQAE  122

Query  491  E-RIIQAEIWELESGNGGARSKNNNG  565
            E R +QA    LE+G G     + +G
Sbjct  123  ERRALQA----LEAGEGARCGGHGHG  144



>gb|ABK92754.1| unknown [Populus trichocarpa]
Length=215

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 83/102 (81%), Gaps = 5/102 (5%)
 Frame = +2

Query  275  FEEAISAYYdssspdgsqssaasKNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIK  454
             ++A S  YDSSSPDG+ S++AS+N VSERNRRKKLN++L+ALR  VP+ISK+DKASIIK
Sbjct  1    MDQASSQIYDSSSPDGAASASASRNTVSERNRRKKLNDKLYALREAVPRISKLDKASIIK  60

Query  455  DAIEYIQELREQERIIQAEIWELESGNGGARSKNNNGIFEFD  580
            DAI+YIQ+L+EQE  +QAEI ELES     RS+ + G +EF+
Sbjct  61   DAIDYIQDLQEQETRLQAEIMELES----ERSEKDKG-YEFE  97



>gb|AIB05458.1| bHLH transcription factor, partial [Zea mays]
Length=258

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 90/146 (62%), Gaps = 30/146 (21%)
 Frame = +2

Query  206  IGDEYKHYWETQTFLQSEELDSYF---EEAISAYYdssspdgsq----------------  328
            +GD +++YWE Q +L+SEEL  Y    ++A+S Y  SS                      
Sbjct  3    MGDSFEYYWEMQQYLESEELSLYMGTQDDALSCYDSSSPDGSISNSSWAPAGVAATASEK  62

Query  329  ------ssaasKNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQ  490
                  ++AA+KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYI++L+ +
Sbjct  63   REGPGGAAAANKNILMERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIEQLQAE  122

Query  491  E-RIIQAEIWELESGNGGARSKNNNG  565
            E R +QA    LE+G G     + +G
Sbjct  123  ERRALQA----LEAGEGARCGGHEHG  144



>ref|XP_002308107.2| hypothetical protein POPTR_0006s07420g [Populus trichocarpa]
 gb|EEE91630.2| hypothetical protein POPTR_0006s07420g [Populus trichocarpa]
Length=248

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 98/137 (72%), Gaps = 12/137 (9%)
 Frame = +2

Query  188  INIMENIGDEYKHYWETQTFLQSEELDSYFEEAISAYY-----dssspdgsqssaasKNI  352
            + I+E+IG E ++ WET  F  +EEL+     A +  +     DSS+ DG+ S+  SKNI
Sbjct  1    MEIIEHIG-ECENSWETNWFW-NEELNFRHSWATNQQFNLGSNDSSATDGTTSTIFSKNI  58

Query  353  VSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            VSER+RRKKL+++L ALR  VPKISKMDKASIIKDAI+YIQ+L+EQE+ +QAEI ELES 
Sbjct  59   VSERSRRKKLSDKLLALREAVPKISKMDKASIIKDAIDYIQDLQEQEKGLQAEIMELESN  118

Query  533  NGGARSKNNNGIFEFDQ  583
                R K + G ++FDQ
Sbjct  119  ----RLKEDLG-YDFDQ  130



>ref|XP_004975234.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Setaria 
italica]
Length=274

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 88/149 (59%), Gaps = 28/149 (19%)
 Frame = +2

Query  206  IGDEYKHYWE-TQTFLQSEELDSYFE---EAISAYYdssspdgsqssaas----------  343
            +GD    YWE TQ +L+ EEL  Y E   +A+S Y  SS    + S ++S          
Sbjct  5    MGD---SYWEETQRYLEYEELSIYLEAQEDAMSCYDSSSPDGSNNSHSSSAPAGDKGASG  61

Query  344  ---------KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQER  496
                     KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYIQ+L+ +ER
Sbjct  62   GGRAAAGGNKNIIVERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIQQLQAEER  121

Query  497  IIQAEIWELESGNGGARSKNNNGIFEFDQ  583
             +  E+   ES  GGA        FE D+
Sbjct  122  QVLQEVRAFESAGGGAPPPEEG--FEHDE  148



>ref|XP_004975236.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Setaria 
italica]
Length=277

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 84/137 (61%), Gaps = 26/137 (19%)
 Frame = +2

Query  206  IGDEYKHYWETQTFLQSEELDSYF---EEAISAYYdssspdgsqssa-------------  337
            +GD +++YWE Q  ++SEEL  Y    ++A+S Y  SS      +S+             
Sbjct  3    MGDSFEYYWEMQRLIESEELSMYLGAQDDALSCYDSSSPDGSMSNSSWAPAVTVTAADDD  62

Query  338  ----------asKNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELRE  487
                      A+KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYI++L+ 
Sbjct  63   KAAGGAGAAGANKNIIMERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIEQLQA  122

Query  488  QERIIQAEIWELESGNG  538
            +ER +  E+  LE   G
Sbjct  123  EERRMLQEVRALEPAGG  139



>gb|EMT28703.1| hypothetical protein F775_52582 [Aegilops tauschii]
Length=296

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 92/167 (55%), Gaps = 42/167 (25%)
 Frame = +2

Query  203  NIGDEYKHYWETQTFLQSEEL-DSYF----EEAISAY-----------------Ydsssp  316
            ++G+ + +YWETQ +L+SEEL DS F    E+AIS Y                       
Sbjct  4    DMGENFAYYWETQRYLESEELVDSIFVGATEDAISYYDSSSPDGSHSSSTPMGAAMPGVG  63

Query  317  dgsqssaasKNIVSERNRRKKLNERLFALRAVVPKISK------------------MDKA  442
             G   + A+KNI+ ER+RR+KLNE+L+ LR+VVP I+K                  MDKA
Sbjct  64   MGMGGTGANKNILMERDRRRKLNEKLYTLRSVVPNITKVSARISAGILPARPSAWQMDKA  123

Query  443  SIIKDAIEYIQELREQERIIQAEIWELESGNGGARSKNNNGIFEFDQ  583
            SIIKDAIEYIQ+L+ +ER ++AE+  LES  G     + +G    DQ
Sbjct  124  SIIKDAIEYIQQLQAEERQMEAEVSALESATGA--EDDCDGGLSVDQ  168



>ref|XP_002309008.1| hypothetical protein POPTR_0006s07410g [Populus trichocarpa]
 gb|EEE92531.1| hypothetical protein POPTR_0006s07410g [Populus trichocarpa]
Length=283

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 86/130 (66%), Gaps = 7/130 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            +ENI  + ++Y E      ++EL S+   +A +  Y+ SS     +S ASK IVSER RR
Sbjct  4    IENIAAD-QNYCEMTKMFSNDELKSWTMHQAFTQSYEYSSSPEGATSTASKTIVSERKRR  62

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            KKLN++L  LR  VPKISK+DKAS +KDAI YIQ+L+EQER +QAEI ELES     +S 
Sbjct  63   KKLNDKLLELRGAVPKISKLDKASTLKDAIVYIQDLQEQERRLQAEIMELES-----KSL  117

Query  554  NNNGIFEFDQ  583
              +  F+F+Q
Sbjct  118  KKDPGFDFEQ  127



>ref|XP_004975237.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Setaria 
italica]
Length=255

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 85/138 (62%), Gaps = 27/138 (20%)
 Frame = +2

Query  206  IGDEYKHYWETQTFLQSEELDSYF----EEAISAYYdssspdgsqssa------------  337
            +GD +++YWE Q  ++SEEL S +    ++A+S Y  SS      +S+            
Sbjct  3    MGDSFEYYWEMQRLIESEELSSMYLGAQDDALSCYDSSSPDGSMSNSSWAPAVTVTAADD  62

Query  338  -----------asKNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELR  484
                       A+KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYI++L+
Sbjct  63   DKAAGGAGAAGANKNIIMERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIEQLQ  122

Query  485  EQERIIQAEIWELESGNG  538
             +ER +  E+  LE   G
Sbjct  123  AEERRMLQEVRALEPAGG  140



>ref|XP_010667302.1| PREDICTED: transcription factor bHLH35-like [Beta vulgaris subsp. 
vulgaris]
Length=250

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 79/130 (61%), Gaps = 12/130 (9%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdg------sqssaasKNIV  355
            M+   +EY+ YW+   ++Q++EL S+  ++ IS    +           S +   + NI 
Sbjct  1    MDTFSEEYQLYWDINKYIQNDELASWELDDDISICNTNHLNLANGGAEKSMTCDDNSNIA  60

Query  356  SERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGN  535
            +ER RRKKLN+RL ALRAVVP I+KMDKAS IKDAI YI EL+EQER I+ +I      N
Sbjct  61   AERCRRKKLNDRLLALRAVVPNITKMDKASTIKDAISYIHELQEQERRIKEDI-----AN  115

Query  536  GGARSKNNNG  565
               R  NNNG
Sbjct  116  FDRRRCNNNG  125



>ref|NP_001151185.1| DNA binding like [Zea mays]
 gb|ACG41902.1| DNA binding like [Zea mays]
Length=261

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 89/146 (61%), Gaps = 30/146 (21%)
 Frame = +2

Query  206  IGDEYKHYWETQTFLQSEELDSYF---EEAISAYYdssspdgsq----------------  328
            +GD +++YWE Q +L+SEEL  Y    ++A+S Y  SS                      
Sbjct  3    MGDSFEYYWEMQQYLESEELSLYMGTQDDALSCYDSSSPDGSISNSSWAPAGVAATASEK  62

Query  329  ------ssaasKNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELR-E  487
                  ++AA+KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYI++L+ E
Sbjct  63   REGPGGAAAANKNILMERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIEQLQAE  122

Query  488  QERIIQAEIWELESGNGGARSKNNNG  565
            + R +QA    L +G G     + +G
Sbjct  123  ERRALQA----LXAGEGARCGGHGHG  144



>ref|XP_003579501.1| PREDICTED: transcription factor bHLH35-like [Brachypodium distachyon]
Length=270

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 81/126 (64%), Gaps = 24/126 (19%)
 Frame = +2

Query  203  NIGDEYKHYWETQTFLQSEEL-DSYF----EEAISAY-------------------Ydss  310
            ++GD + +YWETQ +L+SEEL DS      E+A+S Y                       
Sbjct  4    DMGDSFAYYWETQRYLESEELVDSILAGATEDAMSYYDSSSPDGSHSSSAPAGAATMAPG  63

Query  311  spdgsqssaasKNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQ  490
            +   + +  A+KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYIQ+L+ +
Sbjct  64   AGTATGTGGANKNILMERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIQKLQAE  123

Query  491  ERIIQA  508
            ER + A
Sbjct  124  ERRMAA  129



>emb|CDM80372.1| unnamed protein product [Triticum aestivum]
Length=265

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 84/122 (69%), Gaps = 3/122 (2%)
 Frame = +2

Query  182  FQINIMENIGDEYKHYWETQTFLQSEELDS-YFEEAISAYYdssspdgsqssaasKNIVS  358
             + +++ ++GD    Y   +  L    LDS  + +  S+   ++S   + S+ ASKNIV 
Sbjct  14   LEAHLVFDLGDADSSYLPAEDSLSG--LDSSCYNDPTSSPDGATSSRSTASTRASKNIVE  71

Query  359  ERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNG  538
            ER+RR++LNE+L+A+R VVP I+KMDKASII+DA+ YI+EL+EQER I AE+ +LE+G+ 
Sbjct  72   ERDRRRRLNEKLYAIRGVVPNITKMDKASIIQDAVAYIEELQEQERRILAEVSDLEAGSC  131

Query  539  GA  544
             A
Sbjct  132  TA  133



>ref|XP_004975235.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Setaria 
italica]
Length=242

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYIQ+L+ +ER +  E+   
Sbjct  39   KNIIVERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIQQLQAEERQVLQEVRAF  98

Query  524  ESGNGGARSKNNNGIFEFDQ  583
            ES  GGA        FE D+
Sbjct  99   ESAGGGAPPPEEG--FEHDE  116



>gb|EMS67977.1| Transcription factor bHLH35 [Triticum urartu]
Length=255

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 83/124 (67%), Gaps = 5/124 (4%)
 Frame = +2

Query  182  FQINIMENIGDEYKHYWETQTFLQSEELDSYFEEAISA---YYdssspdgsqssaasKNI  352
             + +++ ++GD    Y   +  L    LDS + ++  +      S S   ++++ ASKNI
Sbjct  14   LEAHLVFDLGDADSSYLPAEDSLSG--LDSCYNDSTGSPDGATSSRSTASTRATRASKNI  71

Query  353  VSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESG  532
            V ER+RR++LNE+L+A+R VVP I+KMDKASII+DA+ YI+EL+EQER I AE+ +LE+G
Sbjct  72   VEERDRRRRLNEKLYAIRGVVPNITKMDKASIIQDAVAYIEELQEQERRILAEVSDLEAG  131

Query  533  NGGA  544
               A
Sbjct  132  GCTA  135



>ref|XP_009418562.1| PREDICTED: transcription factor bHLH35-like isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=259

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            M+    EY +YWE +  L +EEL S  F+E +S Y +SSSPD +  SA    I+ ER RR
Sbjct  1    MDADPSEYANYWEIKCLLDAEELCSLGFDETLSGYCNSSSPDMAAHSALPNTIIMERERR  60

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            KKLN +L+ LR+VVP ++K  KASII DAI YIQ+L+EQER +  EI E ES
Sbjct  61   KKLNRKLYNLRSVVPNMTKTSKASIIFDAINYIQQLQEQERSLLKEISEQES  112



>ref|XP_011020047.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Populus 
euphratica]
Length=247

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 85/130 (65%), Gaps = 7/130 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            +ENI  + ++Y E      ++EL S+  ++A    Y+ SS      S ASK IVSER RR
Sbjct  4    IENIAAD-QNYCEMAKMFSNDELKSWTMDQASILSYEYSSSPEGGDSTASKAIVSERKRR  62

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            +KLN++L  LR  VPKISK+DKAS +KDAI YIQ+L+EQER +QAEI ELES     +S 
Sbjct  63   RKLNDKLLELRGAVPKISKLDKASTLKDAIVYIQDLQEQERRLQAEIMELES-----KSL  117

Query  554  NNNGIFEFDQ  583
              +  F+F+Q
Sbjct  118  KKDPGFDFEQ  127



>ref|XP_011020048.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Populus 
euphratica]
Length=224

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 85/130 (65%), Gaps = 7/130 (5%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            +ENI  + ++Y E      ++EL S+  ++A    Y+ SS      S ASK IVSER RR
Sbjct  4    IENIAAD-QNYCEMAKMFSNDELKSWTMDQASILSYEYSSSPEGGDSTASKAIVSERKRR  62

Query  374  KKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNGGARSK  553
            +KLN++L  LR  VPKISK+DKAS +KDAI YIQ+L+EQER +QAEI ELES     +S 
Sbjct  63   RKLNDKLLELRGAVPKISKLDKASTLKDAIVYIQDLQEQERRLQAEIMELES-----KSL  117

Query  554  NNNGIFEFDQ  583
              +  F+F+Q
Sbjct  118  KKDPGFDFEQ  127



>ref|XP_006845790.1| hypothetical protein AMTR_s00019p00254380 [Amborella trichopoda]
 gb|ERN07465.1| hypothetical protein AMTR_s00019p00254380 [Amborella trichopoda]
Length=248

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KNIVSER RRKKLN+RL+ LR+VVP ISKMDKASIIKDAI YIQ L++QER I AEI +L
Sbjct  81   KNIVSERVRRKKLNDRLYQLRSVVPIISKMDKASIIKDAIAYIQSLQQQEREILAEISQL  140

Query  524  ES  529
            ES
Sbjct  141  ES  142



>ref|XP_002445107.1| hypothetical protein SORBIDRAFT_07g004190 [Sorghum bicolor]
 gb|EES14602.1| hypothetical protein SORBIDRAFT_07g004190 [Sorghum bicolor]
Length=288

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 82/138 (59%), Gaps = 35/138 (25%)
 Frame = +2

Query  206  IGDEYKHYWETQTFLQSEELDSYF---EEAISAYYdssspdgsqssaa------------  340
            +GD +++YWETQ +L+SEEL  Y    ++A+S Y  SS      ++++            
Sbjct  3    MGDSFEYYWETQQYLESEELSIYLGTQDDALSCYDSSSPDGSISNNSSWAAPAGTVATAA  62

Query  341  --------------------sKNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDA  460
                                +KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDA
Sbjct  63   AGKEEEGPGGAGGGGAVAAANKNIIMERDRRRKLNEKLYALRSVVPNITKMDKASIIKDA  122

Query  461  IEYIQELREQERIIQAEI  514
            IEYI+ L+ +ER +  E+
Sbjct  123  IEYIEALQAEERRMLQEV  140



>gb|EYU38740.1| hypothetical protein MIMGU_mgv1a022559mg [Erythranthe guttata]
Length=227

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 6/87 (7%)
 Frame = +2

Query  269  SYFEEAISAYYdssspdgsqssaasKNIVSERNRRKKLNERLFALRAVVPKISKMDKASI  448
            SYFE      Y+SSSP+G+  S+ASKNI SER RRKKLNE L+ALR+VVP I+KMDKAS 
Sbjct  8    SYFE------YESSSPEGTHVSSASKNIASERKRRKKLNETLYALRSVVPNITKMDKAST  61

Query  449  IKDAIEYIQELREQERIIQAEIWELES  529
            ++DAIEYI+ L+++ERIIQ++I E+ES
Sbjct  62   VRDAIEYIKLLQDEERIIQSQISEMES  88



>ref|NP_001147498.1| DNA binding like [Zea mays]
 gb|ACG27738.1| DNA binding like [Zea mays]
Length=264

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 76/109 (70%), Gaps = 10/109 (9%)
 Frame = +2

Query  227  YWE-TQTFLQSEELDSYFE---EAISAYYdsss------pdgsqssaasKNIVSERNRRK  376
            YWE TQ +L+ EEL  Y E   +A+S Y  SS          S ++  +KNI+ ER+RR+
Sbjct  4    YWEETQRYLEYEELSIYLEAQEDAMSCYDSSSPDGSISHSSSSAAACGNKNILMERDRRR  63

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KLN++L+ALR+VVP I+KMDKASIIKDAIEYIQ+L+ +ER +  E+  L
Sbjct  64   KLNDKLYALRSVVPNITKMDKASIIKDAIEYIQQLQAEERRVLQELRVL  112



>ref|XP_008661887.1| PREDICTED: DNA binding like isoform X1 [Zea mays]
Length=340

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 75/106 (71%), Gaps = 10/106 (9%)
 Frame = +2

Query  227  YWE-TQTFLQSEELDSYFE---EAISAYYdsss------pdgsqssaasKNIVSERNRRK  376
            YWE TQ +L+ EEL  Y E   +A+S Y  SS          S ++  +KNI+ ER+RR+
Sbjct  4    YWEETQRYLEYEELSIYLEAQEDAMSCYDSSSPDGSISHSSSSAAACGNKNILMERDRRR  63

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KLN++L+ALR+VVP I+KMDKASIIKDAIEYIQ+L+ +ER +  E+
Sbjct  64   KLNDKLYALRSVVPNITKMDKASIIKDAIEYIQQLQVEERRVLQEL  109



>dbj|BAJ91059.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KNI+ ER+RR++LNE+L+ LR VVP ISKMDKASII+DAI YI+ L+EQER + AEI +L
Sbjct  77   KNIIMERDRRRRLNEKLYNLRGVVPNISKMDKASIIQDAIAYIEALQEQERQLLAEISDL  136

Query  524  ESGNGGA  544
            E+ N  A
Sbjct  137  ETHNCTA  143



>gb|ACN33600.1| unknown [Zea mays]
 gb|AFW57968.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05517.1| bHLH transcription factor, partial [Zea mays]
Length=262

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 76/109 (70%), Gaps = 10/109 (9%)
 Frame = +2

Query  227  YWE-TQTFLQSEELDSYFE---EAISAYYdsss------pdgsqssaasKNIVSERNRRK  376
            YWE TQ +L+ EEL  Y E   +A+S Y  SS          S ++  +KNI+ ER+RR+
Sbjct  4    YWEETQRYLEYEELSIYLEAQEDAMSCYDSSSPDGSISHSSSSAAACGNKNILMERDRRR  63

Query  377  KLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KLN++L+ALR+VVP I+KMDKASIIKDAIEYIQ+L+ +ER +  E+  L
Sbjct  64   KLNDKLYALRSVVPNITKMDKASIIKDAIEYIQQLQVEERRVLQELRVL  112



>ref|XP_010548650.1| PREDICTED: transcription factor bHLH27-like isoform X2 [Tarenaya 
hassleriana]
Length=169

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 82/113 (73%), Gaps = 5/113 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEEL--DSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            MEN GDEYK+YWET  F Q+EEL  DS+ FEEA+S   +SSSPDG+ +S ASKN++SERN
Sbjct  1    MENFGDEYKNYWETTMFFQNEELEYDSWAFEEALSGSGESSSPDGAATSPASKNVLSERN  60

Query  368  RRKKLNERLFALRAVVPKISKMDKASII-KDAIEYIQELREQERIIQ-AEIWE  520
            RR +LN+RL ALR+VVP ISK+    +  K  +  I   ++++ +++  E++E
Sbjct  61   RRHRLNQRLLALRSVVPNISKLKVTCMGEKTGVVCITCSKKRDTMVRLCEVFE  113



>gb|EMT06747.1| Transcription factor bHLH35 [Aegilops tauschii]
Length=248

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 80/131 (61%), Gaps = 20/131 (15%)
 Frame = +2

Query  230  WETQTFLQSEEL-----DSYF---EEAISAYYdss------------spdgsqssaasKN  349
            WET  F +++ L     DS +   E+++S  Y               S   ++++ ASKN
Sbjct  13   WETPNFFEAQVLELGVVDSMYLPAEDSLSGLYSCYDDSSSPDGASSWSSAMTRATRASKN  72

Query  350  IVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            I+ ER+RR++LNE+L+ LR VVP I+KMDKASII+DAI YI+ L+EQER + AEI +LE 
Sbjct  73   IIMERDRRRRLNEKLYNLRGVVPNITKMDKASIIQDAIAYIEALQEQERQLLAEISDLEP  132

Query  530  GNGGARSKNNN  562
             N  A  K  +
Sbjct  133  DNCTAAVKTED  143



>ref|XP_004165347.1| PREDICTED: transcription factor bHLH35-like, partial [Cucumis 
sativus]
Length=80

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAI-SAYYdssspdgsqssaasKNIVSERNR  370
            MENI DEY +YWET  FLQ+E+LDS+  +EA   +Y  SS       S ASKNI+SERNR
Sbjct  1    MENILDEYGYYWETNMFLQTEDLDSWGLDEAFYGSYDSSSPDGTLSLSEASKNILSERNR  60

Query  371  RKKLNERLFALRAVVPKISK  430
            RKKLN+RL ALRAVVP I+K
Sbjct  61   RKKLNDRLLALRAVVPNITK  80



>ref|XP_011020357.1| PREDICTED: transcription factor bHLH35-like [Populus euphratica]
Length=191

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  359  ERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELES  529
            +RN RKKL+++L ALR  VPKISK+DKASIIKDAIEYIQ+L+EQERI+QAEI E ES
Sbjct  6    QRNGRKKLSDKLLALREAVPKISKLDKASIIKDAIEYIQDLQEQERILQAEIREHES  62



>ref|XP_004975232.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Setaria 
italica]
Length=312

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            K++V ER+RR++LNE+L+ALR+VVP I+KMDKASI++DAI YIQ+L+E+ER + AE+  L
Sbjct  86   KSMVMERHRRRRLNEKLYALRSVVPNITKMDKASIVRDAIAYIQQLQEEERRVLAEVSAL  145

Query  524  ESGNGGA  544
            ES +  A
Sbjct  146  ESSSDTA  152



>ref|XP_004975233.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Setaria 
italica]
Length=293

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            K++V ER+RR++LNE+L+ALR+VVP I+KMDKASI++DAI YIQ+L+E+ER + AE+  L
Sbjct  86   KSMVMERHRRRRLNEKLYALRSVVPNITKMDKASIVRDAIAYIQQLQEEERRVLAEVSAL  145

Query  524  ESGNGGA  544
            ES +  A
Sbjct  146  ESSSDTA  152



>ref|XP_002973583.1| hypothetical protein SELMODRAFT_16039, partial [Selaginella moellendorffii]
 gb|EFJ25243.1| hypothetical protein SELMODRAFT_16039, partial [Selaginella moellendorffii]
Length=169

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+VSER RRKKLNERL++LRA+VPKISKMDKASI+ DAI+Y+QEL+ + + +Q ++  L
Sbjct  7    KNLVSERKRRKKLNERLYSLRAIVPKISKMDKASIVADAIDYVQELQGKVQELQEDVSSL  66

Query  524  ESG  532
            E+ 
Sbjct  67   EAA  69



>ref|XP_002975607.1| hypothetical protein SELMODRAFT_16038, partial [Selaginella moellendorffii]
 gb|EFJ23236.1| hypothetical protein SELMODRAFT_16038, partial [Selaginella moellendorffii]
Length=169

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+VSER RRKKLNERL++LRA+VPKISKMDKASI+ DAI+Y+QEL+ + + +Q ++  L
Sbjct  7    KNLVSERKRRKKLNERLYSLRAIVPKISKMDKASIVADAIDYVQELQGKVQELQEDVSSL  66

Query  524  ESG  532
            E+ 
Sbjct  67   EAA  69



>emb|CDY52739.1| BnaC09g53390D [Brassica napus]
Length=80

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 3/80 (4%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSE--ELDSY-FEEAISAYYdssspdgsqssaasKNIVSERN  367
            M+N+  E+ +YWET +FLQ+E  E DS+  EEAIS  YDSSSPDG+ SS ASKNIVSERN
Sbjct  1    MDNVDQEFNNYWETNSFLQNEDFEYDSWPLEEAISGSYDSSSPDGAASSPASKNIVSERN  60

Query  368  RRKKLNERLFALRAVVPKIS  427
            RR+KLN+RLFALR+VVP I+
Sbjct  61   RRQKLNQRLFALRSVVPNIT  80



>ref|XP_009786139.1| PREDICTED: transcription factor ABORTED MICROSPORES [Nicotiana 
sylvestris]
 ref|XP_009786140.1| PREDICTED: transcription factor ABORTED MICROSPORES [Nicotiana 
sylvestris]
 ref|XP_009786141.1| PREDICTED: transcription factor ABORTED MICROSPORES [Nicotiana 
sylvestris]
 ref|XP_009786142.1| PREDICTED: transcription factor ABORTED MICROSPORES [Nicotiana 
sylvestris]
Length=580

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLNERL+ALRA+VPKISK+D+ASI+ DAIEY+ EL +Q + +Q E+ E 
Sbjct  316  KNLVAERKRRKKLNERLYALRALVPKISKLDRASILGDAIEYVMELEKQVKDLQLELEEH  375

Query  524  ESGNGGARSKN  556
               + G R++N
Sbjct  376  SDDDQGGRNQN  386



>gb|ACG33141.1| DNA binding like [Zea mays]
Length=263

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            +N+  ER RR+KLNERL+ALR+VVP I+KMDKASI++DAI +I+ L+EQER + AEI  L
Sbjct  47   RNMAMERTRRRKLNERLYALRSVVPNITKMDKASIVRDAIAHIEHLQEQERRLLAEISVL  106

Query  524  ESGNGG  541
            +S + G
Sbjct  107  QSSDDG  112



>gb|EEC76984.1| hypothetical protein OsI_15289 [Oryza sativa Indica Group]
Length=285

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KNI  ER+RRK+LNE+LFALRAVVPKI+KMDKASI++DAI +I++L E+ER +  EI  L
Sbjct  95   KNIAMERDRRKRLNEKLFALRAVVPKITKMDKASIVRDAIAHIEKLHEEERQLLDEISVL  154

Query  524  ES  529
            +S
Sbjct  155  QS  156



>ref|XP_006653253.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH35-like 
[Oryza brachyantha]
Length=260

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KNI  ER+RRK+LNE+L+ALRAVVPKISKMDKASI++DAI +I++L+ +ER +  EI  L
Sbjct  50   KNIAMERDRRKRLNEKLYALRAVVPKISKMDKASIVRDAIAHIEKLQAEERRLLEEISAL  109

Query  524  ES  529
            ES
Sbjct  110  ES  111



>ref|NP_001173851.1| Os04g0300600 [Oryza sativa Japonica Group]
 emb|CAE05570.2| OSJNBb0013O03.11 [Oryza sativa Japonica Group]
 dbj|BAH92579.1| Os04g0300600 [Oryza sativa Japonica Group]
Length=293

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KNI  ER+RRK+LNE+LFALRAVVPKI+KMDKASI++DAI +I++L+E+ER +  EI  L
Sbjct  97   KNIAMERDRRKRLNEKLFALRAVVPKITKMDKASIVRDAIAHIEKLQEEERQLLDEISVL  156

Query  524  ES  529
            +S
Sbjct  157  QS  158



>ref|XP_001774796.1| predicted protein [Physcomitrella patens]
 gb|EDQ60337.1| predicted protein [Physcomitrella patens]
Length=241

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+VSER RRKKLNE LF LRAVVPKISKMDKASII DAI Y++EL+++   I++EI +L
Sbjct  27   KNLVSERKRRKKLNEGLFQLRAVVPKISKMDKASIIGDAIAYVRELQKELEEIESEIDDL  86

Query  524  ESGNGGA  544
            E    G+
Sbjct  87   EQKCTGS  93



>gb|EEE60703.1| hypothetical protein OsJ_14194 [Oryza sativa Japonica Group]
Length=268

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KNI  ER+RRK+LNE LFALRAVVPKI+KMDKASI++DAI +I++L+E+ER +  EI  L
Sbjct  97   KNIAMERDRRKRLNENLFALRAVVPKITKMDKASIVRDAIAHIEKLQEEERQLLDEISVL  156

Query  524  ES  529
            +S
Sbjct  157  QS  158



>ref|XP_001751559.1| predicted protein [Physcomitrella patens]
 gb|EDQ83876.1| predicted protein [Physcomitrella patens]
Length=378

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+VSER RRKKLNE LF LRAVVPKISKMDKASII DAI Y++EL+++   I++EI +L
Sbjct  159  KNLVSERKRRKKLNEGLFQLRAVVPKISKMDKASIIGDAIAYVRELQKELEEIESEIDDL  218

Query  524  ESGNGGA  544
            E    G+
Sbjct  219  EQKCTGS  225



>tpg|DAA38307.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=274

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            +N+  ER RR+KLNERL+ALR+VVP I+KMDKASI++DAI +I+ L+EQER + AEI  L
Sbjct  90   RNMDMERTRRRKLNERLYALRSVVPNITKMDKASIVRDAIAHIEHLQEQERRLLAEISVL  149

Query  524  ESGNGG  541
            +S + G
Sbjct  150  QSSDDG  155



>ref|XP_003580572.1| PREDICTED: transcription factor bHLH35-like [Brachypodium distachyon]
Length=301

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN++ ER+RR++LNE+L+ LR VVP I+KMDKAS+I+DAI YI+EL+EQER + AEI  L
Sbjct  81   KNVILERDRRRRLNEKLYTLRGVVPNITKMDKASVIQDAISYIEELQEQERRLLAEISGL  140

Query  524  E  526
            +
Sbjct  141  Q  141



>ref|XP_008667200.1| PREDICTED: uncharacterized protein LOC100193646 isoform X3 [Zea 
mays]
Length=307

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            +N+  ER RR+KLNERL+ALR+VVP I+KMDKASI++DAI +I+ L+EQER + AEI  L
Sbjct  90   RNMDMERTRRRKLNERLYALRSVVPNITKMDKASIVRDAIAHIEHLQEQERRLLAEISVL  149

Query  524  ESGNGG  541
            +S + G
Sbjct  150  QSSDDG  155



>ref|XP_008667199.1| PREDICTED: uncharacterized protein LOC100193646 isoform X2 [Zea 
mays]
Length=307

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            +N+  ER RR+KLNERL+ALR+VVP I+KMDKASI++DAI +I+ L+EQER + AEI  L
Sbjct  91   RNMDMERTRRRKLNERLYALRSVVPNITKMDKASIVRDAIAHIEHLQEQERRLLAEISVL  150

Query  524  ESGNGG  541
            +S + G
Sbjct  151  QSSDDG  156



>ref|XP_008667198.1| PREDICTED: uncharacterized protein LOC100193646 isoform X1 [Zea 
mays]
 tpg|DAA38309.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04279.1| bHLH transcription factor, partial [Zea mays]
Length=308

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            +N+  ER RR+KLNERL+ALR+VVP I+KMDKASI++DAI +I+ L+EQER + AEI  L
Sbjct  91   RNMDMERTRRRKLNERLYALRSVVPNITKMDKASIVRDAIAHIEHLQEQERRLLAEISVL  150

Query  524  ESGNGG  541
            +S + G
Sbjct  151  QSSDDG  156



>ref|XP_001767113.1| predicted protein [Physcomitrella patens]
 gb|EDQ68034.1| predicted protein, partial [Physcomitrella patens]
Length=165

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+VSER RRKKLN+ L+ LR++VPKISKMDKASI+ D+I Y++EL++Q + +++EI E+
Sbjct  3    KNLVSERKRRKKLNDGLYTLRSLVPKISKMDKASIVGDSIVYVKELQQQIQSMESEIAEM  62

Query  524  E  526
            E
Sbjct  63   E  63



>gb|EMS46478.1| Transcription factor bHLH35 [Triticum urartu]
Length=226

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KNI++ER+RR+ LNE+L+ALR VVP I+KMDKASII+DAI YI+EL+EQER I A +
Sbjct  62   KNIINERHRRRMLNEKLYALRRVVPNITKMDKASIIQDAIAYIEELQEQERQILAAL  118



>ref|XP_008236126.1| PREDICTED: transcription factor ABORTED MICROSPORES-like [Prunus 
mume]
Length=510

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 4/77 (5%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLNERLFALRA+VP ISK+D+ASI+ DAIEY+QEL++Q + +Q E+ + 
Sbjct  263  KNLVAERKRRKKLNERLFALRALVPNISKLDRASILGDAIEYVQELQKQAKQLQDELDDH  322

Query  524  E----SGNGGARSKNNN  562
                   N G    +NN
Sbjct  323  AEDEGPKNSGITGHHNN  339



>gb|EMT19490.1| Transcription factor bHLH35 [Aegilops tauschii]
Length=181

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KNI++ER+RR+ LNE+L+ALR +VP I+KMDKASII+DAI YI+EL+EQER I A +
Sbjct  61   KNIINERHRRRMLNEKLYALRRIVPNITKMDKASIIQDAIAYIEELQEQERQILAAL  117



>tpg|DAA38308.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=382

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            +N+  ER RR+KLNERL+ALR+VVP I+KMDKASI++DAI +I+ L+EQER + AEI  L
Sbjct  91   RNMDMERTRRRKLNERLYALRSVVPNITKMDKASIVRDAIAHIEHLQEQERRLLAEISVL  150

Query  524  ESGNGG  541
            +S + G
Sbjct  151  QSSDDG  156



>ref|NP_001132214.1| uncharacterized protein LOC100193646 [Zea mays]
 gb|ACF80976.1| unknown [Zea mays]
Length=382

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            +N+  ER RR+KLNERL+ALR+VVP I+KMDKASI++DAI +I+ L+EQER + AEI  L
Sbjct  91   RNMDMERTRRRKLNERLYALRSVVPNITKMDKASIVRDAIAHIEHLQEQERRLLAEISVL  150

Query  524  ESGNGG  541
            +S + G
Sbjct  151  QSSDDG  156



>ref|XP_009616536.1| PREDICTED: transcription factor ABORTED MICROSPORES [Nicotiana 
tomentosiformis]
 ref|XP_009616537.1| PREDICTED: transcription factor ABORTED MICROSPORES [Nicotiana 
tomentosiformis]
 ref|XP_009616538.1| PREDICTED: transcription factor ABORTED MICROSPORES [Nicotiana 
tomentosiformis]
 ref|XP_009616540.1| PREDICTED: transcription factor ABORTED MICROSPORES [Nicotiana 
tomentosiformis]
Length=581

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLNERL+ALRA+VPKISK+D+ASI+ DAIEY+ EL +Q + +Q E+ E 
Sbjct  318  KNLVAERKRRKKLNERLYALRALVPKISKLDRASILGDAIEYVMELEKQVKDLQLELEEH  377

Query  524  ESGNGGARSKN  556
               +   R++N
Sbjct  378  SDDDQSRRNQN  388



>emb|CBI28513.3| unnamed protein product [Vitis vinifera]
Length=545

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLN+RL+ALRA+VPKISK+D+ASI+ DAIE+++EL++Q + +Q E+ E 
Sbjct  308  KNLVAERRRRKKLNDRLYALRALVPKISKLDRASILGDAIEFVKELQKQAKDLQDELEEH  367

Query  524  ESGNGGARSKNNNGI  568
                GG   K N GI
Sbjct  368  SDDEGG---KINAGI  379



>gb|EPS70613.1| hypothetical protein M569_04147, partial [Genlisea aurea]
Length=206

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 56/78 (72%), Gaps = 3/78 (4%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+++ER RRKKLN+RL+ LR+VVPKISKMD+ASI+ DAI+Y++EL ++   I     EL
Sbjct  12   KNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASILGDAIDYLKELLQK---INDLHNEL  68

Query  524  ESGNGGARSKNNNGIFEF  577
            ES  GG  S    G+  F
Sbjct  69   ESTPGGGSSTATPGVNNF  86



>ref|XP_009393956.1| PREDICTED: transcription factor ABORTED MICROSPORES-like [Musa 
acuminata subsp. malaccensis]
Length=345

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 61/80 (76%), Gaps = 6/80 (8%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+ +ER RRKKLN+RLFALRA+VPKI+KMD+ASI+ DAIEY+ +L++Q + +Q E+ E 
Sbjct  88   KNLFAERKRRKKLNDRLFALRALVPKITKMDRASILGDAIEYVMDLQKQVKDLQDELEET  147

Query  524  ---ESGNG---GARSKNNNG  565
               ++G+    G+   N+NG
Sbjct  148  NQEDAGHDKQIGSNLHNSNG  167



>ref|XP_007041798.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
 gb|EOX97629.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
[Theobroma cacao]
Length=615

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLNERL+ALR++VPKISK+D+ASI+ DAIE+++EL+ Q + +Q E+ E 
Sbjct  353  KNLVAERKRRKKLNERLYALRSLVPKISKLDRASILGDAIEFVKELQNQVKELQDEL-EE  411

Query  524  ESGNGGARSKNNNGI  568
             S N G++    NGI
Sbjct  412  HSDNDGSKKTGLNGI  426



>ref|XP_011046011.1| PREDICTED: transcription factor ABORTED MICROSPORES isoform X3 
[Populus euphratica]
Length=582

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLN+RL+ALR++VP ISK+D+ASI+ DAIE+++EL+++ + +Q E+ E 
Sbjct  334  KNLVAERKRRKKLNDRLYALRSLVPNISKLDRASILGDAIEFVKELQKEAKELQDELEE-  392

Query  524  ESGNGGARSKNNNGI  568
             S + GA++ NNN +
Sbjct  393  NSDDEGAKNGNNNNM  407



>ref|XP_001773179.1| predicted protein [Physcomitrella patens]
 gb|EDQ62032.1| predicted protein [Physcomitrella patens]
Length=550

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWE  520
            KN+V+ER RRKKLNERL++LRA+VPKI+KMD+ASI+ DAIEY++EL++Q + +Q E+ +
Sbjct  316  KNLVAERKRRKKLNERLYSLRALVPKITKMDRASILGDAIEYVKELQQQVKELQEELLD  374



>ref|XP_010941334.1| PREDICTED: transcription factor ABORTED MICROSPORES [Elaeis guineensis]
Length=603

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLN+RL+ALR++VPKI+KMD+ASI+ DAIEY+ EL+ Q + +Q E+ E 
Sbjct  345  KNLVAERKRRKKLNDRLYALRSLVPKITKMDRASILGDAIEYVMELQRQVKDLQDELEET  404

Query  524  --ESGNGGARSKNNN  562
              E  +G     NNN
Sbjct  405  NPEDDDGKQNGSNNN  419



>gb|ACB69502.1| ICE87 [Triticum aestivum]
Length=443

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KN+++ER RRKKLN+RL+ALR+VVP+ISKMD+ASI+ DAIEY++EL+++  ++Q E+
Sbjct  257  KNLMAERRRRKKLNDRLYALRSVVPRISKMDRASILGDAIEYLKELKQKINVLQNEL  313



>gb|KJB47688.1| hypothetical protein B456_008G036900 [Gossypium raimondii]
Length=602

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLNERL++LR++VPKISK+D+ASI+ DAIE+++EL  Q++ +Q E+ E 
Sbjct  338  KNLVAERKRRKKLNERLYSLRSLVPKISKLDRASILGDAIEFVKELENQKKELQDELEEH  397

Query  524  ESGNGGARSKNNNGI  568
               + GA+    NG+
Sbjct  398  SDNDNGAKKTGMNGV  412



>ref|XP_009418560.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=282

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 77/137 (56%), Gaps = 26/137 (19%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            M+    EY +YWE +  L +EEL S  F+E +S Y +SSSPD +  SA    I+ ER RR
Sbjct  1    MDADPSEYANYWEIKCLLDAEELCSLGFDETLSGYCNSSSPDMAAHSALPNTIIMERERR  60

Query  374  KKLNERLFALRAVVPKISKM-------------------------DKASIIKDAIEYIQE  478
            KKLN +L+ LR+VVP ++K+                          KASII DAI YIQ+
Sbjct  61   KKLNRKLYNLRSVVPNMTKVKSTAAATAAVSLQLMHLILVFGVQTSKASIIFDAINYIQQ  120

Query  479  LREQERIIQAEIWELES  529
            L+EQER +  EI E ES
Sbjct  121  LQEQERSLLKEISEQES  137



>gb|EMT32961.1| Transcription factor ICE1 [Aegilops tauschii]
Length=560

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KN+++ER RRKKLN+RL+ALR+VVP+ISKMD+ASI+ DAIEY++EL+++  ++Q E+
Sbjct  323  KNLMAERRRRKKLNDRLYALRSVVPRISKMDRASILGDAIEYLKELKQKINVLQNEL  379



>ref|XP_002991957.1| hypothetical protein SELMODRAFT_430203 [Selaginella moellendorffii]
 gb|EFJ06925.1| hypothetical protein SELMODRAFT_430203 [Selaginella moellendorffii]
Length=551

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KN+V+ER RRKKLNERL++LRA+VPKI+KMD+ASI+ DAIEY++EL++Q + +Q E+
Sbjct  335  KNLVAERKRRKKLNERLYSLRALVPKITKMDRASILGDAIEYVKELQQQVKELQDEL  391



>ref|XP_009418559.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=284

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 77/137 (56%), Gaps = 26/137 (19%)
 Frame = +2

Query  197  MENIGDEYKHYWETQTFLQSEELDSY-FEEAISAYYdssspdgsqssaasKNIVSERNRR  373
            M+    EY +YWE +  L +EEL S  F+E +S Y +SSSPD +  SA    I+ ER RR
Sbjct  1    MDADPSEYANYWEIKCLLDAEELCSLGFDETLSGYCNSSSPDMAAHSALPNTIIMERERR  60

Query  374  KKLNERLFALRAVVPKISKM-------------------------DKASIIKDAIEYIQE  478
            KKLN +L+ LR+VVP ++K+                          KASII DAI YIQ+
Sbjct  61   KKLNRKLYNLRSVVPNMTKVKSTAAATAAVSLQLMHLILVFGVQTSKASIIFDAINYIQQ  120

Query  479  LREQERIIQAEIWELES  529
            L+EQER +  EI E ES
Sbjct  121  LQEQERSLLKEISEQES  137



>ref|XP_002985518.1| hypothetical protein SELMODRAFT_451590 [Selaginella moellendorffii]
 gb|EFJ13392.1| hypothetical protein SELMODRAFT_451590 [Selaginella moellendorffii]
Length=551

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KN+V+ER RRKKLNERL++LRA+VPKI+KMD+ASI+ DAIEY++EL++Q + +Q E+
Sbjct  335  KNLVAERKRRKKLNERLYSLRALVPKITKMDRASILGDAIEYVKELQQQVKELQDEL  391



>ref|XP_006379291.1| hypothetical protein POPTR_0009s13860g [Populus trichocarpa]
 gb|ERP57088.1| hypothetical protein POPTR_0009s13860g [Populus trichocarpa]
Length=575

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLN+RL+ALR++VP ISK+D+ASI+ DAIE+++EL+++ + +Q E+ E 
Sbjct  324  KNLVAERKRRKKLNDRLYALRSLVPNISKLDRASILGDAIEFVKELQKEAKELQDELEE-  382

Query  524  ESGNGGARSKNNNGI  568
             S + GA++ NNN +
Sbjct  383  NSEDEGAKNGNNNNM  397



>ref|XP_004975230.1| PREDICTED: transcription factor bHLH35-like isoform X1 [Setaria 
italica]
Length=306

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            +N   ER RR++LNE+L+ALR+VVP I+KMDKASII+DAI Y++ L+EQER + A+I  L
Sbjct  90   RNTAMERGRRRRLNEKLYALRSVVPNITKMDKASIIRDAIAYVEHLQEQERRVLADISAL  149



>emb|CAH66073.1| H0215E01.1 [Oryza sativa Indica Group]
Length=310

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYIQ L+ +E+ +  E+
Sbjct  93   KNILMERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIQHLQAEEQQMLREV  149



>ref|XP_006351594.1| PREDICTED: transcription factor ABORTED MICROSPORES-like isoform 
X2 [Solanum tuberosum]
Length=600

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+++ER RRKKLNERL+ALRA+VPKISK+D+ASI+ DAIEY+ EL +Q + +Q E+ E 
Sbjct  334  KNLMAERKRRKKLNERLYALRALVPKISKLDRASILGDAIEYVMELEKQVKDLQLELEEH  393

Query  524  ESGNGGARSKN  556
               +GG R+ +
Sbjct  394  SDDDGGGRNPD  404



>ref|XP_004975231.1| PREDICTED: transcription factor bHLH35-like isoform X2 [Setaria 
italica]
Length=305

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            +N   ER RR++LNE+L+ALR+VVP I+KMDKASII+DAI Y++ L+EQER + A+I  L
Sbjct  89   RNTAMERGRRRRLNEKLYALRSVVPNITKMDKASIIRDAIAYVEHLQEQERRVLADISAL  148



>ref|XP_001757044.1| predicted protein [Physcomitrella patens]
 gb|EDQ78275.1| predicted protein [Physcomitrella patens]
Length=187

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWE  520
            KN+V+ER RRKKLNERL++LRA+VPKI+KMD+ASI+ DAIEY++EL++Q + +  E+ +
Sbjct  30   KNLVAERKRRKKLNERLYSLRALVPKITKMDRASILGDAIEYVKELQQQVKELHEELVD  88



>gb|EMS57018.1| Transcription factor ICE1 [Triticum urartu]
Length=464

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KN+++ER RRKKLN+RL+ALR+VVP+ISKMD+ASI+ DAIEY++EL+++  ++Q E+
Sbjct  279  KNLLAERRRRKKLNDRLYALRSVVPRISKMDRASILGDAIEYLKELKQKINVLQNEL  335



>ref|XP_007201665.1| hypothetical protein PRUPE_ppa022211mg [Prunus persica]
 gb|EMJ02864.1| hypothetical protein PRUPE_ppa022211mg [Prunus persica]
Length=594

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KN+V+ER RRKKLNERLFALRA+VP ISK+D+ASI+ DAIEY+QEL++Q + +Q E+
Sbjct  346  KNLVAERKRRKKLNERLFALRALVPNISKLDRASILGDAIEYVQELQKQAKQLQDEL  402



>ref|XP_011458682.1| PREDICTED: transcription factor ABORTED MICROSPORES-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=551

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 56/68 (82%), Gaps = 1/68 (1%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLNE+L+ LR++VP ISKMDKASI+KDAI+Y+++L+ Q + +Q ++ E 
Sbjct  302  KNLVAERKRRKKLNEKLYKLRSLVPNISKMDKASILKDAIDYVKDLQRQVKELQ-DVLED  360

Query  524  ESGNGGAR  547
             S  GGA+
Sbjct  361  NSNGGGAK  368



>ref|XP_006351593.1| PREDICTED: transcription factor ABORTED MICROSPORES-like isoform 
X1 [Solanum tuberosum]
Length=601

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+++ER RRKKLNERL+ALRA+VPKISK+D+ASI+ DAIEY+ EL +Q + +Q E+ E 
Sbjct  334  KNLMAERKRRKKLNERLYALRALVPKISKLDRASILGDAIEYVMELEKQVKDLQLELEEH  393

Query  524  ESGNGGARSKN  556
               +GG R+ +
Sbjct  394  SDDDGGGRNPD  404



>ref|XP_008789721.1| PREDICTED: transcription factor bHLH35-like [Phoenix dactylifera]
Length=226

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            K +V ER RR+KL ERL+ALR+VVP I+KMDKASIIKDAI+YIQEL+  ER + +++ +L
Sbjct  31   KYVVMERIRRQKLKERLYALRSVVPNITKMDKASIIKDAIDYIQELQGLERKLLSKVSDL  90

Query  524  ESGNG  538
            E  N 
Sbjct  91   EVSNA  95



>ref|XP_009396705.1| PREDICTED: transcription factor bHLH35-like [Musa acuminata subsp. 
malaccensis]
Length=215

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KNI++ER RRKK N+ L+ LR+VVP I+KM+K S+I DAI YIQEL+EQER +  EI EL
Sbjct  12   KNIMAERERRKKFNKTLYDLRSVVPNITKMNKTSVILDAINYIQELQEQERSLVEEISEL  71

Query  524  ES  529
            ES
Sbjct  72   ES  73



>ref|NP_001052406.1| Os04g0301500 [Oryza sativa Japonica Group]
 dbj|BAF14320.1| Os04g0301500 [Oryza sativa Japonica Group]
 dbj|BAH01225.1| unnamed protein product [Oryza sativa Japonica Group]
Length=310

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYIQ L+ +E+ +  E+
Sbjct  93   KNILMERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIQRLQAEEQQMLREV  149



>dbj|BAC66785.1| Transcription Factor [Oryza sativa]
Length=310

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYIQ L+ +E+ +  E+
Sbjct  93   KNILMERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIQRLQAEEQQMLREV  149



>ref|XP_011045978.1| PREDICTED: transcription factor ABORTED MICROSPORES isoform X1 
[Populus euphratica]
 ref|XP_011045986.1| PREDICTED: transcription factor ABORTED MICROSPORES isoform X1 
[Populus euphratica]
 ref|XP_011045995.1| PREDICTED: transcription factor ABORTED MICROSPORES isoform X1 
[Populus euphratica]
Length=588

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLN+RL+ALR++VP ISK+D+ASI+ DAIE+++EL+++ + +Q E+ E 
Sbjct  334  KNLVAERKRRKKLNDRLYALRSLVPNISKLDRASILGDAIEFVKELQKEAKELQDEL-EE  392

Query  524  ESGNGGARSKNNNGI  568
             S + GA++ NNN +
Sbjct  393  NSDDEGAKNGNNNNM  407



>ref|XP_011046003.1| PREDICTED: transcription factor ABORTED MICROSPORES isoform X2 
[Populus euphratica]
Length=583

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLN+RL+ALR++VP ISK+D+ASI+ DAIE+++EL+++ + +Q E+ E 
Sbjct  334  KNLVAERKRRKKLNDRLYALRSLVPNISKLDRASILGDAIEFVKELQKEAKELQDEL-EE  392

Query  524  ESGNGGARSKNNNGI  568
             S + GA++ NNN +
Sbjct  393  NSDDEGAKNGNNNNM  407



>gb|KGN51291.1| hypothetical protein Csa_5G514470 [Cucumis sativus]
Length=474

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 3/76 (4%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLNERL+ LRA+VPKISKMDKASI+ DAI++++EL++Q + ++ E+ E 
Sbjct  220  KNLVAERKRRKKLNERLYNLRALVPKISKMDKASILGDAIDFVKELQKQVKELRDELEEH  279

Query  524  ---ESGNGGARSKNNN  562
               E+G  G    N N
Sbjct  280  SDDENGKTGLSGNNGN  295



>ref|XP_004245356.1| PREDICTED: transcription factor ABORTED MICROSPORES [Solanum 
lycopersicum]
Length=601

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+++ER RRKKLNERL+ALRA+VPKISK+D+ASI+ DAIEY+ EL +Q + +Q E+ E 
Sbjct  333  KNLMAERKRRKKLNERLYALRALVPKISKLDRASILGDAIEYVMELEKQVKDLQLEVEEH  392

Query  524  ESGNGGARSKNNNGI  568
               +G    +N++ I
Sbjct  393  SDDDGTGGGRNSDQI  407



>ref|XP_009395602.1| PREDICTED: transcription factor ABORTED MICROSPORES-like [Musa 
acuminata subsp. malaccensis]
Length=422

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWE  520
            KN+ +ER RRKKLN+RL+ALRA+VPKI+KMD+ASI+ DAIEY+ +L++Q + +Q E+ E
Sbjct  182  KNLFAERKRRKKLNDRLYALRALVPKITKMDRASILGDAIEYVMDLQKQVKDLQDELEE  240



>ref|XP_006424447.1| hypothetical protein CICLE_v10030052mg [Citrus clementina]
 gb|ESR37687.1| hypothetical protein CICLE_v10030052mg [Citrus clementina]
Length=313

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            + +VSER RR K+ E+L+ LRA+VP ISKMDKASII DA+ Y+QEL+ Q R ++AEI  L
Sbjct  126  RTLVSERKRRGKMKEKLYGLRALVPNISKMDKASIIGDAVSYLQELQMQVRKLKAEIASL  185

Query  524  ESGNGGA  544
            E    G+
Sbjct  186  EYSMAGS  192



>emb|CAE04678.3| OSJNBb0018A10.7 [Oryza sativa Japonica Group]
Length=426

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEI  514
            KNI+ ER+RR+KLNE+L+ALR+VVP I+KMDKASIIKDAIEYIQ L+ +E+ +  E+
Sbjct  93   KNILMERDRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIQRLQAEEQQMLREV  149



>ref|XP_004142831.1| PREDICTED: transcription factor ABORTED MICROSPORES-like [Cucumis 
sativus]
Length=623

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 3/76 (4%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLNERL+ LRA+VPKISKMDKASI+ DAI++++EL++Q + ++ E+ E 
Sbjct  369  KNLVAERKRRKKLNERLYNLRALVPKISKMDKASILGDAIDFVKELQKQVKELRDELEEH  428

Query  524  ---ESGNGGARSKNNN  562
               E+G  G    N N
Sbjct  429  SDDENGKTGLSGNNGN  444



>ref|XP_006488003.1| PREDICTED: transcription factor FER-LIKE IRON DEFICIENCY-INDUCED 
TRANSCRIPTION FACTOR-like [Citrus sinensis]
 gb|KDO60280.1| hypothetical protein CISIN_1g021355mg [Citrus sinensis]
Length=313

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            + +VSER RR K+ E+L+ LRA+VP ISKMDKASII DA+ Y+QEL+ Q R ++AEI  L
Sbjct  126  RTLVSERKRRGKMKEKLYGLRALVPNISKMDKASIIGDAVSYLQELQMQVRKLKAEIASL  185

Query  524  ESGNGGA  544
            E    G+
Sbjct  186  EYSMAGS  192



>ref|XP_011458681.1| PREDICTED: transcription factor ABORTED MICROSPORES-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=583

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 40/73 (55%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLNE+L+ LR++VP ISKMDKASI+KDAI+Y+++L+ Q + +Q ++ E 
Sbjct  334  KNLVAERKRRKKLNEKLYKLRSLVPNISKMDKASILKDAIDYVKDLQRQVKELQ-DVLED  392

Query  524  ESGNGGARSKNNN  562
             S  GGA+   N+
Sbjct  393  NSNGGGAKRTFNS  405



>ref|XP_010928971.1| PREDICTED: transcription factor bHLH35-like [Elaeis guineensis]
Length=291

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  359  ERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWELESGNG  538
            ER RR KL ERL+ALR VVP I+K+DKASIIKDAI+YI+EL+EQER + +EI +LE  N 
Sbjct  104  ERIRRDKLKERLYALRRVVPNITKLDKASIIKDAIDYIEELQEQERRLLSEISDLELSNA  163



>ref|XP_002263966.2| PREDICTED: transcription factor ABORTED MICROSPORES-like isoform 
X1 [Vitis vinifera]
Length=634

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLN+RL+ALRA+VPKISK+D+ASI+ DAIE+++EL++Q + +Q E+ E 
Sbjct  373  KNLVAERRRRKKLNDRLYALRALVPKISKLDRASILGDAIEFVKELQKQAKDLQDELEEH  432

Query  524  ESGNGGARSKNNNGI  568
                GG   K N GI
Sbjct  433  SDDEGG---KINAGI  444



>ref|XP_010651162.1| PREDICTED: transcription factor ABORTED MICROSPORES-like isoform 
X2 [Vitis vinifera]
Length=619

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLN+RL+ALRA+VPKISK+D+ASI+ DAIE+++EL++Q + +Q E+ E 
Sbjct  358  KNLVAERRRRKKLNDRLYALRALVPKISKLDRASILGDAIEFVKELQKQAKDLQDELEEH  417

Query  524  ESGNGGARSKNNNGI  568
                GG   K N GI
Sbjct  418  SDDEGG---KINAGI  429



>emb|CDP16911.1| unnamed protein product [Coffea canephora]
Length=649

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+++ER RRKKLN+RL+ALRA+VPKISK+D+ASI+ DAIEY++EL++Q + +Q E+ E 
Sbjct  389  KNLMAERKRRKKLNDRLYALRALVPKISKLDRASILGDAIEYVKELQKQVKDLQDELEE-  447

Query  524  ESGNGGARSKNNNGI  568
               N       N+GI
Sbjct  448  ---NSDDEDPRNSGI  459



>ref|XP_004156739.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ABORTED 
MICROSPORES-like [Cucumis sativus]
Length=516

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 57/76 (75%), Gaps = 3/76 (4%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRK LNERL+ LRA+VPKISKMDKASI+ DAI++++EL++Q + ++ E+ E 
Sbjct  262  KNLVAERKRRKXLNERLYNLRALVPKISKMDKASILGDAIDFVKELQKQVKELRDELEEH  321

Query  524  ---ESGNGGARSKNNN  562
               E+G  G    N N
Sbjct  322  SDDENGKTGLSGNNGN  337



>dbj|BAJ88508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=253

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQER  496
            +N++S R+RR++LNE+L+A+R VVP I+K+DKASII+DAI YI+EL+EQER
Sbjct  65   RNMISVRDRRRRLNEKLYAIRGVVPNITKLDKASIIQDAIAYIEELQEQER  115



>ref|XP_010262502.1| PREDICTED: uncharacterized protein LOC104601018 [Nelumbo nucifera]
Length=999

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ER RRKKLNERL++LR++VPKISKMD+ASI+ DAIE+++EL+++ + +Q    EL
Sbjct  734  KNLVAERKRRKKLNERLYSLRSLVPKISKMDRASILGDAIEFVKELQKKVKDLQD---EL  790

Query  524  ESGNGGARSKNNNGI  568
            E  +   R+K   GI
Sbjct  791  EEPSDDERAKGATGI  805



>ref|XP_008360009.1| PREDICTED: transcription factor FER-LIKE IRON DEFICIENCY-INDUCED 
TRANSCRIPTION FACTOR-like [Malus domestica]
Length=321

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            + +VSER RR  + ERL+ALR++VP I+KMDKASI+ D++ Y+Q+L++Q + ++AEI  L
Sbjct  132  RTLVSERKRRGSMKERLYALRSLVPNITKMDKASIVGDSVLYVQDLQQQAKKLKAEIASL  191

Query  524  ESGNGGARSKNNN  562
            E+   GA  ++ +
Sbjct  192  EASLAGADDRDGH  204



>emb|CBI21285.3| unnamed protein product [Vitis vinifera]
Length=340

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+++ER RRKKLN+RL+ LR+VVPKISKMD+ASI+ DAIEY++EL ++   +  E+   
Sbjct  152  KNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASILGDAIEYLKELLQRINDLHNELEST  211

Query  524  ESGN  535
             SG+
Sbjct  212  PSGS  215



>ref|XP_006606881.1| PREDICTED: transcription factor ABORTED MICROSPORES-like [Glycine 
max]
Length=297

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWE  520
            KN+V+ER RRKKLN+RL+ LR++VP+ISK+D+ASI+ DAIEY+++L++Q + +Q E+ E
Sbjct  61   KNLVAERKRRKKLNDRLYNLRSLVPRISKLDRASILGDAIEYVKDLQKQVKELQDELEE  119



>ref|XP_004509817.1| PREDICTED: transcription factor ABORTED MICROSPORES-like isoform 
X2 [Cicer arietinum]
Length=375

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ERNRRK++N+ LF LR++VP I+KMD+A+I++DAIEYI+EL++QE  +Q E+  L
Sbjct  191  KNLVTERNRRKRINKGLFTLRSLVPNITKMDRAAILEDAIEYIKELQKQEIKLQEEVKAL  250

Query  524  E  526
            E
Sbjct  251  E  251



>gb|EPS62935.1| hypothetical protein M569_11853 [Genlisea aurea]
Length=252

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+++ER RRKKLN+RL+ LR+VVPKISKMD+ASI+ DAI+Y++EL ++   +  E+   
Sbjct  73   KNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASILGDAIDYLKELLQKIDDLSNELESP  132

Query  524  ESGNGGA  544
              G+ GA
Sbjct  133  APGSSGA  139



>ref|XP_004509816.1| PREDICTED: transcription factor ABORTED MICROSPORES-like isoform 
X1 [Cicer arietinum]
Length=398

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V+ERNRRK++N+ LF LR++VP I+KMD+A+I++DAIEYI+EL++QE  +Q E+  L
Sbjct  214  KNLVTERNRRKRINKGLFTLRSLVPNITKMDRAAILEDAIEYIKELQKQEIKLQEEVKAL  273

Query  524  E  526
            E
Sbjct  274  E  274



>gb|ABR18316.1| unknown [Picea sitchensis]
Length=256

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+ +ER RRKKLN+ L+ LR+VVPKISKMDK SII DAI Y+ +L++  R I+ EI  L
Sbjct  63   KNLHTERKRRKKLNDTLYTLRSVVPKISKMDKQSIIGDAISYVLDLQKTIREIEGEIEGL  122

Query  524  ESGNGGARSK  553
             S N G  ++
Sbjct  123  CSSNKGDHTQ  132



>ref|XP_009372500.1| PREDICTED: transcription factor FER-LIKE IRON DEFICIENCY-INDUCED 
TRANSCRIPTION FACTOR-like [Pyrus x bretschneideri]
Length=322

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            + +VSER RR  + ERL+ALR++VP I+KMDKASI+ D++ Y+Q+L++Q + ++AEI  L
Sbjct  133  RTLVSERKRRGSMKERLYALRSLVPNITKMDKASIVGDSVLYVQDLQQQAKKLKAEIASL  192

Query  524  ESGNGGA  544
            E+   GA
Sbjct  193  EASLAGA  199



>gb|ABA25897.1| inducer of CBF expression 2 [Hordeum vulgare subsp. vulgare]
Length=192

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 54/74 (73%), Gaps = 2/74 (3%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+++ER RRKKLN+RL+ LR+VVPKISKMD+ASI+ DAI+Y++EL ++   + +E+   
Sbjct  1    KNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASILGDAIDYLKELLQRISDLHSELESA  60

Query  524  ESGN--GGARSKNN  559
             S    GG  + N 
Sbjct  61   PSSAALGGPSTANT  74



>emb|CDX98033.1| BnaA06g07840D [Brassica napus]
Length=185

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+++ER RRKKLN+RL+ LR+VVPKISKMD+ASI+ DAI+Y++EL ++   +  E+   
Sbjct  4    KNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASILGDAIDYLKELLQRINDLHTELEST  63

Query  524  ESGNGG  541
             S + G
Sbjct  64   PSSSSG  69



>gb|KJB61054.1| hypothetical protein B456_009G337700 [Gossypium raimondii]
Length=358

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V ERNRRKK+N++LF LRA+VPKISKMD+ +I+ DAIEYI +L E+++ ++ E+ ++
Sbjct  177  KNLVMERNRRKKINDQLFKLRALVPKISKMDRTAILTDAIEYIGDLLEEKKKLENELMKI  236

Query  524  ESGN  535
            +  N
Sbjct  237  DEEN  240



>emb|CDY19416.1| BnaC05g09250D [Brassica napus]
Length=185

 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+++ER RRKKLN+RL+ LR+VVPKISKMD+ASI+ DAI+Y++EL ++   +  E+   
Sbjct  4    KNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASILGDAIDYLKELLQRINDLHTELEST  63

Query  524  ESGNGG  541
             S + G
Sbjct  64   PSSSSG  69



>ref|XP_010107648.1| hypothetical protein L484_008364 [Morus notabilis]
 gb|EXC16559.1| hypothetical protein L484_008364 [Morus notabilis]
Length=595

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 40/74 (54%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+++ER RRKKLNERL+ LR++VP ISK+DKASI+ DA+EY+++L+ Q + +Q E+ E 
Sbjct  352  KNLIAERKRRKKLNERLYTLRSLVPNISKLDKASILGDAMEYVRDLQRQAKELQDEL-EE  410

Query  524  ESGNGGARSKNNNG  565
             S N G + K  NG
Sbjct  411  HSDNDGLKDKVING  424



>gb|KHG16938.1| transcription factor aborted microspores -like protein [Gossypium 
arboreum]
Length=317

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  344  KNIVSERNRRKKLNERLFALRAVVPKISKMDKASIIKDAIEYIQELREQERIIQAEIWEL  523
            KN+V ERNRRKK+N++LF LRA+VPKISKMD+ +I+ DAIEYI +L E+++ ++ E+ ++
Sbjct  149  KNLVMERNRRKKINDQLFKLRALVPKISKMDRTAILTDAIEYIGDLLEEKKKLENELMKI  208

Query  524  ESGN  535
            +  N
Sbjct  209  DEEN  212



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455