BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001L01

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591491.1|  PREDICTED: SKP1-like protein 1A                    236   2e-76   Nicotiana tomentosiformis
ref|XP_006362720.1|  PREDICTED: SKP1-like protein 1B-like               233   7e-75   Solanum tuberosum [potatoes]
gb|ABB77426.1|  Skp1-like protein 1                                     231   2e-74   Petunia integrifolia subsp. inflata
ref|XP_009783395.1|  PREDICTED: SKP1-like protein 1A                    231   3e-74   Nicotiana sylvestris
ref|XP_004250723.1|  PREDICTED: SKP1-like protein 1A                    231   3e-74   Solanum lycopersicum
gb|AAT99735.1|  SKP1                                                    231   4e-74   Nicotiana tabacum [American tobacco]
ref|XP_009779583.1|  PREDICTED: SKP1-like protein 1A                    229   1e-73   Nicotiana sylvestris
ref|XP_009624361.1|  PREDICTED: SKP1-like protein 1A isoform X1         229   2e-73   Nicotiana tomentosiformis
ref|XP_009620406.1|  PREDICTED: SKP1-like protein 1A                    229   2e-73   Nicotiana tomentosiformis
ref|XP_009624363.1|  PREDICTED: SKP1-like protein 1A isoform X2         229   2e-73   Nicotiana tomentosiformis
gb|AFB18000.1|  SKP1 protein                                            228   5e-73   Nicotiana tabacum [American tobacco]
gb|AAO85510.1|  SKP1                                                    228   8e-73   Nicotiana benthamiana
gb|ABB77425.1|  Skp1-like protein 3                                     227   1e-72   Petunia integrifolia subsp. inflata
gb|ACA61785.1|  SKP1-like protein 3                                     226   2e-72   Petunia x hybrida [garden petunia]
ref|XP_004512164.1|  PREDICTED: SKP1-like protein 1A-like               223   8e-71   
gb|ACA61783.1|  SKP1-like protein 1                                     223   8e-71   Petunia x hybrida [garden petunia]
gb|KHN41877.1|  SKP1-like protein 1A                                    222   1e-70   Glycine soja [wild soybean]
ref|XP_003517160.1|  PREDICTED: SKP1-like protein 1A-like               222   1e-70   Glycine max [soybeans]
gb|ACA61784.1|  SKP1-like protein 2                                     221   2e-70   Petunia x hybrida [garden petunia]
ref|XP_003612225.1|  SKP1-like protein                                  221   4e-70   Medicago truncatula
gb|AAX83944.1|  Skp1                                                    221   4e-70   Capsicum annuum
gb|ABB77427.1|  Skp1-like protein 2                                     220   5e-70   Petunia integrifolia subsp. inflata
ref|NP_001235929.1|  uncharacterized protein LOC100527683               219   1e-69   
ref|XP_003612227.1|  SKP1-like protein                                  219   1e-69   Medicago truncatula
gb|ACJ86090.1|  unknown                                                 219   2e-69   Medicago truncatula
ref|XP_006360903.1|  PREDICTED: SKP1-like protein 1B-like               218   5e-69   Solanum tuberosum [potatoes]
ref|XP_006422586.1|  hypothetical protein CICLE_v10029465mg             218   5e-69   Citrus clementina [clementine]
ref|XP_009379340.1|  PREDICTED: SKP1-like protein 1A                    217   1e-68   Pyrus x bretschneideri [bai li]
ref|XP_007157884.1|  hypothetical protein PHAVU_002G106100g             217   1e-68   Phaseolus vulgaris [French bean]
ref|XP_008393845.1|  PREDICTED: SKP1-like protein 1A                    216   2e-68   
ref|XP_006359705.1|  PREDICTED: SKP1-like protein 1B-like               216   2e-68   Solanum tuberosum [potatoes]
gb|AFK44762.1|  unknown                                                 216   2e-68   Lotus japonicus
ref|NP_001241052.1|  uncharacterized protein LOC100798104               215   5e-68   Glycine max [soybeans]
emb|CDP14555.1|  unnamed protein product                                215   5e-68   Coffea canephora [robusta coffee]
ref|NP_001235349.1|  uncharacterized protein LOC100306458               215   6e-68   Glycine max [soybeans]
gb|ACU13236.1|  unknown                                                 215   7e-68   Glycine max [soybeans]
ref|XP_004231049.1|  PREDICTED: SKP1-like protein 1B                    215   8e-68   
gb|AII79402.1|  S-phase kinase-associated protein 1-like protein 5      214   1e-67   Malus hupehensis
ref|XP_009334694.1|  PREDICTED: SKP1-like protein 1B                    214   1e-67   Pyrus x bretschneideri [bai li]
gb|AII79401.1|  S-phase kinase-associated protein 1-like protein 4      214   2e-67   Malus hupehensis
ref|XP_007202708.1|  hypothetical protein PRUPE_ppa012752mg             213   3e-67   Prunus persica
ref|XP_008337985.1|  PREDICTED: SKP1-like protein 1A                    213   3e-67   Malus domestica [apple tree]
ref|XP_007046627.1|  S phase kinase-associated protein 1                213   3e-67   Theobroma cacao [chocolate]
ref|XP_007156190.1|  hypothetical protein PHAVU_003G265900g             213   4e-67   Phaseolus vulgaris [French bean]
gb|AAD34458.1|  Skp1                                                    213   4e-67   Medicago sativa [alfalfa]
ref|XP_010680409.1|  PREDICTED: SKP1-like protein 1B                    213   7e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002510576.1|  skp1, putative                                     213   8e-67   Ricinus communis
gb|ACP20181.1|  SKP1-like protein                                       212   1e-66   Citrus maxima [buntan]
ref|XP_009363460.1|  PREDICTED: SKP1-like protein 1A                    212   1e-66   
gb|AFM75900.1|  GSK1                                                    211   3e-66   Gossypium hirsutum [American cotton]
ref|XP_007225985.1|  hypothetical protein PRUPE_ppa012755mg             211   4e-66   Prunus persica
ref|XP_002510577.1|  skp1, putative                                     211   4e-66   Ricinus communis
ref|XP_008357122.1|  PREDICTED: SKP1-like protein 1B                    210   6e-66   Malus domestica [apple tree]
ref|XP_004287783.1|  PREDICTED: SKP1-like protein 1A                    210   7e-66   Fragaria vesca subsp. vesca
ref|XP_002270061.1|  PREDICTED: SKP1-like protein 1B                    210   9e-66   Vitis vinifera
emb|CAA75118.1|  fimbriata-associated protein                           210   9e-66   Antirrhinum majus [garden snapdragon]
ref|XP_008445323.1|  PREDICTED: SKP1-like protein 1B                    209   2e-65   Cucumis melo [Oriental melon]
ref|XP_006435227.1|  hypothetical protein CICLE_v10002751mg             209   3e-65   Citrus clementina [clementine]
gb|KHG30151.1|  SKP1-like protein 1A                                    208   3e-65   Gossypium arboreum [tree cotton]
gb|KJB63489.1|  hypothetical protein B456_010G002100                    208   3e-65   Gossypium raimondii
gb|KHG24597.1|  SKP1-like protein 1B                                    208   4e-65   Gossypium arboreum [tree cotton]
ref|XP_004512165.1|  PREDICTED: SKP1-like protein 1A-like               208   4e-65   
ref|XP_007041813.1|  S phase kinase-associated protein 1                207   5e-65   Theobroma cacao [chocolate]
gb|KDP36889.1|  hypothetical protein JCGZ_08180                         207   6e-65   Jatropha curcas
ref|XP_009420815.1|  PREDICTED: SKP1-like protein 1A                    207   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB87834.1|  putative kinetochore protein                           206   7e-65   Vicia faba var. minor [tick bean]
ref|XP_010033522.1|  PREDICTED: SKP1-like protein 1B                    207   7e-65   Eucalyptus grandis [rose gum]
ref|XP_002301954.1|  hypothetical protein POPTR_0002s02020g             207   8e-65   Populus trichocarpa [western balsam poplar]
ref|XP_004143010.1|  PREDICTED: SKP1-like protein 1B-like               207   9e-65   Cucumis sativus [cucumbers]
ref|XP_011088616.1|  PREDICTED: SKP1-like protein 1A                    207   1e-64   Sesamum indicum [beniseed]
ref|XP_010266012.1|  PREDICTED: SKP1-like protein 1B                    207   1e-64   Nelumbo nucifera [Indian lotus]
gb|KDP23982.1|  hypothetical protein JCGZ_25370                         207   1e-64   Jatropha curcas
gb|KJB15832.1|  hypothetical protein B456_002G198700                    207   1e-64   Gossypium raimondii
gb|KDP29669.1|  hypothetical protein JCGZ_18831                         206   2e-64   Jatropha curcas
ref|XP_006425391.1|  hypothetical protein CICLE_v10026642mg             206   3e-64   Citrus clementina [clementine]
ref|NP_565123.1|  S-phase kinase-associated protein 1                   206   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248653.2|  PREDICTED: SKP1-like protein 1B                    206   4e-64   
ref|XP_003621661.1|  SKP1-like protein                                  205   5e-64   Medicago truncatula
ref|XP_010550803.1|  PREDICTED: SKP1-like protein 1B                    205   6e-64   Tarenaya hassleriana [spider flower]
ref|XP_011092967.1|  PREDICTED: SKP1-like protein 1A                    205   7e-64   Sesamum indicum [beniseed]
ref|XP_004248654.1|  PREDICTED: SKP1-like protein 1B                    204   8e-64   Solanum lycopersicum
gb|KEH23694.1|  SCF ubiquitin ligase, SKP1 component                    204   1e-63   Medicago truncatula
ref|XP_004144851.1|  PREDICTED: SKP1-like protein 1B-like               204   1e-63   Cucumis sativus [cucumbers]
gb|ABK96569.1|  unknown                                                 204   1e-63   Populus trichocarpa x Populus deltoides
gb|KDO71310.1|  hypothetical protein CISIN_1g030962mg                   204   1e-63   Citrus sinensis [apfelsine]
ref|XP_004291337.1|  PREDICTED: SKP1-like protein 1B                    204   1e-63   Fragaria vesca subsp. vesca
gb|EYU17579.1|  hypothetical protein MIMGU_mgv1a015014mg                204   2e-63   Erythranthe guttata [common monkey flower]
gb|ABS17589.1|  SKP1 component-like 1                                   204   2e-63   Humulus lupulus [common hop]
ref|XP_002306950.1|  hypothetical protein POPTR_0005s26450g             203   4e-63   Populus trichocarpa [western balsam poplar]
gb|EPS66410.1|  hypothetical protein M569_08366                         203   5e-63   Genlisea aurea
ref|XP_009362142.1|  PREDICTED: SKP1-like protein 1A                    203   5e-63   Pyrus x bretschneideri [bai li]
ref|XP_002279232.1|  PREDICTED: SKP1-like protein 1A isoform X5         202   5e-63   Vitis vinifera
gb|ABK92723.1|  unknown                                                 202   5e-63   Populus trichocarpa [western balsam poplar]
ref|XP_011003066.1|  PREDICTED: SKP1-like protein 1B                    202   7e-63   Populus euphratica
ref|XP_011043147.1|  PREDICTED: SKP1-like protein 1B                    202   7e-63   Populus euphratica
ref|XP_010935122.1|  PREDICTED: SKP1-like protein 1A                    202   8e-63   Elaeis guineensis
ref|XP_006302938.1|  hypothetical protein CARUB_v10021077mg             202   8e-63   Capsella rubella
ref|XP_006360899.1|  PREDICTED: SKP1-like protein 1B-like isoform X1    202   9e-63   Solanum tuberosum [potatoes]
ref|XP_008447950.1|  PREDICTED: SKP1-like protein 1B                    202   1e-62   Cucumis melo [Oriental melon]
ref|XP_010095548.1|  SKP1-like protein 1B                               202   1e-62   Morus notabilis
ref|XP_010029647.1|  PREDICTED: SKP1-like protein 1B isoform X1         201   1e-62   Eucalyptus grandis [rose gum]
ref|XP_010494151.1|  PREDICTED: SKP1-like protein 1B                    202   1e-62   Camelina sativa [gold-of-pleasure]
gb|EPS61104.1|  hypothetical protein M569_13700                         202   1e-62   Genlisea aurea
ref|XP_009128146.1|  PREDICTED: SKP1-like protein 1A                    201   1e-62   Brassica rapa
gb|KEH23696.1|  SCF ubiquitin ligase, SKP1 component                    201   2e-62   Medicago truncatula
dbj|BAB85607.1|  kinetochore protein                                    201   2e-62   Brassica juncea [brown mustard]
ref|XP_009363144.1|  PREDICTED: uncharacterized protein LOC103953139    205   3e-62   Pyrus x bretschneideri [bai li]
ref|NP_568603.1|  SKP1-like protein 1B                                  201   4e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AAC63110.1|  UIP2                                                    201   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281119.1|  hypothetical protein CARUB_v10027150mg             202   6e-62   
emb|CDY13521.1|  BnaC02g23320D                                          200   6e-62   Brassica napus [oilseed rape]
ref|XP_006360900.1|  PREDICTED: SKP1-like protein 1B-like isoform X2    199   6e-62   
gb|KFK42033.1|  hypothetical protein AALP_AA2G203200                    200   7e-62   Arabis alpina [alpine rockcress]
ref|XP_010442189.1|  PREDICTED: SKP1-like protein 1B                    200   7e-62   Camelina sativa [gold-of-pleasure]
ref|XP_002863814.1|  hypothetical protein ARALYDRAFT_917589             200   9e-62   Arabidopsis lyrata subsp. lyrata
dbj|BAB85605.1|  kinetochore protein                                    199   1e-61   Brassica juncea [brown mustard]
ref|XP_009104691.1|  PREDICTED: SKP1-like protein 1A                    199   1e-61   Brassica rapa
ref|XP_006847969.1|  hypothetical protein AMTR_s00029p00153350          199   1e-61   Amborella trichopoda
ref|XP_008448523.1|  PREDICTED: SKP1-like protein 1B                    199   1e-61   Cucumis melo [Oriental melon]
ref|XP_011083455.1|  PREDICTED: SKP1-like protein 1A                    199   1e-61   Sesamum indicum [beniseed]
ref|XP_002305525.2|  E3 ubiquitin ligase SCF complex subunit SKP1...    199   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_011046673.1|  PREDICTED: SKP1-like protein 1A                    198   4e-61   Populus euphratica
ref|XP_004287067.1|  PREDICTED: SKP1-like protein 1B                    198   4e-61   Fragaria vesca subsp. vesca
ref|XP_010471746.1|  PREDICTED: SKP1-like protein 1A                    198   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010536422.1|  PREDICTED: SKP1-like protein 1A                    198   5e-61   Tarenaya hassleriana [spider flower]
ref|XP_006390250.1|  hypothetical protein EUTSA_v10019260mg             197   6e-61   Eutrema salsugineum [saltwater cress]
ref|XP_010690359.1|  PREDICTED: SKP1-like protein 1B                    197   6e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010416502.1|  PREDICTED: SKP1-like protein 1A                    197   6e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006360901.1|  PREDICTED: SKP1-like protein 1B-like               197   7e-61   
ref|XP_002531150.1|  skp1, putative                                     197   8e-61   Ricinus communis
ref|XP_010935123.1|  PREDICTED: SKP1-like protein 1B                    196   2e-60   Elaeis guineensis
gb|EMT03937.1|  SKP1-like protein 1A                                    196   2e-60   
ref|XP_004159727.1|  PREDICTED: SKP1-like protein 1A-like               196   2e-60   
ref|XP_010941330.1|  PREDICTED: SKP1-like protein 1B                    196   3e-60   Elaeis guineensis
gb|AGU28415.1|  S phase kinase-associated protein 1                     196   3e-60   Sinapis alba [bai jie]
emb|CAA75117.1|  fimbriata-associated protein                           196   4e-60   Antirrhinum majus [garden snapdragon]
gb|EMT23721.1|  SKP1-like protein 1A                                    196   4e-60   
gb|EMT15375.1|  SKP1-like protein 4                                     196   5e-60   
ref|XP_004146156.1|  PREDICTED: SKP1-like protein 1B-like               195   6e-60   Cucumis sativus [cucumbers]
dbj|BAE72119.1|  SKP1-like protein                                      195   7e-60   Silene latifolia
dbj|BAE72121.1|  SKP1-like protein                                      194   2e-59   Silene latifolia
ref|XP_010266846.1|  PREDICTED: SKP1-like protein 1B isoform X1         193   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_008806601.1|  PREDICTED: SKP1-like protein 1A                    194   2e-59   Phoenix dactylifera
dbj|BAB85604.1|  kinetochore protein                                    192   3e-59   Brassica juncea [brown mustard]
ref|XP_004248652.1|  PREDICTED: SKP1-like protein 1B                    192   4e-59   Solanum lycopersicum
ref|XP_002313704.1|  E3 ubiquitin ligase SCF complex subunit SKP1...    192   5e-59   Populus trichocarpa [western balsam poplar]
gb|EMT33027.1|  SKP1-like protein 1B                                    193   7e-59   
gb|EMT05501.1|  SKP1-like protein 1B                                    192   1e-58   
ref|XP_009395385.1|  PREDICTED: SKP1-like protein 1B                    192   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010539092.1|  PREDICTED: SKP1-like protein 1B                    192   1e-58   Tarenaya hassleriana [spider flower]
ref|XP_009414442.1|  PREDICTED: SKP1-like protein 1A                    192   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003577587.1|  PREDICTED: SKP1-like protein 1A                    192   1e-58   Brachypodium distachyon [annual false brome]
ref|XP_009418685.1|  PREDICTED: SKP1-like protein 1A                    191   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT01680.1|  SKP1-like protein 1B                                    192   1e-58   
ref|XP_002537506.1|  skp1, putative                                     191   1e-58   Ricinus communis
ref|XP_008811446.1|  PREDICTED: SKP1-like protein 1A                    191   2e-58   Phoenix dactylifera
ref|XP_009395355.1|  PREDICTED: SKP1-like protein 1B                    191   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS35771.1|  SKP1-like protein 1B                                    191   2e-58   Triticum urartu
emb|CDX85931.1|  BnaC06g22030D                                          190   3e-58   
dbj|BAB85606.1|  kinetochore protein                                    191   3e-58   Brassica juncea [brown mustard]
ref|XP_008811458.1|  PREDICTED: SKP1-like protein 1A                    191   3e-58   
ref|XP_011046062.1|  PREDICTED: SKP1-like protein 1B                    190   4e-58   Populus euphratica
ref|XP_010941328.1|  PREDICTED: SKP1-like protein 1A                    190   6e-58   Elaeis guineensis
ref|XP_003621659.1|  SKP1-like protein                                  189   6e-58   Medicago truncatula
ref|XP_003628375.1|  SKP1-like protein                                  189   8e-58   Medicago truncatula
gb|EMT03939.1|  SKP1-like protein 1B                                    189   1e-57   
ref|XP_003573486.1|  PREDICTED: SKP1-like protein 1A                    189   1e-57   Brachypodium distachyon [annual false brome]
ref|XP_010440828.1|  PREDICTED: SKP1-like protein 1A                    189   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010428644.1|  PREDICTED: SKP1-like protein 1A                    189   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010061081.1|  PREDICTED: SKP1-like protein 1B isoform X1         188   2e-57   Eucalyptus grandis [rose gum]
gb|KEH23706.1|  SCF ubiquitin ligase, SKP1 component                    188   3e-57   Medicago truncatula
ref|XP_004231048.1|  PREDICTED: SKP1-like protein 1A                    188   3e-57   Solanum lycopersicum
ref|XP_008806600.1|  PREDICTED: SKP1-like protein 1A                    188   3e-57   Phoenix dactylifera
gb|AGF33287.1|  SKP1 1A-like protein                                    187   3e-57   Quercus ilex [holly oak]
ref|XP_010266848.1|  PREDICTED: SKP1-like protein 1B isoform X2         188   3e-57   
gb|KJB17604.1|  hypothetical protein B456_003G007300                    187   4e-57   Gossypium raimondii
ref|XP_010113308.1|  SKP1-like protein 1A                               187   4e-57   Morus notabilis
ref|XP_010646804.1|  PREDICTED: SKP1-like protein 1A isoform X3         192   4e-57   Vitis vinifera
gb|KEH23692.1|  SCF ubiquitin ligase, SKP1 component                    187   4e-57   Medicago truncatula
ref|XP_002887622.1|  hypothetical protein ARALYDRAFT_339769             200   8e-57   
ref|XP_009401439.1|  PREDICTED: SKP1-like protein 1B                    187   8e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003605505.1|  SKP1-like protein                                  187   9e-57   Medicago truncatula
gb|EMS59755.1|  SKP1-like protein 4                                     187   1e-56   Triticum urartu
gb|AGT16907.1|  SKP1-like protein                                       187   1e-56   Saccharum hybrid cultivar R570
ref|XP_002890373.1|  hypothetical protein ARALYDRAFT_889462             186   1e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010683699.1|  PREDICTED: SKP1-like protein 1B isoform X2         186   1e-56   
ref|XP_002880415.1|  hypothetical protein ARALYDRAFT_481069             186   2e-56   
gb|AII79406.1|  S-phase kinase-associated protein 1-like protein 6      186   3e-56   Malus hupehensis
ref|XP_009355656.1|  PREDICTED: SKP1-like protein 1A                    186   3e-56   Pyrus x bretschneideri [bai li]
ref|NP_564105.1|  SKP1-like protein 4                                   185   4e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAT12490.1|  Skp1/Ask1-like protein                                  185   6e-56   Zantedeschia hybrid cultivar
dbj|BAD46569.1|  putative UIP2                                          185   8e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006416426.1|  hypothetical protein EUTSA_v10008964mg             184   2e-55   Eutrema salsugineum [saltwater cress]
emb|CDX73212.1|  BnaC06g36600D                                          184   2e-55   
gb|ABB69022.1|  SKP1                                                    184   2e-55   Brassica napus [oilseed rape]
ref|XP_007219396.1|  hypothetical protein PRUPE_ppa020403mg             183   2e-55   Prunus persica
gb|EMT01771.1|  SKP1-like protein 1B                                    186   3e-55   
ref|XP_007024458.1|  SKP1-like 4                                        182   3e-55   
ref|XP_008232104.1|  PREDICTED: SKP1-like protein 1B                    182   3e-55   Prunus mume [ume]
ref|XP_003605510.1|  SKP1-like protein                                  183   3e-55   Medicago truncatula
ref|XP_010669692.1|  PREDICTED: SKP1-like protein 1B                    183   4e-55   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAB85603.1|  kinetochore protein                                    182   5e-55   Brassica juncea [brown mustard]
ref|XP_004301672.1|  PREDICTED: SKP1-like protein 1A                    182   5e-55   Fragaria vesca subsp. vesca
ref|NP_565604.1|  putative E3 ubiquitin ligase ASK3                     182   8e-55   Arabidopsis thaliana [mouse-ear cress]
gb|ACR38888.1|  SKP1                                                    182   8e-55   Apopellia endiviifolia (species B)
ref|XP_001753554.1|  predicted protein                                  182   9e-55   
ref|NP_001176525.1|  Os11g0456300                                       182   1e-54   
ref|XP_009106248.1|  PREDICTED: SKP1-like protein 1A                    181   1e-54   Brassica rapa
ref|XP_010646801.1|  PREDICTED: SKP1-like protein 1A isoform X2         186   1e-54   Vitis vinifera
ref|XP_004299943.1|  PREDICTED: SKP1-like protein 1B                    181   2e-54   Fragaria vesca subsp. vesca
emb|CDP16774.1|  unnamed protein product                                181   2e-54   Coffea canephora [robusta coffee]
ref|XP_007201294.1|  hypothetical protein PRUPE_ppa012728mg             181   2e-54   Prunus persica
ref|XP_010683700.1|  PREDICTED: SKP1-like protein 1B isoform X3         180   2e-54   
gb|EMT15207.1|  SKP1-like protein 1B                                    181   2e-54   
emb|CDP16773.1|  unnamed protein product                                180   2e-54   Coffea canephora [robusta coffee]
ref|XP_010683698.1|  PREDICTED: SKP1-like protein 1B isoform X1         181   3e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006646753.1|  PREDICTED: SKP1-like protein 1B-like               180   5e-54   Oryza brachyantha
ref|XP_008232108.1|  PREDICTED: SKP1-like protein 1A                    180   5e-54   Prunus mume [ume]
gb|KFK36059.1|  hypothetical protein AALP_AA4G072500                    179   5e-54   Arabis alpina [alpine rockcress]
ref|XP_007221090.1|  hypothetical protein PRUPE_ppa017105mg             179   6e-54   Prunus persica
ref|XP_008372868.1|  PREDICTED: SKP1-like protein 1B                    180   6e-54   
ref|XP_006436098.1|  hypothetical protein CICLE_v10033809mg             179   7e-54   Citrus clementina [clementine]
ref|XP_006661910.1|  PREDICTED: SKP1-like protein 1B-like               179   9e-54   Oryza brachyantha
ref|XP_008382315.1|  PREDICTED: SKP1-like protein 1A isoform X2         179   1e-53   
ref|XP_006359704.1|  PREDICTED: SKP1-like protein 1B-like               179   1e-53   Solanum tuberosum [potatoes]
emb|CCG34083.1|  SCF ubiquitin ligase                                   178   2e-53   uncultured eukaryote
ref|XP_004957494.1|  PREDICTED: SKP1-like protein 1B-like               179   2e-53   Setaria italica
gb|ABK21374.1|  unknown                                                 178   2e-53   Picea sitchensis
emb|CDY44209.1|  BnaC05g15660D                                          178   2e-53   Brassica napus [oilseed rape]
gb|EMS52877.1|  SKP1-like protein 1B                                    178   3e-53   Triticum urartu
ref|XP_001753031.1|  predicted protein                                  178   3e-53   
ref|XP_002277864.1|  PREDICTED: uncharacterized protein LOC100257...    186   3e-53   Vitis vinifera
ref|XP_002976912.1|  hypothetical protein SELMODRAFT_271223             177   4e-53   Selaginella moellendorffii
ref|XP_008382314.1|  PREDICTED: SKP1-like protein 1A isoform X1         177   5e-53   Malus domestica [apple tree]
gb|ABK25195.1|  unknown                                                 177   5e-53   Picea sitchensis
gb|KDO67761.1|  hypothetical protein CISIN_1g044292mg                   177   5e-53   Citrus sinensis [apfelsine]
ref|XP_009373027.1|  PREDICTED: SKP1-like protein 1A                    177   5e-53   Pyrus x bretschneideri [bai li]
ref|XP_010432410.1|  PREDICTED: SKP1-like protein 11                    177   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_008236029.1|  PREDICTED: SKP1-like protein 1A                    177   6e-53   Prunus mume [ume]
ref|XP_006304273.1|  hypothetical protein CARUB_v10010505mg             177   8e-53   Capsella rubella
ref|XP_009149503.1|  PREDICTED: SKP1-like protein 4                     177   9e-53   Brassica rapa
gb|AAX92710.1|  SCF ubiquitin ligase                                    177   9e-53   Picea abies
ref|XP_009372999.1|  PREDICTED: SKP1-like protein 1A                    177   9e-53   Pyrus x bretschneideri [bai li]
ref|XP_010459699.1|  PREDICTED: SKP1-like protein 4                     176   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_009372998.1|  PREDICTED: SKP1-like protein 1A isoform X2         176   1e-52   
ref|XP_009413024.1|  PREDICTED: SKP1-like protein 1A                    177   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
emb|CCG34082.1|  SCF ubiquitin ligase                                   176   1e-52   uncultured eukaryote
ref|XP_002867118.1|  hypothetical protein ARALYDRAFT_912943             176   1e-52   Arabidopsis lyrata subsp. lyrata
gb|KFK35110.1|  hypothetical protein AALP_AA5G237300                    176   1e-52   Arabis alpina [alpine rockcress]
ref|XP_009372996.1|  PREDICTED: SKP1-like protein 1A                    175   3e-52   Pyrus x bretschneideri [bai li]
emb|CCA95090.1|  putative S phase kinase-associated protein 1           173   3e-52   Laburnum anagyroides [common laburnum]
ref|XP_008382346.1|  PREDICTED: SKP1-like protein 1A                    175   3e-52   
ref|XP_009372997.1|  PREDICTED: SKP1-like protein 1A isoform X1         175   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_003616859.1|  SKP1-like protein                                  175   3e-52   Medicago truncatula
ref|XP_003636464.1|  SKP1-like protein                                  175   3e-52   
emb|CAJ38400.1|  fimbriata-associated protein                           176   4e-52   Plantago major [cart-track plant]
ref|XP_010683792.1|  PREDICTED: SKP1-like protein 1B                    175   4e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003574990.1|  PREDICTED: SKP1-like protein 1A                    175   4e-52   Brachypodium distachyon [annual false brome]
emb|CDY40610.1|  BnaC06g02260D                                          175   4e-52   Brassica napus [oilseed rape]
ref|XP_010029649.1|  PREDICTED: SKP1-like protein 1B                    174   5e-52   Eucalyptus grandis [rose gum]
ref|XP_009376944.1|  PREDICTED: SKP1-like protein 1B                    174   6e-52   Pyrus x bretschneideri [bai li]
gb|AEQ39057.1|  putative SKP1-like protein 1                            174   1e-51   Wolffia arrhiza
ref|XP_010437611.1|  PREDICTED: SKP1-like protein 11                    174   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010441072.1|  PREDICTED: SKP1-like protein 11                    173   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010441003.1|  PREDICTED: SKP1-like protein 11                    173   1e-51   Camelina sativa [gold-of-pleasure]
gb|KCW56600.1|  hypothetical protein EUGRSUZ_I02321                     176   1e-51   Eucalyptus grandis [rose gum]
ref|XP_004289997.1|  PREDICTED: SKP1-like protein 1A                    173   1e-51   Fragaria vesca subsp. vesca
ref|XP_002462746.1|  hypothetical protein SORBIDRAFT_02g031280          174   2e-51   Sorghum bicolor [broomcorn]
ref|XP_009147940.1|  PREDICTED: SKP1-like protein 1A                    173   2e-51   Brassica rapa
ref|XP_010477249.1|  PREDICTED: SKP1-like protein 4                     173   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009147939.1|  PREDICTED: SKP1-like protein 13                    173   3e-51   Brassica rapa
emb|CDX93699.1|  BnaA06g03490D                                          173   3e-51   
ref|XP_010029648.1|  PREDICTED: SKP1-like protein 1B isoform X2         172   3e-51   Eucalyptus grandis [rose gum]
ref|XP_010435879.1|  PREDICTED: SKP1-like protein 11                    172   5e-51   Camelina sativa [gold-of-pleasure]
emb|CAN73673.1|  hypothetical protein VITISV_031861                     171   2e-50   Vitis vinifera
ref|XP_010029650.1|  PREDICTED: SKP1-like protein 1B                    171   2e-50   Eucalyptus grandis [rose gum]
emb|CAN81017.1|  hypothetical protein VITISV_028248                     171   2e-50   Vitis vinifera
ref|NP_567959.1|  SKP1-like protein 11                                  170   3e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40611.1|  BnaC06g02270D                                          170   3e-50   Brassica napus [oilseed rape]
ref|XP_006660908.1|  PREDICTED: SKP1-like protein 1B-like               171   3e-50   
gb|ABK28664.1|  unknown                                                 170   3e-50   
gb|ACF85177.1|  unknown                                                 171   3e-50   
ref|XP_002450709.1|  hypothetical protein SORBIDRAFT_05g012740          171   3e-50   
emb|CAE53885.1|  putative SKP1 protein                                  171   3e-50   
ref|XP_004979241.1|  PREDICTED: SKP1-like protein 1B-like               171   3e-50   
ref|XP_010447075.1|  PREDICTED: SKP1-like protein 11 isoform X1         170   4e-50   
ref|XP_008246274.1|  PREDICTED: SKP1-like protein 1A                    169   4e-50   
ref|XP_010450797.1|  PREDICTED: SKP1-like protein 11                    169   5e-50   
gb|ACG31014.1|  SKP1-like protein 1A                                    170   5e-50   
ref|XP_006286731.1|  hypothetical protein CARUB_v10002974mg             169   6e-50   
emb|CAB85491.1|  putative kinetochore protein                           169   8e-50   
ref|XP_008382316.1|  PREDICTED: SKP1-like protein 1A                    169   1e-49   
ref|XP_002453117.1|  hypothetical protein SORBIDRAFT_04g000330          169   1e-49   
ref|NP_567967.1|  SKP1-like protein 12                                  168   1e-49   
emb|CDP16772.1|  unnamed protein product                                168   1e-49   
ref|XP_006393304.1|  hypothetical protein EUTSA_v10012168mg             168   2e-49   
ref|XP_008677157.1|  PREDICTED: uncharacterized protein LOC100280...    170   2e-49   
ref|XP_011075000.1|  PREDICTED: SKP1-like protein 1A                    168   2e-49   
ref|XP_003605511.1|  SKP1                                               167   2e-49   
ref|XP_008232155.1|  PREDICTED: SKP1-like protein 11                    168   2e-49   
ref|XP_010327537.1|  PREDICTED: SKP1-like protein 11                    169   3e-49   
ref|XP_002444405.1|  hypothetical protein SORBIDRAFT_07g021450          168   3e-49   
dbj|BAE72118.1|  SKP1-like protein                                      168   3e-49   
ref|NP_001131741.1|  SKP1-like protein 1A                               166   8e-49   
ref|XP_004306259.1|  PREDICTED: SKP1-like protein 1A                    167   9e-49   
ref|XP_007202707.1|  hypothetical protein PRUPE_ppa012732mg             166   9e-49   
dbj|BAJ91150.1|  predicted protein                                      167   9e-49   
emb|CDM86749.1|  unnamed protein product                                166   1e-48   
emb|CAJ38399.1|  fimbriata-associated protein                           165   1e-48   
gb|EMT01637.1|  SKP1-like protein 1B                                    165   2e-48   
ref|XP_010448526.1|  PREDICTED: SKP1-like protein 4                     166   2e-48   
ref|XP_002947872.1|  hypothetical protein VOLCADRAFT_73445              166   2e-48   
ref|XP_011470549.1|  PREDICTED: SKP1-like protein 1A                    165   2e-48   
gb|KEH19789.1|  SCF ubiquitin ligase, SKP1 component                    165   3e-48   
ref|XP_010056210.1|  PREDICTED: SKP1-like protein 1B                    164   5e-48   
gb|AAP79890.1|  SKP1/ASK1-like protein                                  164   8e-48   
ref|XP_008357536.1|  PREDICTED: SKP1-like protein 1A                    165   8e-48   
gb|AAT09201.1|  skp1 protein                                            164   9e-48   
ref|XP_003063597.1|  predicted protein                                  164   9e-48   
ref|XP_006285109.1|  hypothetical protein CARUB_v10006442mg             163   9e-48   
ref|XP_004951176.1|  PREDICTED: SKP1-like protein 1B-like               164   1e-47   
ref|XP_010438976.1|  PREDICTED: SKP1-like protein 4                     164   1e-47   
gb|KEH23709.1|  SCF ubiquitin ligase, SKP1 component                    163   1e-47   
gb|KJB12141.1|  hypothetical protein B456_002G002700                    162   2e-47   
ref|XP_008347749.1|  PREDICTED: SKP1-like protein 1A                    164   2e-47   
ref|XP_007219120.1|  hypothetical protein PRUPE_ppa015805mg             162   3e-47   
gb|EYU37960.1|  hypothetical protein MIMGU_mgv1a015408mg                162   3e-47   
ref|XP_008245788.1|  PREDICTED: SKP1-like protein 11                    162   3e-47   
ref|XP_002488987.1|  hypothetical protein SORBIDRAFT_0702s002010        166   4e-47   
emb|CDM80524.1|  unnamed protein product                                162   7e-47   
ref|XP_010447073.1|  PREDICTED: SKP1-like protein 11                    161   9e-47   
gb|KCW53209.1|  hypothetical protein EUGRSUZ_J02478                     159   1e-46   
ref|NP_567090.1|  SKP1-like protein 13                                  161   1e-46   
ref|XP_008242039.1|  PREDICTED: SKP1-like protein 1A                    161   1e-46   
ref|XP_010028736.1|  PREDICTED: SKP1-like protein 1A                    161   1e-46   
ref|XP_010433736.1|  PREDICTED: SKP1-like protein 4                     161   2e-46   
gb|KCW55541.1|  hypothetical protein EUGRSUZ_I01424                     160   2e-46   
ref|XP_003605516.1|  SKP1-like protein                                  160   2e-46   
ref|XP_010413610.1|  PREDICTED: SKP1-like protein 13                    160   2e-46   
gb|EMT28670.1|  SKP1-like protein 4                                     165   2e-46   
ref|XP_004289877.1|  PREDICTED: SKP1-like protein 4                     160   2e-46   
ref|XP_001690964.1|  E3 ubiquitin ligase                                160   2e-46   
gb|ADQ00179.1|  E3 ubiquitin ligase                                     160   2e-46   
gb|EMT30556.1|  SKP1-like protein 4                                     160   4e-46   
emb|CDY67544.1|  BnaCnng55410D                                          159   5e-46   
ref|XP_010061082.1|  PREDICTED: SKP1-like protein 1B isoform X2         159   5e-46   
ref|XP_011467750.1|  PREDICTED: SKP1-like protein 1B                    159   7e-46   
gb|ACS69067.1|  pollen specific SKP1-like protein LSK3                  159   8e-46   
ref|XP_002279171.1|  PREDICTED: SKP1-like protein 1A isoform X4         159   8e-46   
ref|XP_008671925.1|  PREDICTED: SKP1-like protein 1A                    159   9e-46   
ref|XP_006393339.1|  hypothetical protein EUTSA_v10012355mg             158   1e-45   
ref|XP_010512295.1|  PREDICTED: SKP1-like protein 13                    158   2e-45   
dbj|BAE72120.1|  SKP1-like protein                                      159   2e-45   
tpg|DAA56608.1|  TPA: hypothetical protein ZEAMMB73_397176              160   3e-45   
gb|KFK36060.1|  hypothetical protein AALP_AA4G072600                    156   3e-45   
gb|EMT17502.1|  hypothetical protein F775_42821                         160   4e-45   
gb|KFK35210.1|  hypothetical protein AALP_AA5G254700                    157   4e-45   
gb|EMT17500.1|  hypothetical protein F775_42820                         157   6e-45   
ref|XP_008670859.1|  PREDICTED: SKP1-like protein 1A                    157   6e-45   
ref|XP_010033520.1|  PREDICTED: SKP1-like protein 1A                    155   6e-45   
ref|XP_008670886.1|  PREDICTED: SKP1-like protein 1A                    157   7e-45   
ref|XP_006293215.1|  hypothetical protein CARUB_v10019539mg             156   8e-45   
emb|CBI37863.3|  unnamed protein product                                155   1e-44   
tpg|DAA58698.1|  TPA: SKP1-like protein 1A                              156   1e-44   
gb|EMS53773.1|  SKP1-like protein 1B                                    156   1e-44   
ref|XP_001422389.1|  predicted protein                                  155   2e-44   
ref|XP_006402659.1|  hypothetical protein EUTSA_v10006390mg             154   2e-44   
gb|KDO84929.1|  hypothetical protein CISIN_1g035736mg                   153   2e-44   
ref|XP_008669236.1|  PREDICTED: SKP1-like protein 1A                    156   2e-44   
ref|XP_002504623.1|  predicted protein                                  155   2e-44   
ref|XP_010646873.1|  PREDICTED: SKP1-like protein 1A                    154   4e-44   
ref|NP_001152275.1|  SKP1-like protein 1A                               155   4e-44   
emb|CAB87813.1|  putative kinetochore protein                           153   4e-44   
gb|EMT17797.1|  SKP1-like protein 1B                                    155   4e-44   
gb|KIZ07701.1|  SKP1-like protein 1A                                    154   4e-44   
emb|CBI37865.3|  unnamed protein product                                153   4e-44   
gb|ACG46345.1|  SKP1-like protein 1A                                    154   4e-44   
ref|XP_003605515.1|  SKP1-like protein                                  154   5e-44   
tpg|DAA42254.1|  TPA: SKP1-like protein 1A                              155   5e-44   
dbj|BAJ53099.1|  JHL20J20.6                                             152   5e-44   
gb|KJB47681.1|  hypothetical protein B456_008G036400                    154   5e-44   
gb|EMS57884.1|  SKP1-like protein 4                                     154   6e-44   
gb|KJB12140.1|  hypothetical protein B456_002G002600                    153   8e-44   
ref|NP_001152391.1|  SKP1-like protein 1A                               154   9e-44   
ref|XP_007220743.1|  hypothetical protein PRUPE_ppa024856mg             153   9e-44   
ref|XP_009382729.1|  PREDICTED: SKP1-like protein 1A                    153   1e-43   
ref|XP_010028740.1|  PREDICTED: SKP1-like protein 1A                    153   1e-43   
gb|EMT23720.1|  SKP1-like protein 1A                                    152   2e-43   
ref|XP_002878310.1|  hypothetical protein ARALYDRAFT_907522             152   2e-43   
gb|AAB38862.1|  homologue to SKP1                                       151   2e-43   
ref|XP_002885472.1|  hypothetical protein ARALYDRAFT_898638             152   2e-43   
ref|XP_009627980.1|  PREDICTED: SKP1-like protein 1B                    152   4e-43   
ref|XP_002878309.1|  hypothetical protein ARALYDRAFT_907521             151   5e-43   
ref|XP_010107659.1|  SKP1-like protein 4                                151   6e-43   
ref|XP_009623472.1|  PREDICTED: SKP1-like protein 1B                    151   6e-43   
ref|XP_002887052.1|  hypothetical protein ARALYDRAFT_894320             151   9e-43   
gb|KJB47682.1|  hypothetical protein B456_008G036500                    150   1e-42   
ref|NP_566695.1|  SKP1-like protein 10                                  150   1e-42   
ref|XP_008664388.1|  PREDICTED: SKP1-like protein 1B                    151   1e-42   
emb|CAA75119.1|  fimbriata-associated protein                           149   1e-42   
ref|XP_006395735.1|  hypothetical protein EUTSA_v10005053mg             150   2e-42   
ref|XP_006383062.1|  hypothetical protein POPTR_0005s11190g             149   2e-42   
gb|EMS45381.1|  SKP1-like protein 1B                                    150   2e-42   
ref|XP_010425103.1|  PREDICTED: SKP1-like protein 16                    150   3e-42   
gb|EMT19091.1|  SKP1-like protein 4                                     149   3e-42   
emb|CDY63159.1|  BnaCnng41550D                                          149   4e-42   
gb|KCW55544.1|  hypothetical protein EUGRSUZ_I01426                     149   5e-42   
gb|KEH29323.1|  SCF ubiquitin ligase, SKP1 component                    152   6e-42   
gb|ABK28567.1|  unknown                                                 149   6e-42   
ref|NP_001149673.1|  SKP1-like protein 1A                               149   6e-42   
ref|NP_566694.1|  SKP1-like protein 9                                   149   6e-42   
ref|XP_010028737.1|  PREDICTED: SKP1-like protein 1A                    149   6e-42   
gb|KFK35211.1|  hypothetical protein AALP_AA5G254800                    148   7e-42   
ref|XP_003616611.1|  SKP1-like protein                                  147   1e-41   
ref|XP_010941329.1|  PREDICTED: SKP1-like protein 1A                    148   2e-41   
gb|AFK43118.1|  unknown                                                 147   2e-41   
emb|CCG34078.1|  SCF ubiquitin ligase                                   147   2e-41   
ref|XP_006393342.1|  hypothetical protein EUTSA_v10012113mg             147   2e-41   
gb|KFK44141.1|  hypothetical protein AALP_AA1G220400                    147   2e-41   
ref|XP_005651580.1|  E3 ubiquitin ligase SCF complex, Skp subunit       147   2e-41   
ref|XP_006402629.1|  hypothetical protein EUTSA_v10006377mg             145   2e-41   
emb|CDY69121.1|  BnaCnng61970D                                          146   3e-41   
gb|KCW67979.1|  hypothetical protein EUGRSUZ_F01672                     146   3e-41   
ref|XP_009786816.1|  PREDICTED: SKP1-like protein 1A                    146   4e-41   
gb|AGT15908.1|  SKP1-like protein                                       147   4e-41   
ref|XP_010028739.1|  PREDICTED: SKP1-like protein 1A                    147   5e-41   
ref|XP_003578534.1|  PREDICTED: SKP1-like protein 1B                    146   9e-41   
gb|KCW55546.1|  hypothetical protein EUGRSUZ_I01426                     145   1e-40   
emb|CEG00859.1|  E3 ubiquitin ligase, SCF complex, Skp subunit          145   1e-40   
tpg|DAA42753.1|  TPA: hypothetical protein ZEAMMB73_293473              153   1e-40   
gb|EMT14444.1|  SKP1-like protein 1B                                    145   1e-40   
gb|KDO67759.1|  hypothetical protein CISIN_1g040816mg                   144   1e-40   
gb|KEH29322.1|  SCF ubiquitin ligase, SKP1 component                    145   2e-40   
ref|XP_010506934.1|  PREDICTED: SKP1-like protein 16                    144   2e-40   
emb|CDX77280.1|  BnaC08g03250D                                          145   2e-40   
gb|EYU37961.1|  hypothetical protein MIMGU_mgv1a019768mg                145   2e-40   
ref|XP_009138886.1|  PREDICTED: SKP1-like protein 1A                    145   2e-40   
ref|XP_005846142.1|  hypothetical protein CHLNCDRAFT_59724              145   2e-40   
gb|EYU37963.1|  hypothetical protein MIMGU_mgv1a024618mg                144   3e-40   
ref|XP_002875195.1|  hypothetical protein ARALYDRAFT_484224             145   3e-40   
gb|KJB47684.1|  hypothetical protein B456_008G036700                    144   3e-40   
ref|XP_002885471.1|  hypothetical protein ARALYDRAFT_898637             144   3e-40   
ref|XP_008670860.1|  PREDICTED: SKP1-like protein 1A                    145   4e-40   
ref|XP_009107332.1|  PREDICTED: SKP1-like protein 13                    144   5e-40   
gb|KFK33483.1|  hypothetical protein AALP_AA5G019100                    144   6e-40   
dbj|BAC19974.1|  putative Skp1                                          144   7e-40   
emb|CDX89042.1|  BnaA04g01440D                                          143   8e-40   
ref|NP_565296.1|  SKP1-like protein 14                                  143   8e-40   
emb|CDY16470.1|  BnaA08g02970D                                          143   9e-40   
emb|CDX80590.1|  BnaC07g28540D                                          143   1e-39   
gb|AAT37114.1|  skp1-like protein                                       143   1e-39   
ref|XP_010539834.1|  PREDICTED: SKP1-like protein 1A                    142   2e-39   
ref|NP_001168727.1|  uncharacterized protein LOC100382519               150   2e-39   
ref|XP_006436096.1|  hypothetical protein CICLE_v10033955mg             141   2e-39   
gb|EMT27938.1|  SKP1-like protein 1B                                    140   4e-39   
emb|CDY01389.1|  BnaA07g11620D                                          142   4e-39   
gb|KFK33482.1|  hypothetical protein AALP_AA5G019000                    142   4e-39   
gb|EMT11528.1|  SKP1-like protein 4                                     141   5e-39   
gb|EAZ06800.1|  hypothetical protein OsI_29044                          142   5e-39   
ref|XP_003547631.1|  PREDICTED: LOW QUALITY PROTEIN: SKP1-like pr...    140   6e-39   
ref|XP_010502326.1|  PREDICTED: SKP1-like protein 14                    141   8e-39   
gb|EMT16783.1|  SKP1-like protein 1A                                    140   9e-39   
ref|XP_010514085.1|  PREDICTED: SKP1-like protein 14                    140   1e-38   
emb|CDX96963.1|  BnaC02g31010D                                          141   1e-38   
emb|CAB87835.1|  putative kinetochore protein                           139   1e-38   
emb|CCG34079.1|  SCF ubiquitin ligase                                   140   1e-38   
ref|NP_001061672.1|  Os08g0375700                                       140   1e-38   
emb|CBI22121.3|  unnamed protein product                                152   1e-38   
emb|CCG34080.1|  SCF ubiquitin ligase                                   140   2e-38   
ref|XP_004236226.1|  PREDICTED: SKP1-like protein 1B                    140   2e-38   
gb|EAZ06798.1|  hypothetical protein OsI_29042                          140   2e-38   
emb|CCG34081.1|  SCF ubiquitin ligase                                   140   2e-38   
gb|KFK33484.1|  hypothetical protein AALP_AA5G019200                    140   2e-38   
gb|EMT30811.1|  SKP1-like protein 10                                    140   4e-38   
ref|XP_009103351.1|  PREDICTED: SKP1-like protein 3                     139   4e-38   
ref|XP_010514084.1|  PREDICTED: SKP1-like protein 14                    139   5e-38   
gb|KHG09322.1|  SKP1-like protein 11                                    140   5e-38   
ref|XP_005781634.1|  hypothetical protein EMIHUDRAFT_434598             139   5e-38   
ref|XP_010502325.1|  PREDICTED: SKP1-like protein 14                    139   6e-38   
gb|KEH23718.1|  SCF ubiquitin ligase, SKP1 component                    139   8e-38   
ref|XP_010413609.1|  PREDICTED: SKP1-like protein 5                     138   9e-38   
ref|XP_006648624.1|  PREDICTED: SKP1-like protein 4-like                138   1e-37   
ref|XP_010469243.1|  PREDICTED: SKP1-like protein 5                     138   1e-37   
ref|XP_006292236.1|  hypothetical protein CARUB_v10018443mg             137   1e-37   
gb|KCW67981.1|  hypothetical protein EUGRSUZ_F01672                     135   2e-37   
ref|XP_002765750.1|  glycoprotein FP21 precursor, putative              137   2e-37   
ref|NP_565297.1|  SKP1-like protein 16                                  137   2e-37   
ref|XP_010510863.1|  PREDICTED: SKP1-like protein 14                    138   2e-37   
ref|NP_567091.1|  SKP1-like protein 5                                   137   3e-37   
ref|XP_001761524.1|  predicted protein                                  135   4e-37   
ref|XP_010425101.1|  PREDICTED: SKP1-like protein 16                    137   6e-37   
ref|XP_004965640.1|  PREDICTED: SKP1-like protein 1B-like               136   6e-37   
ref|XP_010430688.1|  PREDICTED: SKP1-like protein 14                    136   7e-37   
ref|XP_006393347.1|  hypothetical protein EUTSA_v10011957mg             135   7e-37   
emb|CCG34076.1|  SCF ubiquitin ligase                                   136   8e-37   
emb|CDY03015.1|  BnaC07g22120D                                          135   8e-37   
ref|XP_006393341.1|  hypothetical protein EUTSA_v10012272mg             135   8e-37   
ref|XP_003285579.1|  cytosolic glycoprotein FP21                        135   9e-37   
dbj|BAB03085.1|  kinetechore (Skp1p-like) protein-like                  136   1e-36   
emb|CCG34074.1|  SCF ubiquitin ligase                                   135   1e-36   



>ref|XP_009591491.1| PREDICTED: SKP1-like protein 1A [Nicotiana tomentosiformis]
 ref|XP_009782768.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
Length=156

 Score =   236 bits (603),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHV+A +KT++K  EDDLK+FDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVDAVAKTDDKASEDDLKSFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  484  IKGKTP  501
            IKGKTP
Sbjct  121  IKGKTP  126



>ref|XP_006362720.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=155

 Score =   233 bits (594),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/126 (93%), Positives = 121/126 (96%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHV+ ASKTE+K  ED+LKTFD+DFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVD-ASKTEDKASEDELKTFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|ABB77426.1| Skp1-like protein 1 [Petunia integrifolia subsp. inflata]
 gb|ACA61786.1| SKP1-like protein 4 [Petunia x hybrida]
Length=156

 Score =   231 bits (590),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+SKMIVLKSSDGETFEVEE+VALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKMIVLKSSDGETFEVEESVALESQTIKHMIEDDCADSSIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHVEAA+KT++K  E+DLK FDA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVEAAAKTDDKVSEEDLKNFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  484  IKGKTP  501
            IKGKTP
Sbjct  121  IKGKTP  126



>ref|XP_009783395.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
Length=155

 Score =   231 bits (590),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 121/126 (96%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHV+ A+KTE+K  ED+LK FD+DFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVD-ATKTEDKASEDELKAFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_004250723.1| PREDICTED: SKP1-like protein 1A [Solanum lycopersicum]
Length=155

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 121/126 (96%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+SSKMIVLKSSDGETFEV+EAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MASSKMIVLKSSDGETFEVDEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHV+ ASKTE+K  ED+LKTFDADFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVD-ASKTEDKASEDELKTFDADFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|AAT99735.1| SKP1 [Nicotiana tabacum]
Length=155

 Score =   231 bits (588),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 121/126 (96%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHV+ A+KTE+K  ED+LK FD+DFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVD-ATKTEDKASEDELKGFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_009779583.1| PREDICTED: SKP1-like protein 1A [Nicotiana sylvestris]
 gb|AAC63273.1| SKP1-like protein [Nicotiana clevelandii]
Length=153

 Score =   229 bits (585),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMIVL+SSDGETFEVEE+VALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYCKRHV
Sbjct  2    KMIVLRSSDGETFEVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHV  61

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            +AASKTE+K  EDDLK FDADFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIKGK
Sbjct  62   DAASKTEDKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  121

Query  496  TP  501
            TP
Sbjct  122  TP  123



>ref|XP_009624361.1| PREDICTED: SKP1-like protein 1A isoform X1 [Nicotiana tomentosiformis]
Length=153

 Score =   229 bits (584),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMIVLKSSDGETFEVEE+VA+ESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYCKRHV
Sbjct  2    KMIVLKSSDGETFEVEESVAVESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHV  61

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            +AASKTE+K  EDDLK FDADFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIKGK
Sbjct  62   DAASKTEDKSVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  121

Query  496  TP  501
            TP
Sbjct  122  TP  123



>ref|XP_009620406.1| PREDICTED: SKP1-like protein 1A [Nicotiana tomentosiformis]
Length=153

 Score =   229 bits (584),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMIVLKSSDGETFEVEE+VA+ESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYCKRHV
Sbjct  2    KMIVLKSSDGETFEVEESVAVESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHV  61

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            +AASKTE+K  EDDLK FDADFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIKGK
Sbjct  62   DAASKTEDKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  121

Query  496  TP  501
            TP
Sbjct  122  TP  123



>ref|XP_009624363.1| PREDICTED: SKP1-like protein 1A isoform X2 [Nicotiana tomentosiformis]
Length=153

 Score =   229 bits (583),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMIVLKSSDGETFEVEE+VA+ESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYCKRHV
Sbjct  2    KMIVLKSSDGETFEVEESVAVESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHV  61

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            +AASKTE+K  EDDLK FDADFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIKGK
Sbjct  62   DAASKTEDKSVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  121

Query  496  TP  501
            TP
Sbjct  122  TP  123



>gb|AFB18000.1| SKP1 protein [Nicotiana tabacum]
Length=155

 Score =   228 bits (581),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCA T IPLPNVTSKILAKVIEYC
Sbjct  1    MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCAGTSIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHV+ A+KTE+K  ED+LK FD+DFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVD-ATKTEDKASEDELKGFDSDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|AAO85510.1| SKP1 [Nicotiana benthamiana]
Length=153

 Score =   228 bits (580),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMIVL+SSDGETFEVEE+VALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYCKRHV
Sbjct  2    KMIVLRSSDGETFEVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHV  61

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            +AASKTE+K  EDDLK FDADFVKVDQ+TLFDLILAANYLNIK LLDLTCQTVADMIKGK
Sbjct  62   DAASKTEDKAVEDDLKAFDADFVKVDQSTLFDLILAANYLNIKRLLDLTCQTVADMIKGK  121

Query  496  TP  501
            TP
Sbjct  122  TP  123



>gb|ABB77425.1| Skp1-like protein 3 [Petunia integrifolia subsp. inflata]
 gb|ACT35736.1| SKP1-like 2 [Petunia x hybrida]
Length=155

 Score =   227 bits (579),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 121/126 (96%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+SKMIVLKSSDGETF+VEE+VALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKMIVLKSSDGETFQVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHVE A+K+E+K  ED+LK+FD+DFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVE-ANKSEDKASEDELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|ACA61785.1| SKP1-like protein 3 [Petunia x hybrida]
Length=155

 Score =   226 bits (577),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+SKMIVLKSSDGETF+VEE+VALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKMIVLKSSDGETFQVEESVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHVE A+K E+K  ED+LK+FD+DFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVE-ANKAEDKASEDELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_004512164.1| PREDICTED: SKP1-like protein 1A-like [Cicer arietinum]
Length=155

 Score =   223 bits (567),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS+K I LKSSDGE FEV+EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSTKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEAAS +++KP EDDLK +DADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVEAAS-SDDKPTEDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|ACA61783.1| SKP1-like protein 1 [Petunia x hybrida]
Length=155

 Score =   223 bits (567),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+SKMIVLKSSDGETF+VEE+VALES T KHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKMIVLKSSDGETFQVEESVALESXTXKHMIEDDCADTSIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHVE A+K+E+K  ED+LK+FD+DFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVE-ANKSEDKASEDELKSFDSDFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|KHN41877.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   222 bits (566),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS+K I LKSSDGE FEVEEAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSAKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEAA+  E+KP EDDLK +DA+FVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVEAAN-PEDKPSEDDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_003517160.1| PREDICTED: SKP1-like protein 1A-like [Glycine max]
 gb|KHN36011.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   222 bits (566),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS+K I LKSSDGE FEV+EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSAKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEAA+  E+KP EDDLK +DADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVEAAN-PEDKPSEDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|ACA61784.1| SKP1-like protein 2 [Petunia x hybrida]
 gb|ACT35738.1| SKP1-like 1 [Petunia x hybrida]
Length=154

 Score =   221 bits (563),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 119/124 (96%), Gaps = 1/124 (1%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + KMIVLKSSDGETF+VEE+VA+ESQTIKHMIEDDCAD+ IPLPNVTS+ILAKVIEYCKR
Sbjct  2    AEKMIVLKSSDGETFQVEESVAVESQTIKHMIEDDCADSSIPLPNVTSQILAKVIEYCKR  61

Query  310  HVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  489
            HVE ASK+E+K  EDDLK+FDADFVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIK
Sbjct  62   HVE-ASKSEDKATEDDLKSFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIK  120

Query  490  GKTP  501
            GKTP
Sbjct  121  GKTP  124



>ref|XP_003612225.1| SKP1-like protein [Medicago truncatula]
 gb|ABG27019.1| SKP1-like a [Medicago truncatula]
 gb|ACJ83981.1| unknown [Medicago truncatula]
 gb|AES95183.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
 gb|AFK47584.1| unknown [Medicago truncatula]
Length=155

 Score =   221 bits (562),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 119/126 (94%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS++ I LKSSDGETFEV+EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSTRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEAA+  EEKP ED++K++D +FVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVEAAA-AEEKPSEDEIKSWDGEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|AAX83944.1| Skp1 [Capsicum annuum]
Length=156

 Score =   221 bits (562),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ K I+LKSSDGETFEV+EAVALESQTIKHMIEDDCA+T IPLPNVTSKIL+KV+EYC
Sbjct  1    MSAPKKILLKSSDGETFEVDEAVALESQTIKHMIEDDCANTSIPLPNVTSKILSKVVEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HV+A +KTE+K  EDDLK+FD++FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVDAGAKTEDKASEDDLKSFDSEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  484  IKGKTP  501
            IKGKTP
Sbjct  121  IKGKTP  126



>gb|ABB77427.1| Skp1-like protein 2 [Petunia integrifolia subsp. inflata]
Length=154

 Score =   220 bits (561),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 118/124 (95%), Gaps = 1/124 (1%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + KMIVLKSSDGETF+VEE+VA+ESQTIKHMIEDDCAD+ IPLPNVTS+ILAKVIEYCKR
Sbjct  2    AEKMIVLKSSDGETFQVEESVAVESQTIKHMIEDDCADSSIPLPNVTSQILAKVIEYCKR  61

Query  310  HVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  489
            HVE ASKTE+K  EDDLK+FDADFVKVDQ+ LFDLILAANYLNIKSLLDLTCQTVADMIK
Sbjct  62   HVE-ASKTEDKATEDDLKSFDADFVKVDQSMLFDLILAANYLNIKSLLDLTCQTVADMIK  120

Query  490  GKTP  501
            GKTP
Sbjct  121  GKTP  124



>ref|NP_001235929.1| uncharacterized protein LOC100527683 [Glycine max]
 gb|ACU16825.1| unknown [Glycine max]
Length=155

 Score =   219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS+K I LKSSDGE FEVEEAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSAKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEAA+  E+KP EDDLK + A+FVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVEAAN-PEDKPSEDDLKAWAAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_003612227.1| SKP1-like protein [Medicago truncatula]
 gb|ABG27020.1| SKP1-like b [Medicago truncatula]
 gb|ACJ84134.1| unknown [Medicago truncatula]
 gb|ACJ85945.1| unknown [Medicago truncatula]
 gb|AES95185.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
 gb|AFK39072.1| unknown [Medicago truncatula]
Length=155

 Score =   219 bits (558),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 120/126 (95%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS++ I LKSSDGETFEV+EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSTRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HV+AA+  EEKP ED+LK++D++FVKVDQATLFDLILAANYLNIK+LLDLTCQTVADM
Sbjct  61   KKHVDAAA-AEEKPNEDELKSWDSEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|ACJ86090.1| unknown [Medicago truncatula]
Length=155

 Score =   219 bits (557),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS++ I LKSSDGETFEV+EAVALESQTIKHMIEDDCAD+ IPLPNV SKILAKVIEYC
Sbjct  1    MSSTRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVASKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEAA+  EEKP ED++K++D +FVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVEAAA-AEEKPSEDEIKSWDGEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_006360903.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=150

 Score =   218 bits (554),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 1/121 (1%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MIVL+SSDGETFEV+EAVALESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYCKRHVE
Sbjct  1    MIVLRSSDGETFEVDEAVALESQTIKHMIEDDCADTSIPLPNVTSKILAKVIEYCKRHVE  60

Query  319  AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  498
               KTE+K  E+DLKTFDA+FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIKGKT
Sbjct  61   VP-KTEDKTAEEDLKTFDAEFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  119

Query  499  P  501
            P
Sbjct  120  P  120



>ref|XP_006422586.1| hypothetical protein CICLE_v10029465mg [Citrus clementina]
 ref|XP_006486726.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR35826.1| hypothetical protein CICLE_v10029465mg [Citrus clementina]
 gb|KDO68088.1| hypothetical protein CISIN_1g031498mg [Citrus sinensis]
Length=158

 Score =   218 bits (555),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 115/128 (90%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS K I LKSSDGETFEVEE VALESQTIKHM+EDDCADTVIPLPNVTS IL+KVIEYC
Sbjct  1    MSSEKKITLKSSDGETFEVEETVALESQTIKHMVEDDCADTVIPLPNVTSTILSKVIEYC  60

Query  304  KRHVEAAS--KTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVEA S  K ++K  EDDLKT+DADFVKVDQ TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KKHVEAGSGDKKDDKSTEDDLKTWDADFVKVDQNTLFDLILAANYLNIKGLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>ref|XP_009379340.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=156

 Score =   217 bits (552),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SSSK I LKSSDGE+FEVEEAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            RHV+AA K +EK  EDDLK +D +FVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  63   RHVDAA-KPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>ref|XP_007157884.1| hypothetical protein PHAVU_002G106100g [Phaseolus vulgaris]
 gb|AGV54260.1| SKP1-like protein [Phaseolus vulgaris]
 gb|ESW29878.1| hypothetical protein PHAVU_002G106100g [Phaseolus vulgaris]
Length=155

 Score =   217 bits (552),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS++ I LKSSDGE FEV+EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MSSARKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HV+AA+  ++KP E+DLK +DADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVDAAN-PDDKPSEEDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_008393845.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
 gb|ACB87913.1| SKP1-like protein 1 [Malus domestica]
Length=156

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SSSK I LKSSDGE+FEVEEAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            RHV+AA K +EK  EDDLK +D +FVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  63   RHVDAA-KPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>ref|XP_006359705.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=156

 Score =   216 bits (550),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS   I+LKSSDGE FEV+EAVALESQTIKH+IEDDCA + IPLPNVTSKILAKVIEY 
Sbjct  1    MSSPTKILLKSSDGEVFEVDEAVALESQTIKHLIEDDCAGSNIPLPNVTSKILAKVIEYS  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHVEA+SKTE+K  ED+LK FDA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVEASSKTEDKAAEDELKVFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  484  IKGKTP  501
            IKGKTP
Sbjct  121  IKGKTP  126



>gb|AFK44762.1| unknown [Lotus japonicus]
Length=155

 Score =   216 bits (550),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS+K I LKSSDGE FEV+EAVALES+TIKHM+EDDCAD+ IPLPN TSKILAKVIEYC
Sbjct  1    MSSAKKITLKSSDGEAFEVDEAVALESRTIKHMVEDDCADSGIPLPNATSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEAA+  +EKP ED+LK +DADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVEAAN-PDEKPTEDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|NP_001241052.1| uncharacterized protein LOC100798104 [Glycine max]
 gb|ACU21125.1| unknown [Glycine max]
 gb|KHN00453.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   215 bits (548),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 116/126 (92%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+S+K I LKSSDGE FEVEEAVA+ESQTIKHMIED+CAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MASTKKITLKSSDGEAFEVEEAVAVESQTIKHMIEDNCADSGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEA    +EKP ED+LK +DADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVEANC-ADEKPSEDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>emb|CDP14555.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   215 bits (548),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 1/127 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS K+IVLKSSDGETFEVEE VALESQTIKHMIED+CADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSSPKIIVLKSSDGETFEVEELVALESQTIKHMIEDNCADTCIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTE-EKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            K+HVEA   ++ +K  ++DLK+FDADFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   KKHVEAPKSSDGDKSSDEDLKSFDADFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVAD  120

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  121  MIKGKTP  127



>ref|NP_001235349.1| uncharacterized protein LOC100306458 [Glycine max]
 gb|ACU14645.1| unknown [Glycine max]
 gb|KHN35539.1| SKP1-like protein 1A [Glycine soja]
Length=155

 Score =   215 bits (548),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+S+K I LKSSDGE FEVEEAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MASTKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEA S  +EKP ED LK +D DFV VDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVEANS-ADEKPSEDVLKAWDVDFVNVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|ACU13236.1| unknown [Glycine max]
Length=155

 Score =   215 bits (547),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+S+K I LKSSDGE FEVEEAVA+ESQTIKHM+ED+CAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MASTKKITLKSSDGEAFEVEEAVAVESQTIKHMVEDNCADSGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEA    +EKP ED+LK +DADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVEANC-ADEKPSEDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_004231049.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=156

 Score =   215 bits (547),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+   I+LKSSDGE FEV+EAVALESQTIKH+IEDDCA + IPLPNVTSKILAKVIEY 
Sbjct  1    MSTPTKILLKSSDGEVFEVDEAVALESQTIKHLIEDDCAGSNIPLPNVTSKILAKVIEYS  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            KRHVEA+SKTE+K  ED+LK FDA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KRHVEASSKTEDKAAEDELKVFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  484  IKGKTP  501
            IKGKTP
Sbjct  121  IKGKTP  126



>gb|AII79402.1| S-phase kinase-associated protein 1-like protein 5 [Malus hupehensis]
Length=156

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SSSK I LKSSDGE+FEVEEAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            RHV+AA K +EK  EDDLK +D +FVKVDQATLFDLILAANYLNIK LLDLTCQTVADMI
Sbjct  63   RHVDAA-KPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KG+TP
Sbjct  122  KGRTP  126



>ref|XP_009334694.1| PREDICTED: SKP1-like protein 1B [Pyrus x bretschneideri]
Length=156

 Score =   214 bits (545),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 2/127 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I LKSSDGETFEV+EAVALESQTIKHM+EDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSERKITLKSSDGETFEVDEAVALESQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGED-DLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            ++HVEAA K EE+P  D DLK +DA+FVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   RKHVEAA-KPEERPAVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  119

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  120  MIKGKTP  126



>gb|AII79401.1| S-phase kinase-associated protein 1-like protein 4 [Malus hupehensis]
Length=156

 Score =   214 bits (545),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SSSK I LKSSDGE+FEVEEAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+AA K +EK  EDDLK +D +FVKVDQATLFDLILAANYLNIK+LLDLTCQTVADMI
Sbjct  63   KHVDAA-KPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKTLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>ref|XP_007202708.1| hypothetical protein PRUPE_ppa012752mg [Prunus persica]
 gb|EMJ03907.1| hypothetical protein PRUPE_ppa012752mg [Prunus persica]
Length=156

 Score =   213 bits (543),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SSSK I LKSSDGE+FEVEEAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+AA K +EK  EDDLK +D DFVKVDQATLFDLILAANYLNIK LLDLTCQTVADMI
Sbjct  63   KHVDAA-KPDEKISEDDLKAWDQDFVKVDQATLFDLILAANYLNIKLLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>ref|XP_008337985.1| PREDICTED: SKP1-like protein 1A [Malus domestica]
Length=156

 Score =   213 bits (543),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SSSK I LKSSDGE+FEVEEAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+AA K +EK  EDDLK +D +FVKVDQATLFDLILAANYLNIK+LLDLTCQTVADMI
Sbjct  63   KHVDAA-KPDEKISEDDLKAWDQEFVKVDQATLFDLILAANYLNIKTLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>ref|XP_007046627.1| S phase kinase-associated protein 1 [Theobroma cacao]
 gb|EOX90784.1| S phase kinase-associated protein 1 [Theobroma cacao]
Length=156

 Score =   213 bits (543),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SS + I LKSSDGE+FEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK
Sbjct  3    SSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HVEA  KTE++  ED+LK +DADFVKVDQATLFDLILAANYLNIK LLDLTCQTVADMI
Sbjct  63   KHVEAP-KTEDRTAEDELKNWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>ref|XP_007156190.1| hypothetical protein PHAVU_003G265900g [Phaseolus vulgaris]
 gb|ESW28184.1| hypothetical protein PHAVU_003G265900g [Phaseolus vulgaris]
Length=155

 Score =   213 bits (543),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+S+K I LKSSDGE FEV+E VALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYC
Sbjct  1    MASTKKITLKSSDGEAFEVDEIVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEA S  +EKP ED+LK +DA+FVKVDQATLFDLILAANYLNIK+LLDLTCQTVADM
Sbjct  61   KKHVEANS-ADEKPTEDELKAWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|AAD34458.1| Skp1 [Medicago sativa]
Length=153

 Score =   213 bits (542),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 118/124 (95%), Gaps = 1/124 (1%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            +++ I LKSSDGETFEV+EAVALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYCK+
Sbjct  1    TTRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCKK  60

Query  310  HVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  489
            HV+AA+  E+KP ED+LK++D++FVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK
Sbjct  61   HVDAAA-AEDKPNEDELKSWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  119

Query  490  GKTP  501
            GKTP
Sbjct  120  GKTP  123



>ref|XP_010680409.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=158

 Score =   213 bits (541),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 118/128 (92%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+S++ I LKSSDGETFEVEE+VALESQTIKHM+EDDCAD VIPLPNVTSKILAKVIEYC
Sbjct  1    MASTRKITLKSSDGETFEVEESVALESQTIKHMVEDDCADNVIPLPNVTSKILAKVIEYC  60

Query  304  KRHVE--AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HV+   +S+  ++  +D+LKT+DADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA
Sbjct  61   KKHVDFPKSSENNDRQVDDELKTWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>ref|XP_002510576.1| skp1, putative [Ricinus communis]
 gb|EEF52763.1| skp1, putative [Ricinus communis]
Length=157

 Score =   213 bits (541),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 119/128 (93%), Gaps = 3/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+S+ I LKSSDGETFEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTSRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVE  SK++++P   +D+LKT+DA+FVKVDQATLFDLILAANYLNIKSLLDLTCQTVA
Sbjct  61   KKHVE-TSKSDDRPSSVDDELKTWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  119

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  120  DMIKGKTP  127



>gb|ACP20181.1| SKP1-like protein [Citrus maxima]
Length=158

 Score =   212 bits (540),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 113/128 (88%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS K I LKSSDGETFEVEE VALESQTIKH +EDDCADTVIPLPNVTS IL+KVIEYC
Sbjct  1    MSSEKKITLKSSDGETFEVEETVALESQTIKHTVEDDCADTVIPLPNVTSTILSKVIEYC  60

Query  304  KRHVEAAS--KTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVEA S  K ++K   DDLKT+DADFVKVDQ TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KKHVEAGSGDKKDDKSTVDDLKTWDADFVKVDQNTLFDLILAANYLNIKGLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>ref|XP_009363460.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=156

 Score =   212 bits (539),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SSSK I LKSSDGE+FEVEEAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK
Sbjct  3    SSSKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+AA K +EK  EDDLK +D +FVKVDQ TLFDLILAANYLNIK+LLDLTCQTVADMI
Sbjct  63   KHVDAA-KPDEKISEDDLKAWDQEFVKVDQVTLFDLILAANYLNIKTLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>gb|AFM75900.1| GSK1 [Gossypium hirsutum]
 gb|AFP55363.1| SKP1-like protein [Gossypium hirsutum]
 gb|KHG25005.1| SKP1-like protein 1B [Gossypium arboreum]
 gb|KJB17605.1| hypothetical protein B456_003G007300 [Gossypium raimondii]
Length=156

 Score =   211 bits (537),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SS + I LKSSDGE+FEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK
Sbjct  3    SSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HVEA  KT+++  +D+LK++DADFVKVDQATLFDLILAANYLNIK LLDLTCQTVADMI
Sbjct  63   KHVEAP-KTDDRSADDELKSWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>ref|XP_007225985.1| hypothetical protein PRUPE_ppa012755mg [Prunus persica]
 ref|XP_008221225.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
 gb|AFJ21662.1| Skp1-like protein 1 [Prunus avium]
 gb|EMJ27184.1| hypothetical protein PRUPE_ppa012755mg [Prunus persica]
Length=156

 Score =   211 bits (536),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I LKSSDGETFEV+EAVALESQTIKHM+EDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSERKITLKSSDGETFEVDEAVALESQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HV+AA   +    ++DLK +D DFVK+DQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KKHVDAAKPDDRPSNDEDLKAWDTDFVKIDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  484  IKGKTP  501
            IKGKTP
Sbjct  121  IKGKTP  126



>ref|XP_002510577.1| skp1, putative [Ricinus communis]
 gb|EEF52764.1| skp1, putative [Ricinus communis]
Length=157

 Score =   211 bits (536),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ K I LKSSDGETFEVEE VALESQTIKHMIEDDCAD+ IPLPNVTSKIL+KVIEYC
Sbjct  1    MSAGKKITLKSSDGETFEVEELVALESQTIKHMIEDDCADSGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKP--GEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVE   K+E++P   +DDLK +DA+FVKVDQATLFDLILAANYLNIKSLLDLTCQTVA
Sbjct  61   KKHVETP-KSEDRPSSADDDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  119

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  120  DMIKGKTP  127



>ref|XP_008357122.1| PREDICTED: SKP1-like protein 1B [Malus domestica]
 gb|AII79405.1| S-phase kinase-associated protein 1-like protein 2 [Malus hupehensis]
Length=156

 Score =   210 bits (534),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I LKSSDGETFEV+EAVAL SQTIKHM+EDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSERKITLKSSDGETFEVDEAVALMSQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            ++HVEAA   E    ++DLK +DA+FVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   RKHVEAAKPEERASVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  484  IKGKTP  501
            IKGKTP
Sbjct  121  IKGKTP  126



>ref|XP_004287783.1| PREDICTED: SKP1-like protein 1A [Fragaria vesca subsp. vesca]
Length=156

 Score =   210 bits (534),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SS+K I LKSSDGE+FEVEEAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK
Sbjct  3    SSAKKITLKSSDGESFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+AA K +EK  E++LK +D DFVKVDQATLFDLILAANYLNIK+LLDLTCQTVADMI
Sbjct  63   KHVDAA-KPDEKVTEEELKVWDQDFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>ref|XP_002270061.1| PREDICTED: SKP1-like protein 1B [Vitis vinifera]
 ref|XP_010664854.1| PREDICTED: SKP1-like protein 1B [Vitis vinifera]
 emb|CAN76662.1| hypothetical protein VITISV_040452 [Vitis vinifera]
Length=156

 Score =   210 bits (534),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 115/127 (91%), Gaps = 2/127 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSS+ I LKSSDGE F+V+EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSSSRKITLKSSDGEAFDVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKPGED-DLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            K+HVEA  K EE+ G D +LK +DADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   KKHVEAP-KPEERSGVDEELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  119

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  120  MIKGKTP  126



>emb|CAA75118.1| fimbriata-associated protein [Antirrhinum majus]
Length=165

 Score =   210 bits (534),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 117/131 (89%), Gaps = 6/131 (5%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            ++SK I L+SSDGE FEV+EA+AL SQTIKHMIEDDCAD VIPLPNVT KIL+KVIEYCK
Sbjct  5    NASKKITLRSSDGEVFEVDEAIALLSQTIKHMIEDDCADNVIPLPNVTGKILSKVIEYCK  64

Query  307  RHVEA-ASKTEEK-----PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQ  468
            RHV+A A+K+EEK      G+DDLK FDADFVKVDQATLFDLILAANYLNIK+LLDLTCQ
Sbjct  65   RHVDADAAKSEEKVAAAAAGDDDLKAFDADFVKVDQATLFDLILAANYLNIKTLLDLTCQ  124

Query  469  TVADMIKGKTP  501
            TVADMIKGKTP
Sbjct  125  TVADMIKGKTP  135



>ref|XP_008445323.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=157

 Score =   209 bits (531),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 117/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I LKSSDGE FEV+EAVALESQTIKHMIEDDCAD+ IPLPNVTSKIL+KVIEYC
Sbjct  1    MSSGRKITLKSSDGEIFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVE+  K E++ G  +DDLKT+D++FVKVDQATLFDLILAANYLNIKSLLDLTCQTVA
Sbjct  61   KKHVESP-KPEDRTGSVDDDLKTWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  119

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  120  DMIKGKTP  127



>ref|XP_006435227.1| hypothetical protein CICLE_v10002751mg [Citrus clementina]
 ref|XP_006473700.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR48467.1| hypothetical protein CICLE_v10002751mg [Citrus clementina]
Length=158

 Score =   209 bits (531),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 116/129 (90%), Gaps = 4/129 (3%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+SK I LKSSDGE FEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTSKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKPG---EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            K+HVE ASK++++     +DDLK +D DFVKVDQATLFDLILAANYLNIKSLLDLTCQTV
Sbjct  61   KKHVE-ASKSDDRATSGVDDDLKAWDTDFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  119

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  120  ADMIKGKTP  128



>gb|KHG30151.1| SKP1-like protein 1A [Gossypium arboreum]
Length=156

 Score =   208 bits (530),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S+S+ I+L+SSDGETFEVEEAVA+ESQTIKHMIEDDCAD  IPLPNVTSKIL+KV+EYCK
Sbjct  3    STSRKIMLRSSDGETFEVEEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILSKVLEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+AA+  E+ P +D+LK +DADFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  63   KHVDAAADKEKTP-DDELKVWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>gb|KJB63489.1| hypothetical protein B456_010G002100 [Gossypium raimondii]
Length=158

 Score =   208 bits (530),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 115/127 (91%), Gaps = 3/127 (2%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S+ + I+LKSSDGE FEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYCK
Sbjct  3    STGRKIILKSSDGENFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  62

Query  307  RHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            +HVE ASK+E++    +DDLK +DADFVKVDQATLFDLILAANYLNIK LLDLTCQTVAD
Sbjct  63   KHVE-ASKSEDRSASLDDDLKAWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVAD  121

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  122  MIKGKTP  128



>gb|KHG24597.1| SKP1-like protein 1B [Gossypium arboreum]
Length=158

 Score =   208 bits (530),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 116/127 (91%), Gaps = 3/127 (2%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S+ + I+LKSSDGE FEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYCK
Sbjct  3    STGRKIILKSSDGENFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCK  62

Query  307  RHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            +HVE ASK+E++    +DDLK +DADFVKVDQATLFDLILAANYLNIK+LLDLTCQTVAD
Sbjct  63   KHVE-ASKSEDRSASLDDDLKGWDADFVKVDQATLFDLILAANYLNIKALLDLTCQTVAD  121

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  122  MIKGKTP  128



>ref|XP_004512165.1| PREDICTED: SKP1-like protein 1A-like [Cicer arietinum]
Length=155

 Score =   208 bits (529),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS++   LKSSDGE FEV+EAVA+ESQTIKHMIEDDCA   IPLPNVTSKILAKVIEYC
Sbjct  1    MSSTRKFTLKSSDGEAFEVDEAVAVESQTIKHMIEDDCAGNGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVEAA+ +++KP EDDLK +D+DFVKVDQATLF+LILAANYLNIK+LLDLTC TVADM
Sbjct  61   KKHVEAAT-SDDKPTEDDLKAWDSDFVKVDQATLFELILAANYLNIKNLLDLTCMTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_007041813.1| S phase kinase-associated protein 1 [Theobroma cacao]
 gb|EOX97644.1| S phase kinase-associated protein 1 [Theobroma cacao]
Length=156

 Score =   207 bits (528),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S+SK I+L+SSDGE FEVEEAVA+ESQTIKHMIEDDCAD  IP+PNVTSKILAKV+EYCK
Sbjct  3    STSKKIMLRSSDGEAFEVEEAVAVESQTIKHMIEDDCADNEIPVPNVTSKILAKVLEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+AA+  E+ P EDDLK +DADFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVA+MI
Sbjct  63   KHVDAAADKEKIP-EDDLKVWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVAEMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>gb|KDP36889.1| hypothetical protein JCGZ_08180 [Jatropha curcas]
Length=157

 Score =   207 bits (528),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 117/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ + I LKS+DGETFEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTGRKITLKSADGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKP--GEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVE   K++++P   +++LKT+DADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA
Sbjct  61   KKHVETP-KSDDRPSSADEELKTWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  119

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  120  DMIKGKTP  127



>ref|XP_009420815.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=159

 Score =   207 bits (528),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 115/128 (90%), Gaps = 5/128 (4%)
 Frame = +1

Query  133  SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRH  312
            +K I L+SSDGE FEVEEAVA+ESQTIKHMIEDDCAD  IPLPNVTSKILAKV+EYCK+H
Sbjct  2    AKTITLRSSDGEVFEVEEAVAMESQTIKHMIEDDCADNGIPLPNVTSKILAKVVEYCKKH  61

Query  313  VEAASK---TEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            V+AA++   +++ P   EDDLKT+DADFVKVDQATLFDLILAANYLNIK LLDLTCQTVA
Sbjct  62   VDAAARSSSSDDAPSVTEDDLKTWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVA  121

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  122  DMIKGKTP  129



>emb|CAB87834.1| putative kinetochore protein [Vicia faba var. minor]
Length=124

 Score =   206 bits (525),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+S+K I LKSSDGE FEV+EAVALESQ IKHMIEDDCAD+ IPLPNVTSKILAKVIE+C
Sbjct  1    MASTKKITLKSSDGEAFEVDEAVALESQAIKHMIEDDCADSGIPLPNVTSKILAKVIEFC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HV AA+ +++KP ED+LK +DADFVKVDQ TLFDLILAANYLNIK+LLDLTCQTVADM
Sbjct  61   KKHVXAAA-SDDKPTEDELKAWDADFVKVDQVTLFDLILAANYLNIKNLLDLTCQTVADM  119

Query  484  IKGKT  498
            IKGKT
Sbjct  120  IKGKT  124



>ref|XP_010033522.1| PREDICTED: SKP1-like protein 1B [Eucalyptus grandis]
 gb|KCW53208.1| hypothetical protein EUGRSUZ_J02478 [Eucalyptus grandis]
Length=155

 Score =   207 bits (527),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 116/126 (92%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS+K I L+SSDGE+FEV+EAVA+ESQTIKHMIEDDCAD+ IPLPNVTS+ILAKVIEYC
Sbjct  1    MSSAKKITLRSSDGESFEVDEAVAVESQTIKHMIEDDCADSGIPLPNVTSRILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVE+A K +++  EDDLK +DA+FVKVDQATLFDLILAANYLNIK LLDLTC TVADM
Sbjct  61   KKHVESA-KPDDRTTEDDLKAWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCLTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_002301954.1| hypothetical protein POPTR_0002s02020g [Populus trichocarpa]
 ref|XP_011034986.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
 gb|ABK94461.1| unknown [Populus trichocarpa]
 gb|EEE81227.1| hypothetical protein POPTR_0002s02020g [Populus trichocarpa]
Length=157

 Score =   207 bits (527),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSS+   LKSSDGE FEV+EAVALESQTIKHMIE+DCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSSSRKFTLKSSDGEAFEVDEAVALESQTIKHMIEEDCADNAIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKP--GEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVE   K++++P   +DDLK++DA+FVKVDQATLFDLILAANYLNIK+LLDLTCQTVA
Sbjct  61   KKHVETP-KSDDRPSSADDDLKSWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  119

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  120  DMIKGKTP  127



>ref|XP_004143010.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 ref|XP_004161077.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN62264.1| hypothetical protein Csa_2G346050 [Cucumis sativus]
Length=157

 Score =   207 bits (527),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 116/128 (91%), Gaps = 3/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I LKSSDGE FEV+EAVALESQTIKHMIEDDCAD+ IPLPNV SKIL+KVIEYC
Sbjct  1    MSSGRKITLKSSDGEIFEVDEAVALESQTIKHMIEDDCADSGIPLPNVNSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVE+  K E++ G  +DDLKT+D++FVKVDQATLFDLILAANYLNIKSLLDLTCQTVA
Sbjct  61   KKHVESP-KPEDRTGSVDDDLKTWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  119

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  120  DMIKGKTP  127



>ref|XP_011088616.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=166

 Score =   207 bits (527),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 113/131 (86%), Gaps = 6/131 (5%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            ++ KMIVLKSSDGETFEVEEAVA ESQTIKHMIED+CADT IPLPNVTSKILAKVIEYCK
Sbjct  6    AAQKMIVLKSSDGETFEVEEAVAPESQTIKHMIEDNCADTSIPLPNVTSKILAKVIEYCK  65

Query  307  RHV------EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQ  468
            RHV       A +   +K  EDDLK FDA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQ
Sbjct  66   RHVDAAAKASADATASDKVAEDDLKAFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQ  125

Query  469  TVADMIKGKTP  501
            TVADMIKGKTP
Sbjct  126  TVADMIKGKTP  136



>ref|XP_010266012.1| PREDICTED: SKP1-like protein 1B [Nelumbo nucifera]
Length=154

 Score =   207 bits (526),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 113/124 (91%), Gaps = 1/124 (1%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S K + LKSSDGETF+V+EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYCK+
Sbjct  2    SGKKVTLKSSDGETFDVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCKK  61

Query  310  HVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  489
            HVE   KT+++  ED+LK +DA+FVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK
Sbjct  62   HVETP-KTDDRGAEDELKNWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  120

Query  490  GKTP  501
            GKTP
Sbjct  121  GKTP  124



>gb|KDP23982.1| hypothetical protein JCGZ_25370 [Jatropha curcas]
Length=158

 Score =   207 bits (526),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 111/128 (87%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSSK I LKSSDGE FEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSSKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVE     +   G  +D+LK +DA+FVKVDQATLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KKHVETPKSDDRSNGSADDELKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>gb|KJB15832.1| hypothetical protein B456_002G198700 [Gossypium raimondii]
Length=156

 Score =   207 bits (526),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 115/125 (92%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S+S+ I+L+SSDGETFEVEEAVA+ESQTIKHMIEDDCAD  IPLPNVTSKIL+KV+EYCK
Sbjct  3    STSRKIMLRSSDGETFEVEEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILSKVLEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+A +  E+ P +D+LK +DADFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  63   KHVDAVADKEKTP-DDELKAWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>gb|KDP29669.1| hypothetical protein JCGZ_18831 [Jatropha curcas]
Length=159

 Score =   206 bits (525),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 115/129 (89%), Gaps = 3/129 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+SK + LKSSDGETFEVEEAVA+ESQTIKHMIEDDCADT IPLPNVTSKILAKVIEYC
Sbjct  1    MSTSKKVTLKSSDGETFEVEEAVAVESQTIKHMIEDDCADTEIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAAS---KTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            K+HVEAA+     ++   ++ L T+DADFVKVDQ TLFDLILAANYLNIKSLLDLTCQTV
Sbjct  61   KKHVEAATADKDKDKSSSDEALTTWDADFVKVDQNTLFDLILAANYLNIKSLLDLTCQTV  120

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  121  ADMIKGKTP  129



>ref|XP_006425391.1| hypothetical protein CICLE_v10026642mg [Citrus clementina]
 ref|XP_006467001.1| PREDICTED: SKP1-like protein 1B-like [Citrus sinensis]
 gb|ESR38631.1| hypothetical protein CICLE_v10026642mg [Citrus clementina]
Length=168

 Score =   206 bits (524),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 112/138 (81%), Gaps = 12/138 (9%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS KMIVLKS DGE+FEVEEAVALES TIKHMIEDDCAD  IPLPNVT KILAKV+EYC
Sbjct  1    MSSPKMIVLKSCDGESFEVEEAVALESTTIKHMIEDDCADNGIPLPNVTGKILAKVVEYC  60

Query  304  KRHVEA------------ASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKS  447
            K+HVE             ++ T    GE+DLK++D DFVKVDQATLFDLILAANYLNIK 
Sbjct  61   KKHVEVPATQDSNNSGANSNGTATNGGEEDLKSWDTDFVKVDQATLFDLILAANYLNIKG  120

Query  448  LLDLTCQTVADMIKGKTP  501
            LLDLTCQTVADMIKGKTP
Sbjct  121  LLDLTCQTVADMIKGKTP  138



>ref|NP_565123.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
 sp|Q39255.1|SKP1A_ARATH RecName: Full=SKP1-like protein 1A; Short=SKP1-like 1; AltName: 
Full=UFO-binding protein 1 [Arabidopsis thaliana]
 pdb|2P1M|A Chain A, Tir1-ask1 Complex Structure
 pdb|2P1N|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1N|D Chain D, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1O|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1P|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|2P1Q|A Chain A, Mechanism Of Auxin Perception By The Tir1 Ubiquitin 
Ligase
 pdb|3C6N|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 pdb|3C6O|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein-Substrate 
Interactions In Auxin Perception And Signaling
 pdb|3C6P|A Chain A, Small Molecule Agonists And Antagonists Of F-Box Protein- 
Substrate Interactions In Auxin Perception And Signaling
 pdb|3OGK|A Chain A, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|C Chain C, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|E Chain E, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|G Chain G, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|I Chain I, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|K Chain K, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|M Chain M, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGK|O Chain O, Structure Of Coi1-Ask1 In Complex With Coronatine And 
An Incomplete Jaz1 Degron
 pdb|3OGL|A Chain A, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|C Chain C, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|E Chain E, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|G Chain G, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|I Chain I, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|K Chain K, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|M Chain M, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGL|O Chain O, Structure Of Coi1-Ask1 In Complex With Ja-Isoleucine 
And The Jaz1 Degron
 pdb|3OGM|A Chain A, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|C Chain C, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|E Chain E, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|G Chain G, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|I Chain I, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|K Chain K, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|M Chain M, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 pdb|3OGM|O Chain O, Structure Of Coi1-Ask1 In Complex With Coronatine And 
The Jaz1 Degron
 gb|AAF26761.1|AC007396_10 T4O12.17 [Arabidopsis thaliana]
 gb|AAB17535.1| homolog to Skp1p, an evolutionarily conserved kinetochore protein 
in budding yeast [Arabidopsis thaliana]
 gb|AAC14444.1| Skp1 homolog [Arabidopsis thaliana]
 gb|AAC63109.1| UIP1 [Arabidopsis thaliana]
 gb|AAL87354.1| putative SKP1/ASK1 protein At1 [Arabidopsis thaliana]
 gb|AAM45019.1| putative SKP1/ASK1 protein At1 [Arabidopsis thaliana]
 gb|AEE35780.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
Length=160

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 114/129 (88%), Gaps = 5/129 (4%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSDGE+FEVEEAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYCKR
Sbjct  2    SAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKR  61

Query  310  HVE-AASKTEEKPG----EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            HVE AASK E   G    +DDLK +DADF+K+DQATLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  122  ADMIKGKTP  130



>ref|XP_004248653.2| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=160

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = +1

Query  115  LKKMSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVI  294
            L K     MIVL+SSDGETFEV++AVALESQTIKHMIED+CADT IPLPN+TSKILA VI
Sbjct  3    LGKGVGRWMIVLRSSDGETFEVDKAVALESQTIKHMIEDNCADTSIPLPNITSKILALVI  62

Query  295  EYCKRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            EYCKRH+E A K E+K  E+DLKTFDA+FVKVDQ+TLF+LILA NYLNIKSL+DLTCQTV
Sbjct  63   EYCKRHLEVA-KVEDKIAEEDLKTFDAEFVKVDQSTLFNLILAVNYLNIKSLMDLTCQTV  121

Query  475  ADMIKGKTP  501
            A+MIKGKTP
Sbjct  122  AEMIKGKTP  130



>ref|XP_003621661.1| SKP1-like protein [Medicago truncatula]
 gb|AES77879.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   205 bits (522),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S++K + LKSSD ETFEV EAVALESQTIKHMIEDDC D  IP+PNVT +ILAKVIEYCK
Sbjct  3    STTKKMTLKSSDNETFEVPEAVALESQTIKHMIEDDCTDNGIPVPNVTGQILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+AAS ++EKP EDDLK +DA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQ+VADMI
Sbjct  63   KHVDAAS-SDEKPSEDDLKNWDAEFVKVDQDTLFDLILAANYLNIKSLLDLTCQSVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>ref|XP_010550803.1| PREDICTED: SKP1-like protein 1B [Tarenaya hassleriana]
Length=158

 Score =   205 bits (522),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 112/127 (88%), Gaps = 3/127 (2%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S + I LKSSDGETFEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYCK+
Sbjct  2    SGRKIALKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCKK  61

Query  310  HVEAASKTEEK---PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            HV+A+ KTE       +DDLK +DA+FVKVDQATLFDLILAANYLNIK LLDLTCQTVAD
Sbjct  62   HVDASVKTETATTYSTDDDLKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVAD  121

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  122  MIKGKTP  128



>ref|XP_011092967.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=169

 Score =   205 bits (522),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 117/133 (88%), Gaps = 8/133 (6%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +SSKMIVLKSSDGETFEVEEAVA+ESQTIKHMIED+CADT IPLPNVTSKILAKVIEYCK
Sbjct  7    ASSKMIVLKSSDGETFEVEEAVAVESQTIKHMIEDNCADTCIPLPNVTSKILAKVIEYCK  66

Query  307  RHVEAASKTE--------EKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLT  462
            RHV+AA+K          +K  ++DLK FD +FVKVDQ TLFDLILAANYLNIKSLLDLT
Sbjct  67   RHVDAAAKANADGALTPADKVVDEDLKAFDTEFVKVDQGTLFDLILAANYLNIKSLLDLT  126

Query  463  CQTVADMIKGKTP  501
            CQTVADMIKGKTP
Sbjct  127  CQTVADMIKGKTP  139



>ref|XP_004248654.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=150

 Score =   204 bits (520),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 113/121 (93%), Gaps = 1/121 (1%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MIVL+ SDGETFEV++AVALESQTIKHMIEDDCADT IPLPN+TSKILA VIEYCKRH+E
Sbjct  1    MIVLRCSDGETFEVDKAVALESQTIKHMIEDDCADTSIPLPNITSKILALVIEYCKRHLE  60

Query  319  AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  498
             A K E++  E+DLKTFDA+FVKVDQ+TLF+LILAANYLNIKSL+DLTCQTVA+MIKGKT
Sbjct  61   VA-KVEDQTAEEDLKTFDAEFVKVDQSTLFNLILAANYLNIKSLMDLTCQTVAEMIKGKT  119

Query  499  P  501
            P
Sbjct  120  P  120



>gb|KEH23694.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   204 bits (520),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S+SK I LKSSD ETFEV EAVALESQTIKHMIEDDC D  IP+PNVT +ILAKVIEYCK
Sbjct  3    STSKKITLKSSDNETFEVPEAVALESQTIKHMIEDDCTDNGIPVPNVTGQILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+A S ++EKP EDDLK +DA+FVKVDQ  LFDLILAANYLNIKSLLDLTCQTVADMI
Sbjct  63   KHVDAES-SDEKPSEDDLKNWDAEFVKVDQDKLFDLILAANYLNIKSLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>ref|XP_004144851.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 ref|XP_004163420.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN43257.1| hypothetical protein Csa_7G012950 [Cucumis sativus]
Length=155

 Score =   204 bits (519),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSSK IVL+SSDGETF+V+E VA+ESQTIKHMIEDDCADTVIPLPNVTS IL+KVIEYC
Sbjct  1    MSSSKKIVLRSSDGETFDVDEIVAVESQTIKHMIEDDCADTVIPLPNVTSAILSKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K HVE   K + K  +D LKT+DA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KMHVETDDK-DSKVIDDTLKTWDAEFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|ABK96569.1| unknown [Populus trichocarpa x Populus deltoides]
Length=158

 Score =   204 bits (519),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 114/129 (88%), Gaps = 4/129 (3%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I L+SSDGE+FEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSGRKISLRSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEK---PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            K+HVE   K+E++    G+D+LK +D +FV+VDQATLFDLILAANYLNIK LLDLTCQTV
Sbjct  61   KKHVETP-KSEDRGTNSGDDELKNWDTEFVRVDQATLFDLILAANYLNIKGLLDLTCQTV  119

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  120  ADMIKGKTP  128



>gb|KDO71310.1| hypothetical protein CISIN_1g030962mg [Citrus sinensis]
Length=168

 Score =   204 bits (520),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 111/138 (80%), Gaps = 12/138 (9%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS KMIVLKS DGE+FEVEEAVALES TIKHMIEDDCAD  IPLPNVT KILAKV+EYC
Sbjct  1    MSSPKMIVLKSCDGESFEVEEAVALESTTIKHMIEDDCADNGIPLPNVTGKILAKVVEYC  60

Query  304  KRHVEAASKTEE------------KPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKS  447
            K+HVE  +  +               GE+DLK++D DFVKVDQATLFDLILAANYLNIK 
Sbjct  61   KKHVEVPTTQDSNTSGANSNGAATNGGEEDLKSWDTDFVKVDQATLFDLILAANYLNIKG  120

Query  448  LLDLTCQTVADMIKGKTP  501
            LLDLTCQTVADMIKGKTP
Sbjct  121  LLDLTCQTVADMIKGKTP  138



>ref|XP_004291337.1| PREDICTED: SKP1-like protein 1B [Fragaria vesca subsp. vesca]
Length=159

 Score =   204 bits (519),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 114/129 (88%), Gaps = 3/129 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I LKSSDGE+FEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASK---TEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            K+HV+AA K        G+++LK +DADFVKVDQATLFDLILAANYLNIK+LLDLTCQTV
Sbjct  61   KKHVDAAPKSDDRSSSSGDEELKNWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTV  120

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  121  ADMIKGKTP  129



>gb|EYU17579.1| hypothetical protein MIMGU_mgv1a015014mg [Erythranthe guttata]
Length=170

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 114/133 (86%), Gaps = 8/133 (6%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +  K I L+SSDGE FEVE+AVA+ESQTIKHMIEDDCAD VIPLPNVT KIL+KVIEYCK
Sbjct  8    NGGKKITLRSSDGEVFEVEDAVAVESQTIKHMIEDDCADNVIPLPNVTGKILSKVIEYCK  67

Query  307  RHVEA---ASKTEEK-----PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLT  462
            RHV+A   A+K ++K       ++DLK FDADFVKVDQATLFDLILAANYLNIKSLLDLT
Sbjct  68   RHVDAAASATKADDKLASAAASDEDLKVFDADFVKVDQATLFDLILAANYLNIKSLLDLT  127

Query  463  CQTVADMIKGKTP  501
            CQTVADMIKGKTP
Sbjct  128  CQTVADMIKGKTP  140



>gb|ABS17589.1| SKP1 component-like 1 [Humulus lupulus]
Length=157

 Score =   204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 113/128 (88%), Gaps = 3/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ + I LKSSDGET EV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTGRKITLKSSDGETLEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HV  A K E++    +D+LK +DADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA
Sbjct  61   KKHV-GAPKAEDRASSVDDELKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  119

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  120  DMIKGKTP  127



>ref|XP_002306950.1| hypothetical protein POPTR_0005s26450g [Populus trichocarpa]
 gb|ABK95554.1| unknown [Populus trichocarpa]
 gb|EEE93946.1| hypothetical protein POPTR_0005s26450g [Populus trichocarpa]
Length=157

 Score =   203 bits (516),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 115/128 (90%), Gaps = 3/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ +  +LKSSDGE+FEV+EAVA+ESQTIKHMIEDDCAD  IPLPNVTSK+LAKVIEYC
Sbjct  1    MSTGRKFILKSSDGESFEVDEAVAVESQTIKHMIEDDCADNGIPLPNVTSKVLAKVIEYC  60

Query  304  KRHVEAASKTEEKPGE--DDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVE+  K++++P    DDLK +DA+FVKVDQATLFDLILAANYLNIK+LLDLTCQ VA
Sbjct  61   KKHVESP-KSDDRPSSAADDLKAWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQRVA  119

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  120  DMIKGKTP  127



>gb|EPS66410.1| hypothetical protein M569_08366, partial [Genlisea aurea]
Length=168

 Score =   203 bits (516),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 117/133 (88%), Gaps = 8/133 (6%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +SSK I L+SSDGE FEVEEAVA+ESQTIKHMIEDDCAD+VIPLPNV  KIL+KVIEYC+
Sbjct  6    NSSKKITLRSSDGEIFEVEEAVAVESQTIKHMIEDDCADSVIPLPNVHGKILSKVIEYCR  65

Query  307  RHVE---AASKTEEKPG-----EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLT  462
            RHVE   +A+K+++K       ++DLK+FDA+FVKVDQ TLFDLILAANYLNIKSLLDLT
Sbjct  66   RHVEVGASAAKSDDKVSSALSPDEDLKSFDAEFVKVDQGTLFDLILAANYLNIKSLLDLT  125

Query  463  CQTVADMIKGKTP  501
            CQTVADMIKGKTP
Sbjct  126  CQTVADMIKGKTP  138



>ref|XP_009362142.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
 ref|XP_009373360.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=177

 Score =   203 bits (517),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I LKSSDGETFEV+EAVAL SQTIKHM+EDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSERKITLKSSDGETFEVDEAVALMSQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            ++HVEAA   E    ++DLK +DA+FVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   RKHVEAAKPEERASVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  484  IKGKT  498
            IK KT
Sbjct  121  IKEKT  125



>ref|XP_002279232.1| PREDICTED: SKP1-like protein 1A isoform X5 [Vitis vinifera]
 emb|CAN73136.1| hypothetical protein VITISV_023042 [Vitis vinifera]
Length=155

 Score =   202 bits (515),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+SSK I L+SSDGE F++EE VA+ESQTIKHMIED CAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MASSKTITLRSSDGEAFDLEEVVAVESQTIKHMIEDGCADNAIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVE   K EE    D+LK +DADFVKVDQATLFDLILAANYL+IKSLLDLTCQTVADM
Sbjct  61   KKHVE-TPKAEEHAVNDELKAWDADFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>gb|ABK92723.1| unknown [Populus trichocarpa]
Length=158

 Score =   202 bits (515),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 113/129 (88%), Gaps = 4/129 (3%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I L+SSDGE+FEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSGRKISLRSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEK---PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            K+HVE   K E++    G+D+LK +D +FV+VDQATLFDLILAANYLNIK LLDLTCQTV
Sbjct  61   KKHVETP-KPEDRGTNSGDDELKNWDTEFVRVDQATLFDLILAANYLNIKGLLDLTCQTV  119

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  120  ADMIKGKTP  128



>ref|XP_011003066.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=157

 Score =   202 bits (514),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 114/128 (89%), Gaps = 3/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ +  +LKSSDGE+FEV+EAVA+ESQTIKHMIEDDCAD  IPLPNVTSK+LAKVIEYC
Sbjct  1    MSAGRKFILKSSDGESFEVDEAVAVESQTIKHMIEDDCADNGIPLPNVTSKVLAKVIEYC  60

Query  304  KRHVEAASKTEEKPGE--DDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVE+  K++++P    DDLK +DA+FVKVDQATLFDLILAANYLNIK LLDLTCQ VA
Sbjct  61   KKHVESP-KSDDRPSSAADDLKAWDAEFVKVDQATLFDLILAANYLNIKHLLDLTCQRVA  119

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  120  DMIKGKTP  127



>ref|XP_011043147.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=158

 Score =   202 bits (514),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 113/129 (88%), Gaps = 4/129 (3%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I L+SSDGE+FEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSGRKISLRSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEK---PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            K+HVE   K+E++    G D+LK +DA+FV+VDQ TLFDLILAANYLNIK LLDLTCQTV
Sbjct  61   KKHVETP-KSEDRGTNSGGDELKNWDAEFVRVDQVTLFDLILAANYLNIKDLLDLTCQTV  119

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  120  ADMIKGKTP  128



>ref|XP_010935122.1| PREDICTED: SKP1-like protein 1A [Elaeis guineensis]
Length=163

 Score =   202 bits (514),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 111/132 (84%), Gaps = 8/132 (6%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + K I LKSSDGE FEVEEAVA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYCKR
Sbjct  2    AEKKITLKSSDGEVFEVEEAVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKR  61

Query  310  HVEAASK--------TEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTC  465
            HV+ A+         T  KP +D+LK++DA+FVKVDQATLFDLILAANYLNIK LLDLTC
Sbjct  62   HVDFAAASSRSTADDTSSKPADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTC  121

Query  466  QTVADMIKGKTP  501
            QTVADMIKGKTP
Sbjct  122  QTVADMIKGKTP  133



>ref|XP_006302938.1| hypothetical protein CARUB_v10021077mg [Capsella rubella]
 gb|EOA35836.1| hypothetical protein CARUB_v10021077mg [Capsella rubella]
Length=159

 Score =   202 bits (514),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 116/128 (91%), Gaps = 4/128 (3%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSDGE+FEV+EAVALESQTI HM+EDDC +  +PLPNVTSKILAKVIEYCK+
Sbjct  2    SAKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVENGVPLPNVTSKILAKVIEYCKK  61

Query  310  HVE-AASKTEEKPG---EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            HVE AA+K+E   G   +DDLKT+DADF+K+DQATLF+LILAANYLNIK+LLDLTCQTVA
Sbjct  62   HVEAAAAKSEAVEGASTDDDLKTWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  121

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  122  DMIKGKTP  129



>ref|XP_006360899.1| PREDICTED: SKP1-like protein 1B-like isoform X1 [Solanum tuberosum]
Length=150

 Score =   202 bits (513),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 109/121 (90%), Gaps = 1/121 (1%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MIVL+SSDGETFEV+EAVALES TIKHMIEDDC DT I LPNVTSKIL KVIEYCKRHVE
Sbjct  1    MIVLRSSDGETFEVDEAVALESPTIKHMIEDDCTDTSISLPNVTSKILVKVIEYCKRHVE  60

Query  319  AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  498
               K E+K  E DLKTFDA+FVKVDQ+TL+DL+LAANYLNIKSLLDLTCQTVADMIKGKT
Sbjct  61   VP-KAEDKTAEVDLKTFDAEFVKVDQSTLYDLMLAANYLNIKSLLDLTCQTVADMIKGKT  119

Query  499  P  501
            P
Sbjct  120  P  120



>ref|XP_008447950.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=155

 Score =   202 bits (513),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 112/126 (89%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSSK IVL+SSDGETF+V+E VA+ESQTIKHMIEDDC DTVIPLPNVTS IL+KV+EYC
Sbjct  1    MSSSKKIVLRSSDGETFDVDEIVAVESQTIKHMIEDDCVDTVIPLPNVTSAILSKVVEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K HVE   K + K  +D LKT+DA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   KMHVETDDK-DSKVIDDTLKTWDAEFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_010095548.1| SKP1-like protein 1B [Morus notabilis]
 gb|EXB60668.1| SKP1-like protein 1B [Morus notabilis]
Length=157

 Score =   202 bits (513),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I LKSSDGETFEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSSGRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAAS-KTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            K+HVEA          +DDLK +DADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  61   KKHVEAPKSDDRASSADDDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  120

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  121  MIKGKTP  127



>ref|XP_010029647.1| PREDICTED: SKP1-like protein 1B isoform X1 [Eucalyptus grandis]
Length=155

 Score =   201 bits (512),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M++S+ I L+SSDGE+F+VE++VA+ESQTIKHMIED CAD  IPLPNV SKILAKVIEYC
Sbjct  1    MATSRKITLRSSDGESFDVEQSVAVESQTIKHMIEDGCADNAIPLPNVNSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K HVE+A K E++  +++LKT+D DFVKVDQATLFDLIL+ANYLNIKSLLDLTCQTVADM
Sbjct  61   KMHVESA-KPEDRVNDEELKTWDVDFVKVDQATLFDLILSANYLNIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_010494151.1| PREDICTED: SKP1-like protein 1B [Camelina sativa]
Length=168

 Score =   202 bits (513),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 114/138 (83%), Gaps = 12/138 (9%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ + I LKSSDGE FE++EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTEEK------------PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKS  447
            K+HVEAA+K+E                ++DLKT+D++F+KVDQ TLFDLILAANYLNIK 
Sbjct  61   KKHVEAAAKSETAVSTAATTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKG  120

Query  448  LLDLTCQTVADMIKGKTP  501
            LLDLTCQTVADMIKGKTP
Sbjct  121  LLDLTCQTVADMIKGKTP  138



>gb|EPS61104.1| hypothetical protein M569_13700 [Genlisea aurea]
Length=167

 Score =   202 bits (513),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 112/131 (85%), Gaps = 6/131 (5%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +S   IVL+SSDGE FEV+E+VALESQTIKH+IED CADT IPLPNVT+KIL+KVIEYCK
Sbjct  7    TSESKIVLRSSDGELFEVDESVALESQTIKHLIEDKCADTAIPLPNVTAKILSKVIEYCK  66

Query  307  RHVEAASKT------EEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQ  468
            +H+ AASK        EK  ED+LK FDA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQ
Sbjct  67   QHISAASKVTDGLTLSEKAVEDELKAFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQ  126

Query  469  TVADMIKGKTP  501
            TVADMIKGKTP
Sbjct  127  TVADMIKGKTP  137



>ref|XP_009128146.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
 emb|CDY39073.1| BnaA02g17620D [Brassica napus]
Length=160

 Score =   201 bits (512),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 115/129 (89%), Gaps = 5/129 (4%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSDGE+FEV+EAVALESQTI HM+EDDC D  IPLPNVTSKILAKVIEYCK+
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKK  61

Query  310  HVE-AASKTEEKPG----EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            HV+ AASKTE   G    +DDLK +DA+F+K+DQATLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAAASKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  122  ADMIKGKTP  130



>gb|KEH23696.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   201 bits (512),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S++K I LKSSD ETFEV EAVALESQTIK+MIEDDC D  IP+PNVT +ILAKVIEYCK
Sbjct  3    STTKKITLKSSDNETFEVPEAVALESQTIKYMIEDDCTDNGIPVPNVTGQILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+A S ++EKP EDDLK +DA+FVKVDQA LF LILAANYLNIKSLLDLTCQTVADMI
Sbjct  63   KHVDAES-SDEKPSEDDLKNWDAEFVKVDQAKLFGLILAANYLNIKSLLDLTCQTVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>dbj|BAB85607.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   201 bits (511),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 115/129 (89%), Gaps = 5/129 (4%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSDGE+FEV+EAVALESQTI HM+EDDC D  IPLPNVTSKILAKVIEYCK+
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKK  61

Query  310  HVE-AASKTEEKPG----EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            HV+ AASKTE   G    +DDLK +DA+F+K+DQATLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAAASKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  122  ADMIKGKTP  130



>ref|XP_009363144.1| PREDICTED: uncharacterized protein LOC103953139 [Pyrus x bretschneideri]
Length=275

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS + I LKSSDGETFEV+EAVAL SQTIKHM+EDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSSERKITLKSSDGETFEVDEAVALMSQTIKHMVEDDCADNGIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            ++HVEAA   E    ++DLK +DA+FVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM
Sbjct  61   RKHVEAAKPEERASVDEDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  120

Query  484  IKGKT  498
            IK KT
Sbjct  121  IKEKT  125



>ref|NP_568603.1| SKP1-like protein 1B [Arabidopsis thaliana]
 sp|Q9FHW7.1|SKP1B_ARATH RecName: Full=SKP1-like protein 1B; AltName: Full=SKP1-like 2; 
AltName: Full=UFO-binding protein 2 [Arabidopsis thaliana]
 gb|AAC14445.1| Skp1 homolog [Arabidopsis thaliana]
 dbj|BAB08452.1| UIP2 [Arabidopsis thaliana]
 gb|AAO44064.1| At5g42190 [Arabidopsis thaliana]
 dbj|BAE99755.1| UIP2 [Arabidopsis thaliana]
 gb|AED94777.1| S-phase kinase-associated protein 1 [Arabidopsis thaliana]
Length=171

 Score =   201 bits (511),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 112/141 (79%), Gaps = 15/141 (11%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ + I LKSSDGE FE++EAVALESQTIKHMIEDDC D  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTE---------------EKPGEDDLKTFDADFVKVDQATLFDLILAANYLN  438
            KRHVEAA K+E                   ++DLKT+D++F+KVDQ TLFDLILAANYLN
Sbjct  61   KRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLN  120

Query  439  IKSLLDLTCQTVADMIKGKTP  501
            IK LLDLTCQTVADMIKGKTP
Sbjct  121  IKGLLDLTCQTVADMIKGKTP  141



>gb|AAC63110.1| UIP2 [Arabidopsis thaliana]
Length=172

 Score =   201 bits (510),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 112/141 (79%), Gaps = 15/141 (11%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ + I LKSSDGE FE++EAVALESQTIKHMIEDDC D  IPLPNVTSKIL+KVIEYC
Sbjct  2    MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYC  61

Query  304  KRHVEAASKTE---------------EKPGEDDLKTFDADFVKVDQATLFDLILAANYLN  438
            KRHVEAA K+E                   ++DLKT+D++F+KVDQ TLFDLILAANYLN
Sbjct  62   KRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLN  121

Query  439  IKSLLDLTCQTVADMIKGKTP  501
            IK LLDLTCQTVADMIKGKTP
Sbjct  122  IKGLLDLTCQTVADMIKGKTP  142



>ref|XP_006281119.1| hypothetical protein CARUB_v10027150mg [Capsella rubella]
 gb|EOA14017.1| hypothetical protein CARUB_v10027150mg [Capsella rubella]
Length=204

 Score =   202 bits (513),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 115/142 (81%), Gaps = 14/142 (10%)
 Frame = +1

Query  118  KKMSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIE  297
            K MS+ + I LKSSDGE FE++EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIE
Sbjct  33   KPMSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIE  92

Query  298  YCKRHVEAASKTE--------------EKPGEDDLKTFDADFVKVDQATLFDLILAANYL  435
            YCK+HVEAA+K+E                  ++DLKT+D++F+KVDQ TLFDLILAANYL
Sbjct  93   YCKKHVEAAAKSETAVSAASTTTTAAASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYL  152

Query  436  NIKSLLDLTCQTVADMIKGKTP  501
            NIK LLDLTCQTVADMIKGKTP
Sbjct  153  NIKGLLDLTCQTVADMIKGKTP  174



>emb|CDY13521.1| BnaC02g23320D [Brassica napus]
Length=160

 Score =   200 bits (509),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 115/129 (89%), Gaps = 5/129 (4%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSDGE+FEV+EAVALESQTI HM+EDDC D  IPLPNVTSKILAKVIEYCK+
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKK  61

Query  310  HVE-AASKTEEKPG----EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            HV+ AASKT+   G    +DDLK +DA+F+K+DQATLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAAASKTDAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  122  ADMIKGKTP  130



>ref|XP_006360900.1| PREDICTED: SKP1-like protein 1B-like isoform X2 [Solanum tuberosum]
Length=149

 Score =   199 bits (507),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MIVL+SSDGETFEV+EAVALES TIKHMIEDDC DT I LPNVTSKIL KVIEYCKRHVE
Sbjct  1    MIVLRSSDGETFEVDEAVALESPTIKHMIEDDCTDTSISLPNVTSKILVKVIEYCKRHVE  60

Query  319  AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  498
               K E+K  E DLKTFDA+FVKVDQ+TL+DL+LAANYLNI SL+DLTCQTVADMIKGKT
Sbjct  61   VP-KAEDKTAEVDLKTFDAEFVKVDQSTLYDLMLAANYLNINSLIDLTCQTVADMIKGKT  119

Query  499  P  501
            P
Sbjct  120  P  120



>gb|KFK42033.1| hypothetical protein AALP_AA2G203200 [Arabis alpina]
Length=159

 Score =   200 bits (508),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 116/128 (91%), Gaps = 4/128 (3%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSDGE+FEV+EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYCK+
Sbjct  2    SAKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  310  HVE-AASKTEEKPG---EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            HV+ AASK+E   G   ++DLKT+DA+F+K+DQATLF+LILAANYLNIK+LLDLTCQTVA
Sbjct  62   HVDAAASKSEAVDGGSSDEDLKTWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  121

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  122  DMIKGKTP  129



>ref|XP_010442189.1| PREDICTED: SKP1-like protein 1B [Camelina sativa]
Length=170

 Score =   200 bits (509),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 112/140 (80%), Gaps = 14/140 (10%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ + I LKSSDGE FE+EEAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTVRKITLKSSDGENFEIEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTEEK--------------PGEDDLKTFDADFVKVDQATLFDLILAANYLNI  441
            K+HVEAA+   E                 ++DLKT+D++F+KVDQ TLFDLILAANYLNI
Sbjct  61   KKHVEAAAAKSETAVATAATTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNI  120

Query  442  KSLLDLTCQTVADMIKGKTP  501
            K LLDLTCQTVADMIKGKTP
Sbjct  121  KGLLDLTCQTVADMIKGKTP  140



>ref|XP_002863814.1| hypothetical protein ARALYDRAFT_917589 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40073.1| hypothetical protein ARALYDRAFT_917589 [Arabidopsis lyrata subsp. 
lyrata]
Length=169

 Score =   200 bits (508),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 114/139 (82%), Gaps = 13/139 (9%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ + I LKSSDGE FE++EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYC
Sbjct  1    MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYC  60

Query  304  KRHVEAASKTE-------------EKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIK  444
            K+HVEAA+K+E                 ++DLKT+D++F+KVDQ TLFDLILAANYLNIK
Sbjct  61   KKHVEAAAKSETTTEAAATTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIK  120

Query  445  SLLDLTCQTVADMIKGKTP  501
             LLDLTCQTVADMIKGKTP
Sbjct  121  GLLDLTCQTVADMIKGKTP  139



>dbj|BAB85605.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   199 bits (507),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 5/129 (4%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSDGE+FEV+EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYCK+
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  310  HVEA-ASKTEEKPG----EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            HV+A ASK+E   G    +DDLK +DA+F+K+DQATLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAVASKSEAVDGGGSSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  122  ADMIKGKTP  130



>ref|XP_009104691.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
 dbj|BAB85608.1| kinetochore protein [Brassica juncea]
Length=160

 Score =   199 bits (506),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 5/129 (4%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSDGE+FEV+EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYCK+
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  310  HVE-AASKTEEKPG----EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            HV+ AASK+E   G    +DDLK +DA+F+K+DQATLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAAASKSEAVDGGGSSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  122  ADMIKGKTP  130



>ref|XP_006847969.1| hypothetical protein AMTR_s00029p00153350 [Amborella trichopoda]
 gb|ERN09550.1| hypothetical protein AMTR_s00029p00153350 [Amborella trichopoda]
Length=157

 Score =   199 bits (506),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K + LKSSDGE FEVEE+VA+ESQTIKHMIEDDCA   IPLPNV+SKILAKVIEYCK HV
Sbjct  6    KKVTLKSSDGEVFEVEESVAVESQTIKHMIEDDCAGNGIPLPNVSSKILAKVIEYCKYHV  65

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            +A   TE+K  E+++K++DA+FV+VDQATLFDLILAANYLNIK+LLDLTCQTVADMIKGK
Sbjct  66   DAQKVTEDKTQEEEIKSWDAEFVRVDQATLFDLILAANYLNIKNLLDLTCQTVADMIKGK  125

Query  496  TP  501
            TP
Sbjct  126  TP  127



>ref|XP_008448523.1| PREDICTED: SKP1-like protein 1B [Cucumis melo]
Length=155

 Score =   199 bits (506),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSSK I LKSSDG+ FEV+ AVAL+SQTI+HMIED CAD  IPLPNV SKILAKVIEYC
Sbjct  1    MSSSKKITLKSSDGDYFEVDGAVALQSQTIRHMIEDSCADNGIPLPNVNSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            ++HV A+S  +  P  DDLKT+D DFV VDQATLFDLILAANYL+IKSLLDLTCQTVADM
Sbjct  61   RKHVNASS-LDPAPSVDDLKTWDRDFVNVDQATLFDLILAANYLDIKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGKTP
Sbjct  120  IKGKTP  125



>ref|XP_011083455.1| PREDICTED: SKP1-like protein 1A [Sesamum indicum]
Length=170

 Score =   199 bits (507),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 112/133 (84%), Gaps = 8/133 (6%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +SS+ I L+SSDGE FEV+EAVA+ESQTIKHMIEDDCAD VIPLPNVT KIL+KVIEYCK
Sbjct  8    NSSRKITLRSSDGEVFEVDEAVAVESQTIKHMIEDDCADNVIPLPNVTGKILSKVIEYCK  67

Query  307  RHVEAASK--------TEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLT  462
            RHV+AA+               +DDLK FDADFVKVDQATLFDLILAANYLNIK+LLDLT
Sbjct  68   RHVDAAAAASKADDKLASTAATDDDLKAFDADFVKVDQATLFDLILAANYLNIKTLLDLT  127

Query  463  CQTVADMIKGKTP  501
            CQTVADMIKGKTP
Sbjct  128  CQTVADMIKGKTP  140



>ref|XP_002305525.2| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
 gb|ABK92824.1| unknown [Populus trichocarpa]
 gb|EEE86036.2| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
Length=161

 Score =   199 bits (505),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 110/131 (84%), Gaps = 5/131 (4%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS SK I LKSSDGETF V+EAVA+ESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSESKKITLKSSDGETFVVDEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEK-----PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQ  468
            K+HVEA S  E+        ++ LK++D +FVKVDQ TLFDLILAANYLNIK LLDLTCQ
Sbjct  61   KKHVEAGSDKEKNVTGVTEKDESLKSWDTEFVKVDQNTLFDLILAANYLNIKGLLDLTCQ  120

Query  469  TVADMIKGKTP  501
            TVADMIKGKTP
Sbjct  121  TVADMIKGKTP  131



>ref|XP_011046673.1| PREDICTED: SKP1-like protein 1A [Populus euphratica]
Length=161

 Score =   198 bits (503),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 110/131 (84%), Gaps = 5/131 (4%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS SK I LKSSDGETF V+EAVA+ESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MSESKKITLKSSDGETFVVDEAVAVESQTIKHMIEDDCADNEIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEK-----PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQ  468
            K+HVEA S  E+        ++ LK++D +FVKVDQ TLFDLILAANYLNIK LLDLTCQ
Sbjct  61   KKHVEAGSDKEKNVTGVTEKDESLKSWDTEFVKVDQNTLFDLILAANYLNIKDLLDLTCQ  120

Query  469  TVADMIKGKTP  501
            TVADMIKGKTP
Sbjct  121  TVADMIKGKTP  131



>ref|XP_004287067.1| PREDICTED: SKP1-like protein 1B [Fragaria vesca subsp. vesca]
Length=159

 Score =   198 bits (503),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 105/127 (83%), Gaps = 2/127 (2%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S  K+I LKSSD ETFEV+EAVALESQTIKHM+ED CAD  IPLPNVT  ILA+VIEYCK
Sbjct  3    SEKKLITLKSSDNETFEVDEAVALESQTIKHMVEDGCADNAIPLPNVTGAILARVIEYCK  62

Query  307  RHVEAASKTEE--KPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            +HVE   K  E  K GE  LKTFDA+FVKVDQ  LFDLILAANYLNIK LLDLTCQTVAD
Sbjct  63   KHVEEGGKDAEKDKSGESPLKTFDAEFVKVDQNVLFDLILAANYLNIKGLLDLTCQTVAD  122

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  123  MIKGKTP  129



>ref|XP_010471746.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=162

 Score =   198 bits (503),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 116/132 (88%), Gaps = 6/132 (5%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS++K IVLKSSDGE+FEV+E+VA ESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC
Sbjct  1    MSTTKKIVLKSSDGESFEVDESVARESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYC  60

Query  304  KRHVE-AASKTEEKPG-----EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTC  465
            K+HVE  ASKT+   G     +++LKT+DA+F+K+DQATLF+LILAANYLNIK+LLDLTC
Sbjct  61   KKHVEVTASKTDAAEGAASSADEELKTWDAEFMKIDQATLFELILAANYLNIKNLLDLTC  120

Query  466  QTVADMIKGKTP  501
            QTVADMIKGKTP
Sbjct  121  QTVADMIKGKTP  132



>ref|XP_010536422.1| PREDICTED: SKP1-like protein 1A [Tarenaya hassleriana]
Length=166

 Score =   198 bits (503),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 116/136 (85%), Gaps = 10/136 (7%)
 Frame = +1

Query  124  MSSS--KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIE  297
            MSS+  + I+LKSSDGE FEV+E VALESQTIKHM+EDDCAD  IPLPNVTSK+LAKVIE
Sbjct  1    MSSAVERKIILKSSDGEAFEVDEVVALESQTIKHMVEDDCADNGIPLPNVTSKVLAKVIE  60

Query  298  YCKRHVEAAS--KTEEKPG------EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLL  453
            YCK+HV+AA+   +E+  G      +DDLK +DA+FVKVDQATLFDLILAANYLNIK LL
Sbjct  61   YCKKHVDAAAANNSEDCVGGSAGGDKDDLKAWDAEFVKVDQATLFDLILAANYLNIKGLL  120

Query  454  DLTCQTVADMIKGKTP  501
            DLTCQTVADMIKGKTP
Sbjct  121  DLTCQTVADMIKGKTP  136



>ref|XP_006390250.1| hypothetical protein EUTSA_v10019260mg [Eutrema salsugineum]
 gb|ESQ27536.1| hypothetical protein EUTSA_v10019260mg [Eutrema salsugineum]
Length=159

 Score =   197 bits (502),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 114/128 (89%), Gaps = 4/128 (3%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            SSK IVLKSSDGE+FEV+EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYCK+
Sbjct  2    SSKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  310  HVE-AASKTEEKPG---EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            HV+ AASK+E   G   ++DLK +D +F+K+DQATLF+LILAANYLNIK+LLDLTCQTVA
Sbjct  62   HVDSAASKSEAVDGASSDEDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  121

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  122  DMIKGKTP  129



>ref|XP_010690359.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=166

 Score =   197 bits (502),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 112/130 (86%), Gaps = 8/130 (6%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I LKSSDGE F+VEE+VALESQTIKHMIEDDCAD  IPLPNVT KIL+KVIEYCK+HV
Sbjct  7    KKITLKSSDGENFDVEESVALESQTIKHMIEDDCADNAIPLPNVTGKILSKVIEYCKKHV  66

Query  316  EAA---SKTEEKP-----GEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
            E+A   S TE++       +++LK++DA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQT
Sbjct  67   ESAAAKSSTEDRSSSNATADEELKSWDAEFVKVDQNTLFDLILAANYLNIKSLLDLTCQT  126

Query  472  VADMIKGKTP  501
            VADMIKGKTP
Sbjct  127  VADMIKGKTP  136



>ref|XP_010416502.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=162

 Score =   197 bits (502),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 116/132 (88%), Gaps = 6/132 (5%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS++K IVLKSSDGE+FEV+E VALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC
Sbjct  1    MSTTKKIVLKSSDGESFEVDELVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYC  60

Query  304  KRHVE-AASKTEEKPG-----EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTC  465
            K+HVE  ASKT+   G     +++LKT+DA+F+K+DQATLF+LILAANYLNIK+LLDLTC
Sbjct  61   KKHVEVTASKTDAVDGAASSADEELKTWDAEFMKIDQATLFELILAANYLNIKNLLDLTC  120

Query  466  QTVADMIKGKTP  501
            QTVADMIKGKTP
Sbjct  121  QTVADMIKGKTP  132



>ref|XP_006360901.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=149

 Score =   197 bits (501),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 110/121 (91%), Gaps = 1/121 (1%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MI L+S DGETFEV+EAVALES+TIKH+IEDDCA+T IPL NVT KILAKVIEYCKRHVE
Sbjct  1    MISLRSFDGETFEVDEAVALESETIKHLIEDDCANTSIPLHNVTGKILAKVIEYCKRHVE  60

Query  319  AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  498
               K E+K  ++DLKTFDA+FVKVDQ+TLF+L+LAANYLNIKSLLDLTCQTVADMIKGKT
Sbjct  61   -VPKAEDKTAKEDLKTFDAEFVKVDQSTLFNLMLAANYLNIKSLLDLTCQTVADMIKGKT  119

Query  499  P  501
            P
Sbjct  120  P  120



>ref|XP_002531150.1| skp1, putative [Ricinus communis]
 gb|EEF31235.1| skp1, putative [Ricinus communis]
Length=161

 Score =   197 bits (501),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 109/130 (84%), Gaps = 6/130 (5%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            SSK I LKSSDGE FEV+E VALESQTIKHMIEDDCAD+ IPLPNVTSKILAKVIEYCK+
Sbjct  2    SSKKITLKSSDGEPFEVDEVVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYCKK  61

Query  310  HVEAASKTEE------KPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
            HVE    + E         +D+LK +DA+FVKVDQ+TLFDLILAANYLNIK LLDLTCQT
Sbjct  62   HVETPKSSSEDRTINNSNTDDELKAWDAEFVKVDQSTLFDLILAANYLNIKGLLDLTCQT  121

Query  472  VADMIKGKTP  501
            VADMIKGKTP
Sbjct  122  VADMIKGKTP  131



>ref|XP_010935123.1| PREDICTED: SKP1-like protein 1B [Elaeis guineensis]
Length=163

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 110/132 (83%), Gaps = 8/132 (6%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + K I LKSSDGE FEVEE VA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYCK+
Sbjct  2    AEKKITLKSSDGEVFEVEETVAMESQTIKHMIEDDCAGNGIPLPNVTSKILSKVIEYCKK  61

Query  310  HVEAASK--------TEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTC  465
            HV+AA+         T  K  +++LKT+DADFVKVDQATLFDLILAANYLNIK LLDLTC
Sbjct  62   HVDAAAASSKSTVDDTSSKIVDEELKTWDADFVKVDQATLFDLILAANYLNIKGLLDLTC  121

Query  466  QTVADMIKGKTP  501
            QTVADMIKGKTP
Sbjct  122  QTVADMIKGKTP  133



>gb|EMT03937.1| SKP1-like protein 1A [Aegilops tauschii]
Length=164

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 108/126 (86%), Gaps = 4/126 (3%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE F+VEEAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYCK+HV
Sbjct  9    KMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHV  68

Query  316  EA----ASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            +A    ++ T      +DLK+FDADFVKVDQATLF LILAANYLNIK LLDLTCQTVADM
Sbjct  69   QADASSSTSTAAPAPAEDLKSFDADFVKVDQATLFALILAANYLNIKGLLDLTCQTVADM  128

Query  484  IKGKTP  501
            IKGKTP
Sbjct  129  IKGKTP  134



>ref|XP_004159727.1| PREDICTED: SKP1-like protein 1A-like [Cucumis sativus]
Length=155

 Score =   196 bits (498),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSS  I+LKSSDG+ F+V++AVAL+SQTI+HMIED+CA   IPLPNV SKILAKVI+YC
Sbjct  1    MSSSNKIILKSSDGDYFQVDDAVALQSQTIRHMIEDNCAHNGIPLPNVNSKILAKVIQYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            ++HV+A+S  +  P EDDLKT+D DFV VDQATLFDLILAANYL++KSLLDLTCQTVADM
Sbjct  61   RKHVDASS-ADPLPSEDDLKTWDRDFVNVDQATLFDLILAANYLDVKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGK P
Sbjct  120  IKGKKP  125



>ref|XP_010941330.1| PREDICTED: SKP1-like protein 1B [Elaeis guineensis]
Length=164

 Score =   196 bits (498),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 112/133 (84%), Gaps = 9/133 (7%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + K I+LKSSDGE FEV+E VA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYCK+
Sbjct  2    AEKKIILKSSDGEVFEVDEMVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKK  61

Query  310  HVEAASK---------TEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLT  462
            HV+AA+          T  K GE+DLKT+DA+FVKVDQATLFDLILAANYLNIK LLDLT
Sbjct  62   HVDAAAAAASKSATDDTSSKLGEEDLKTWDAEFVKVDQATLFDLILAANYLNIKGLLDLT  121

Query  463  CQTVADMIKGKTP  501
            CQTVADMIKGKTP
Sbjct  122  CQTVADMIKGKTP  134



>gb|AGU28415.1| S phase kinase-associated protein 1 [Sinapis alba]
Length=158

 Score =   196 bits (497),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 112/129 (87%), Gaps = 5/129 (4%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSDGE+FEV+EAVALESQTI HM+EDDC D  IPLPNVTSKILAKVIEYCK+
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGIPLPNVTSKILAKVIEYCKK  61

Query  310  HVE-AASKTEEKPG----EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            HV+ AASKTE   G    +DDLK +DA+F+K+DQATLF LILAANYLNIK+LLDLTC  V
Sbjct  62   HVDAAASKTEAVDGGASSDDDLKAWDAEFMKIDQATLFALILAANYLNIKNLLDLTCGGV  121

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  122  ADMIKGKTP  130



>emb|CAA75117.1| fimbriata-associated protein [Antirrhinum majus]
Length=161

 Score =   196 bits (497),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 111/129 (86%), Gaps = 6/129 (5%)
 Frame = +1

Query  133  SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRH  312
            +K I L+SSDGE FEVEE++ALESQTIKHMIEDDCAD VIPLPNVT KIL+KVIEYCKRH
Sbjct  3    TKKITLRSSDGEVFEVEESLALESQTIKHMIEDDCADNVIPLPNVTGKILSKVIEYCKRH  62

Query  313  VEAASKTEEK------PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            V+AA+   +         +D+LK FDADFVKVDQATLFDLILAANYLNIK+LLDLTCQTV
Sbjct  63   VDAAAAKADDKLASTGTSDDELKAFDADFVKVDQATLFDLILAANYLNIKTLLDLTCQTV  122

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  123  ADMIKGKTP  131



>gb|EMT23721.1| SKP1-like protein 1A [Aegilops tauschii]
Length=164

 Score =   196 bits (497),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 109/127 (86%), Gaps = 6/127 (5%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE F+VEEAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+K+IEYCK+HV
Sbjct  9    KMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKIIEYCKKHV  68

Query  316  EA-----ASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            +A      S T   P E DLK++DADFVKVDQATLFDLILAANYLNIK LLDLTCQTVAD
Sbjct  69   QADASSSTSTTAAAPAE-DLKSYDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVAD  127

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  128  MIKGKTP  134



>gb|EMT15375.1| SKP1-like protein 4 [Aegilops tauschii]
Length=172

 Score =   196 bits (497),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 109/134 (81%), Gaps = 12/134 (9%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI+LKSS+GE F+VE AVA+ESQTI+HMIEDDCAD  IPLPNV SKILAKVIEYCK+HV
Sbjct  9    KMILLKSSNGEGFQVEAAVAIESQTIRHMIEDDCADNGIPLPNVDSKILAKVIEYCKKHV  68

Query  316  EAA------------SKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDL  459
            +A+            S T      +DLK+FDA+FVKVDQATLFDLILAANYLNIK LLDL
Sbjct  69   QASPNPADSSAADANSSTSTAAAAEDLKSFDAEFVKVDQATLFDLILAANYLNIKGLLDL  128

Query  460  TCQTVADMIKGKTP  501
            TCQTVADMIKGKTP
Sbjct  129  TCQTVADMIKGKTP  142



>ref|XP_004146156.1| PREDICTED: SKP1-like protein 1B-like [Cucumis sativus]
 gb|KGN55643.1| hypothetical protein Csa_3G002630 [Cucumis sativus]
Length=155

 Score =   195 bits (495),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSS  I LKSSDG+ F+V++AVAL+SQTI+HMIED+CA   IPLPNV SKILAKVI+YC
Sbjct  1    MSSSNKITLKSSDGDYFQVDDAVALQSQTIRHMIEDNCAHNGIPLPNVNSKILAKVIQYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            ++HV+A+S  +  P EDDLKT+D DFV VDQATLFDLILAANYL++KSLLDLTCQTVADM
Sbjct  61   RKHVDASS-ADPLPSEDDLKTWDRDFVNVDQATLFDLILAANYLDVKSLLDLTCQTVADM  119

Query  484  IKGKTP  501
            IKGK P
Sbjct  120  IKGKKP  125



>dbj|BAE72119.1| SKP1-like protein [Silene latifolia]
Length=160

 Score =   195 bits (495),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 110/137 (80%), Gaps = 13/137 (9%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K I+LKSSDGE FEV++ VALESQTIKHMIEDDCAD  IPLPNVT KIL+KVIEYCK+
Sbjct  7    STKKILLKSSDGEDFEVDQIVALESQTIKHMIEDDCADNAIPLPNVTGKILSKVIEYCKK  66

Query  310  HVEAASKTEEK-------------PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSL  450
            HVE A K + +             P +DDLK +D +FVKVDQ TLFDLILAANYLNIKSL
Sbjct  67   HVEFAEKNKGETTTTTSAAGTGTTPVDDDLKNWDTEFVKVDQNTLFDLILAANYLNIKSL  126

Query  451  LDLTCQTVADMIKGKTP  501
            LDLTCQTVADMIKGKTP
Sbjct  127  LDLTCQTVADMIKGKTP  143



>dbj|BAE72121.1| SKP1-like protein [Silene latifolia]
Length=173

 Score =   194 bits (494),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 110/137 (80%), Gaps = 13/137 (9%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K I+LKSSDGE FEV++ VALESQTIKHMIEDDCAD  IPLPNVT KIL+KVIEYCK+
Sbjct  7    STKKILLKSSDGEDFEVDQIVALESQTIKHMIEDDCADNAIPLPNVTGKILSKVIEYCKK  66

Query  310  HVEAASKTEEK-------------PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSL  450
            HVE A K + +             P +DDLK +D +FVKVDQ TLFDLILAANYLNIKSL
Sbjct  67   HVEFAEKNKGETTTTTSAAGTGTTPVDDDLKNWDTEFVKVDQNTLFDLILAANYLNIKSL  126

Query  451  LDLTCQTVADMIKGKTP  501
            LDLTCQTVADMIKGKTP
Sbjct  127  LDLTCQTVADMIKGKTP  143



>ref|XP_010266846.1| PREDICTED: SKP1-like protein 1B isoform X1 [Nelumbo nucifera]
 ref|XP_010266847.1| PREDICTED: SKP1-like protein 1B isoform X1 [Nelumbo nucifera]
Length=154

 Score =   193 bits (491),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S K + LK SDGETF+V+EAVALESQTIKHMIE+DC D  IPLPNVTSKIL KVIEYCK+
Sbjct  2    SGKKVTLKGSDGETFDVDEAVALESQTIKHMIEEDCIDNGIPLPNVTSKILCKVIEYCKK  61

Query  310  HVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  489
            HVE   +T+++  +++LK +DA+FVKVDQATLFDLILAANYL+IKSLLDLTCQTVADMIK
Sbjct  62   HVETP-RTDDRTADEELKNWDAEFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIK  120

Query  490  GKTP  501
            GKTP
Sbjct  121  GKTP  124



>ref|XP_008806601.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=163

 Score =   194 bits (492),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 108/128 (84%), Gaps = 8/128 (6%)
 Frame = +1

Query  142  IVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVEA  321
            I LKSSDGE FEVEEAVA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYCKRHV+A
Sbjct  6    ITLKSSDGEVFEVEEAVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKRHVDA  65

Query  322  ASK--------TEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            A+         T  K  +D+LK +DA+FVKVDQATLFDLILAANYLNIK LLDLTCQTVA
Sbjct  66   AAASSKSTADDTSSKLADDELKAWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVA  125

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  126  DMIKGKTP  133



>dbj|BAB85604.1| kinetochore protein [Brassica juncea]
Length=145

 Score =   192 bits (489),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 5/125 (4%)
 Frame = +1

Query  142  IVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE-  318
            +VLKSSDGE+FEV+EAVALESQTI HM+EDD  D  IPLPNVTSKILAKVIEYCK+HV+ 
Sbjct  1    MVLKSSDGESFEVDEAVALESQTIAHMVEDDGVDNGIPLPNVTSKILAKVIEYCKKHVDA  60

Query  319  AASKTEEKPG----EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            AASKTE   G    +DDLK +DA+F+K+DQATLF+LILAANYLNIK+LLDLTCQTVADMI
Sbjct  61   AASKTEAVDGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMI  120

Query  487  KGKTP  501
            KGKTP
Sbjct  121  KGKTP  125



>ref|XP_004248652.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327406.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327407.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327408.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
 ref|XP_010327409.1| PREDICTED: SKP1-like protein 1B [Solanum lycopersicum]
Length=150

 Score =   192 bits (489),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 109/121 (90%), Gaps = 1/121 (1%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MI+L+S +GE+FEV+E VALES+TIKHMIEDDCA+  IP+PNVT KILAKVI+YCKRHVE
Sbjct  1    MIILRSFNGESFEVDETVALESETIKHMIEDDCANNTIPVPNVTGKILAKVIKYCKRHVE  60

Query  319  AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  498
              SK E+   ++DLKTFDA+FVKVDQ+TLF+LILAANYL IKSL+DLTCQT+ADMIKGKT
Sbjct  61   -VSKAEDNTAKEDLKTFDAEFVKVDQSTLFNLILAANYLKIKSLIDLTCQTLADMIKGKT  119

Query  499  P  501
            P
Sbjct  120  P  120



>ref|XP_002313704.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
 gb|EEE87659.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein 
[Populus trichocarpa]
Length=158

 Score =   192 bits (489),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS SK I LKSSDGETF VEEAVA+ESQTIKHMIEDDCA+  IPLPNVTSKILAKVIEYC
Sbjct  1    MSESKKITLKSSDGETFVVEEAVAVESQTIKHMIEDDCAENDIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEA-ASKTEEKPGEDD-LKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVEA A K     G+D+ +K++DA+FVKVD+ TLFDLILAANYLNIK LLDLTCQ  A
Sbjct  61   KKHVEADADKDATITGKDEFMKSWDAEFVKVDKNTLFDLILAANYLNIKDLLDLTCQAAA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>gb|EMT33027.1| SKP1-like protein 1B [Aegilops tauschii]
Length=175

 Score =   193 bits (490),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 109/137 (80%), Gaps = 15/137 (11%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE F++EEAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYCK+HV
Sbjct  9    KMITLKSSDGEEFQIEEAVAMESQTIRHMIEDDCADDGIPLPNVDSKILSKVIEYCKKHV  68

Query  316  EAASK---------------TEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSL  450
            +A+ K               T      +DLK+FDA+FVKVDQATLFDLILAANYLNIK L
Sbjct  69   QASPKPADSGAAADASSFTSTAAAAPAEDLKSFDAEFVKVDQATLFDLILAANYLNIKGL  128

Query  451  LDLTCQTVADMIKGKTP  501
            LDLTCQTVADMIKGKTP
Sbjct  129  LDLTCQTVADMIKGKTP  145



>gb|EMT05501.1| SKP1-like protein 1B [Aegilops tauschii]
Length=175

 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 108/137 (79%), Gaps = 15/137 (11%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE F+VEEA+A+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYCK+HV
Sbjct  9    KMITLKSSDGEEFQVEEAIAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHV  68

Query  316  EAASK---------------TEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSL  450
            +A+ K               T      +DLK+FDA+F+KVDQ TLFDLILAANYLNIK L
Sbjct  69   QASPKPANSGAAVDASSSTSTAVAASAEDLKSFDAEFIKVDQNTLFDLILAANYLNIKGL  128

Query  451  LDLTCQTVADMIKGKTP  501
            LDLTCQTVADMIKGKTP
Sbjct  129  LDLTCQTVADMIKGKTP  145



>ref|XP_009395385.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=161

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 112/130 (86%), Gaps = 7/130 (5%)
 Frame = +1

Query  133  SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRH  312
            +KMI LKSSDGE FEV+EAVA+ESQTIKHMIEDDCA+  IPLPNVTSKILAKVIEYC++H
Sbjct  2    AKMITLKSSDGEVFEVDEAVAMESQTIKHMIEDDCAENGIPLPNVTSKILAKVIEYCRKH  61

Query  313  VEAASKTEEKP-------GEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
            V+A++    K         +D+LK++DA+FVKVDQATLFDLILAANYLNIK LLDLTCQT
Sbjct  62   VDASAAAASKSSDDSSKLADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQT  121

Query  472  VADMIKGKTP  501
            VADMIKGKTP
Sbjct  122  VADMIKGKTP  131



>ref|XP_010539092.1| PREDICTED: SKP1-like protein 1B [Tarenaya hassleriana]
Length=157

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (87%), Gaps = 2/126 (2%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S + I LKSSDGETFEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKIL+KVIEYCK+
Sbjct  2    SGRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILSKVIEYCKK  61

Query  310  HVE--AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            HV+  A S+      ED +K +DA+FVKVDQATLFDLILAANYLNIK LLDLTCQTVADM
Sbjct  62   HVDAAAKSEAAAAAEEDVMKNWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADM  121

Query  484  IKGKTP  501
            IKGKTP
Sbjct  122  IKGKTP  127



>ref|XP_009414442.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=157

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I+LKSSDGE FEV+ AVA+ESQTI+HMIEDDC +  +PLPNVTSKILAKVIEYC++HV
Sbjct  3    KKIILKSSDGEEFEVDVAVAMESQTIRHMIEDDCFENGVPLPNVTSKILAKVIEYCRKHV  62

Query  316  EAASKTE---EKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +AAS +     K  +++LK +DADFVKVDQATLFDLILAANYLNIK LLDLTCQTVADMI
Sbjct  63   DAASNSSGDASKVPDEELKAWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMI  122

Query  487  KGKTP  501
            KGKTP
Sbjct  123  KGKTP  127



>ref|XP_003577587.1| PREDICTED: SKP1-like protein 1A [Brachypodium distachyon]
Length=181

 Score =   192 bits (489),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 106/142 (75%), Gaps = 21/142 (15%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE FEVEE VA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYC +HV
Sbjct  11   KMITLKSSDGEEFEVEETVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  70

Query  316  EAA--------------------SKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYL  435
             A                     S T   PGE DLK +DADFVKVDQATLFDLILAANYL
Sbjct  71   HATAAAKAANPSDGDANPAAANNSSTTAAPGE-DLKNWDADFVKVDQATLFDLILAANYL  129

Query  436  NIKSLLDLTCQTVADMIKGKTP  501
            NIK LLDLTCQTVADMIKGKTP
Sbjct  130  NIKGLLDLTCQTVADMIKGKTP  151



>ref|XP_009418685.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=161

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 7/130 (5%)
 Frame = +1

Query  133  SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRH  312
            +K I+LKSSDGE FEV+EAVA+ESQTIKHMIEDDCA+  IPLPNVTS ILAKVIEYC++H
Sbjct  2    AKTIMLKSSDGEVFEVDEAVAMESQTIKHMIEDDCAENGIPLPNVTSAILAKVIEYCRKH  61

Query  313  VEAASKTE-------EKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
            VEA++           KP +D +K++DA+FVKVDQATLFDLILAANYLNIK LLDLTCQT
Sbjct  62   VEASAAAASKSSDDGSKPTDDVIKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQT  121

Query  472  VADMIKGKTP  501
            VADMIKGKTP
Sbjct  122  VADMIKGKTP  131



>gb|EMT01680.1| SKP1-like protein 1B [Aegilops tauschii]
Length=172

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 108/134 (81%), Gaps = 12/134 (9%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE F+VEEAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYCK+HV
Sbjct  9    KMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHV  68

Query  316  EAASKTEEKPG------------EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDL  459
            +A+ K  +                +DLK+FDA+FVKVDQATLFDLILA NYLNIK LLDL
Sbjct  69   QASPKLADSTDASSSISTAAAAPAEDLKSFDAEFVKVDQATLFDLILATNYLNIKGLLDL  128

Query  460  TCQTVADMIKGKTP  501
            TCQTVADMIKGKTP
Sbjct  129  TCQTVADMIKGKTP  142



>ref|XP_002537506.1| skp1, putative [Ricinus communis]
 gb|EEF24877.1| skp1, putative [Ricinus communis]
Length=158

 Score =   191 bits (486),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+SK I LKSSDGETF+VEEAVA+ESQTIKH+I+DDCAD+VIP+PNVT KIL+KVIEYC
Sbjct  1    MSASKKITLKSSDGETFDVEEAVAVESQTIKHIIDDDCADSVIPIPNVTGKILSKVIEYC  60

Query  304  KRHVEAAS--KTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HV  A+    + K  +D LK++DADFV+VDQ TLFDLILAANYLN+K LLDLTCQTVA
Sbjct  61   KKHVADAAFKDNDNKDSDDALKSWDADFVRVDQNTLFDLILAANYLNVKGLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>ref|XP_008811446.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=162

 Score =   191 bits (485),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 107/128 (84%), Gaps = 8/128 (6%)
 Frame = +1

Query  142  IVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE-  318
            I+LKSSDGE FEVEE VA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYCKRHVE 
Sbjct  5    IILKSSDGEVFEVEETVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKRHVEA  64

Query  319  -------AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
                   AA  +  K  +D+LK +DA+FV+VDQATLFDLILAANYLNIK LLDLTCQTVA
Sbjct  65   SAAASKAAAEDSSSKLADDELKAWDAEFVRVDQATLFDLILAANYLNIKGLLDLTCQTVA  124

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  125  DMIKGKTP  132



>ref|XP_009395355.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=160

 Score =   191 bits (485),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 110/129 (85%), Gaps = 7/129 (5%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I LKSSDGE FEV+EAVA+ESQTIKHMIEDDCA+  IPLPNVTSKILAKVIEYCK+HV
Sbjct  2    KTITLKSSDGEVFEVDEAVAMESQTIKHMIEDDCAENGIPLPNVTSKILAKVIEYCKKHV  61

Query  316  EAASKTE-------EKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            +A++           K  +D+LK++DA+FVKVDQATLFDLILAANYLNIK LLDLTCQTV
Sbjct  62   DASAAASSKSPDDASKLADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTV  121

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  122  ADMIKGKTP  130



>gb|EMS35771.1| SKP1-like protein 1B [Triticum urartu]
Length=167

 Score =   191 bits (485),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 107/133 (80%), Gaps = 9/133 (7%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
               KMI LKSSDGE F+VEEAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYCK
Sbjct  6    GEKKMITLKSSDGEEFQVEEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCK  65

Query  307  RHVE--------AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLT  462
            +HV+        + S     P E DLK FDA+FVKVDQATLFDLILAANYLNIK LLDLT
Sbjct  66   KHVQADSTDASSSTSTAAAAPAE-DLKIFDAEFVKVDQATLFDLILAANYLNIKGLLDLT  124

Query  463  CQTVADMIKGKTP  501
            CQTVADMIKGKTP
Sbjct  125  CQTVADMIKGKTP  137



>emb|CDX85931.1| BnaC06g22030D [Brassica napus]
 emb|CDX68112.1| BnaA07g21520D [Brassica napus]
Length=151

 Score =   190 bits (483),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 107/124 (86%), Gaps = 4/124 (3%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSDGE+FEV+EAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYCK+
Sbjct  2    STKKIVLKSSDGESFEVDEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  310  HVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  489
            H      +     +DDLK +DA+F+K+DQATLF+LILAANYLNIK+LLDLTCQTVADMIK
Sbjct  62   HAVDGGGS----SDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIK  117

Query  490  GKTP  501
            GKTP
Sbjct  118  GKTP  121



>dbj|BAB85606.1| kinetochore protein [Brassica juncea]
Length=161

 Score =   191 bits (484),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 112/130 (86%), Gaps = 6/130 (5%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSDGE+FEV+EAVA ESQT+ HM+EDDC +  IPLPNVTSKILAKVIEYCK+
Sbjct  2    STKKIVLKSSDGESFEVDEAVARESQTLAHMVEDDCIENGIPLPNVTSKILAKVIEYCKK  61

Query  310  HVE-AASKTE-----EKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
            HV+ AA+KTE         +DDLK +D +F+K+DQATLF+LILAANYLNIK+LLDLTCQT
Sbjct  62   HVDAAAAKTEGAVDGAASSDDDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  472  VADMIKGKTP  501
            VADMIKGKTP
Sbjct  122  VADMIKGKTP  131



>ref|XP_008811458.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=164

 Score =   191 bits (484),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 108/133 (81%), Gaps = 9/133 (7%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + K I LKSSDGE FEV+E VA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYCK+
Sbjct  2    AEKKITLKSSDGEVFEVDEMVAMESQTIKHMIEDDCASNGIPLPNVTSKILSKVIEYCKK  61

Query  310  HV---------EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLT  462
            HV          AA  T  K  +DDLKT+DA+FVKVDQATLFDLILAANYLNIK LLDLT
Sbjct  62   HVDAAAAAASKSAADDTSFKLADDDLKTWDAEFVKVDQATLFDLILAANYLNIKGLLDLT  121

Query  463  CQTVADMIKGKTP  501
            CQTVADMIKGKTP
Sbjct  122  CQTVADMIKGKTP  134



>ref|XP_011046062.1| PREDICTED: SKP1-like protein 1B [Populus euphratica]
Length=158

 Score =   190 bits (483),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 110/128 (86%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS SK I LKSSDGETF VEEAVA+ESQTIKHMIEDDCA++ IPLPNVT KILAKVIEYC
Sbjct  1    MSESKKITLKSSDGETFVVEEAVAVESQTIKHMIEDDCAESDIPLPNVTGKILAKVIEYC  60

Query  304  KRHVEA-ASKTEEKPGEDD-LKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K+HVEA A K     G+D+ LK++D++FVKVD+ TLFDLILAANYLNIK LLDLTCQ  A
Sbjct  61   KKHVEADADKDAIITGKDEFLKSWDSEFVKVDKNTLFDLILAANYLNIKDLLDLTCQAAA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>ref|XP_010941328.1| PREDICTED: SKP1-like protein 1A [Elaeis guineensis]
Length=163

 Score =   190 bits (482),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 108/129 (84%), Gaps = 9/129 (7%)
 Frame = +1

Query  142  IVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVEA  321
            I+LKSSDGE FEVEE+VA+ESQTIKHMIEDDCA   IPLPNVTSKIL+KVIEYCKRHVEA
Sbjct  5    IILKSSDGEVFEVEESVAMESQTIKHMIEDDCAGNGIPLPNVTSKILSKVIEYCKRHVEA  64

Query  322  AS---------KTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            ++          +  K  +++LK +D +FV+VDQATLFDLILAANYLNIK LLDLTCQTV
Sbjct  65   SAAASKYAAEDSSSSKAADNELKAWDDEFVRVDQATLFDLILAANYLNIKGLLDLTCQTV  124

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  125  ADMIKGKTP  133



>ref|XP_003621659.1| SKP1-like protein [Medicago truncatula]
 gb|AES77877.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=156

 Score =   189 bits (481),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S++K I LKSSD ETFEV EAVALE QTIKHMI+DDC D  I +PNVT +ILAKVIEYCK
Sbjct  3    STTKKITLKSSDNETFEVPEAVALELQTIKHMIKDDCTDNGILVPNVTGQILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +H++AAS ++EKP EDDLK +DA+FVKV Q TLFDLILAAN LNIKSLLDLTCQ VADMI
Sbjct  63   KHIDAAS-SDEKPSEDDLKNWDAEFVKVHQTTLFDLILAANDLNIKSLLDLTCQYVADMI  121

Query  487  KGKTP  501
            KGKTP
Sbjct  122  KGKTP  126



>ref|XP_003628375.1| SKP1-like protein [Medicago truncatula]
 gb|AET02851.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=157

 Score =   189 bits (481),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SS++ + LKSSD ETFEVEEAVAL+SQTIKHMIEDDCA T IPLPNVTSKILAKVIEYCK
Sbjct  3    SSARKVTLKSSDDETFEVEEAVALKSQTIKHMIEDDCAKTEIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HVEA + +E KP EDD+K +DA+FVKVD  T F+LILAANYL+IKSLL+LTCQ VA+ I
Sbjct  63   KHVEATTSSEGKPSEDDVKAWDAEFVKVDLNTRFELILAANYLDIKSLLELTCQDVAETI  122

Query  487  KGKT  498
            K KT
Sbjct  123  KDKT  126



>gb|EMT03939.1| SKP1-like protein 1B [Aegilops tauschii]
Length=164

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 106/127 (83%), Gaps = 6/127 (5%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE F+VE AVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYCK+H 
Sbjct  9    KMITLKSSDGEEFQVEVAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHA  68

Query  316  EAASKTEE-----KPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
               + + +      P E DLK+FDA+FVKVDQATLFDLILAANYLNIK LLDLTCQTVAD
Sbjct  69   PKPADSSDFTAAAAPAE-DLKSFDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVAD  127

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  128  MIKGKTP  134



>ref|XP_003573486.1| PREDICTED: SKP1-like protein 1A [Brachypodium distachyon]
Length=168

 Score =   189 bits (480),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 105/131 (80%), Gaps = 9/131 (7%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE FEVEE VA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYC +HV
Sbjct  8    KMITLKSSDGEEFEVEETVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  67

Query  316  EAASKTEEKPGE---------DDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQ  468
             AA  T+              DDLK +DADFVKVDQATLFDLILAANYLNIK LLDLTCQ
Sbjct  68   HAADATDAAAANTSAAPAAPTDDLKNWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQ  127

Query  469  TVADMIKGKTP  501
            TVADMIKGKTP
Sbjct  128  TVADMIKGKTP  138



>ref|XP_010440828.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=162

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 112/132 (85%), Gaps = 6/132 (5%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS++K IVLKSSDGE+FE +E VA ESQTI HM+EDDC D  +PLPNVTSKILAKVIEYC
Sbjct  1    MSTTKKIVLKSSDGESFEADELVARESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYC  60

Query  304  KRHVE-AASKT-----EEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTC  465
            K+HVE  ASKT          +++LKT+DA+F+K++QATLF+LILAANYLNIK+LLDLTC
Sbjct  61   KKHVEVTASKTDAADAVASSADEELKTWDAEFMKINQATLFELILAANYLNIKTLLDLTC  120

Query  466  QTVADMIKGKTP  501
            QTVADMIKGKTP
Sbjct  121  QTVADMIKGKTP  132



>ref|XP_010428644.1| PREDICTED: SKP1-like protein 1A [Camelina sativa]
Length=170

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 113/136 (83%), Gaps = 11/136 (8%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +++K IVLKSSDGE+FEV+E VALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYCK
Sbjct  5    TTTKKIVLKSSDGESFEVDELVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCK  64

Query  307  RHVE-AASKT----------EEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLL  453
            +HVE  ASKT               +++LKT+DA+F+K+DQATLF+LILAANYLNIK+LL
Sbjct  65   KHVEVTASKTDAADGAAAGAASSAADEELKTWDAEFMKIDQATLFELILAANYLNIKNLL  124

Query  454  DLTCQTVADMIKGKTP  501
            DLTCQTVADMIKGKTP
Sbjct  125  DLTCQTVADMIKGKTP  140



>ref|XP_010061081.1| PREDICTED: SKP1-like protein 1B isoform X1 [Eucalyptus grandis]
 gb|KCW67978.1| hypothetical protein EUGRSUZ_F01672 [Eucalyptus grandis]
Length=160

 Score =   188 bits (478),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 108/130 (83%), Gaps = 4/130 (3%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSSS+ IVL+SSD E+FEVE AVALE QTIKHMIEDDCA   IPLPNV+SKIL+K+IE+C
Sbjct  1    MSSSRKIVLESSDKESFEVEVAVALECQTIKHMIEDDCAGDGIPLPNVSSKILSKIIEFC  60

Query  304  KRHVEA----ASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
            ++HV+A    A        +D+LK +DA+F+KVDQATLFDLILAANYLNIK LLDLTCQ 
Sbjct  61   RKHVDADRERAGSASPAAADDELKAWDAEFIKVDQATLFDLILAANYLNIKGLLDLTCQN  120

Query  472  VADMIKGKTP  501
            VADMIKGKTP
Sbjct  121  VADMIKGKTP  130



>gb|KEH23706.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=158

 Score =   188 bits (477),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 2/126 (2%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +S KMI LKS DGETFEV EAVAL+SQTIKH+IEDDCAD VIP+PNVT KILAKVIEYCK
Sbjct  4    TSKKMITLKSDDGETFEVSEAVALKSQTIKHIIEDDCADNVIPVPNVTGKILAKVIEYCK  63

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVK-VDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            +HVEA S ++EK  EDDLK +DADF K VDQ TLF ++LAANYLNIK+LLDL CQTVAD 
Sbjct  64   KHVEATS-SDEKVSEDDLKNWDADFAKEVDQQTLFQILLAANYLNIKNLLDLCCQTVADD  122

Query  484  IKGKTP  501
            IK K P
Sbjct  123  IKDKKP  128



>ref|XP_004231048.1| PREDICTED: SKP1-like protein 1A [Solanum lycopersicum]
Length=158

 Score =   188 bits (477),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 107/128 (84%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS K I+LKS+DGE FEVEEAVALESQTIK +IEDDCA + IP+ NV+  ILAKV+EY 
Sbjct  1    MSSPKKILLKSNDGEVFEVEEAVALESQTIKFLIEDDCAGSHIPISNVSGNILAKVLEYL  60

Query  304  KRHVE--AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            KRHVE  + SKTE    +  LK FDA+FVKVDQ TLFDLILAANYLNIKSLLDLTCQTVA
Sbjct  61   KRHVEEESTSKTEGADADAALKVFDAEFVKVDQKTLFDLILAANYLNIKSLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>ref|XP_008806600.1| PREDICTED: SKP1-like protein 1A [Phoenix dactylifera]
Length=164

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 111/135 (82%), Gaps = 10/135 (7%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+ +K I LKSSDGE FEVEE VA+ESQTIKH+IEDDCA   IPLPNVTSKILAKVIEYC
Sbjct  1    MAENK-ITLKSSDGEVFEVEETVAMESQTIKHLIEDDCATNGIPLPNVTSKILAKVIEYC  59

Query  304  KRHVEAASK---------TEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLD  456
            K+HV+AA+          T  K  +D+LK +DA+FVKVDQATLFDLILAANYLNIK LLD
Sbjct  60   KKHVDAAAAASSKSTADDTSSKLADDELKAWDAEFVKVDQATLFDLILAANYLNIKGLLD  119

Query  457  LTCQTVADMIKGKTP  501
            LTCQTVADMIKGKTP
Sbjct  120  LTCQTVADMIKGKTP  134



>gb|AGF33287.1| SKP1 1A-like protein, partial [Quercus ilex]
Length=124

 Score =   187 bits (474),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 1/110 (1%)
 Frame = +1

Query  172  FEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVEAASKTEEKPGE  351
            FEVEEAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK+HVE+ S  +E+  +
Sbjct  1    FEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCKKHVESTS-ADERTSD  59

Query  352  DDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  501
            +DLK +D +FV+VDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP
Sbjct  60   EDLKAWDTEFVRVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  109



>ref|XP_010266848.1| PREDICTED: SKP1-like protein 1B isoform X2 [Nelumbo nucifera]
Length=154

 Score =   188 bits (477),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 109/124 (88%), Gaps = 1/124 (1%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S K + LKSSDGETF V++AVALESQTI HMIE+DC D  IPLP VTSKIL+KVIEYCK+
Sbjct  2    SGKKVTLKSSDGETFNVDKAVALESQTIMHMIEEDCIDNGIPLPTVTSKILSKVIEYCKK  61

Query  310  HVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  489
            HV+  ++T+++  ++ LK +DA+FVKVDQATLFDLILAANYL+IKSLLDLTCQTVADMIK
Sbjct  62   HVK-TTRTDDRTADEKLKNWDAEFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIK  120

Query  490  GKTP  501
            GKTP
Sbjct  121  GKTP  124



>gb|KJB17604.1| hypothetical protein B456_003G007300 [Gossypium raimondii]
Length=148

 Score =   187 bits (475),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 107/125 (86%), Gaps = 9/125 (7%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SS + I LKSSDGE+FEV+EAVALESQTIKHMIEDDCAD  IPLPNVTSKILAKVIEYCK
Sbjct  3    SSGRKITLKSSDGESFEVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HVEA  KT+++  +D+LK++DADFVKVDQATLFDLIL         LLDLTCQTVADMI
Sbjct  63   KHVEAP-KTDDRSADDELKSWDADFVKVDQATLFDLILG--------LLDLTCQTVADMI  113

Query  487  KGKTP  501
            KGKTP
Sbjct  114  KGKTP  118



>ref|XP_010113308.1| SKP1-like protein 1A [Morus notabilis]
 gb|EXC35315.1| SKP1-like protein 1A [Morus notabilis]
Length=163

 Score =   187 bits (476),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 111/130 (85%), Gaps = 5/130 (4%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SSSK IVL+SSDGE+FEVEEAVAL+SQTIKHM+ED   D+ IPLPNVTS+IL+KVIEYC 
Sbjct  4    SSSKKIVLRSSDGESFEVEEAVALQSQTIKHMVEDVSDDSAIPLPNVTSRILSKVIEYCN  63

Query  307  RH-----VEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
            RH       +AS +     ++DLK++DA+FVKVDQATLFDLILAANYLNIK+LLDLTCQT
Sbjct  64   RHSDASSSASASASAGASDDNDLKSWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQT  123

Query  472  VADMIKGKTP  501
            VADMIKGKTP
Sbjct  124  VADMIKGKTP  133



>ref|XP_010646804.1| PREDICTED: SKP1-like protein 1A isoform X3 [Vitis vinifera]
Length=301

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+SSK I L+SSDGE F++EE VA+ESQTIKHMIED CAD  IPLPNVTSKILAKVIEYC
Sbjct  1    MASSKTITLRSSDGEAFDLEEVVAVESQTIKHMIEDGCADNAIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVE   K EE    D+LK +DADFVKVDQATLFDLILAANYL IKSLLDLTCQTVADM
Sbjct  61   KKHVE-TPKAEEHAVNDELKAWDADFVKVDQATLFDLILAANYLGIKSLLDLTCQTVADM  119

Query  484  IK  489
            IK
Sbjct  120  IK  121


 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +1

Query  142  IVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVEA  321
            + L+SSDG  F V+ AVA+ESQTIKHMIED CAD  IPLPNVTSKILA+VIEYCK+HVE 
Sbjct  153  LTLQSSDGMFFYVDVAVAMESQTIKHMIEDRCADNAIPLPNVTSKILARVIEYCKKHVET  212

Query  322  ASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  501
              K EE    D+L+ +DADFVKVDQATLFDLILAANYL+IKSLLDLTCQTVADMIKGKTP
Sbjct  213  -PKAEEHAVNDELRAWDADFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIKGKTP  271



>gb|KEH23692.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=159

 Score =   187 bits (476),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 108/127 (85%), Gaps = 3/127 (2%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +++KMI LKS D E FEV EAVALESQTIKHMIEDDCAD  IP+ NVT KILAKVIEYCK
Sbjct  4    TTTKMITLKSYDNEIFEVPEAVALESQTIKHMIEDDCADNAIPVQNVTGKILAKVIEYCK  63

Query  307  RHVEAASKTEEKPGEDD--LKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            +HV+ AS  +EKP E +  LK +DADFVKVD+ TLF+LILAANYL+IKSLLDLTCQ+ AD
Sbjct  64   KHVQVAS-ADEKPSESEEYLKNWDADFVKVDKETLFELILAANYLDIKSLLDLTCQSAAD  122

Query  481  MIKGKTP  501
            M+KGKTP
Sbjct  123  MMKGKTP  129



>ref|XP_002887622.1| hypothetical protein ARALYDRAFT_339769 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63881.1| hypothetical protein ARALYDRAFT_339769 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 114/128 (89%), Gaps = 4/128 (3%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            SSK IVLKSSDGE+FEVEEAVALESQTI HM+EDDC D  +PLPNVTSKILAKVIEYCK+
Sbjct  2    SSKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKK  61

Query  310  HVE-AASKTEEKPG---EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            HVE AA+K+E   G   ++DLK +D +F+K+DQATLF+LILAANYLNIK+LLDLTCQTVA
Sbjct  62   HVEVAAAKSEAVDGATSDEDLKAWDTEFMKIDQATLFELILAANYLNIKNLLDLTCQTVA  121

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  122  DMIKGKTP  129



>ref|XP_009401439.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
 ref|XP_009401447.1| PREDICTED: SKP1-like protein 1B [Musa acuminata subsp. malaccensis]
Length=157

 Score =   187 bits (474),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 109/125 (87%), Gaps = 3/125 (2%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I L+SSDGE FEV+ AVA+ESQTIKHMIEDDCA+  IPLPNV +KILAKVIEYC++HV
Sbjct  3    KKITLRSSDGEVFEVDVAVAMESQTIKHMIEDDCAENGIPLPNVNAKILAKVIEYCRKHV  62

Query  316  E-AASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            + AASK+ +     +++LK +DA+FVKVDQATLFDLILAANYLNIK LLDLTCQTVADMI
Sbjct  63   DAAASKSSDDASKVDEELKPWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMI  122

Query  487  KGKTP  501
            KGKTP
Sbjct  123  KGKTP  127



>ref|XP_003605505.1| SKP1-like protein [Medicago truncatula]
 gb|AES87702.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=164

 Score =   187 bits (474),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 112/126 (89%), Gaps = 2/126 (2%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCAD-TVIPLPNVTSKILAKVIEYC  303
            +++K I LKSSD ETFE+E+AVALESQTIKH+I+D+CAD + IPLPNVT KILA VIE+C
Sbjct  9    TATKKITLKSSDNETFEIEKAVALESQTIKHLIDDNCADDSGIPLPNVTGKILAMVIEHC  68

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HV+A S ++EKP ED++  +D +FVKVDQ TLFDLILAANYLNIKSLLDLTC+TVADM
Sbjct  69   KKHVDATS-SDEKPSEDEINKWDTEFVKVDQDTLFDLILAANYLNIKSLLDLTCKTVADM  127

Query  484  IKGKTP  501
            IKG+TP
Sbjct  128  IKGRTP  133



>gb|EMS59755.1| SKP1-like protein 4 [Triticum urartu]
Length=164

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 106/126 (84%), Gaps = 4/126 (3%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSD E F+V EAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYCK+HV
Sbjct  9    KMITLKSSDREEFQVAEAVAMESQTIRHMIEDDCADNGIPLPNVDSKILSKVIEYCKKHV  68

Query  316  EA----ASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            +     ++ T      +DLK+FDA+FVKVDQATLFDLILAANYLNIK LLDLTCQTVADM
Sbjct  69   QVDAGSSTSTAAAAPAEDLKSFDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADM  128

Query  484  IKGKTP  501
            IKGKTP
Sbjct  129  IKGKTP  134



>gb|AGT16907.1| SKP1-like protein [Saccharum hybrid cultivar R570]
Length=176

 Score =   187 bits (475),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 106/139 (76%), Gaps = 17/139 (12%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE FEVE AVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYC +HV
Sbjct  8    KMITLKSSDGEEFEVEVAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  67

Query  316  E--AASKTEEKPGED---------------DLKTFDADFVKVDQATLFDLILAANYLNIK  444
               AA+    K G D               DLK +DADFVKVDQATLFDLILAANYLNIK
Sbjct  68   HAAAAAAAASKAGSDDVGAAAANSTAASGEDLKNWDADFVKVDQATLFDLILAANYLNIK  127

Query  445  SLLDLTCQTVADMIKGKTP  501
             LLDLTCQTVADMIKGKTP
Sbjct  128  GLLDLTCQTVADMIKGKTP  146



>ref|XP_002890373.1| hypothetical protein ARALYDRAFT_889462 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66632.1| hypothetical protein ARALYDRAFT_889462 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   186 bits (473),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 110/130 (85%), Gaps = 6/130 (5%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            ++K I+LKSSDGE+FE++EAVA+ESQTIKHMIEDDCAD  IPLPNVT  ILAKVIEYCK+
Sbjct  2    AAKKIILKSSDGESFEIDEAVAVESQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKK  61

Query  310  HVEAASKT---EEKPG---EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
            HVEAA+++   E+  G    D+LK +D DFVKVDQ TLFDLILAANYLNI  LLDLTC+ 
Sbjct  62   HVEAAAESGGDEDFCGSTENDELKAWDNDFVKVDQPTLFDLILAANYLNISGLLDLTCKA  121

Query  472  VADMIKGKTP  501
            VADM++GKTP
Sbjct  122  VADMMRGKTP  131



>ref|XP_010683699.1| PREDICTED: SKP1-like protein 1B isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=152

 Score =   186 bits (472),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MI LKSSDGE FEVEE+VALE +TIK MIEDDCADT IPLPNVT+KIL+KVIEYCK+HVE
Sbjct  1    MITLKSSDGEKFEVEESVALECETIKLMIEDDCADTAIPLPNVTAKILSKVIEYCKKHVE  60

Query  319  AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  498
            +A+  +    ED LK +D +FVKVDQ TLF+LILAANYLNI+SLLDLTCQTV+D+IK KT
Sbjct  61   SAAAAKSCSTEDKLKIWDKEFVKVDQKTLFNLILAANYLNIRSLLDLTCQTVSDIIKDKT  120

Query  499  P  501
            P
Sbjct  121  P  121



>ref|XP_002880415.1| hypothetical protein ARALYDRAFT_481069 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56674.1| hypothetical protein ARALYDRAFT_481069 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   186 bits (472),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 108/133 (81%), Gaps = 12/133 (9%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            ++K I+LKSSDGE+FEV+EAVA+ESQTIKHMIEDDCAD  IPLPNVT  ILAKVIEYCK+
Sbjct  2    AAKKIILKSSDGESFEVDEAVAVESQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKK  61

Query  310  HVEAASKTEEKPGE---------DDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLT  462
            HVEAA+   E  G+         D+LK +D DFVKVDQ TLFDLILAANYLNI  LLDLT
Sbjct  62   HVEAAA---EAGGDKDFCGSTENDELKAWDNDFVKVDQPTLFDLILAANYLNISGLLDLT  118

Query  463  CQTVADMIKGKTP  501
            C+ VADM++GKTP
Sbjct  119  CKAVADMMRGKTP  131



>gb|AII79406.1| S-phase kinase-associated protein 1-like protein 6 [Malus hupehensis]
Length=165

 Score =   186 bits (471),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 106/133 (80%), Gaps = 8/133 (6%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +  KMI LKSSDGE FEV+EAVA+ESQTIKHM+EDDCAD  IPLPNVTS ILAKVIEYC+
Sbjct  3    AEKKMITLKSSDGEAFEVDEAVAMESQTIKHMVEDDCADNAIPLPNVTSHILAKVIEYCR  62

Query  307  RHVEAASKTEE----KPG-EDDLKTFDADFV---KVDQATLFDLILAANYLNIKSLLDLT  462
            +HVE  +  +     K G E+ LK FD DFV   K DQ  LFDLILAANYLNIKSLLDLT
Sbjct  63   KHVEGRTDGDSTDVGKIGDENTLKKFDDDFVNEIKADQNVLFDLILAANYLNIKSLLDLT  122

Query  463  CQTVADMIKGKTP  501
            CQTVADMIKGKTP
Sbjct  123  CQTVADMIKGKTP  135



>ref|XP_009355656.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=165

 Score =   186 bits (471),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 106/133 (80%), Gaps = 8/133 (6%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +  KMI LKSSDGE FEV+EAVA+ESQTIKHM+EDDCAD  IPLPNVTS ILAKVIEYC+
Sbjct  3    AEKKMITLKSSDGEAFEVDEAVAMESQTIKHMVEDDCADNAIPLPNVTSHILAKVIEYCR  62

Query  307  RHVEAASKTEE----KPG-EDDLKTFDADFV---KVDQATLFDLILAANYLNIKSLLDLT  462
            +HVE  +  +     K G E+ LK FD DFV   K DQ  LFDLILAANYLNIKSLLDLT
Sbjct  63   KHVEGRTDGDSTDVGKIGDENTLKKFDDDFVNEIKADQNVLFDLILAANYLNIKSLLDLT  122

Query  463  CQTVADMIKGKTP  501
            CQTVADMIKGKTP
Sbjct  123  CQTVADMIKGKTP  135



>ref|NP_564105.1| SKP1-like protein 4 [Arabidopsis thaliana]
 sp|Q9LNT9.1|ASK4_ARATH RecName: Full=SKP1-like protein 4; Short=AtSK4 [Arabidopsis thaliana]
 gb|AAF79899.1|AC022472_8 Contains similarity to Skp1 mRNA from Medicago sativa gb|AF135596 
and is a member of Skp1 family PF|01466 [Arabidopsis thaliana]
 gb|AAL25617.1| At1g20140/T20H2_8 [Arabidopsis thaliana]
 gb|AAM19990.1| At1g20140/T20H2_8 [Arabidopsis thaliana]
 gb|AEE29943.1| SKP1-like protein 4 [Arabidopsis thaliana]
Length=163

 Score =   185 bits (470),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 108/133 (81%), Gaps = 12/133 (9%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + KMI+LKSSDGE+FE+EEAVA++SQTIKHMIEDDCAD  IPLPNVT  ILAKVIEYCK+
Sbjct  4    TKKMIILKSSDGESFEIEEAVAVKSQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKK  63

Query  310  HVEAASKTEEKPGE---------DDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLT  462
            HVEAA+   E  G+         D+LK +D++FVKVDQ TLFDLILAANYLNI  LLDLT
Sbjct  64   HVEAAA---EAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLT  120

Query  463  CQTVADMIKGKTP  501
            C+ VAD ++GKTP
Sbjct  121  CKAVADQMRGKTP  133



>gb|AAT12490.1| Skp1/Ask1-like protein [Zantedeschia hybrid cultivar]
Length=167

 Score =   185 bits (469),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 4/127 (3%)
 Frame = +1

Query  133  SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRH  312
            SK + LKSSDGE FEVEE VA+ESQTI+++IEDDC    +PLPNVT +ILAKVIE+CK+H
Sbjct  11   SKKLTLKSSDGEVFEVEETVAMESQTIRNLIEDDCTADGVPLPNVTGRILAKVIEFCKKH  70

Query  313  VE-AASKTEE---KPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            VE AA K +E   +  +++LK +DADFVKVDQ TLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  71   VEIAALKADEGVDRAADEELKVWDADFVKVDQTTLFDLILAANYLNIKSLLDLTCQTVAD  130

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  131  MIKGKTP  137



>dbj|BAD46569.1| putative UIP2 [Oryza sativa Japonica Group]
 dbj|BAH01115.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84966.1| hypothetical protein OsI_32208 [Oryza sativa Indica Group]
 gb|EEE70133.1| hypothetical protein OsJ_30167 [Oryza sativa Japonica Group]
Length=175

 Score =   185 bits (469),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 105/136 (77%), Gaps = 15/136 (11%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MI L+S +G+ FEV EAVA+ESQTI+HMIED CADT IPLPNV++KIL+KVIEYC +HVE
Sbjct  10   MITLRSCEGQVFEVAEAVAMESQTIRHMIEDKCADTGIPLPNVSAKILSKVIEYCSKHVE  69

Query  319  AASKTE---------------EKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLL  453
            A                     K  ED+LKTFDA+FVKVDQ+TLFDLILAANYLNIK LL
Sbjct  70   ARGGAAAAADGDAPAPAAVEANKAVEDELKTFDAEFVKVDQSTLFDLILAANYLNIKGLL  129

Query  454  DLTCQTVADMIKGKTP  501
            DLTCQTVADMIKGKTP
Sbjct  130  DLTCQTVADMIKGKTP  145



>ref|XP_006416426.1| hypothetical protein EUTSA_v10008964mg [Eutrema salsugineum]
 gb|ESQ34779.1| hypothetical protein EUTSA_v10008964mg [Eutrema salsugineum]
Length=162

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 110/131 (84%), Gaps = 8/131 (6%)
 Frame = +1

Query  133  SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRH  312
            SK IVL+SSDGE+FEV+EAVA+ESQTIKHMIEDDCA   IPLPNV S IL+KVIEYCK+H
Sbjct  2    SKKIVLRSSDGESFEVDEAVAVESQTIKHMIEDDCAGNGIPLPNVNSAILSKVIEYCKKH  61

Query  313  VE--AASKTEEK----PGEDD--LKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQ  468
            V+  AA+ + EK    P ++D  LKT+DA FV VDQATLFDLILAANYLNI  LLDLTC+
Sbjct  62   VDAAAAASSGEKDICAPTDEDNELKTWDAAFVNVDQATLFDLILAANYLNITGLLDLTCK  121

Query  469  TVADMIKGKTP  501
            TVADM++GKTP
Sbjct  122  TVADMMRGKTP  132



>emb|CDX73212.1| BnaC06g36600D [Brassica napus]
Length=161

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 109/130 (84%), Gaps = 6/130 (5%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSD E+FEV+EAVA ESQT+ HM+EDDC D  IPLPNVT KILAKVIEYCK+
Sbjct  2    STKKIVLKSSDNESFEVDEAVARESQTLAHMVEDDCTDNGIPLPNVTGKILAKVIEYCKK  61

Query  310  HVEAASKTEEK------PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
            HV+AA+   E         +DDLK +DA+F+K+DQATLF+LILAANYLNIK+LLDLTCQT
Sbjct  62   HVDAAAAKTEAAADGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  472  VADMIKGKTP  501
            VADMIKGKTP
Sbjct  122  VADMIKGKTP  131



>gb|ABB69022.1| SKP1 [Brassica napus]
Length=160

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 5/129 (4%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSD E+FEV+EAVA ESQT+ HM+EDDC D  IPLPNVT KILAKVIEYCK+
Sbjct  2    STKKIVLKSSDNESFEVDEAVARESQTLAHMVEDDCTDNDIPLPNVTGKILAKVIEYCKK  61

Query  310  HVEAASKTEEK-----PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTV  474
            HV+AA+   E        +DDLK +DA+F+K+DQATLF+LILAANYLNIK+LLDLTCQTV
Sbjct  62   HVDAAAAKTEAADGGASSDDDLKAWDAEFMKIDQATLFELILAANYLNIKNLLDLTCQTV  121

Query  475  ADMIKGKTP  501
            ADMIKGKTP
Sbjct  122  ADMIKGKTP  130



>ref|XP_007219396.1| hypothetical protein PRUPE_ppa020403mg [Prunus persica]
 gb|EMJ20595.1| hypothetical protein PRUPE_ppa020403mg [Prunus persica]
Length=156

 Score =   183 bits (465),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 104/122 (85%), Gaps = 2/122 (2%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I LKS DGE FEVEEAVA++SQTIKHM+EDDCAD  IPLPNVTS I+AKVIEYCK+H 
Sbjct  7    KKITLKSDDGEIFEVEEAVAMQSQTIKHMVEDDCADGPIPLPNVTSNIVAKVIEYCKKHH  66

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            E  +  E+   ++D+K +D +FVKVDQ+T+FDLILAANYLN+KSLLDLTCQTVADMI GK
Sbjct  67   EEDADGEK--NKEDIKKWDVEFVKVDQSTMFDLILAANYLNVKSLLDLTCQTVADMINGK  124

Query  496  TP  501
            TP
Sbjct  125  TP  126



>gb|EMT01771.1| SKP1-like protein 1B [Aegilops tauschii]
Length=252

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 107/137 (78%), Gaps = 15/137 (11%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDG+ F+VEEAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYCK+HV
Sbjct  9    KMITLKSSDGQEFDVEEAVAMESQTIRHMIEDDCADNDIPLPNVDSKILSKVIEYCKKHV  68

Query  316  EAASKTEEKPG---------------EDDLKTFDADFVKVDQATLFDLILAANYLNIKSL  450
            +A+ K  +                   +DLK+FDA+FVKVD+ATLFDLILAANYLNIK L
Sbjct  69   QASPKPADSGAVTDANSSTSTAAAAPAEDLKSFDAEFVKVDRATLFDLILAANYLNIKGL  128

Query  451  LDLTCQTVADMIKGKTP  501
            LDLTCQTVADMIK  TP
Sbjct  129  LDLTCQTVADMIKDNTP  145



>ref|XP_007024458.1| SKP1-like 4 [Theobroma cacao]
 gb|EOY27080.1| SKP1-like 4 [Theobroma cacao]
Length=152

 Score =   182 bits (463),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 5/125 (4%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S+SK I+L+SSDG+T EVEEAVA++  TIKHMIEDDCAD  IP+PNVTS+ILAKV+EYCK
Sbjct  3    STSKKIMLRSSDGKTVEVEEAVAVQLLTIKHMIEDDCADNEIPIPNVTSEILAKVLEYCK  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HV+       K GED+LK +DADFVKVDQ  L+ L+LAANYLNI+SLLDL CQTVADMI
Sbjct  63   KHVDKG-----KMGEDELKAWDADFVKVDQNILYHLVLAANYLNIQSLLDLICQTVADMI  117

Query  487  KGKTP  501
            KGKTP
Sbjct  118  KGKTP  122



>ref|XP_008232104.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
 ref|XP_008245448.1| PREDICTED: SKP1-like protein 1B [Prunus mume]
Length=156

 Score =   182 bits (463),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 2/122 (2%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I LKS DGE FEVEEAVA++SQTI+HM+EDDCAD  IPLPNVTS I+AKVIEYCK+  
Sbjct  7    KKITLKSDDGEIFEVEEAVAMQSQTIRHMVEDDCADGPIPLPNVTSNIVAKVIEYCKKKH  66

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            E  +  E+   ++D+K +DA FVKVDQ+TLFDLILAANYLNIKSLLDLTCQTVADMIKGK
Sbjct  67   EEDADGEK--NKEDIKNWDAAFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGK  124

Query  496  TP  501
            TP
Sbjct  125  TP  126



>ref|XP_003605510.1| SKP1-like protein [Medicago truncatula]
 gb|AES87707.1| SCF ubiquitin ligase, SKP1 component [Medicago truncatula]
Length=175

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 2/126 (2%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SS+K I LKS DGETF++EEAVALESQTIKH+I+D   DT IP+PNVT KILAKVIEYCK
Sbjct  21   SSAKKITLKSYDGETFDIEEAVALESQTIKHLIDDVSDDTGIPIPNVTGKILAKVIEYCK  80

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD-M  483
            +HVE A ++ EKP ED+LK +DA+FV+VDQ TLFDLILAANYLNIKSLLDLTC++VAD M
Sbjct  81   KHVEYA-RSNEKPPEDELKKWDAEFVQVDQETLFDLILAANYLNIKSLLDLTCKSVADMM  139

Query  484  IKGKTP  501
            +  KTP
Sbjct  140  LAAKTP  145



>ref|XP_010669692.1| PREDICTED: SKP1-like protein 1B [Beta vulgaris subsp. vulgaris]
Length=171

 Score =   183 bits (464),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 113/137 (82%), Gaps = 12/137 (9%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            ++ K I LKSSDGE F+VEE+VALE QTIK++IEDDCAD VIPLPNVT+KIL+KVIEYCK
Sbjct  4    TTVKKITLKSSDGENFDVEESVALECQTIKYIIEDDCADNVIPLPNVTAKILSKVIEYCK  63

Query  307  RHVE--AASKTEEK----------PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSL  450
            +HVE  AA+K+  +            E++LKT+DA+FVKVDQ TLFDLILAANYLNIKSL
Sbjct  64   KHVESVAAAKSSTEDGSSSSNPTTADEEELKTWDAEFVKVDQNTLFDLILAANYLNIKSL  123

Query  451  LDLTCQTVADMIKGKTP  501
            LDLTCQTVA+M+ GKTP
Sbjct  124  LDLTCQTVANMMTGKTP  140



>dbj|BAB85603.1| kinetochore protein [Brassica juncea]
 emb|CDX87650.1| BnaA07g32230D [Brassica napus]
Length=161

 Score =   182 bits (463),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 109/130 (84%), Gaps = 6/130 (5%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSD E+FEV+EAVA ESQT+ HM+EDDC D  IPLPNVT KILAKVIEYCK+
Sbjct  2    STKKIVLKSSDDESFEVDEAVARESQTLAHMVEDDCTDNGIPLPNVTGKILAKVIEYCKK  61

Query  310  HVEAASKTEEK------PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
            HV+AA+   E       P ++DLK +DA+F+ +DQATLF+LILAANYLNIK+LLDLTCQT
Sbjct  62   HVDAAAAKTEATADGGAPSDEDLKAWDAEFMNIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  472  VADMIKGKTP  501
            VADMIKGKTP
Sbjct  122  VADMIKGKTP  131



>ref|XP_004301672.1| PREDICTED: SKP1-like protein 1A [Fragaria vesca subsp. vesca]
Length=163

 Score =   182 bits (463),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 99/125 (79%), Gaps = 8/125 (6%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            S  KMI L+S+DGE FE+EE VALESQTIKHM+EDDCA+  IPLPNV   ILAKVIEYCK
Sbjct  17   SEKKMITLQSADGEPFEIEEVVALESQTIKHMVEDDCAENAIPLPNVKGAILAKVIEYCK  76

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HVE A         +DLK +DA++V VDQ  LFDLILAANYLNIK LLDLTCQ VADMI
Sbjct  77   KHVEDAG--------EDLKAWDAEYVNVDQNVLFDLILAANYLNIKGLLDLTCQKVADMI  128

Query  487  KGKTP  501
            KGKTP
Sbjct  129  KGKTP  133



>ref|NP_565604.1| putative E3 ubiquitin ligase ASK3 [Arabidopsis thaliana]
 sp|Q9SL93.1|ASK3_ARATH RecName: Full=SKP1-like protein 3; Short=AtSK3 [Arabidopsis thaliana]
 gb|AAD31370.1| E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At3), putative 
[Arabidopsis thaliana]
 gb|AAK96604.1| At2g25700/F3N11.15 [Arabidopsis thaliana]
 gb|AAM98112.1| At2g25700/F3N11.15 [Arabidopsis thaliana]
 gb|AEC07739.1| putative E3 ubiquitin ligase ASK3 [Arabidopsis thaliana]
Length=163

 Score =   182 bits (461),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 104/133 (78%), Gaps = 12/133 (9%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + KMI+LKSSDGE+FEVEEAVA+ESQTIKHMIEDDC D  IPLPNVT  ILAKVIEYCK+
Sbjct  4    TKKMIILKSSDGESFEVEEAVAVESQTIKHMIEDDCVDNGIPLPNVTGAILAKVIEYCKK  63

Query  310  HVEAASKTEEKPGEDD---------LKTFDADFVKVDQATLFDLILAANYLNIKSLLDLT  462
            HVEAA+   E  G+ D         LKT+D DFVKVD  TLFDL+ AANYLNI  LLDLT
Sbjct  64   HVEAAA---EAGGDKDFYGSTENHELKTWDNDFVKVDHPTLFDLLRAANYLNISGLLDLT  120

Query  463  CQTVADMIKGKTP  501
            C+ VAD ++GKTP
Sbjct  121  CKAVADQMRGKTP  133



>gb|ACR38888.1| SKP1 [Pellia endiviifolia (species B)]
 gb|ACR38897.1| SKP1 [Pellia endiviifolia (species B)]
Length=158

 Score =   182 bits (461),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 105/128 (82%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS    + LKSSD E FEVE+ VA ESQT+K+MIED   +  IPLPNV+SKIL+KVIEYC
Sbjct  1    MSKETKVKLKSSDDEMFEVEDVVAFESQTVKNMIEDTGTENAIPLPNVSSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKP--GEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K HVE     ++KP   ED++KT+DA+FVKVDQATLFDLILAANYLNIK+LLDLTCQTVA
Sbjct  61   KFHVETQKAADDKPVATEDEIKTWDAEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>ref|XP_001753554.1| predicted protein [Physcomitrella patens]
 gb|EDQ81777.1| predicted protein [Physcomitrella patens]
Length=158

 Score =   182 bits (461),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 106/127 (83%), Gaps = 3/127 (2%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + + + L+SSD E FEV+EAVA ESQ +K+MIED   D VIPLPNV+SKILAKVIEYCK 
Sbjct  2    AEQRVKLRSSDDEMFEVDEAVAFESQAVKNMIEDTGKDAVIPLPNVSSKILAKVIEYCKY  61

Query  310  HVE-AASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            HV+     T++KP   EDD+K +DADFVKVDQATLFDLILAANYLNIK+LLDLTCQTVAD
Sbjct  62   HVDNQKGATDDKPAASEDDIKAWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTVAD  121

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  122  MIKGKTP  128



>ref|NP_001176525.1| Os11g0456300 [Oryza sativa Japonica Group]
 gb|ABA93508.1| SKP1-like protein 1B, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH95253.1| Os11g0456300 [Oryza sativa Japonica Group]
Length=173

 Score =   182 bits (461),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 105/136 (77%), Gaps = 14/136 (10%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE FEVEE VA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYC +HV
Sbjct  8    KMITLKSSDGEEFEVEEPVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  67

Query  316  EAASKTEE--------------KPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLL  453
             AA+                   P  +DLK +DADFVKVDQATLFDLILAANYLNIK LL
Sbjct  68   HAAAAAASKAADDAASAAAAVPPPSGEDLKNWDADFVKVDQATLFDLILAANYLNIKGLL  127

Query  454  DLTCQTVADMIKGKTP  501
            DLTCQTVADMIKGKTP
Sbjct  128  DLTCQTVADMIKGKTP  143



>ref|XP_009106248.1| PREDICTED: SKP1-like protein 1A [Brassica rapa]
Length=161

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 108/130 (83%), Gaps = 6/130 (5%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            S+K IVLKSSD E+FEV+EAVA ESQT+ HM+EDDC D  IPLPNVT KILAKVIEYCK+
Sbjct  2    STKKIVLKSSDAESFEVDEAVARESQTLAHMVEDDCTDNGIPLPNVTGKILAKVIEYCKK  61

Query  310  HVEAASKTEEK------PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
            HV+AA+   E       P ++DLK +DA+F+ +DQATLF+LILAANYLNIK+LLDLTCQT
Sbjct  62   HVDAAAAKTEATADGGAPSDEDLKAWDAEFMNIDQATLFELILAANYLNIKNLLDLTCQT  121

Query  472  VADMIKGKTP  501
            V DMIKGKTP
Sbjct  122  VPDMIKGKTP  131



>ref|XP_010646801.1| PREDICTED: SKP1-like protein 1A isoform X2 [Vitis vinifera]
Length=306

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +1

Query  142  IVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVEA  321
            + L+SSDG  F V+ AVA+ESQTIKHMIED CAD  IPLPNVTSKILA+VIEYCK+HVE 
Sbjct  158  LTLQSSDGMFFYVDVAVAMESQTIKHMIEDRCADNAIPLPNVTSKILARVIEYCKKHVET  217

Query  322  ASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  501
              K EE    D+L+ +DADFVKVDQATLFDLILAANYL+IKSLLDLTCQTVADMIKGKTP
Sbjct  218  -PKAEEHAVNDELRAWDADFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIKGKTP  276


 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 97/127 (76%), Gaps = 6/127 (5%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIED-----DCADTVIPLPNVTSKILAK  288
            M+SSK+I L+SS+GE F ++   A+E   IK MIE+        D  IPLPNVTSKILAK
Sbjct  1    MASSKIITLRSSEGEDFGLDVVAAMELLVIKPMIEELQVIKPMIDNAIPLPNVTSKILAK  60

Query  289  VIEYCKRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQ  468
            VIEYCK+HVE   K EE    D+LK +DADFVKVDQATLFDLILAANYL IKSLLDLTCQ
Sbjct  61   VIEYCKKHVET-PKAEEHAVNDELKAWDADFVKVDQATLFDLILAANYLGIKSLLDLTCQ  119

Query  469  TVADMIK  489
            TVADMIK
Sbjct  120  TVADMIK  126



>ref|XP_004299943.1| PREDICTED: SKP1-like protein 1B [Fragaria vesca subsp. vesca]
Length=159

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + KM+ LKS DGE FE+EEAVA++SQTIKHM+EDDCAD  IPLPNV   ILA+VIEY K+
Sbjct  5    NKKMLTLKSEDGEVFEIEEAVAVQSQTIKHMVEDDCADNAIPLPNVKGPILARVIEYLKK  64

Query  310  HVEAASKTEEKPGED-DLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            HV  A + +E   ED  LK FD +F+KVDQ+ LFDLILAANYLNIK LLDLTCQ VADMI
Sbjct  65   HVADAEENKESKKEDVGLKEFDEEFLKVDQSVLFDLILAANYLNIKELLDLTCQAVADMI  124

Query  487  KGKTP  501
            KGKTP
Sbjct  125  KGKTP  129



>emb|CDP16774.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MIVL SSDGETFEVEE+V L+SQTIKHMIEDDCA++ IPLPNVT  ILAKV+EYCK+HV+
Sbjct  1    MIVLNSSDGETFEVEESVILQSQTIKHMIEDDCANSAIPLPNVTGTILAKVLEYCKQHVK  60

Query  319  AASKTEEKPGE-DDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
                 E    E + LK+FDA+FVKVDQ TLFD+ILAANYL+IK LL LTCQTVADM+KGK
Sbjct  61   PNDGEESSKDEAERLKSFDAEFVKVDQKTLFDIILAANYLDIKGLLVLTCQTVADMMKGK  120

Query  496  TP  501
            TP
Sbjct  121  TP  122



>ref|XP_007201294.1| hypothetical protein PRUPE_ppa012728mg [Prunus persica]
 gb|EMJ02493.1| hypothetical protein PRUPE_ppa012728mg [Prunus persica]
Length=157

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 101/128 (79%), Gaps = 6/128 (5%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +  KMI LKS+DGE FEVEEAVALESQTIKHM EDDC D  IPLPNV S +LAKVIEYC+
Sbjct  3    TEKKMITLKSADGEIFEVEEAVALESQTIKHMAEDDCVDNAIPLPNVESHVLAKVIEYCR  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFV---KVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            +HVE A+  E K   D +K F+ DFV   K DQ+ LFD ILAANYLNIKSLLDLTCQTVA
Sbjct  63   KHVELAANDENK---DTVKEFNDDFVNEIKADQSVLFDTILAANYLNIKSLLDLTCQTVA  119

Query  478  DMIKGKTP  501
            DMIKGK P
Sbjct  120  DMIKGKAP  127



>ref|XP_010683700.1| PREDICTED: SKP1-like protein 1B isoform X3 [Beta vulgaris subsp. 
vulgaris]
Length=150

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 104/121 (86%), Gaps = 2/121 (2%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MI LKSSDGE FEVEE+VALE +TIK MIEDDCADT IPLPNVT+KIL+KVIEYCK+HVE
Sbjct  1    MITLKSSDGEKFEVEESVALECETIKLMIEDDCADTAIPLPNVTAKILSKVIEYCKKHVE  60

Query  319  AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  498
            +A+        ++LK +D +FVKVDQ TLF+LILAANYLNI+SLLDLTCQTV+D+IK KT
Sbjct  61   SAAAA--NSTNEELKIWDKEFVKVDQKTLFNLILAANYLNIRSLLDLTCQTVSDIIKDKT  118

Query  499  P  501
            P
Sbjct  119  P  119



>gb|EMT15207.1| SKP1-like protein 1B [Aegilops tauschii]
Length=169

 Score =   181 bits (459),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 105/135 (78%), Gaps = 10/135 (7%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +++K + LKSSDGE FEVE AVA+ SQTIKHM+ED CAD +IPLPNVT+KIL+KVIEYC 
Sbjct  5    AAAKKLTLKSSDGEDFEVEVAVAMASQTIKHMVEDGCADNIIPLPNVTAKILSKVIEYCT  64

Query  307  RHV----------EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLD  456
            +H              + T  KP E+ LK FD +FVKV+QATLFDLILAANYL+IK LLD
Sbjct  65   QHAPKADDAAAADSTGTATAVKPDEEKLKAFDTEFVKVEQATLFDLILAANYLDIKGLLD  124

Query  457  LTCQTVADMIKGKTP  501
            LTCQTVADMIKGKTP
Sbjct  125  LTCQTVADMIKGKTP  139



>emb|CDP16773.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   180 bits (457),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 6/125 (5%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            SS KMI L+SSDGETFEVEE VA+ES+TIKHMIEDDCA++ IP+PNVTS  L KVIEYCK
Sbjct  4    SSPKMITLQSSDGETFEVEEVVAMESRTIKHMIEDDCANSSIPIPNVTSNTLTKVIEYCK  63

Query  307  RHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            +HVEA      K  E+ LK+FDADF+K+D+ TL+DL++A+NYL+IKSLLDL CQTVAD I
Sbjct  64   KHVEA------KNDEEGLKSFDADFMKIDKDTLYDLLMASNYLDIKSLLDLGCQTVADKI  117

Query  487  KGKTP  501
            KGK P
Sbjct  118  KGKNP  122



>ref|XP_010683698.1| PREDICTED: SKP1-like protein 1B isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=171

 Score =   181 bits (458),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 106/134 (79%), Gaps = 12/134 (9%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            +MI LKSSDGE FEVEE+VALE +TIK MIEDDCADT IPLPNVT+KIL+KVIEYCK+HV
Sbjct  7    RMITLKSSDGEKFEVEESVALECETIKLMIEDDCADTAIPLPNVTAKILSKVIEYCKKHV  66

Query  316  EAA------------SKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDL  459
            E+A            S T      ++LK +D +FVKVDQ TLF+LILAANYLNI+SLLDL
Sbjct  67   ESAAAAKSCSTEDSCSSTANSSTNEELKIWDKEFVKVDQKTLFNLILAANYLNIRSLLDL  126

Query  460  TCQTVADMIKGKTP  501
            TCQTV+D+IK KTP
Sbjct  127  TCQTVSDIIKDKTP  140



>ref|XP_006646753.1| PREDICTED: SKP1-like protein 1B-like [Oryza brachyantha]
 ref|XP_006646755.1| PREDICTED: SKP1-like protein 1B-like [Oryza brachyantha]
Length=167

 Score =   180 bits (457),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 107/130 (82%), Gaps = 8/130 (6%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE FEVEEAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYC +HV
Sbjct  8    KMITLKSSDGEEFEVEEAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  67

Query  316  EAASKTEE--------KPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQT  471
             A++ T +            DDLK +DADFVKVDQATLFDLILAANYLNIK LLDLTCQT
Sbjct  68   HASNSTSDDAPAPATNSTSADDLKNWDADFVKVDQATLFDLILAANYLNIKGLLDLTCQT  127

Query  472  VADMIKGKTP  501
            VADMIKGKTP
Sbjct  128  VADMIKGKTP  137



>ref|XP_008232108.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
Length=156

 Score =   180 bits (456),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 102/122 (84%), Gaps = 2/122 (2%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I LKS DGE FEVEEAVA++SQTI+HM+EDDCAD  IPLPNVTS ILAKVIEYC++H 
Sbjct  7    KKITLKSDDGEIFEVEEAVAMQSQTIRHMMEDDCADGAIPLPNVTSNILAKVIEYCRKHK  66

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            E A+  E K  +D LK +DA+FVK+DQ TLF LI+ ANYLNIKSLLDLT QTVA+MIKGK
Sbjct  67   EEAADGENK--KDILKEWDAEFVKLDQVTLFHLIMTANYLNIKSLLDLTAQTVAEMIKGK  124

Query  496  TP  501
            TP
Sbjct  125  TP  126



>gb|KFK36059.1| hypothetical protein AALP_AA4G072500 [Arabis alpina]
Length=151

 Score =   179 bits (455),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 103/127 (81%), Gaps = 7/127 (6%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS  KMIVLKS DGE FE+EEAVAL+SQTI HM+EDDC +  IP+ NVT +ILAKVIEYC
Sbjct  1    MSDRKMIVLKSFDGEIFEIEEAVALQSQTIAHMVEDDCVENGIPISNVTGEILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVK-VDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            K+HV+     EE      LKT+D +F+K +DQ+TLF+LILAANYLNIK+LLD TCQTVAD
Sbjct  61   KKHVDGGGSEEE------LKTWDEEFMKNIDQSTLFNLILAANYLNIKTLLDFTCQTVAD  114

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  115  MIKGKTP  121



>ref|XP_007221090.1| hypothetical protein PRUPE_ppa017105mg [Prunus persica]
 gb|EMJ22289.1| hypothetical protein PRUPE_ppa017105mg [Prunus persica]
Length=156

 Score =   179 bits (455),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 2/122 (2%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I LKS DGE FEVEEAVA++SQTI+HM+EDDCAD  IPL NVTS I+AKVIEYCK+H 
Sbjct  7    KKITLKSEDGEIFEVEEAVAMQSQTIRHMVEDDCADGPIPLQNVTSNIVAKVIEYCKKHH  66

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            E  +  E+   ++D+K +D +FVKVDQ+T+FDLILAANYLN+KSLLDLTCQTVADMI GK
Sbjct  67   EEDADGEK--NKEDIKKWDVEFVKVDQSTMFDLILAANYLNVKSLLDLTCQTVADMINGK  124

Query  496  TP  501
            TP
Sbjct  125  TP  126



>ref|XP_008372868.1| PREDICTED: SKP1-like protein 1B [Malus domestica]
Length=165

 Score =   180 bits (456),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 103/133 (77%), Gaps = 8/133 (6%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +  KMI LKSSDGE FEV+EAVA+ESQTIKHM+EDDCAD  IPLPNVTS ILAKVIEYC+
Sbjct  3    AEKKMITLKSSDGEAFEVDEAVAMESQTIKHMVEDDCADNAIPLPNVTSHILAKVIEYCR  62

Query  307  RHVEAASKTEE----KPG-EDDLKTFDADFV---KVDQATLFDLILAANYLNIKSLLDLT  462
            +HVE  +  +     K G E  LK FD DFV   K DQ  LFDLILAANYLNIKSLLDLT
Sbjct  63   KHVEGRTDGDSTDXGKIGDEXTLKKFDDDFVNEIKADQNVLFDLILAANYLNIKSLLDLT  122

Query  463  CQTVADMIKGKTP  501
            C TVADMIKG TP
Sbjct  123  CXTVADMIKGXTP  135



>ref|XP_006436098.1| hypothetical protein CICLE_v10033809mg [Citrus clementina]
 ref|XP_006486025.1| PREDICTED: SKP1-like protein 1A-like [Citrus sinensis]
 gb|ESR49338.1| hypothetical protein CICLE_v10033809mg [Citrus clementina]
Length=160

 Score =   179 bits (455),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 103/121 (85%), Gaps = 2/121 (2%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MI+LKSSDGETFEVEE VAL+SQTI+HM+EDDCAD+VIPLPNVT  IL+ V+EYCK+HVE
Sbjct  12   MIILKSSDGETFEVEETVALQSQTIRHMVEDDCADSVIPLPNVTGTILSMVVEYCKKHVE  71

Query  319  AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  498
            AA+      G++D+K +D DFVKVDQ TL DL+LAANYLNIK LL+LTCQ  ADMIK K+
Sbjct  72   AAAAA--AGGDNDVKNWDRDFVKVDQETLLDLLLAANYLNIKDLLELTCQATADMIKDKS  129

Query  499  P  501
            P
Sbjct  130  P  130



>ref|XP_006661910.1| PREDICTED: SKP1-like protein 1B-like [Oryza brachyantha]
Length=169

 Score =   179 bits (455),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 109/132 (83%), Gaps = 10/132 (8%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KMI LKSSDGE FEVEEAVA+ESQTI+HMIEDDCAD  IPLPNV SKIL+KVIEYC +HV
Sbjct  8    KMITLKSSDGEEFEVEEAVAMESQTIRHMIEDDCADNGIPLPNVNSKILSKVIEYCNKHV  67

Query  316  EAASKT---EEKPGE-------DDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTC  465
             A++ T   ++ P         DDLK +DADFVKVDQATLFDLILAANYLNIK LLDLTC
Sbjct  68   HASNSTSTSDDAPAPAANSTSADDLKNWDADFVKVDQATLFDLILAANYLNIKGLLDLTC  127

Query  466  QTVADMIKGKTP  501
            QTVADMIKGKTP
Sbjct  128  QTVADMIKGKTP  139



>ref|XP_008382315.1| PREDICTED: SKP1-like protein 1A isoform X2 [Malus domestica]
Length=154

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 103/126 (82%), Gaps = 2/126 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS K I LKSSD E FEVEEA+A+ESQTIKHM+ED CA   IPLPNVTS ILAKVIEYC
Sbjct  1    MSSHK-ITLKSSDDEMFEVEEAIAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYC  59

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            ++H E    T    GE ++K +DA+F+K+DQ TL+DLI+AANYL+IK LLDLTCQTVADM
Sbjct  60   RKHSEDEGAT-AADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADM  118

Query  484  IKGKTP  501
            IKGKTP
Sbjct  119  IKGKTP  124



>ref|XP_006359704.1| PREDICTED: SKP1-like protein 1B-like [Solanum tuberosum]
Length=158

 Score =   179 bits (453),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 106/128 (83%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MSS K I L+SSDGE FEVEEAVALESQTIK +IEDDCA + IP+ NVTS ILAKV+EY 
Sbjct  1    MSSLKKISLRSSDGEVFEVEEAVALESQTIKFLIEDDCAGSDIPISNVTSNILAKVLEYL  60

Query  304  KRHVE--AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            KRHVE    +  ++   ++DLK FDA+FVKVDQ TLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KRHVEADDKAADDKAAADNDLKVFDAEFVKVDQKTLFDLILAANYLNIKGLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>emb|CCG34083.1| SCF ubiquitin ligase [uncultured eukaryote]
Length=158

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 103/128 (80%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+    + LKSSD E F+V EAVA ESQTIK+MIED      IPLPNV+SKIL+KVIEYC
Sbjct  1    MARESKVSLKSSDDELFDVTEAVAFESQTIKNMIEDTGTANAIPLPNVSSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K HVEA    +EK    ED++KT+D +FVKVDQATLFDLILAANYLNIK+LLDLTCQTVA
Sbjct  61   KFHVEAQKPADEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>ref|XP_004957494.1| PREDICTED: SKP1-like protein 1B-like [Setaria italica]
Length=174

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 101/134 (75%), Gaps = 12/134 (9%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            KM++L S D E FEVEE+VA ES+TI HMIED C D  IP+PNV  KILAKVIEYCK+HV
Sbjct  11   KMLMLVSCDKENFEVEESVARESRTILHMIEDGCTDNGIPIPNVNGKILAKVIEYCKKHV  70

Query  316  EAASKTE------------EKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDL  459
            EA    +             K  ED+LKTFDADFVKVDQ TLFDLILAANYL+IK LLDL
Sbjct  71   EARRGADGDGDAAEPTAATNKASEDELKTFDADFVKVDQGTLFDLILAANYLDIKGLLDL  130

Query  460  TCQTVADMIKGKTP  501
            TCQTVADMIKGKTP
Sbjct  131  TCQTVADMIKGKTP  144



>gb|ABK21374.1| unknown [Picea sitchensis]
 gb|ABK26105.1| unknown [Picea sitchensis]
 gb|ABK26432.1| unknown [Picea sitchensis]
Length=158

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+    + LKSSD E F+V EAVA ESQTIK+MIED    + IPLPNV+SKIL+KVIEYC
Sbjct  1    MARECKVSLKSSDDELFDVNEAVAFESQTIKNMIEDTGTASAIPLPNVSSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K HVEA    +EK    ED++KT+D +FVKVDQATLFDLILAANYLNIK+LLDLTCQTVA
Sbjct  61   KYHVEAQKPADEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>emb|CDY44209.1| BnaC05g15660D [Brassica napus]
Length=161

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 104/132 (79%), Gaps = 11/132 (8%)
 Frame = +1

Query  133  SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRH  312
            SK I+LKSSDGE+FEV+EAVALESQTIKHM+EDDC    IPLPNVTS ILAKVIEYCK+H
Sbjct  2    SKKIILKSSDGESFEVDEAVALESQTIKHMVEDDCIADGIPLPNVTSAILAKVIEYCKKH  61

Query  313  VEAASKTEEKPGEDD---------LKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTC  465
            V+AA+  E   G+ D         LK +D +F KVDQ TLFDLILAANYLNI  LLDLTC
Sbjct  62   VDAAA--EANAGDKDIYGNTEDTELKNWDTEFAKVDQPTLFDLILAANYLNITGLLDLTC  119

Query  466  QTVADMIKGKTP  501
            +TVADMI GKTP
Sbjct  120  KTVADMIVGKTP  131



>gb|EMS52877.1| SKP1-like protein 1B [Triticum urartu]
Length=166

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 104/132 (79%), Gaps = 7/132 (5%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +++K + LKSSDGE FEVE AVA+ SQTIKHM+ED CAD +IPLPNV +K+L+KVIEYC 
Sbjct  5    AAAKKLTLKSSDGEDFEVEVAVAMASQTIKHMVEDGCADNIIPLPNVNAKVLSKVIEYCT  64

Query  307  RHVEAASKTEE-------KPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTC  465
            +H   A            KP E+ LK FDA+FVKV+QATLFDLILAANYL+IK LLDLTC
Sbjct  65   QHAPKADDAATADSATAVKPDEETLKAFDAEFVKVEQATLFDLILAANYLDIKGLLDLTC  124

Query  466  QTVADMIKGKTP  501
            QTVADMIKGKTP
Sbjct  125  QTVADMIKGKTP  136



>ref|XP_001753031.1| predicted protein [Physcomitrella patens]
 gb|EDQ82072.1| predicted protein [Physcomitrella patens]
Length=157

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 104/126 (83%), Gaps = 2/126 (2%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + K + LKSSD E FEV+EAVA ESQ +K+MIED   D  IPLPNV+SKILAKVIEYCK 
Sbjct  2    AEKRVKLKSSDDEMFEVDEAVAFESQAVKNMIEDTGIDAPIPLPNVSSKILAKVIEYCKY  61

Query  310  HVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            HVE    +++K    E+++K +DADFVKVDQATLFDLILAANYLNIK+LLDLTCQTVADM
Sbjct  62   HVENQKPSDDKQATPEEEIKAWDADFVKVDQATLFDLILAANYLNIKNLLDLTCQTVADM  121

Query  484  IKGKTP  501
            IKGKTP
Sbjct  122  IKGKTP  127



>ref|XP_002277864.1| PREDICTED: uncharacterized protein LOC100257179 isoform X1 [Vitis 
vinifera]
Length=438

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = +1

Query  142  IVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVEA  321
            + L+SSDG  F V+ AVA+ESQTIKHMIED CAD  IPLPNVTSKILA+VIEYCK+HVE 
Sbjct  290  LTLQSSDGMFFYVDVAVAMESQTIKHMIEDRCADNAIPLPNVTSKILARVIEYCKKHVET  349

Query  322  ASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP  501
              K EE    D+L+ +DADFVKVDQATLFDLILAANYL+IKSLLDLTCQTVADMIKGKTP
Sbjct  350  -PKAEEHAVNDELRAWDADFVKVDQATLFDLILAANYLDIKSLLDLTCQTVADMIKGKTP  408


 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+SSK I+L+SS+GE F +    A+E   IK +IE+      IPLPNVTSKILAKVIEYC
Sbjct  1    MASSKTIILRSSEGEDFGLHVVAAMELLVIKPIIEEGNTKRAIPLPNVTSKILAKVIEYC  60

Query  304  KRHVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            K+HVE   K EE    D+LK + ADF K D+AT FDLI AA+YL+IK LLDL CQTV DM
Sbjct  61   KKHVE-TPKAEEHAVNDELKGWAADFFKDDRATFFDLIKAADYLHIKCLLDLACQTVVDM  119

Query  484  IKGKTP  501
             K  +P
Sbjct  120  TKEMSP  125


 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 80/120 (67%), Gaps = 18/120 (15%)
 Frame = +1

Query  142  IVLKSSDGETFEVEEAVALESQTIKH----MIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            + LKSSD ETF+++ AVA ES+ IK     MI+D  A+  I   NVTSKILA VIEYCK+
Sbjct  153  LTLKSSDSETFDLDVAVATESRKIKRKIKRMIKDRRANNAILDLNVTSKILATVIEYCKK  212

Query  310  HVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  489
            H             D L+    DFVKVD+ TL DLI AANYL IKSLLDLTCQTVADMIK
Sbjct  213  H----------AVNDKLE----DFVKVDRTTLLDLIKAANYLGIKSLLDLTCQTVADMIK  258



>ref|XP_002976912.1| hypothetical protein SELMODRAFT_271223 [Selaginella moellendorffii]
 ref|XP_002980633.1| hypothetical protein SELMODRAFT_154042 [Selaginella moellendorffii]
 gb|EFJ18284.1| hypothetical protein SELMODRAFT_154042 [Selaginella moellendorffii]
 gb|EFJ22022.1| hypothetical protein SELMODRAFT_271223 [Selaginella moellendorffii]
Length=157

 Score =   177 bits (450),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 105/126 (83%), Gaps = 3/126 (2%)
 Frame = +1

Query  133  SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRH  312
            S  + L+SSDGE FEV+EAVALESQT+K+MIED  +D  IPLPNV SKILAKVIEY K H
Sbjct  2    STKVKLRSSDGEMFEVDEAVALESQTVKNMIEDTGSDAPIPLPNVPSKILAKVIEYSKYH  61

Query  313  VEAASKTEEK---PGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADM  483
            V+A    ++    P E+++K +DA+FVKVDQATLFDLILAANYLNI++LLDLTCQTVADM
Sbjct  62   VDAQKSGDDSKVVPTEEEIKAWDAEFVKVDQATLFDLILAANYLNIRNLLDLTCQTVADM  121

Query  484  IKGKTP  501
            IKGKTP
Sbjct  122  IKGKTP  127



>ref|XP_008382314.1| PREDICTED: SKP1-like protein 1A isoform X1 [Malus domestica]
 gb|AII79404.1| S-phase kinase-associated protein 1-like protein 1 [Malus hupehensis]
Length=160

 Score =   177 bits (450),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 100/122 (82%), Gaps = 1/122 (1%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I LKSSD E FEVEEA+A+ESQTIKHM+ED CA   IPLPNVTS ILAKVIEYC++H 
Sbjct  10   KKITLKSSDDEMFEVEEAIAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYCRKHS  69

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            E    T    GE ++K +DA+F+K+DQ TL+DLI+AANYL+IK LLDLTCQTVADMIKGK
Sbjct  70   EDEGAT-AADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMIKGK  128

Query  496  TP  501
            TP
Sbjct  129  TP  130



>gb|ABK25195.1| unknown [Picea sitchensis]
Length=158

 Score =   177 bits (449),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 103/128 (80%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+    + LKSSD E F+V EAVA ESQTIK+MIED    + IPLPNV+SKIL+KVIEYC
Sbjct  1    MARECKVSLKSSDDELFDVNEAVAFESQTIKNMIEDTGTASAIPLPNVSSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K HVEA    +EK    ED++KT+D +FVKVDQATLFDLILAANYLNIK LLDLTCQTVA
Sbjct  61   KYHVEAQKPADEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKDLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>gb|KDO67761.1| hypothetical protein CISIN_1g044292mg [Citrus sinensis]
Length=160

 Score =   177 bits (449),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 103/121 (85%), Gaps = 2/121 (2%)
 Frame = +1

Query  139  MIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHVE  318
            MI+LKSSDGETFEVEE VAL+SQTI+HM+EDDCAD+VIPLPNVT  IL+ V+EYCK+HVE
Sbjct  12   MIILKSSDGETFEVEETVALQSQTIRHMVEDDCADSVIPLPNVTGTILSMVVEYCKKHVE  71

Query  319  AASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKT  498
            AA+      G++D+K +D DFVKVDQ TL DL+LAANYLNIK LL+LTCQ  AD+IK K+
Sbjct  72   AAAAA--AGGDNDVKNWDRDFVKVDQETLLDLLLAANYLNIKDLLELTCQATADVIKDKS  129

Query  499  P  501
            P
Sbjct  130  P  130



>ref|XP_009373027.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=161

 Score =   177 bits (449),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 100/122 (82%), Gaps = 1/122 (1%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I LKSSD E FEVEEAVA+ESQTIKHM+ED CA   IPLPNVTS ILAKVIEYC++H 
Sbjct  11   KKITLKSSDDEMFEVEEAVAIESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYCRKHR  70

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            E    T    GE ++K +DA+F+K+DQ TL+DLI+AANYL+IK LLDLTCQTVADMIKGK
Sbjct  71   EDEGAT-AADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMIKGK  129

Query  496  TP  501
            TP
Sbjct  130  TP  131



>ref|XP_010432410.1| PREDICTED: SKP1-like protein 11 [Camelina sativa]
Length=153

 Score =   177 bits (448),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 5/127 (4%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            MS+ KMI+LKSSDG++FEVEE VA++SQTI HM+EDDCA T IPL NVTSK LA VIEYC
Sbjct  1    MSTKKMIMLKSSDGQSFEVEEDVAIQSQTIAHMVEDDCASTEIPLANVTSKTLALVIEYC  60

Query  304  KR-HVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            K+ HV+AA+       E++LKT+D  F++ DQ+T+FDLILAANYLNI SLLDLTCQTVAD
Sbjct  61   KKHHVDAANPI----PEEELKTWDKQFMETDQSTIFDLILAANYLNIVSLLDLTCQTVAD  116

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  117  MIKGKTP  123



>ref|XP_008236029.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
 ref|XP_008236030.1| PREDICTED: SKP1-like protein 1A [Prunus mume]
Length=157

 Score =   177 bits (448),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 101/128 (79%), Gaps = 6/128 (5%)
 Frame = +1

Query  127  SSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCK  306
            +  K+I LKS+DGE FEVEEAVALESQTIKHM EDDC D  IPLP V S ILAKVIEYC+
Sbjct  3    TEKKIITLKSADGEIFEVEEAVALESQTIKHMAEDDCVDNAIPLPIVESHILAKVIEYCR  62

Query  307  RHVEAASKTEEKPGEDDLKTFDADFV---KVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            +HVE A+  E K   D +K F+ DFV   K DQ+ LFD ILAANYLNIKSLLDLTCQTVA
Sbjct  63   KHVEFAANDENK---DTVKKFNDDFVNEIKTDQSVLFDTILAANYLNIKSLLDLTCQTVA  119

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  120  DMIKGKTP  127



>ref|XP_006304273.1| hypothetical protein CARUB_v10010505mg [Capsella rubella]
 gb|EOA37171.1| hypothetical protein CARUB_v10010505mg [Capsella rubella]
Length=162

 Score =   177 bits (448),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 104/136 (76%), Gaps = 14/136 (10%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+++K I+LKSSDGE+FEV+E VA+ESQTIKHMIEDDC    IPLPNVT  ILAKVIEYC
Sbjct  1    MAAAKKIILKSSDGESFEVDEVVAVESQTIKHMIEDDCTGNGIPLPNVTGTILAKVIEYC  60

Query  304  KRHVEAAS----------KTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLL  453
            K+H EAA+           TE     D+LK +D +FVKVDQ TLFDLILAANYLNI  LL
Sbjct  61   KKHAEAAADDGGDKDFCGSTE----NDELKAWDTEFVKVDQNTLFDLILAANYLNISGLL  116

Query  454  DLTCQTVADMIKGKTP  501
            DLTC+ VAD +KGKTP
Sbjct  117  DLTCKAVADQMKGKTP  132



>ref|XP_009149503.1| PREDICTED: SKP1-like protein 4 [Brassica rapa]
 emb|CDY29370.1| BnaA06g14260D [Brassica napus]
Length=161

 Score =   177 bits (448),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 104/132 (79%), Gaps = 11/132 (8%)
 Frame = +1

Query  133  SKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRH  312
            SK I+LKSSDGE+FEV++AVALESQTIKHM+EDDC    IPLPNVTS ILAKVIEYCK+H
Sbjct  2    SKKIILKSSDGESFEVDQAVALESQTIKHMVEDDCVADGIPLPNVTSAILAKVIEYCKKH  61

Query  313  VEAASKTEEKPGEDD---------LKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTC  465
            V+AA+  E   G+ D         LK +D +F KVDQ TLFDLILAANYLNI  LLDLTC
Sbjct  62   VDAAA--EANAGDKDIYGNTEDTELKNWDTEFAKVDQPTLFDLILAANYLNITGLLDLTC  119

Query  466  QTVADMIKGKTP  501
            +TVADM+ GKTP
Sbjct  120  KTVADMMVGKTP  131



>gb|AAX92710.1| SCF ubiquitin ligase [Picea abies]
Length=190

 Score =   177 bits (450),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 104/128 (81%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+    + LKSSD E F+V EAVA ESQTIK+MIED    + IPLPNV+SKIL+KVIEYC
Sbjct  1    MARECKVSLKSSDDELFDVNEAVAFESQTIKNMIEDTGTASAIPLPNVSSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K HVEA    +EK    ED++KT+D +FVKVDQATLFDLILAANYLNIK+LLDLTCQTVA
Sbjct  61   KYHVEAQKPADEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>ref|XP_009372999.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=161

 Score =   177 bits (448),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 100/122 (82%), Gaps = 1/122 (1%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I LKSSD E FEVEEAVA++SQTIKHM+ED CA   IPLPNVTS ILAKVIEYC++H 
Sbjct  11   KKITLKSSDDEMFEVEEAVAMQSQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYCRKHR  70

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            E    T    GE ++K +DA+F+K+DQ TL+DLI+AANYL+IK LLDLTCQTVADMIKGK
Sbjct  71   EDEGAT-AADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMIKGK  129

Query  496  TP  501
            TP
Sbjct  130  TP  131



>ref|XP_010459699.1| PREDICTED: SKP1-like protein 4 [Camelina sativa]
Length=162

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 105/133 (79%), Gaps = 8/133 (6%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+S+K I+LKSSDGE+FEV+EAVA+ESQTIKHMIE+DCA   IPLPNVT   LAKVI YC
Sbjct  1    MTSNK-IILKSSDGESFEVDEAVAVESQTIKHMIEEDCASNGIPLPNVTGATLAKVIAYC  59

Query  304  KRHVEAASKTE-------EKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLT  462
            K+HVEAAS+ +            D+LK +D +F+KVDQ TLFDLILAANYLNI  LLDLT
Sbjct  60   KKHVEAASEADGVDKDLCGSNENDELKNWDTEFLKVDQPTLFDLILAANYLNISGLLDLT  119

Query  463  CQTVADMIKGKTP  501
            CQ VAD +KGKTP
Sbjct  120  CQAVADQMKGKTP  132



>ref|XP_009372998.1| PREDICTED: SKP1-like protein 1A isoform X2 [Pyrus x bretschneideri]
Length=154

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            ++K I LKSSD E FEVEE VA+ESQTIKHM+ED CA   IPLPNVTS ILAKVIEYC++
Sbjct  2    AAKKITLKSSDDEMFEVEEVVAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYCRK  61

Query  310  HVEAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIK  489
            H E    T    GE ++K +DA+F+K+DQ TL+DLI+AANYL+IK LLDLTCQTVADMIK
Sbjct  62   HREDEGAT-AADGEKNVKEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMIK  120

Query  490  GKTP  501
            GKTP
Sbjct  121  GKTP  124



>ref|XP_009413024.1| PREDICTED: SKP1-like protein 1A [Musa acuminata subsp. malaccensis]
Length=168

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 110/127 (87%), Gaps = 5/127 (4%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            + + LKSSDGE FEV EA A+ESQTI+HMIED CA++ IPLPNVTS+ILAKVIEYC +HV
Sbjct  12   RKVTLKSSDGEEFEVAEAAAMESQTIRHMIEDGCAESGIPLPNVTSRILAKVIEYCNKHV  71

Query  316  EAASKTEE-----KPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  480
            +A+SK+ E     +  +DDLK +DA+FVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD
Sbjct  72   DASSKSGEDGATGRVADDDLKAWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD  131

Query  481  MIKGKTP  501
            MIKGKTP
Sbjct  132  MIKGKTP  138



>emb|CCG34082.1| SCF ubiquitin ligase [uncultured eukaryote]
Length=158

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 102/128 (80%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  MSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYC  303
            M+    + LKSSD E F+  EAVA ESQTIK+MIED      IPLPNV+SKIL+KVIEYC
Sbjct  1    MARESKVSLKSSDDELFDATEAVAFESQTIKNMIEDTGTANAIPLPNVSSKILSKVIEYC  60

Query  304  KRHVEAASKTEEKPG--EDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVA  477
            K HVEA    +EK    ED++KT+D +FVKVDQATLFDLILAANYLNIK+LLDLTCQTVA
Sbjct  61   KFHVEAQKPADEKSAISEDEIKTWDQEFVKVDQATLFDLILAANYLNIKNLLDLTCQTVA  120

Query  478  DMIKGKTP  501
            DMIKGKTP
Sbjct  121  DMIKGKTP  128



>ref|XP_002867118.1| hypothetical protein ARALYDRAFT_912943 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43377.1| hypothetical protein ARALYDRAFT_912943 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 102/125 (82%), Gaps = 5/125 (4%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            SS MIVL SSDG++FEVEEAVA++SQTI HM+EDDCA   IPL NVTSK LAKVIEYCK+
Sbjct  2    SSTMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCAANGIPLANVTSKTLAKVIEYCKK  61

Query  310  HVEAASKTEEKP-GEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI  486
            H       E  P  ED+LK +D +F++ DQ+T+FDLILAANYLNIKSLLDLTCQT+ADMI
Sbjct  62   H----HVDEANPISEDELKKWDTEFMETDQSTIFDLILAANYLNIKSLLDLTCQTIADMI  117

Query  487  KGKTP  501
            KGK P
Sbjct  118  KGKNP  122



>gb|KFK35110.1| hypothetical protein AALP_AA5G237300 [Arabis alpina]
Length=162

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 107/131 (82%), Gaps = 7/131 (5%)
 Frame = +1

Query  130  SSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKR  309
            SSK IVLKSSDGE+FEV+EAVAL+SQTIKHMIEDDCA   IPLPNVT KILAKV+EYCK+
Sbjct  2    SSKKIVLKSSDGESFEVDEAVALQSQTIKHMIEDDCAGDGIPLPNVTGKILAKVVEYCKK  61

Query  310  HVEAASKTEEK----PGEDD--LKTFDADFVKV-DQATLFDLILAANYLNIKSLLDLTCQ  468
            HVE  ++  +K      E+D  LKT+D +F K  DQATLF++ILAANYLNI  LLDL C+
Sbjct  62   HVEVEAEGGDKDVYGSKEEDEALKTWDTEFAKTDDQATLFEIILAANYLNIGGLLDLMCK  121

Query  469  TVADMIKGKTP  501
            TVADM++GKTP
Sbjct  122  TVADMMRGKTP  132



>ref|XP_009372996.1| PREDICTED: SKP1-like protein 1A [Pyrus x bretschneideri]
Length=160

 Score =   175 bits (444),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = +1

Query  136  KMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTVIPLPNVTSKILAKVIEYCKRHV  315
            K I LKSSD E FEVEEAVA+ESQTIKHM+ED CA   IPLPNVTS ILAKVIEYC++H 
Sbjct  10   KKITLKSSDDEMFEVEEAVAMESQTIKHMVEDGCAGNAIPLPNVTSAILAKVIEYCRKHH  69

Query  316  EAASKTEEKPGEDDLKTFDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGK  495
            E    T    GE ++  +DA+F+K+DQ TL+DLI+AANYL+IK LLDLTCQTVADMIKGK
Sbjct  70   EDEGAT-AADGEKNVNEWDAEFMKIDQNTLYDLIMAANYLDIKGLLDLTCQTVADMIKGK  128

Query  496  TP  501
            TP
Sbjct  129  TP  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300