BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L02

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089572.1|  PREDICTED: peroxisomal membrane protein 13         119   7e-29   Sesamum indicum [beniseed]
ref|XP_007223181.1|  hypothetical protein PRUPE_ppa009172mg             117   7e-28   Prunus persica
gb|AFK39269.1|  unknown                                                 113   1e-27   Medicago truncatula
ref|XP_008237186.1|  PREDICTED: peroxisomal membrane protein 13         116   1e-27   Prunus mume [ume]
ref|XP_008369189.1|  PREDICTED: peroxisomal membrane protein 13         116   2e-27   
ref|XP_010242714.1|  PREDICTED: peroxisomal membrane protein 13-like    114   5e-27   Nelumbo nucifera [Indian lotus]
ref|XP_006447908.1|  hypothetical protein CICLE_v10016105mg             113   1e-26   Citrus clementina [clementine]
gb|KEH39502.1|  hypothetical protein MTR_2g099360                       114   1e-26   Medicago truncatula
ref|XP_003597539.1|  Peroxisome biogenesis factor                       113   2e-26   Medicago truncatula
gb|KDO51030.1|  hypothetical protein CISIN_1g022421mg                   112   4e-26   Citrus sinensis [apfelsine]
gb|KDO51029.1|  hypothetical protein CISIN_1g022421mg                   112   4e-26   Citrus sinensis [apfelsine]
ref|XP_006469374.1|  PREDICTED: peroxisomal membrane protein 13-like    112   4e-26   Citrus sinensis [apfelsine]
gb|KDP45181.1|  hypothetical protein JCGZ_15046                         110   1e-25   Jatropha curcas
ref|XP_010258482.1|  PREDICTED: peroxisomal membrane protein 13-like    110   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_004240448.1|  PREDICTED: peroxisomal membrane protein 13         110   2e-25   Solanum lycopersicum
ref|XP_009764929.1|  PREDICTED: peroxisomal membrane protein 13 i...    110   2e-25   Nicotiana sylvestris
ref|XP_010094089.1|  hypothetical protein L484_018106                   110   3e-25   Morus notabilis
ref|XP_006344086.1|  PREDICTED: peroxisomal membrane protein 13-l...    110   3e-25   Solanum tuberosum [potatoes]
ref|XP_009764922.1|  PREDICTED: peroxisomal membrane protein 13 i...    109   3e-25   Nicotiana sylvestris
emb|CDP06814.1|  unnamed protein product                                109   3e-25   Coffea canephora [robusta coffee]
ref|XP_009341150.1|  PREDICTED: peroxisomal membrane protein 13         109   5e-25   Pyrus x bretschneideri [bai li]
ref|XP_009615747.1|  PREDICTED: peroxisomal membrane protein 13 i...    108   8e-25   Nicotiana tomentosiformis
gb|ACB59355.1|  peroxisome biogenesis factor 13                         108   1e-24   Nicotiana tabacum [American tobacco]
ref|XP_009615746.1|  PREDICTED: peroxisomal membrane protein 13 i...    108   1e-24   Nicotiana tomentosiformis
ref|XP_003546796.1|  PREDICTED: peroxisomal membrane protein 13         108   1e-24   Glycine max [soybeans]
gb|ACU19041.1|  unknown                                                 107   2e-24   Glycine max [soybeans]
ref|XP_003543576.1|  PREDICTED: peroxisomal membrane protein 13 i...    107   2e-24   Glycine max [soybeans]
ref|XP_006344102.1|  PREDICTED: peroxisomal membrane protein 13-like    107   3e-24   Solanum tuberosum [potatoes]
ref|XP_004486871.1|  PREDICTED: peroxisomal membrane protein 13-like    106   6e-24   Cicer arietinum [garbanzo]
gb|EYU36869.1|  hypothetical protein MIMGU_mgv1a010448mg                106   6e-24   Erythranthe guttata [common monkey flower]
ref|XP_007049511.1|  Peroxin 13                                         106   6e-24   
ref|XP_006344085.1|  PREDICTED: peroxisomal membrane protein 13-l...    106   6e-24   Solanum tuberosum [potatoes]
gb|KDO50763.1|  hypothetical protein CISIN_1g022548mg                   105   7e-24   Citrus sinensis [apfelsine]
gb|KJB42660.1|  hypothetical protein B456_007G162100                    105   8e-24   Gossypium raimondii
ref|XP_007150473.1|  hypothetical protein PHAVU_005G155400g             105   1e-23   Phaseolus vulgaris [French bean]
gb|KJB42659.1|  hypothetical protein B456_007G162100                    103   1e-23   Gossypium raimondii
ref|XP_004299871.1|  PREDICTED: peroxisomal membrane protein 13 i...    105   1e-23   Fragaria vesca subsp. vesca
ref|XP_004299872.1|  PREDICTED: peroxisomal membrane protein 13 i...    105   1e-23   Fragaria vesca subsp. vesca
gb|KJB42658.1|  hypothetical protein B456_007G162100                    105   2e-23   Gossypium raimondii
gb|KJB42661.1|  hypothetical protein B456_007G162100                    105   2e-23   Gossypium raimondii
gb|KHG04730.1|  Peroxisomal membrane 13 -like protein                   104   2e-23   Gossypium arboreum [tree cotton]
gb|KDO50762.1|  hypothetical protein CISIN_1g022548mg                   104   2e-23   Citrus sinensis [apfelsine]
ref|XP_006442934.1|  hypothetical protein CICLE_v10021425mg             103   2e-23   
ref|XP_004152142.1|  PREDICTED: uncharacterized protein LOC101221260    104   4e-23   Cucumis sativus [cucumbers]
gb|ACU21190.1|  unknown                                                 102   4e-23   Glycine max [soybeans]
ref|XP_008347893.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...    105   5e-23   
ref|XP_006442935.1|  hypothetical protein CICLE_v10021425mg             103   7e-23   Citrus clementina [clementine]
ref|XP_008454097.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...    103   9e-23   
ref|XP_010069556.1|  PREDICTED: peroxisomal membrane protein 13         102   1e-22   Eucalyptus grandis [rose gum]
gb|KCW87650.1|  hypothetical protein EUGRSUZ_A00039                     101   1e-22   Eucalyptus grandis [rose gum]
gb|KCW87649.1|  hypothetical protein EUGRSUZ_A00039                     101   2e-22   Eucalyptus grandis [rose gum]
ref|XP_010672281.1|  PREDICTED: peroxisomal membrane protein 13         102   2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003537925.1|  PREDICTED: peroxisomal membrane protein 13-like    100   4e-22   Glycine max [soybeans]
ref|XP_010025045.1|  PREDICTED: peroxisomal membrane protein 13-like    101   4e-22   Eucalyptus grandis [rose gum]
gb|AGV54834.1|  hypothetical protein                                  99.4    2e-21   Phaseolus vulgaris [French bean]
ref|XP_009388497.1|  PREDICTED: peroxisomal membrane protein 13-like  98.6    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW87079.1|  hypothetical protein EUGRSUZ_B03613                   93.2    8e-21   Eucalyptus grandis [rose gum]
ref|XP_002524578.1|  nucleic acid binding protein, putative           97.4    1e-20   
gb|KCW81100.1|  hypothetical protein EUGRSUZ_C02476                   92.4    1e-20   Eucalyptus grandis [rose gum]
gb|ABF99230.1|  expressed protein                                     95.1    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051486.1|  Os03g0786000                                     95.9    3e-20   
ref|XP_007131922.1|  hypothetical protein PHAVU_011G052000g           95.5    5e-20   Phaseolus vulgaris [French bean]
ref|XP_011006736.1|  PREDICTED: peroxisomal membrane protein 13-like  95.1    5e-20   Populus euphratica
ref|XP_002320551.2|  hypothetical protein POPTR_0014s17220g           95.1    8e-20   
dbj|BAK08359.1|  predicted protein                                    93.2    2e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS63109.1|  hypothetical protein M569_11678                       92.0    3e-19   Genlisea aurea
ref|XP_003558107.2|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...  95.9    3e-19   
ref|XP_010547186.1|  PREDICTED: peroxisomal membrane protein 13 i...  92.8    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_010547185.1|  PREDICTED: peroxisomal membrane protein 13 i...  92.8    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_006657451.1|  PREDICTED: peroxisomal membrane protein 13-l...  92.0    6e-19   Oryza brachyantha
ref|XP_006657452.1|  PREDICTED: peroxisomal membrane protein 13-l...  92.0    6e-19   Oryza brachyantha
ref|XP_011043592.1|  PREDICTED: peroxisomal membrane protein 13-like  91.7    1e-18   Populus euphratica
ref|XP_011047732.1|  PREDICTED: peroxisomal membrane protein 13-l...  90.5    1e-18   Populus euphratica
ref|XP_006858184.1|  hypothetical protein AMTR_s00062p00160630        90.9    2e-18   
gb|EMT00619.1|  Putative peroxisomal (S)-2-hydroxy-acid oxidase 1     93.6    2e-18   
ref|XP_011047730.1|  PREDICTED: peroxisomal membrane protein 13-l...  90.1    3e-18   Populus euphratica
ref|XP_009399015.1|  PREDICTED: peroxisomal membrane protein 13       89.7    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011011867.1|  PREDICTED: peroxisomal membrane protein 13-like  89.7    4e-18   Populus euphratica
tpg|DAA51783.1|  TPA: glycine-rich protein                            89.4    7e-18   
ref|XP_006372778.1|  glycine-rich family protein                      89.0    9e-18   
ref|XP_010929991.1|  PREDICTED: peroxisomal membrane protein 13-like  88.6    9e-18   Elaeis guineensis
gb|ABK93770.1|  unknown                                               89.0    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_006650694.1|  PREDICTED: peroxisomal membrane protein 13-like  88.6    1e-17   Oryza brachyantha
gb|ACL54731.1|  unknown                                               88.2    1e-17   Zea mays [maize]
gb|KJB84020.1|  hypothetical protein B456_N001500                     87.8    2e-17   Gossypium raimondii
ref|XP_006407824.1|  hypothetical protein EUTSA_v10021215mg           88.2    2e-17   Eutrema salsugineum [saltwater cress]
ref|XP_008796037.1|  PREDICTED: peroxisomal membrane protein 13-like  87.8    2e-17   
ref|NP_001149646.1|  LOC100283272                                     87.0    3e-17   
ref|NP_001058908.1|  Os07g0152800                                     87.0    4e-17   
ref|XP_008775485.1|  PREDICTED: peroxisomal membrane protein 13-like  86.7    5e-17   Phoenix dactylifera
ref|XP_006298214.1|  hypothetical protein CARUB_v10014265mg           86.3    8e-17   Capsella rubella
ref|XP_010941061.1|  PREDICTED: peroxisomal membrane protein 13-like  85.9    8e-17   
gb|EMT28271.1|  hypothetical protein F775_30696                       85.1    2e-16   
ref|XP_004955471.1|  PREDICTED: peroxisomal membrane protein 13-l...  84.7    2e-16   
ref|XP_004981531.1|  PREDICTED: peroxisomal membrane protein 13-l...  84.7    2e-16   Setaria italica
ref|XP_010551992.1|  PREDICTED: peroxisomal membrane protein 13-like  84.3    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_004955472.1|  PREDICTED: peroxisomal membrane protein 13-l...  84.3    3e-16   Setaria italica
ref|XP_004981532.1|  PREDICTED: peroxisomal membrane protein 13-l...  84.3    3e-16   
ref|XP_004955473.1|  PREDICTED: peroxisomal membrane protein 13-l...  84.3    3e-16   Setaria italica
emb|CDX74040.1|  BnaA03g30070D                                        84.0    4e-16   
ref|XP_009134980.1|  PREDICTED: peroxisomal membrane protein 13-like  84.0    5e-16   Brassica rapa
ref|XP_010454009.1|  PREDICTED: peroxisomal membrane protein 13-like  83.6    5e-16   Camelina sativa [gold-of-pleasure]
dbj|BAJ85612.1|  predicted protein                                    83.2    6e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010486321.1|  PREDICTED: peroxisomal membrane protein 13       83.6    6e-16   Camelina sativa [gold-of-pleasure]
dbj|BAJ86828.1|  predicted protein                                    83.2    8e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY07989.1|  BnaC03g35340D                                        83.6    8e-16   Brassica napus [oilseed rape]
ref|XP_010464388.1|  PREDICTED: peroxisomal membrane protein 13-like  83.2    8e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008812815.1|  PREDICTED: peroxisomal membrane protein 13-like  81.6    2e-15   
gb|KDP43909.1|  hypothetical protein JCGZ_20919                       80.1    8e-15   Jatropha curcas
gb|EMS58205.1|  hypothetical protein TRIUR3_02268                     80.5    9e-15   Triticum urartu
ref|NP_001132789.1|  uncharacterized protein LOC100194278             80.1    9e-15   Zea mays [maize]
ref|XP_008667293.1|  PREDICTED: uncharacterized protein LOC100194...  80.1    9e-15   Zea mays [maize]
ref|XP_008667295.1|  PREDICTED: uncharacterized protein LOC100194...  80.1    9e-15   Zea mays [maize]
ref|XP_008667294.1|  PREDICTED: uncharacterized protein LOC100194...  79.7    1e-14   Zea mays [maize]
gb|ACG37046.1|  glycine-rich protein                                  79.7    1e-14   Zea mays [maize]
ref|XP_008667292.1|  PREDICTED: uncharacterized protein LOC100194...  80.1    1e-14   Zea mays [maize]
ref|XP_002884657.1|  hypothetical protein ARALYDRAFT_478079           79.7    2e-14   
emb|CDY28038.1|  BnaC05g44400D                                        79.3    2e-14   Brassica napus [oilseed rape]
dbj|BAH56952.1|  AT3G07560                                            76.6    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147062.1|  PREDICTED: peroxisomal membrane protein 13       78.2    4e-14   Brassica rapa
emb|CDY35943.1|  BnaA05g30070D                                        78.6    5e-14   Brassica napus [oilseed rape]
ref|NP_187412.1|  peroxin 13                                          78.2    5e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008809369.1|  PREDICTED: peroxisomal membrane protein 13-l...  77.0    7e-14   
ref|XP_008809368.1|  PREDICTED: peroxisomal membrane protein 13-l...  77.0    8e-14   
ref|XP_003557652.2|  PREDICTED: peroxisomal (S)-2-hydroxy-acid ox...  79.7    8e-14   
gb|ABK26417.1|  unknown                                               74.7    7e-13   Picea sitchensis
ref|XP_002466342.1|  hypothetical protein SORBIDRAFT_01g005970        75.9    8e-13   
ref|XP_010910086.1|  PREDICTED: peroxisomal membrane protein 13-l...  70.5    2e-11   Elaeis guineensis
ref|XP_010910084.1|  PREDICTED: peroxisomal membrane protein 13-l...  70.1    3e-11   
ref|XP_010910087.1|  PREDICTED: peroxisomal membrane protein 13-l...  69.7    3e-11   
ref|XP_010910085.1|  PREDICTED: peroxisomal membrane protein 13-l...  70.1    4e-11   
ref|XP_006859049.1|  hypothetical protein AMTR_s00068p00188230        58.2    1e-07   
ref|XP_009124313.1|  PREDICTED: peroxisomal membrane protein 13-like  57.0    1e-06   
gb|ABK22418.1|  unknown                                               55.5    5e-06   Picea sitchensis
tpg|DAA39779.1|  TPA: hypothetical protein ZEAMMB73_031103            55.5    6e-06   
gb|AFW87992.1|  hypothetical protein ZEAMMB73_343017                  52.0    1e-04   



>ref|XP_011089572.1| PREDICTED: peroxisomal membrane protein 13 [Sesamum indicum]
Length=285

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            MENN Q SGGG PPKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTA PGE+V+  DR+ 
Sbjct  1    MENNAQSSGGGPPPKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTAQPGEVVSTTDRSA  60

Query  296  AVNRNAVARPVPSRPWEQQ  352
            AVNRN + RPVP+RPWEQQ
Sbjct  61   AVNRNTLGRPVPTRPWEQQ  79



>ref|XP_007223181.1| hypothetical protein PRUPE_ppa009172mg [Prunus persica]
 gb|EMJ24380.1| hypothetical protein PRUPE_ppa009172mg [Prunus persica]
Length=303

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            ME+NPQPS  G PPKPWERAGSSSGPAPFKP S G+TSDVVEASGTA PGEIV+++DRN 
Sbjct  1    MESNPQPSANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVSSSDRNA  60

Query  296  AVNRNAVARPVPSRPWEQ  349
             VNRNA+ARPVPSRPWEQ
Sbjct  61   TVNRNALARPVPSRPWEQ  78



>gb|AFK39269.1| unknown [Medicago truncatula]
Length=149

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M +NPQPS    PPKPWERAGSSSGPAPF+P S G+TSDVVEASGTA PGEIVTAADR+ 
Sbjct  1    MASNPQPSASNPPPKPWERAGSSSGPAPFRPPSGGSTSDVVEASGTAKPGEIVTAADRSA  60

Query  296  AVNRNAVARPVPSRPWEQ  349
            AVNRN +ARPVP+RPWEQ
Sbjct  61   AVNRNTLARPVPTRPWEQ  78



>ref|XP_008237186.1| PREDICTED: peroxisomal membrane protein 13 [Prunus mume]
Length=303

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 70/78 (90%), Gaps = 0/78 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            ME+NPQPS  G PPKPWERAGSSSGPAPFKP S G+TSDVVEASGTA PGEIV+++DRN 
Sbjct  1    MESNPQPSANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVSSSDRNA  60

Query  296  AVNRNAVARPVPSRPWEQ  349
             VNRNA+ARPVPSRPWEQ
Sbjct  61   TVNRNALARPVPSRPWEQ  78



>ref|XP_008369189.1| PREDICTED: peroxisomal membrane protein 13 [Malus domestica]
Length=305

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M++NPQPS  G PPKPWERAGSSSGPAPFKP S G+TSDVVEASGTA PGEIV ++DRNT
Sbjct  1    MDSNPQPSANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVPSSDRNT  60

Query  296  AVNRNAVARPVPSRPWEQQ  352
            A NRNA+ARPVPSRPWEQ 
Sbjct  61   AANRNALARPVPSRPWEQN  79



>ref|XP_010242714.1| PREDICTED: peroxisomal membrane protein 13-like [Nelumbo nucifera]
Length=280

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            ME+ PQ      PPKPWERA +SSGPAPF+PSSPG+TSDVVEASGTA PGEIV+ ADRNT
Sbjct  1    MESRPQQGASNPPPKPWERAATSSGPAPFRPSSPGSTSDVVEASGTAKPGEIVSTADRNT  60

Query  296  AVNRNAVARPVPSRPWEQ  349
             VNRN + RPVP+RPWEQ
Sbjct  61   TVNRNTLGRPVPTRPWEQ  78



>ref|XP_006447908.1| hypothetical protein CICLE_v10016105mg [Citrus clementina]
 gb|ESR61148.1| hypothetical protein CICLE_v10016105mg [Citrus clementina]
Length=297

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M++N Q + GG P KPWERAG+SSGP PFKP S G+TSDVVEASGTA PG+IV+ ADRNT
Sbjct  1    MDSNSQQAAGGPPAKPWERAGTSSGPTPFKPPSSGSTSDVVEASGTARPGDIVSTADRNT  60

Query  296  AVNRNAVARPVPSRPWEQQQ  355
            AVNRN + RPVP+RPWEQQQ
Sbjct  61   AVNRNNLTRPVPTRPWEQQQ  80



>gb|KEH39502.1| hypothetical protein MTR_2g099360 [Medicago truncatula]
Length=315

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M +NPQPS    PPKPWERAGSSSGPAPF+P S G+TSDVVEASGTA PGEIVTAADR+ 
Sbjct  1    MASNPQPSASNPPPKPWERAGSSSGPAPFRPPSGGSTSDVVEASGTAKPGEIVTAADRSA  60

Query  296  AVNRNAVARPVPSRPWEQ  349
            AVNRN +ARPVP+RPWEQ
Sbjct  61   AVNRNTLARPVPTRPWEQ  78



>ref|XP_003597539.1| Peroxisome biogenesis factor [Medicago truncatula]
 gb|AES67790.1| hypothetical protein MTR_2g099360 [Medicago truncatula]
Length=316

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M +NPQPS    PPKPWERAGSSSGPAPF+P S G+TSDVVEASGTA PGEIVTAADR+ 
Sbjct  1    MASNPQPSASNPPPKPWERAGSSSGPAPFRPPSGGSTSDVVEASGTAKPGEIVTAADRSA  60

Query  296  AVNRNAVARPVPSRPWEQ  349
            AVNRN +ARPVP+RPWEQ
Sbjct  61   AVNRNTLARPVPTRPWEQ  78



>gb|KDO51030.1| hypothetical protein CISIN_1g022421mg [Citrus sinensis]
Length=296

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M++N Q + GG P KPWERAG+SSGP PFKP S G+TSDVVEASGTA PG+IV+  DRNT
Sbjct  1    MDSNSQQAAGGPPAKPWERAGTSSGPTPFKPPSSGSTSDVVEASGTARPGDIVSTVDRNT  60

Query  296  AVNRNAVARPVPSRPWEQQQ  355
            AVNRN + RPVP+RPWEQQQ
Sbjct  61   AVNRNNLTRPVPTRPWEQQQ  80



>gb|KDO51029.1| hypothetical protein CISIN_1g022421mg [Citrus sinensis]
Length=297

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M++N Q + GG P KPWERAG+SSGP PFKP S G+TSDVVEASGTA PG+IV+  DRNT
Sbjct  1    MDSNSQQAAGGPPAKPWERAGTSSGPTPFKPPSSGSTSDVVEASGTARPGDIVSTVDRNT  60

Query  296  AVNRNAVARPVPSRPWEQQQ  355
            AVNRN + RPVP+RPWEQQQ
Sbjct  61   AVNRNNLTRPVPTRPWEQQQ  80



>ref|XP_006469374.1| PREDICTED: peroxisomal membrane protein 13-like [Citrus sinensis]
Length=297

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M++N Q + GG P KPWERAG+SSGP PFKP S G+TSDVVEASGTA PG+IV+  DRNT
Sbjct  1    MDSNSQQAAGGPPAKPWERAGTSSGPTPFKPPSSGSTSDVVEASGTARPGDIVSTVDRNT  60

Query  296  AVNRNAVARPVPSRPWEQQQ  355
            AVNRN + RPVP+RPWEQQQ
Sbjct  61   AVNRNNLTRPVPTRPWEQQQ  80



>gb|KDP45181.1| hypothetical protein JCGZ_15046 [Jatropha curcas]
Length=290

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAG-SSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRN  292
            M++N Q +G G P KPWE+AG SSSGP PFKP SPG+TSDVVEASGTA PGEIV+AADRN
Sbjct  1    MDSNSQQTGSGPPAKPWEQAGTSSSGPTPFKPPSPGSTSDVVEASGTARPGEIVSAADRN  60

Query  293  TAVNRNAVARPVPSRPWEQQ  352
            T VNRN + RPVP+RPWEQQ
Sbjct  61   TTVNRNTLGRPVPTRPWEQQ  80



>ref|XP_010258482.1| PREDICTED: peroxisomal membrane protein 13-like [Nelumbo nucifera]
 ref|XP_010258483.1| PREDICTED: peroxisomal membrane protein 13-like [Nelumbo nucifera]
Length=283

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            ME+ PQ      PPKPWERAG+SSGPAPFKP SPG+TS+VVE +GT+ PGEIV+ ADRNT
Sbjct  1    MESKPQQGANSPPPKPWERAGTSSGPAPFKPPSPGSTSEVVEGAGTSKPGEIVSTADRNT  60

Query  296  AVNRNAVARPVPSRPWEQ  349
             VNRN + RPVP+RPWEQ
Sbjct  61   TVNRNTLGRPVPTRPWEQ  78



>ref|XP_004240448.1| PREDICTED: peroxisomal membrane protein 13 [Solanum lycopersicum]
Length=296

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  164  WERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSRPW  343
            WERAGSSSGPAPFKP S GNTSDVVEASGTA PGEIV+ A+RNTAVN N +ARPVP+RPW
Sbjct  18   WERAGSSSGPAPFKPPSAGNTSDVVEASGTARPGEIVSTANRNTAVNNNTLARPVPTRPW  77

Query  344  EQQQ  355
            EQQQ
Sbjct  78   EQQQ  81



>ref|XP_009764929.1| PREDICTED: peroxisomal membrane protein 13 isoform X2 [Nicotiana 
sylvestris]
Length=298

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAGSSSGP PFKP S GNTSDVVEASGTA PGEIV+ A+RNTAVN + +ARPVP R
Sbjct  16   KPWERAGSSSGPTPFKPPSSGNTSDVVEASGTARPGEIVSTANRNTAVNNSTLARPVPPR  75

Query  338  PWEQQQ  355
            PWEQQQ
Sbjct  76   PWEQQQ  81



>ref|XP_010094089.1| hypothetical protein L484_018106 [Morus notabilis]
 gb|EXB55179.1| hypothetical protein L484_018106 [Morus notabilis]
Length=350

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M++ PQPSG   PPKPWERAG S+GPAPFKP S G+T+DVVEASGTA PGEIV+ +DRNT
Sbjct  52   MDSQPQPSGNTPPPKPWERAGGSTGPAPFKPPSGGSTTDVVEASGTAKPGEIVSTSDRNT  111

Query  296  AVNRNAVARPVPSRPWEQ  349
            AVNRNA++RPVP+RPWEQ
Sbjct  112  AVNRNALSRPVPTRPWEQ  129



>ref|XP_006344086.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Solanum 
tuberosum]
Length=299

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAGSSSGPAPFKP S G+TSDVVEASGTA PGEIV+ A+RNTAVN + +ARPVP+R
Sbjct  10   KPWERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSTANRNTAVNNSTLARPVPTR  69

Query  338  PWEQQQ  355
            PWEQQQ
Sbjct  70   PWEQQQ  75



>ref|XP_009764922.1| PREDICTED: peroxisomal membrane protein 13 isoform X1 [Nicotiana 
sylvestris]
Length=298

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAGSSSGP PFKP S GNTSDVVEASGTA PGEIV+ A+RNTAVN + +ARPVP R
Sbjct  16   KPWERAGSSSGPTPFKPPSSGNTSDVVEASGTARPGEIVSTANRNTAVNNSTLARPVPPR  75

Query  338  PWEQQQ  355
            PWEQQQ
Sbjct  76   PWEQQQ  81



>emb|CDP06814.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 1/68 (1%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRN-TAVNRNAVARPVPS  334
            KPWERAGSSSGPAPFKP SPG+TSDVVEASGTA PGEIV+ ADR+ + VN NAV RP+PS
Sbjct  22   KPWERAGSSSGPAPFKPPSPGSTSDVVEASGTARPGEIVSTADRSASTVNANAVGRPMPS  81

Query  335  RPWEQQQQ  358
            RPWEQQQQ
Sbjct  82   RPWEQQQQ  89



>ref|XP_009341150.1| PREDICTED: peroxisomal membrane protein 13 [Pyrus x bretschneideri]
Length=304

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M++N QP   G PPKPWERAGSSSGPAPFKP S G+TSDVVEASGTA PGEIV ++DRNT
Sbjct  1    MDSNSQPPANGPPPKPWERAGSSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVPSSDRNT  60

Query  296  AVNRNAVARPVPSRPWEQ  349
            A NRNA+ARPVPSRPWEQ
Sbjct  61   AANRNALARPVPSRPWEQ  78



>ref|XP_009615747.1| PREDICTED: peroxisomal membrane protein 13 isoform X2 [Nicotiana 
tomentosiformis]
Length=299

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAGSSSGP PFKP S GNTSDVVEASGTA PGEIV+ A+RNT VN + +ARPVP R
Sbjct  16   KPWERAGSSSGPTPFKPPSSGNTSDVVEASGTARPGEIVSTANRNTTVNNSTLARPVPPR  75

Query  338  PWEQQQ  355
            PWEQQQ
Sbjct  76   PWEQQQ  81



>gb|ACB59355.1| peroxisome biogenesis factor 13 [Nicotiana tabacum]
Length=299

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAGSSSGP PFKP S GNTSDVVEASGTA PGEIV+ A+RNT VN + +ARPVP R
Sbjct  16   KPWERAGSSSGPTPFKPPSSGNTSDVVEASGTARPGEIVSTANRNTTVNNSTLARPVPPR  75

Query  338  PWEQQQ  355
            PWEQQQ
Sbjct  76   PWEQQQ  81



>ref|XP_009615746.1| PREDICTED: peroxisomal membrane protein 13 isoform X1 [Nicotiana 
tomentosiformis]
Length=299

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAGSSSGP PFKP S GNTSDVVEASGTA PGEIV+ A+RNT VN + +ARPVP R
Sbjct  16   KPWERAGSSSGPTPFKPPSSGNTSDVVEASGTARPGEIVSTANRNTTVNNSTLARPVPPR  75

Query  338  PWEQQQ  355
            PWEQQQ
Sbjct  76   PWEQQQ  81



>ref|XP_003546796.1| PREDICTED: peroxisomal membrane protein 13 [Glycine max]
 gb|KHN33283.1| Peroxisomal membrane protein 13 [Glycine soja]
Length=297

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+AGSSSGPAPFKP S GNTSDVVEASGTA PGEIV+++DR+ AVNRN + RPVPSR
Sbjct  15   KPWEQAGSSSGPAPFKPPSAGNTSDVVEASGTAKPGEIVSSSDRSAAVNRNTLGRPVPSR  74

Query  338  PWEQ  349
            PWEQ
Sbjct  75   PWEQ  78



>gb|ACU19041.1| unknown [Glycine max]
Length=301

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+AGSSSGPAPFKP S GNTSDVVEASGTA PGEIV+++DR+ AVNRN + RPVP+R
Sbjct  15   KPWEQAGSSSGPAPFKPPSAGNTSDVVEASGTAKPGEIVSSSDRSAAVNRNTLGRPVPTR  74

Query  338  PWEQ  349
            PWEQ
Sbjct  75   PWEQ  78



>ref|XP_003543576.1| PREDICTED: peroxisomal membrane protein 13 isoform X1 [Glycine 
max]
 gb|KHN30082.1| Peroxisomal membrane protein 13 [Glycine soja]
Length=301

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+AGSSSGPAPFKP S GNTSDVVEASGTA PGEIV+++DR+ AVNRN + RPVP+R
Sbjct  15   KPWEQAGSSSGPAPFKPPSAGNTSDVVEASGTAKPGEIVSSSDRSAAVNRNTLGRPVPTR  74

Query  338  PWEQ  349
            PWEQ
Sbjct  75   PWEQ  78



>ref|XP_006344102.1| PREDICTED: peroxisomal membrane protein 13-like [Solanum tuberosum]
Length=304

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  164  WERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSRPW  343
            WERAGSSSGPAPFKP S G+TSDVVEASGTA PGEIV+ A+RNTAVN + +ARPVP+RPW
Sbjct  18   WERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSTANRNTAVNNSTLARPVPTRPW  77

Query  344  EQQQ  355
            EQQQ
Sbjct  78   EQQQ  81



>ref|XP_004486871.1| PREDICTED: peroxisomal membrane protein 13-like [Cicer arietinum]
Length=298

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAGSSSGP PF+P S GNTSDVVEASGTA PGEIVT ADRN AVN N + RPVP+R
Sbjct  13   KPWERAGSSSGPTPFRPPSGGNTSDVVEASGTAKPGEIVTTADRNAAVNGNTLTRPVPTR  72

Query  338  PWEQQ  352
            PWEQ 
Sbjct  73   PWEQN  77



>gb|EYU36869.1| hypothetical protein MIMGU_mgv1a010448mg [Erythranthe guttata]
Length=312

 Score =   106 bits (265),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = +2

Query  116  MENNPQpsgggsppKP-WERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRN  292
            MENN Q SGGG PP   WERAGSSSGP PFKPSS GNTS VVEASGTA PGE+V+ A+R+
Sbjct  1    MENNAQASGGGGPPPKPWERAGSSSGPGPFKPSSAGNTSAVVEASGTAQPGEVVSTANRS  60

Query  293  TAVNRNAVARPVPSRPWEQQQ  355
            T VN N + RPVP+RPWEQQQ
Sbjct  61   TTVNTNTLGRPVPARPWEQQQ  81



>ref|XP_007049511.1| Peroxin 13 [Theobroma cacao]
 gb|EOX93668.1| Peroxin 13 [Theobroma cacao]
Length=290

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +2

Query  116  MENNPQpsgggspp-KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRN  292
            M++NPQ    G  P KPWE+A SSSG  PFKP SPG+TSDVVEASGTA PGEIV+  DR 
Sbjct  1    MDSNPQQPAAGGSPPKPWEQARSSSGSGPFKPPSPGSTSDVVEASGTARPGEIVSTTDRT  60

Query  293  TAVNRNAVARPVPSRPWEQQ  352
            TAVNRNAV RP+PSRPWEQQ
Sbjct  61   TAVNRNAVGRPLPSRPWEQQ  80



>ref|XP_006344085.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Solanum 
tuberosum]
Length=305

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  164  WERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSRPW  343
            WERAGSSSGPAPFKP S G+TSDVVEASGTA PGEIV+ A+RNTAVN + +ARPVP+RPW
Sbjct  18   WERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSTANRNTAVNNSTLARPVPTRPW  77

Query  344  EQQQ  355
            EQQQ
Sbjct  78   EQQQ  81



>gb|KDO50763.1| hypothetical protein CISIN_1g022548mg [Citrus sinensis]
Length=249

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  164  WERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSRPW  343
            WERAG++SGP PFKP S GNTSDVVE+SGTANPGEIV+A+DR   VNRNAV RP+PSRPW
Sbjct  18   WERAGAASGPTPFKPPSAGNTSDVVESSGTANPGEIVSASDRTATVNRNAVGRPLPSRPW  77

Query  344  EQ  349
            EQ
Sbjct  78   EQ  79



>gb|KJB42660.1| hypothetical protein B456_007G162100 [Gossypium raimondii]
Length=236

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+AG S+G  PFKP SPG+TSDVVEASGTA PGE+V+ ADR  AVNRNAV RP+PSR
Sbjct  16   KPWEQAGGSTGSGPFKPPSPGSTSDVVEASGTARPGELVSTADRTAAVNRNAVGRPLPSR  75

Query  338  PWEQQ  352
            PWEQQ
Sbjct  76   PWEQQ  80



>ref|XP_007150473.1| hypothetical protein PHAVU_005G155400g [Phaseolus vulgaris]
 gb|ESW22467.1| hypothetical protein PHAVU_005G155400g [Phaseolus vulgaris]
Length=298

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M + PQPSG   PPKPWE+AGSSSGP PFKP S GNTS+VVEASGTA PGEIV+ +DR  
Sbjct  1    MAHKPQPSGNSPPPKPWEQAGSSSGPVPFKPPSAGNTSEVVEASGTAKPGEIVSGSDRTA  60

Query  296  AVNRNAVARPVPSRPWEQ  349
            AVNRN++ RPVP+RPWEQ
Sbjct  61   AVNRNSLGRPVPTRPWEQ  78



>gb|KJB42659.1| hypothetical protein B456_007G162100 [Gossypium raimondii]
Length=203

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+AG S+G  PFKP SPG+TSDVVEASGTA PGE+V+ ADR  AVNRNAV RP+PSR
Sbjct  16   KPWEQAGGSTGSGPFKPPSPGSTSDVVEASGTARPGELVSTADRTAAVNRNAVGRPLPSR  75

Query  338  PWEQQ  352
            PWEQQ
Sbjct  76   PWEQQ  80



>ref|XP_004299871.1| PREDICTED: peroxisomal membrane protein 13 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=318

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAGSSSGPAPFKP S G+TSDVVEASGTA PGEIV++ADR+T  NRN + RPVPSR
Sbjct  16   KPWERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSSADRSTPNNRNTLGRPVPSR  75

Query  338  PWEQQQ  355
            PWEQ  
Sbjct  76   PWEQNY  81



>ref|XP_004299872.1| PREDICTED: peroxisomal membrane protein 13 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=308

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAGSSSGPAPFKP S G+TSDVVEASGTA PGEIV++ADR+T  NRN + RPVPSR
Sbjct  16   KPWERAGSSSGPAPFKPPSAGSTSDVVEASGTARPGEIVSSADRSTPNNRNTLGRPVPSR  75

Query  338  PWEQQQ  355
            PWEQ  
Sbjct  76   PWEQNY  81



>gb|KJB42658.1| hypothetical protein B456_007G162100, partial [Gossypium raimondii]
Length=293

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+AG S+G  PFKP SPG+TSDVVEASGTA PGE+V+ ADR  AVNRNAV RP+PSR
Sbjct  16   KPWEQAGGSTGSGPFKPPSPGSTSDVVEASGTARPGELVSTADRTAAVNRNAVGRPLPSR  75

Query  338  PWEQQ  352
            PWEQQ
Sbjct  76   PWEQQ  80



>gb|KJB42661.1| hypothetical protein B456_007G162100 [Gossypium raimondii]
Length=293

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+AG S+G  PFKP SPG+TSDVVEASGTA PGE+V+ ADR  AVNRNAV RP+PSR
Sbjct  16   KPWEQAGGSTGSGPFKPPSPGSTSDVVEASGTARPGELVSTADRTAAVNRNAVGRPLPSR  75

Query  338  PWEQQ  352
            PWEQQ
Sbjct  76   PWEQQ  80



>gb|KHG04730.1| Peroxisomal membrane 13 -like protein [Gossypium arboreum]
Length=293

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+AG S+G  PFKP SPG+TSDVVEASGTA PGE+V+ ADR  AVNRNAV RP+PSR
Sbjct  16   KPWEQAGGSTGAGPFKPPSPGSTSDVVEASGTARPGELVSTADRTAAVNRNAVGRPLPSR  75

Query  338  PWEQQ  352
            PWEQQ
Sbjct  76   PWEQQ  80



>gb|KDO50762.1| hypothetical protein CISIN_1g022548mg [Citrus sinensis]
Length=295

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  164  WERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSRPW  343
            WERAG++SGP PFKP S GNTSDVVE+SGTANPGEIV+A+DR   VNRNAV RP+PSRPW
Sbjct  18   WERAGAASGPTPFKPPSAGNTSDVVESSGTANPGEIVSASDRTATVNRNAVGRPLPSRPW  77

Query  344  EQ  349
            EQ
Sbjct  78   EQ  79



>ref|XP_006442934.1| hypothetical protein CICLE_v10021425mg [Citrus clementina]
 gb|ESR56174.1| hypothetical protein CICLE_v10021425mg [Citrus clementina]
Length=249

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  164  WERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSRPW  343
            WE+AG++SGP PFKP S GNTSDVVE+SGTANPGEIV+A+DR   VNRNAV RP+PSRPW
Sbjct  18   WEQAGAASGPTPFKPPSAGNTSDVVESSGTANPGEIVSASDRTATVNRNAVGRPLPSRPW  77

Query  344  EQ  349
            EQ
Sbjct  78   EQ  79



>ref|XP_004152142.1| PREDICTED: uncharacterized protein LOC101221260 [Cucumis sativus]
 ref|XP_004164566.1| PREDICTED: uncharacterized LOC101221260 [Cucumis sativus]
 gb|KGN52996.1| hypothetical protein Csa_4G010950 [Cucumis sativus]
Length=298

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAG SSG APF+P S GNTSDVVEASGTA PGEIV+++DR  AVNRN++ RPVP+R
Sbjct  16   KPWERAGGSSGSAPFRPPSAGNTSDVVEASGTAKPGEIVSSSDRTAAVNRNSLGRPVPTR  75

Query  338  PWEQ  349
            PWEQ
Sbjct  76   PWEQ  79



>gb|ACU21190.1| unknown [Glycine max]
Length=216

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+AGS SGPAPFKP S GNTSDVVEASGTA PGEIV+++DR+ AVNRN + RPVPSR
Sbjct  15   KPWEQAGSPSGPAPFKPPSAGNTSDVVEASGTAKPGEIVSSSDRSAAVNRNTLGRPVPSR  74

Query  338  PWEQ  349
            PW Q
Sbjct  75   PWGQ  78



>ref|XP_008347893.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal membrane protein 
13-like [Malus domestica]
Length=465

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 2/66 (3%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPV--P  331
            KPWERA SSSGP PFKP S G+TSDVVEASGTA PGEIV ++DRNTAVNRNA+ARPV  P
Sbjct  19   KPWERASSSSGPTPFKPPSAGSTSDVVEASGTAKPGEIVPSSDRNTAVNRNALARPVPFP  78

Query  332  SRPWEQ  349
            SRPWEQ
Sbjct  79   SRPWEQ  84



>ref|XP_006442935.1| hypothetical protein CICLE_v10021425mg [Citrus clementina]
 ref|XP_006478829.1| PREDICTED: peroxisomal membrane protein 13-like [Citrus sinensis]
 gb|ESR56175.1| hypothetical protein CICLE_v10021425mg [Citrus clementina]
Length=295

 Score =   103 bits (256),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  164  WERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSRPW  343
            WE+AG++SGP PFKP S GNTSDVVE+SGTANPGEIV+A+DR   VNRNAV RP+PSRPW
Sbjct  18   WEQAGAASGPTPFKPPSAGNTSDVVESSGTANPGEIVSASDRTATVNRNAVGRPLPSRPW  77

Query  344  EQ  349
            EQ
Sbjct  78   EQ  79



>ref|XP_008454097.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal membrane protein 
13 [Cucumis melo]
Length=296

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWER G SSG APF+P S GNTSDVVEASGTA PGEIV+++DR  AVNRN++ RPVP+R
Sbjct  16   KPWERVGGSSGSAPFRPPSAGNTSDVVEASGTAKPGEIVSSSDRTAAVNRNSLGRPVPTR  75

Query  338  PWEQ  349
            PWEQ
Sbjct  76   PWEQ  79



>ref|XP_010069556.1| PREDICTED: peroxisomal membrane protein 13 [Eucalyptus grandis]
 gb|KCW57942.1| hypothetical protein EUGRSUZ_H00681 [Eucalyptus grandis]
Length=305

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAG SSGPAPFKP S G+TSD+VEASGTA PGEIV+  DR   VN N++ARPVP+R
Sbjct  15   KPWERAGGSSGPAPFKPPSSGSTSDIVEASGTARPGEIVSTTDRTVPVNANSIARPVPTR  74

Query  338  PWEQQ  352
            PWEQQ
Sbjct  75   PWEQQ  79



>gb|KCW87650.1| hypothetical protein EUGRSUZ_A00039 [Eucalyptus grandis]
Length=230

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWER+G+SSGPAPFKP S G+TSDVVEASGTA PGEIV + DR T  N NA+ RPVP+R
Sbjct  16   KPWERSGASSGPAPFKPPSAGSTSDVVEASGTARPGEIVASTDRTTTPNTNALGRPVPTR  75

Query  338  PWEQQ  352
            PWEQQ
Sbjct  76   PWEQQ  80



>gb|KCW87649.1| hypothetical protein EUGRSUZ_A00039 [Eucalyptus grandis]
Length=238

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWER+G+SSGPAPFKP S G+TSDVVEASGTA PGEIV + DR T  N NA+ RPVP+R
Sbjct  16   KPWERSGASSGPAPFKPPSAGSTSDVVEASGTARPGEIVASTDRTTTPNTNALGRPVPTR  75

Query  338  PWEQQ  352
            PWEQQ
Sbjct  76   PWEQQ  80



>ref|XP_010672281.1| PREDICTED: peroxisomal membrane protein 13 [Beta vulgaris subsp. 
vulgaris]
Length=290

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M   PQ    G PPKPWER+GSSSGPAPF+P S G TSDVVEASGTA PGEIV+ ++RNT
Sbjct  1    MSTTPQQGASGPPPKPWERSGSSSGPAPFRPPSSGATSDVVEASGTAKPGEIVSTSNRNT  60

Query  296  AVNRNAVARPVPSRPWE  346
            AVN NA  RP+P+RPWE
Sbjct  61   AVNVNAAGRPLPTRPWE  77



>ref|XP_003537925.1| PREDICTED: peroxisomal membrane protein 13-like [Glycine max]
 gb|KHN06187.1| Peroxisomal membrane protein 13 [Glycine soja]
Length=280

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+A SSSGPAPFKP S G+TSDVVEASGTA PGEIV A+D+   VNRNA+ RP+P+R
Sbjct  10   KPWEKAASSSGPAPFKPPSAGSTSDVVEASGTAKPGEIVPASDKTATVNRNALGRPLPTR  69

Query  338  PWEQ  349
            PWEQ
Sbjct  70   PWEQ  73



>ref|XP_010025045.1| PREDICTED: peroxisomal membrane protein 13-like [Eucalyptus grandis]
 gb|KCW87648.1| hypothetical protein EUGRSUZ_A00039 [Eucalyptus grandis]
Length=293

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWER+G+SSGPAPFKP S G+TSDVVEASGTA PGEIV + DR T  N NA+ RPVP+R
Sbjct  16   KPWERSGASSGPAPFKPPSAGSTSDVVEASGTARPGEIVASTDRTTTPNTNALGRPVPTR  75

Query  338  PWEQQ  352
            PWEQQ
Sbjct  76   PWEQQ  80



>gb|AGV54834.1| hypothetical protein [Phaseolus vulgaris]
Length=291

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M +NPQPS    PPKPWE+  +SSGPAPFKP S G TSDVVE+SGTA PGEIV+A++   
Sbjct  1    MASNPQPSAYSPPPKPWEKVAASSGPAPFKPPSAGTTSDVVESSGTAKPGEIVSASNNTA  60

Query  296  AVNRNAVARPVPSRPWEQ  349
             VNRNA+ RP+P+RPWEQ
Sbjct  61   TVNRNALGRPLPTRPWEQ  78



>ref|XP_009388497.1| PREDICTED: peroxisomal membrane protein 13-like [Musa acuminata 
subsp. malaccensis]
Length=284

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERAG+SSGP PF+P S G TS+VVEASGTA PGE+VT ++RN  VNRN + RP+P R
Sbjct  15   KPWERAGTSSGPVPFRPQSSGRTSEVVEASGTAKPGEVVTGSERNATVNRNTLGRPLPPR  74

Query  338  PWEQ  349
            PW+Q
Sbjct  75   PWQQ  78



>gb|KCW87079.1| hypothetical protein EUGRSUZ_B03613 [Eucalyptus grandis]
Length=91

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +2

Query  101  LPLCLMENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTA  280
            L L L   + + +G  S   PWERAG SSGPAPFKP S G+TSD+VEASGTA PGEIV+ 
Sbjct  2    LGLALRVISLEAAGAKSGHDPWERAGGSSGPAPFKPPSSGSTSDIVEASGTARPGEIVST  61

Query  281  ADRNTAVNRNAVARPVPSRPWEQQQ  355
             DR   VN N++ARPVP+RP   Q 
Sbjct  62   TDRTIPVNANSIARPVPTRPCAHQS  86



>ref|XP_002524578.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF37786.1| nucleic acid binding protein, putative [Ricinus communis]
Length=313

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 2/67 (3%)
 Frame = +2

Query  158  KPWERAG-SSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNR-NAVARPVP  331
            KPWER+G SSSGP PFKP +PG+TSDVVEASGTA PGEIV AA+R TAVN  N + RPVP
Sbjct  29   KPWERSGTSSSGPTPFKPPTPGSTSDVVEASGTARPGEIVPAANRTTAVNNTNTLGRPVP  88

Query  332  SRPWEQQ  352
            +RPWEQQ
Sbjct  89   TRPWEQQ  95



>gb|KCW81100.1| hypothetical protein EUGRSUZ_C02476 [Eucalyptus grandis]
Length=84

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  161  PWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSRP  340
            PWERAG SSGPAPFKP S G+TSD VEAS TA PGEIV+  D+   VN N++ARPVP+RP
Sbjct  22   PWERAGGSSGPAPFKPPSSGSTSDRVEASETARPGEIVSTTDKTIPVNANSIARPVPTRP  81

Query  341  WEQ  349
            WEQ
Sbjct  82   WEQ  84



>gb|ABF99230.1| expressed protein [Oryza sativa Japonica Group]
Length=190

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPVPS  334
            KPWERAG+SSGPAPFKP S G+TSD+VEASGTA PGE+V+AA+ N A N N+ ++RPVP 
Sbjct  9    KPWERAGTSSGPAPFKPPSGGSTSDIVEASGTAKPGEVVSAAESNVASNVNSTISRPVPP  68

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  69   RPWQQQ  74



>ref|NP_001051486.1| Os03g0786000 [Oryza sativa Japonica Group]
 gb|ABF99229.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13400.1| Os03g0786000 [Oryza sativa Japonica Group]
 gb|EAY92093.1| hypothetical protein OsI_13799 [Oryza sativa Indica Group]
 gb|EAZ28826.1| hypothetical protein OsJ_12860 [Oryza sativa Japonica Group]
 dbj|BAG87836.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=270

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPVPS  334
            KPWERAG+SSGPAPFKP S G+TSD+VEASGTA PGE+V+AA+ N A N N+ ++RPVP 
Sbjct  9    KPWERAGTSSGPAPFKPPSGGSTSDIVEASGTAKPGEVVSAAESNVASNVNSTISRPVPP  68

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  69   RPWQQQ  74



>ref|XP_007131922.1| hypothetical protein PHAVU_011G052000g [Phaseolus vulgaris]
 gb|ESW03916.1| hypothetical protein PHAVU_011G052000g [Phaseolus vulgaris]
Length=286

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+  +SSGPAPFKP S G TSDVVE+SGTA PGEIV+A++    VNRNA+ RP+P+R
Sbjct  10   KPWEKVAASSGPAPFKPPSAGTTSDVVESSGTAKPGEIVSASNNTATVNRNALGRPLPTR  69

Query  338  PWEQ  349
            PWEQ
Sbjct  70   PWEQ  73



>ref|XP_011006736.1| PREDICTED: peroxisomal membrane protein 13-like [Populus euphratica]
Length=288

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAG-SSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRN  292
            M++N Q  GG  PPKPWERAG SSSGP PFKP SPG+TSDVVEASGT  PGEIV A   N
Sbjct  1    MDSNSQQPGGSPPPKPWERAGTSSSGPTPFKPPSPGSTSDVVEASGTTKPGEIVPATGGN  60

Query  293  TAVNRNAVARPVPSRPWEQQ  352
            T    N++ RPVP+RPWEQQ
Sbjct  61   TVATANSLGRPVPTRPWEQQ  80



>ref|XP_002320551.2| hypothetical protein POPTR_0014s17220g [Populus trichocarpa]
 gb|EEE98866.2| hypothetical protein POPTR_0014s17220g [Populus trichocarpa]
Length=308

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAG-SSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRN  292
            M++N Q  G   PPKPWERAG SSSGP PFKP SPG+TSDVVEASGT  PGEIV A   N
Sbjct  1    MDSNSQQPGSSPPPKPWERAGTSSSGPTPFKPPSPGSTSDVVEASGTTKPGEIVPATGGN  60

Query  293  TAVNRNAVARPVPSRPWEQQ  352
            T    N+  RPVP+RPWEQQ
Sbjct  61   TVATANSFGRPVPTRPWEQQ  80



>dbj|BAK08359.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=270

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVN-RNAVARPVPS  334
            KPWER G+SSGPAPFKP S G+TSDVVEASGTA PGE+V+AA  N A N  N VA PVP 
Sbjct  9    KPWERVGTSSGPAPFKPPSGGSTSDVVEASGTAKPGEVVSAAQSNAAFNVNNTVAGPVPP  68

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  69   RPWQQQ  74



>gb|EPS63109.1| hypothetical protein M569_11678, partial [Genlisea aurea]
Length=201

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAG-SSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPS  334
            KPWERAG SSSGPAPF+P S GNTSDVVEASGTA PGE+V++       NRN + RP+P+
Sbjct  1    KPWERAGGSSSGPAPFRPPSAGNTSDVVEASGTAQPGEVVSSTSDVNNTNRNTLGRPLPT  60

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  61   RPWDQQ  66



>ref|XP_003558107.2| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Brachypodium 
distachyon]
Length=699

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVN-RNAVARPVPS  334
            KPWER G+SSGPAPFKP S G TSD+VEASGTA PGE+V+AA  N A+   N V+RPVP 
Sbjct  9    KPWERVGTSSGPAPFKPPSGGTTSDIVEASGTAKPGEVVSAAQSNAALGVNNTVSRPVPP  68

Query  335  RPWEQQQ  355
            RPW+QQQ
Sbjct  69   RPWQQQQ  75



>ref|XP_010547186.1| PREDICTED: peroxisomal membrane protein 13 isoform X2 [Tarenaya 
hassleriana]
Length=295

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARPVPS  334
            KPWE+AG +SGP+PFKP + G+T+D VE+SGTA PGEIVT+A+R  TA N NA++RPVP+
Sbjct  12   KPWEQAGGTSGPSPFKPPTNGSTTDAVESSGTARPGEIVTSANRTTTAANTNALSRPVPT  71

Query  335  RPWEQQ  352
            RPWEQQ
Sbjct  72   RPWEQQ  77



>ref|XP_010547185.1| PREDICTED: peroxisomal membrane protein 13 isoform X1 [Tarenaya 
hassleriana]
Length=296

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARPVPS  334
            KPWE+AG +SGP+PFKP + G+T+D VE+SGTA PGEIVT+A+R  TA N NA++RPVP+
Sbjct  13   KPWEQAGGTSGPSPFKPPTNGSTTDAVESSGTARPGEIVTSANRTTTAANTNALSRPVPT  72

Query  335  RPWEQQ  352
            RPWEQQ
Sbjct  73   RPWEQQ  78



>ref|XP_006657451.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Oryza 
brachyantha]
Length=278

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRN-AVARPV  328
            KPWERAG+  +SGPAPFKP S G TSDVVEASGTA PGE VTAA+RNT+ N N AV+RP+
Sbjct  9    KPWERAGAEGASGPAPFKPPSGGTTSDVVEASGTAKPGETVTAAERNTSANINSAVSRPM  68

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  69   PQRPWQQ  75



>ref|XP_006657452.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Oryza 
brachyantha]
Length=276

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRN-AVARPV  328
            KPWERAG+  +SGPAPFKP S G TSDVVEASGTA PGE VTAA+RNT+ N N AV+RP+
Sbjct  7    KPWERAGAEGASGPAPFKPPSGGTTSDVVEASGTAKPGETVTAAERNTSANINSAVSRPM  66

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  67   PQRPWQQ  73



>ref|XP_011043592.1| PREDICTED: peroxisomal membrane protein 13-like [Populus euphratica]
Length=303

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M +NPQPS    PPKPWE++G SSG  PFKP SPG+TSDVVEASGTA PGEIV ++  NT
Sbjct  1    MASNPQPSANNPPPKPWEQSGGSSGATPFKPPSPGSTSDVVEASGTARPGEIVQSSG-NT  59

Query  296  AVNRNAVARPVPSRPWEQ  349
              N NAV RP+P+RPWEQ
Sbjct  60   TNNANAVGRPLPARPWEQ  77



>ref|XP_011047732.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Populus 
euphratica]
Length=224

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M +NPQPS    PPKPWE+AG SSG  PFKP S G+TSDVVEASGTA PGEIV ++   +
Sbjct  1    MASNPQPSANNPPPKPWEQAGGSSGATPFKPPSAGSTSDVVEASGTARPGEIVQSSG--S  58

Query  296  AVNRNAVARPVPSRPWEQ  349
            A N NAV RP+PSRPWEQ
Sbjct  59   AANTNAVGRPLPSRPWEQ  76



>ref|XP_006858184.1| hypothetical protein AMTR_s00062p00160630 [Amborella trichopoda]
 gb|ERN19651.1| hypothetical protein AMTR_s00062p00160630 [Amborella trichopoda]
Length=314

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWER  SS+GP+PFKP +PG T+DVVEASGTA PGEI   A+RNT VN N   RP P R
Sbjct  36   KPWERVESSAGPSPFKPPAPGRTTDVVEASGTAKPGEIAPVAERNTVVNGNPAGRPQPVR  95

Query  338  PWEQQQ  355
            PWEQ +
Sbjct  96   PWEQDR  101



>gb|EMT00619.1| Putative peroxisomal (S)-2-hydroxy-acid oxidase 1 [Aegilops tauschii]
Length=756

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVN-RNAVARPVPS  334
            KPWER G+SSGPAPFKP S G+TSDVVEASGTA PGE+V+AA  N A N  N VA PVP 
Sbjct  9    KPWERVGTSSGPAPFKPPSGGSTSDVVEASGTAKPGEVVSAAQSNAAFNVNNTVAGPVPP  68

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  69   RPWQQQ  74



>ref|XP_011047730.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Populus 
euphratica]
Length=281

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M +NPQPS    PPKPWE+AG SSG  PFKP S G+TSDVVEASGTA PGEIV ++   +
Sbjct  1    MASNPQPSANNPPPKPWEQAGGSSGATPFKPPSAGSTSDVVEASGTARPGEIVQSS--GS  58

Query  296  AVNRNAVARPVPSRPWEQ  349
            A N NAV RP+PSRPWEQ
Sbjct  59   AANTNAVGRPLPSRPWEQ  76



>ref|XP_009399015.1| PREDICTED: peroxisomal membrane protein 13 [Musa acuminata subsp. 
malaccensis]
Length=278

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE AG++SGPAPFKP S G+TSDVVEASGTA PGEIV  ADRN   N   +AR VP R
Sbjct  14   KPWELAGTTSGPAPFKPPSSGSTSDVVEASGTAKPGEIVPTADRNVTANTTTLARSVPPR  73

Query  338  PWE  346
            PW+
Sbjct  74   PWQ  76



>ref|XP_011011867.1| PREDICTED: peroxisomal membrane protein 13-like [Populus euphratica]
Length=281

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 60/78 (77%), Gaps = 2/78 (3%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M +NPQPS    PPKPWE+AG SSG  PFKP S G+TSDVVEASGTA PGEIV ++   +
Sbjct  1    MASNPQPSANNPPPKPWEQAGGSSGATPFKPPSAGSTSDVVEASGTARPGEIVQSS--GS  58

Query  296  AVNRNAVARPVPSRPWEQ  349
            A N NAV RP+PSRPWEQ
Sbjct  59   AANTNAVGRPLPSRPWEQ  76



>tpg|DAA51783.1| TPA: glycine-rich protein [Zea mays]
Length=287

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPVPS  334
            KPWERAG+SSGP PFKP S G+TSDVVEASGTA  GE+V+AA  N A N N+ ++ PVP 
Sbjct  33   KPWERAGNSSGPVPFKPPSGGSTSDVVEASGTAKHGEVVSAAGNNVASNVNSTISMPVPP  92

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  93   RPWQQQ  98



>ref|XP_006372778.1| glycine-rich family protein [Populus trichocarpa]
 gb|ERP50575.1| glycine-rich family protein [Populus trichocarpa]
Length=297

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M +NPQPS    PPKPWE++G SSG  PFKP S G+TSDVVEASGTA PGEIV ++  NT
Sbjct  1    MASNPQPSANNPPPKPWEQSGGSSGATPFKPPSAGSTSDVVEASGTARPGEIVQSSG-NT  59

Query  296  AVNRNAVARPVPSRPWEQ  349
              N NAV RP+P+RPWEQ
Sbjct  60   TNNTNAVGRPLPARPWEQ  77



>ref|XP_010929991.1| PREDICTED: peroxisomal membrane protein 13-like [Elaeis guineensis]
Length=267

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+AG+SSGPAPFKP S G+TS+VVEASGTAN GEIV  A RNT+   N + RPVP R
Sbjct  13   KPWEQAGNSSGPAPFKPPSSGSTSEVVEASGTANAGEIVPNAQRNTSTT-NTLGRPVPPR  71

Query  338  PWEQ  349
            PWEQ
Sbjct  72   PWEQ  75



>gb|ABK93770.1| unknown [Populus trichocarpa]
Length=304

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +2

Query  116  MENNPQpsgggsppKPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNT  295
            M +NPQPS    PPKPWE++G SSG  PFKP S G+TSDVVEASGTA PGEIV ++  NT
Sbjct  1    MASNPQPSANNPPPKPWEQSGGSSGATPFKPPSAGSTSDVVEASGTARPGEIVQSSG-NT  59

Query  296  AVNRNAVARPVPSRPWEQ  349
              N NAV RP+P+RPWEQ
Sbjct  60   TNNTNAVGRPLPARPWEQ  77



>ref|XP_006650694.1| PREDICTED: peroxisomal membrane protein 13-like [Oryza brachyantha]
Length=269

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPVPS  334
            KPWE AG+SSGPAPF+P S G+TSD+VEASGTA PGE+V+A + N   N N  ++RP+P 
Sbjct  9    KPWEHAGTSSGPAPFRPPSGGSTSDIVEASGTAKPGEVVSATEGNVTSNVNGNISRPLPP  68

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  69   RPWQQQ  74



>gb|ACL54731.1| unknown [Zea mays]
Length=264

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPVPS  334
            KPWERAG+SSGP PFKP S G+TSDVVEASGTA  GE+V+AA  N A N N+ ++ PVP 
Sbjct  10   KPWERAGNSSGPVPFKPPSGGSTSDVVEASGTAKHGEVVSAAGNNVASNVNSTISMPVPP  69

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  70   RPWQQQ  75



>gb|KJB84020.1| hypothetical protein B456_N001500 [Gossypium raimondii]
Length=255

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+ G SS    FK  S G+T+DVVEASGTA PGEIV+  DR TAV+RN + RP+P+R
Sbjct  24   KPWEQVGGSSDSRTFKSPSIGSTNDVVEASGTARPGEIVSTTDRTTAVDRNVLGRPLPNR  83

Query  338  PWEQQ  352
            PWEQQ
Sbjct  84   PWEQQ  88



>ref|XP_006407824.1| hypothetical protein EUTSA_v10021215mg [Eutrema salsugineum]
 gb|ESQ49277.1| hypothetical protein EUTSA_v10021215mg [Eutrema salsugineum]
Length=303

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARPVPS  334
            KPWE+ G++SGP PF+P S  +T+D VEASGTANPGE+V + +R NTA N NA++RPVP+
Sbjct  13   KPWEQEGNTSGPKPFRPPSNTSTADSVEASGTANPGELVPSVNRTNTAANMNALSRPVPT  72

Query  335  RPWEQQ  352
            RPWEQQ
Sbjct  73   RPWEQQ  78



>ref|XP_008796037.1| PREDICTED: peroxisomal membrane protein 13-like [Phoenix dactylifera]
Length=268

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWE+AG+SSGPAPFKP S G+TS+VVEASGTAN GEIV  A RNT+   N + RP+P R
Sbjct  13   KPWEQAGNSSGPAPFKPPSSGSTSEVVEASGTANAGEIVPNAQRNTSTT-NTLGRPLPPR  71

Query  338  PWEQ  349
            PWEQ
Sbjct  72   PWEQ  75



>ref|NP_001149646.1| LOC100283272 [Zea mays]
 gb|ACG36223.1| glycine-rich protein [Zea mays]
Length=264

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPVPS  334
            KPWERAG+SSGP PFKP S G+TSDVVEASGTA  GE+V+A+  N A N N+ ++ PVP 
Sbjct  10   KPWERAGNSSGPVPFKPPSGGSTSDVVEASGTAKHGEVVSASGNNVASNVNSTISMPVPP  69

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  70   RPWQQQ  75



>ref|NP_001058908.1| Os07g0152800 [Oryza sativa Japonica Group]
 dbj|BAC84718.1| putative glycine-rich protein [Oryza sativa Japonica Group]
 dbj|BAF20822.1| Os07g0152800 [Oryza sativa Japonica Group]
 dbj|BAG89526.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81528.1| hypothetical protein OsI_24927 [Oryza sativa Indica Group]
 gb|EEE66580.1| hypothetical protein OsJ_23124 [Oryza sativa Japonica Group]
Length=280

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVN-RNAVARPV  328
            KPWERAG+  +SGPAPFKP S G TSDVVEASGTA PGE VTA +RN + N  N V+RP+
Sbjct  7    KPWERAGAEGTSGPAPFKPPSGGTTSDVVEASGTAKPGETVTATERNLSANVNNPVSRPM  66

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  67   PQRPWQQ  73



>ref|XP_008775485.1| PREDICTED: peroxisomal membrane protein 13-like [Phoenix dactylifera]
Length=283

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPWERA +SSGPAPFKP S G+TSDVVEASG A PGE V   +R+   NRN + RP+P R
Sbjct  15   KPWERATTSSGPAPFKPPSSGSTSDVVEASGAAKPGETVPNTERSVLPNRNTIGRPLPPR  74

Query  338  PWEQ  349
            PW+Q
Sbjct  75   PWQQ  78



>ref|XP_006298214.1| hypothetical protein CARUB_v10014265mg [Capsella rubella]
 gb|EOA31112.1| hypothetical protein CARUB_v10014265mg [Capsella rubella]
Length=302

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARPVPS  334
            KPWE+ G++SGP PF+P S  +T+  VEASGTANPGE+V++ +R NTA N NA++RPVP+
Sbjct  12   KPWEQEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVSSVNRTNTAANMNALSRPVPT  71

Query  335  RPWEQQ  352
            RPWEQQ
Sbjct  72   RPWEQQ  77



>ref|XP_010941061.1| PREDICTED: peroxisomal membrane protein 13-like [Elaeis guineensis]
 gb|AGE46029.1| putative peroxisome biogenesis factor 13 [Elaeis guineensis]
Length=284

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +2

Query  158  KPWERAGSSSGP-APFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPS  334
            KPWERA ++SGP APFKP S G+TSD+VEASGTA PGE V + +R+   NRN + RP+PS
Sbjct  15   KPWERATTTSGPPAPFKPPSSGSTSDIVEASGTAKPGEAVPSTERSVLPNRNTIGRPLPS  74

Query  335  RPWEQ  349
            RPW+Q
Sbjct  75   RPWQQ  79



>gb|EMT28271.1| hypothetical protein F775_30696 [Aegilops tauschii]
Length=287

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVN-RNAVARPV  328
            KPWERAG+  +SGP+PFKP S G+TSDVVEASGTA PGE + A +RN + N  N+++RP+
Sbjct  7    KPWERAGAEGTSGPSPFKPPSGGSTSDVVEASGTAKPGETIAATERNMSANVNNSISRPM  66

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  67   PQRPWQQ  73



>ref|XP_004955471.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Setaria 
italica]
Length=278

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPV  328
            KPWER+G   ++GPAPFKP S G+TSDVVEASGTA PGE V+AA+RN + N N+ V+RPV
Sbjct  7    KPWERSGGEGTAGPAPFKPPSGGSTSDVVEASGTAKPGENVSAAERNASGNVNSTVSRPV  66

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  67   PQRPWQQ  73



>ref|XP_004981531.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Setaria 
italica]
Length=263

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPVPS  334
            KPWERAG+SSGPAPFKP S G T++VVEASGTA  GEIV+A   N   N  + ++RPVP 
Sbjct  10   KPWERAGASSGPAPFKPPSGGTTNEVVEASGTAKHGEIVSATGNNVTSNVTSNISRPVPP  69

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  70   RPWQQQ  75



>ref|XP_010551992.1| PREDICTED: peroxisomal membrane protein 13-like [Tarenaya hassleriana]
Length=276

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRN-TAVNRNAVARPVPS  334
            KP ERAGS+SGP+PFKP +  +T+D VE+SGTA PGEIVT  +R  T  N NA+ RPVP+
Sbjct  13   KPGERAGSASGPSPFKPPTNSSTADAVESSGTARPGEIVTTTNRTATVANTNALGRPVPT  72

Query  335  RPWEQQ  352
            RPWEQQ
Sbjct  73   RPWEQQ  78



>ref|XP_004955472.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Setaria 
italica]
Length=278

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPV  328
            KPWER+G   ++GPAPFKP S G+TSDVVEASGTA PGE V+AA+RN + N N+ V+RPV
Sbjct  9    KPWERSGGEGTAGPAPFKPPSGGSTSDVVEASGTAKPGENVSAAERNASGNVNSTVSRPV  68

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  69   PQRPWQQ  75



>ref|XP_004981532.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Setaria 
italica]
Length=240

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPVPS  334
            KPWERAG+SSGPAPFKP S G T++VVEASGTA  GEIV+A   N   N  + ++RPVP 
Sbjct  10   KPWERAGASSGPAPFKPPSGGTTNEVVEASGTAKHGEIVSATGNNVTSNVTSNISRPVPP  69

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  70   RPWQQQ  75



>ref|XP_004955473.1| PREDICTED: peroxisomal membrane protein 13-like isoform X3 [Setaria 
italica]
Length=276

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPV  328
            KPWER+G   ++GPAPFKP S G+TSDVVEASGTA PGE V+AA+RN + N N+ V+RPV
Sbjct  7    KPWERSGGEGTAGPAPFKPPSGGSTSDVVEASGTAKPGENVSAAERNASGNVNSTVSRPV  66

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  67   PQRPWQQ  73



>emb|CDX74040.1| BnaA03g30070D [Brassica napus]
Length=298

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 4/70 (6%)
 Frame = +2

Query  158  KPWERAGS---SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARP  325
            KPWE+ G+   +SGP PF+P S  +T+D VEASGTANPGE+V++ +R NTA   N + RP
Sbjct  66   KPWEQEGNNNNTSGPKPFRPPSNTSTADSVEASGTANPGELVSSVNRTNTAATMNGLTRP  125

Query  326  VPSRPWEQQQ  355
            VPSRPWEQQQ
Sbjct  126  VPSRPWEQQQ  135



>ref|XP_009134980.1| PREDICTED: peroxisomal membrane protein 13-like [Brassica rapa]
Length=304

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 4/70 (6%)
 Frame = +2

Query  158  KPWERAGS---SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARP  325
            KPWE+ G+   +SGP PF+P S  +T+D VEASGTANPGE+V++A+R NTA   N + RP
Sbjct  10   KPWEQEGNNNNASGPKPFRPPSNTSTADSVEASGTANPGELVSSANRTNTAATMNGLTRP  69

Query  326  VPSRPWEQQQ  355
            VPSRPWEQQQ
Sbjct  70   VPSRPWEQQQ  79



>ref|XP_010454009.1| PREDICTED: peroxisomal membrane protein 13-like [Camelina sativa]
Length=298

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARPVPS  334
            KPWE+ G++SGP PF+P S  +T+  VEASGTANPGE+V++ +R NT+ N NA++RPVP+
Sbjct  12   KPWEQEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVSSINRTNTSPNMNALSRPVPT  71

Query  335  RPWEQQ  352
            RPWEQQ
Sbjct  72   RPWEQQ  77



>dbj|BAJ85612.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVN-RNAVARPV  328
            KPWERAG+  +SGP PFKP S G+TSDVVEASGTA PGE + A +RN + N  N ++RP+
Sbjct  7    KPWERAGAEGTSGPLPFKPPSGGSTSDVVEASGTAKPGETIAATERNMSANVNNPISRPM  66

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  67   PQRPWQQ  73



>ref|XP_010486321.1| PREDICTED: peroxisomal membrane protein 13 [Camelina sativa]
Length=303

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 55/66 (83%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARPVPS  334
            KPWE+ G++SGP PF+P S  +T+  VEASGTANPGE+V++ +R NT+ N NA++RPVP+
Sbjct  12   KPWEQEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVSSINRTNTSPNMNALSRPVPT  71

Query  335  RPWEQQ  352
            RPWEQQ
Sbjct  72   RPWEQQ  77



>dbj|BAJ86828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=288

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVN-RNAVARPV  328
            KPWERAG+  +SGP PFKP S G+TSDVVEASGTA PGE + A +RN + N  N ++RP+
Sbjct  7    KPWERAGAEGTSGPLPFKPPSGGSTSDVVEASGTAKPGETIAATERNMSANVNNPISRPM  66

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  67   PQRPWQQ  73



>emb|CDY07989.1| BnaC03g35340D [Brassica napus]
Length=340

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 54/70 (77%), Gaps = 4/70 (6%)
 Frame = +2

Query  158  KPWERAGS---SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARP  325
            KPWE+ G+   +SGP PF+P S  +T+D VEASGTANPGE+V++ +R NTA   N + RP
Sbjct  94   KPWEQEGNNNNTSGPKPFRPPSNTSTADSVEASGTANPGELVSSVNRTNTAATMNGLTRP  153

Query  326  VPSRPWEQQQ  355
            VPSRPWEQQQ
Sbjct  154  VPSRPWEQQQ  163



>ref|XP_010464388.1| PREDICTED: peroxisomal membrane protein 13-like [Camelina sativa]
Length=304

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 54/66 (82%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARPVPS  334
            KPWE+ G++SGP PF+P S  +T+  VEASGTANPGE+V++ +R NT+ N NA+ RPVP+
Sbjct  12   KPWEQEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVSSINRTNTSPNMNALTRPVPT  71

Query  335  RPWEQQ  352
            RPWEQQ
Sbjct  72   RPWEQQ  77



>ref|XP_008812815.1| PREDICTED: peroxisomal membrane protein 13-like [Phoenix dactylifera]
Length=215

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPW+R GSSS PAPFKP SP +TS+VVEASGTA PGE  + A+ N + N  A+ R VPS 
Sbjct  24   KPWQRVGSSSRPAPFKPLSPRSTSNVVEASGTAKPGEAASGAEGNASANWKALGRSVPSG  83

Query  338  PWEQ  349
            PWEQ
Sbjct  84   PWEQ  87



>gb|KDP43909.1| hypothetical protein JCGZ_20919 [Jatropha curcas]
Length=263

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAV-NRNAVARPVPS  334
            KPWERAG  SG +PFKP S G+T+DVVEASGTA P E V +  RN  V NR +V RP+P 
Sbjct  10   KPWERAGVPSGSSPFKPPSTGSTNDVVEASGTAKPAETVASLGRNAMVNNRTSVRRPIPV  69

Query  335  RPWE  346
            RPWE
Sbjct  70   RPWE  73



>gb|EMS58205.1| hypothetical protein TRIUR3_02268 [Triticum urartu]
Length=317

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVN-RNAVARPV  328
            KPWERAG+  +SGP+PFKP S G+TSDVVEASGTA PGE + A + N + N  N ++RP+
Sbjct  37   KPWERAGAEGTSGPSPFKPPSGGSTSDVVEASGTAKPGETIAATEGNMSANVNNPISRPM  96

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  97   PQRPWQQ  103



>ref|NP_001132789.1| uncharacterized protein LOC100194278 [Zea mays]
 gb|ACF81784.1| unknown [Zea mays]
 tpg|DAA42630.1| TPA: hypothetical protein ZEAMMB73_006666 [Zea mays]
Length=297

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPV  328
            KPWER+G+  +SGPAPFKP S G+TSDVVEASGTA P E VTA + N A N N+ V+RP+
Sbjct  7    KPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNSTVSRPM  66

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  67   PQRPWQQ  73



>ref|XP_008667293.1| PREDICTED: uncharacterized protein LOC100194278 isoform X2 [Zea 
mays]
Length=301

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPV  328
            KPWER+G+  +SGPAPFKP S G+TSDVVEASGTA P E VTA + N A N N+ V+RP+
Sbjct  11   KPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNSTVSRPM  70

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  71   PQRPWQQ  77



>ref|XP_008667295.1| PREDICTED: uncharacterized protein LOC100194278 isoform X4 [Zea 
mays]
 tpg|DAA42629.1| TPA: glycine-rich protein [Zea mays]
Length=270

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPV  328
            KPWER+G+  +SGPAPFKP S G+TSDVVEASGTA P E VTA + N A N N+ V+RP+
Sbjct  7    KPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNSTVSRPM  66

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  67   PQRPWQQ  73



>ref|XP_008667294.1| PREDICTED: uncharacterized protein LOC100194278 isoform X3 [Zea 
mays]
Length=284

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPV  328
            KPWER+G+  +SGPAPFKP S G+TSDVVEASGTA P E VTA + N A N N+ V+RP+
Sbjct  21   KPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNSTVSRPM  80

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  81   PQRPWQQ  87



>gb|ACG37046.1| glycine-rich protein [Zea mays]
Length=270

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPV  328
            KPWER+G+  +SGPAPFKP S G+TSDVVEASGTA P E VTA + N A N N+ ++RP+
Sbjct  7    KPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNSTISRPM  66

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  67   PQRPWQQ  73



>ref|XP_008667292.1| PREDICTED: uncharacterized protein LOC100194278 isoform X1 [Zea 
mays]
Length=311

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNA-VARPV  328
            KPWER+G+  +SGPAPFKP S G+TSDVVEASGTA P E VTA + N A N N+ V+RP+
Sbjct  21   KPWERSGTEGTSGPAPFKPPSGGSTSDVVEASGTAKPSENVTAMEGNAAPNVNSTVSRPM  80

Query  329  PSRPWEQ  349
            P RPW+Q
Sbjct  81   PQRPWQQ  87



>ref|XP_002884657.1| hypothetical protein ARALYDRAFT_478079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60916.1| hypothetical protein ARALYDRAFT_478079 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 2/67 (3%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIV--TAADRNTAVNRNAVARPVP  331
            KPWE+ G++SGP PF+P S  +T+  VEASGTANPGE+V       NTA N NA++RPVP
Sbjct  12   KPWEQEGNTSGPTPFRPPSNTSTAGSVEASGTANPGEVVPPPVNRTNTAANMNALSRPVP  71

Query  332  SRPWEQQ  352
            +RPWEQQ
Sbjct  72   ARPWEQQ  78



>emb|CDY28038.1| BnaC05g44400D [Brassica napus]
Length=284

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 3/68 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARPV  328
            KPWE+ G+  +SGP PF+P S  +T+D VEASGTANPGE+V++ +R NTA   N ++RPV
Sbjct  13   KPWEQEGNNNASGPKPFRPPSNTSTADSVEASGTANPGELVSSVNRTNTAPTMNGLSRPV  72

Query  329  PSRPWEQQ  352
            P+RPWEQQ
Sbjct  73   PTRPWEQQ  80



>dbj|BAH56952.1| AT3G07560 [Arabidopsis thaliana]
Length=140

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 2/68 (3%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIV-TAADR-NTAVNRNAVARPVP  331
            KPWE+ G++SGP PF+P S  +T+  VEASGTANPGE+V    +R NTA N N+++RPVP
Sbjct  12   KPWEKEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVPPPVNRPNTAANMNSLSRPVP  71

Query  332  SRPWEQQQ  355
            +RPWEQQ 
Sbjct  72   ARPWEQQN  79



>ref|XP_009147062.1| PREDICTED: peroxisomal membrane protein 13 [Brassica rapa]
Length=289

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 3/68 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARPV  328
            KPWE+ G+  ++GP PF+P S  +T+D VEASGTANPGE+V++ +R NTA   N ++RPV
Sbjct  13   KPWEQEGNNNAAGPKPFRPPSNTSTADSVEASGTANPGELVSSVNRTNTAPTMNGLSRPV  72

Query  329  PSRPWEQQ  352
            P+RPWEQQ
Sbjct  73   PTRPWEQQ  80



>emb|CDY35943.1| BnaA05g30070D [Brassica napus]
Length=339

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 3/68 (4%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADR-NTAVNRNAVARPV  328
            KPWE+ G+  ++GP PF+P S  +T+D VEASGTANPGE+V++ +R NTA   N ++RPV
Sbjct  63   KPWEQEGNNNAAGPKPFRPPSNTSTADSVEASGTANPGELVSSVNRTNTAPTMNGLSRPV  122

Query  329  PSRPWEQQ  352
            P+RPWEQQ
Sbjct  123  PTRPWEQQ  130



>ref|NP_187412.1| peroxin 13 [Arabidopsis thaliana]
 sp|Q9SRR0.1|PEX13_ARATH RecName: Full=Peroxisomal membrane protein 13; AltName: Full=Peroxin-13; 
Short=AtPEX13; AltName: Full=Peroxisome biogenesis 
protein 13; AltName: Full=Pex13p; AltName: Full=Protein ABERRANT 
PEROXISOME MORPHOLOGY 2 [Arabidopsis thaliana]
 gb|AAF02160.1|AC009853_20 unknown protein [Arabidopsis thaliana]
 gb|AAL77696.1| AT3g07560/F21O3_27 [Arabidopsis thaliana]
 gb|AAM10369.1| AT3g07560/F21O3_27 [Arabidopsis thaliana]
 gb|AEE74561.1| peroxin 13 [Arabidopsis thaliana]
Length=304

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 2/67 (3%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIV-TAADR-NTAVNRNAVARPVP  331
            KPWE+ G++SGP PF+P S  +T+  VEASGTANPGE+V    +R NTA N N+++RPVP
Sbjct  12   KPWEKEGNTSGPNPFRPPSNTSTAGSVEASGTANPGEVVPPPVNRPNTAANMNSLSRPVP  71

Query  332  SRPWEQQ  352
            +RPWEQQ
Sbjct  72   ARPWEQQ  78



>ref|XP_008809369.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Phoenix 
dactylifera]
Length=215

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPW+RAG+S GP+PFKP S G TSDVVEASGTA PGEIV   +RN   N N V RP+P R
Sbjct  9    KPWDRAGTSPGPSPFKPQSSGGTSDVVEASGTAKPGEIVPNNERNAL-NNNIVGRPLPPR  67

Query  338  PWEQQQ  355
            PW+Q  
Sbjct  68   PWQQNH  73



>ref|XP_008809368.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Phoenix 
dactylifera]
Length=221

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            KPW+RAG+S GP+PFKP S G TSDVVEASGTA PGEIV   +R  A+N N V RP+P R
Sbjct  15   KPWDRAGTSPGPSPFKPQSSGGTSDVVEASGTAKPGEIVPNNER-NALNNNIVGRPLPPR  73

Query  338  PWEQQQ  355
            PW+Q  
Sbjct  74   PWQQNH  79



>ref|XP_003557652.2| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO5 [Brachypodium 
distachyon]
Length=659

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 50/67 (75%), Gaps = 5/67 (7%)
 Frame = +2

Query  158  KPWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVP  331
            KPWERAG+  +SGPAPFKP S G+TSDVVEASGTA PGE + A   N +   N V+R +P
Sbjct  7    KPWERAGAEGTSGPAPFKPPSGGSTSDVVEASGTAKPGETIAATTANVS---NPVSRTMP  63

Query  332  SRPWEQQ  352
             RPW+QQ
Sbjct  64   QRPWQQQ  70



>gb|ABK26417.1| unknown [Picea sitchensis]
Length=295

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAV-NRNAVARPVPS  334
            KPWER GSSSGP+PF+P S G+TS+VVE+SG A  GE  +  +RN  + NR+ + RP+P+
Sbjct  11   KPWERVGSSSGPSPFRPPSTGSTSNVVESSGVAKIGE-SSDTERNVPLANRSTIGRPMPA  69

Query  335  RPWEQ  349
            RPWEQ
Sbjct  70   RPWEQ  74



>ref|XP_002466342.1| hypothetical protein SORBIDRAFT_01g005970 [Sorghum bicolor]
 gb|EER93340.1| hypothetical protein SORBIDRAFT_01g005970 [Sorghum bicolor]
Length=409

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAAD-RNTAVNRNAVARPVPS  334
            KPWERAG+SSG  PFKP S G+TSDVVEASGTA  GE+V+AA     +   + ++ PVP 
Sbjct  153  KPWERAGASSGSVPFKPPSGGSTSDVVEASGTAKHGEVVSAAGNNVASNVNSNISTPVPP  212

Query  335  RPWEQQ  352
            RPW+QQ
Sbjct  213  RPWQQQ  218



>ref|XP_010910086.1| PREDICTED: peroxisomal membrane protein 13-like isoform X3 [Elaeis 
guineensis]
Length=288

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            K W++ GSSS  APFKP SPG+TS+VVEASGTA PG   + A+ N + N +A+ + V SR
Sbjct  19   KHWQQVGSSS--APFKPPSPGSTSNVVEASGTAKPGVAASGAEGNESANWSALGKSVRSR  76

Query  338  PWEQ  349
            PWEQ
Sbjct  77   PWEQ  80



>ref|XP_010910084.1| PREDICTED: peroxisomal membrane protein 13-like isoform X1 [Elaeis 
guineensis]
Length=309

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            K W++ GSSS  APFKP SPG+TS+VVEASGTA PG   + A+ N + N +A+ + V SR
Sbjct  40   KHWQQVGSSS--APFKPPSPGSTSNVVEASGTAKPGVAASGAEGNESANWSALGKSVRSR  97

Query  338  PWEQ  349
            PWEQ
Sbjct  98   PWEQ  101



>ref|XP_010910087.1| PREDICTED: peroxisomal membrane protein 13-like isoform X4 [Elaeis 
guineensis]
Length=278

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            K W++ GSSS  APFKP SPG+TS+VVEASGTA PG   + A+ N + N +A+ + V SR
Sbjct  40   KHWQQVGSSS--APFKPPSPGSTSNVVEASGTAKPGVAASGAEGNESANWSALGKSVRSR  97

Query  338  PWEQ  349
            PWEQ
Sbjct  98   PWEQ  101



>ref|XP_010910085.1| PREDICTED: peroxisomal membrane protein 13-like isoform X2 [Elaeis 
guineensis]
Length=299

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 47/64 (73%), Gaps = 2/64 (3%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSR  337
            K W++ GSSS  APFKP SPG+TS+VVEASGTA PG   + A+ N + N +A+ + V SR
Sbjct  40   KHWQQVGSSS--APFKPPSPGSTSNVVEASGTAKPGVAASGAEGNESANWSALGKSVRSR  97

Query  338  PWEQ  349
            PWEQ
Sbjct  98   PWEQ  101



>ref|XP_006859049.1| hypothetical protein AMTR_s00068p00188230 [Amborella trichopoda]
 gb|ERN20516.1| hypothetical protein AMTR_s00068p00188230 [Amborella trichopoda]
Length=145

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +2

Query  179  SSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRNTAVNRNAVARPVPSRPWEQQQ  355
            SS+G +PFKP +PG T+DVV ASGTA PG  V  A  N  +N N   RP PSR WEQ +
Sbjct  3    SSAGLSPFKPPAPGRTADVVAASGTAKPG--VPVAQWNPVMNGNPAGRPQPSRAWEQNR  59



>ref|XP_009124313.1| PREDICTED: peroxisomal membrane protein 13-like [Brassica rapa]
Length=262

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 45/70 (64%), Gaps = 13/70 (19%)
 Frame = +2

Query  158  KPWERAG---SSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAADRN-TAVNRNAVARP  325
            KPWERAG   +S  P PF+P S  +T+D VEASGT         ADRN T  N NA++RP
Sbjct  13   KPWERAGNNNTSGPPKPFRPPSNTSTADSVEASGT---------ADRNHTPANMNALSRP  63

Query  326  VPSRPWEQQQ  355
            +P RP +QQQ
Sbjct  64   LPIRPRQQQQ  73



>gb|ABK22418.1| unknown [Picea sitchensis]
Length=289

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 2/66 (3%)
 Frame = +2

Query  158  KPWERAGSSSGPAPFKPSSPGN-TSDVVEASGTANPGEIVTAADRNT-AVNRNAVARPVP  331
            KPWER G SSGP+PF+  S GN T++V ++ G   P E      RN  + N   VARP+P
Sbjct  9    KPWERVGGSSGPSPFRSPSTGNGTNNVGDSCGDTKPEEKNDNIQRNLPSGNGGIVARPMP  68

Query  332  SRPWEQ  349
             RPWE+
Sbjct  69   QRPWER  74



>tpg|DAA39779.1| TPA: hypothetical protein ZEAMMB73_031103 [Zea mays]
Length=358

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +2

Query  161  PWER--AGSSSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAAD  286
            PWER  A  +SGPAPFKP S G+TSDVVEASGTA P E VT  +
Sbjct  106  PWERSRAEGASGPAPFKPPSAGSTSDVVEASGTAKPDENVTVTE  149



>gb|AFW87992.1| hypothetical protein ZEAMMB73_343017 [Zea mays]
Length=507

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = +2

Query  161  PWERAGS--SSGPAPFKPSSPGNTSDVVEASGTANPGEIVTAA  283
            PWER+G+  + GPAPFK  S G+TSDVVEASGTA P E VT +
Sbjct  113  PWERSGAEGAYGPAPFKSPSGGSTSDVVEASGTAKPDENVTES  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940