BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K23

Length=485
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606105.1|  PREDICTED: serine/threonine-protein kinase A...    221   8e-67   Nicotiana tomentosiformis
ref|XP_009801690.1|  PREDICTED: serine/threonine-protein kinase A...    218   8e-66   Nicotiana sylvestris
ref|XP_004249015.1|  PREDICTED: serine/threonine-protein kinase A...    217   2e-65   Solanum lycopersicum
ref|XP_006362327.1|  PREDICTED: serine/threonine-protein kinase A...    216   6e-65   Solanum tuberosum [potatoes]
ref|XP_008355748.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    199   5e-60   
ref|XP_008370313.1|  PREDICTED: serine/threonine-protein kinase A...    199   1e-58   
ref|XP_009370852.1|  PREDICTED: serine/threonine-protein kinase A...    199   1e-58   
ref|XP_004160326.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    198   4e-58   
ref|XP_008442306.1|  PREDICTED: serine/threonine-protein kinase A...    198   4e-58   Cucumis melo [Oriental melon]
ref|XP_004137666.1|  PREDICTED: serine/threonine-protein kinase A...    198   5e-58   Cucumis sativus [cucumbers]
gb|KGN58674.1|  hypothetical protein Csa_3G727920                       198   3e-57   Cucumis sativus [cucumbers]
ref|XP_009337839.1|  PREDICTED: serine/threonine-protein kinase A...    195   4e-57   Pyrus x bretschneideri [bai li]
ref|XP_008244257.1|  PREDICTED: serine/threonine-protein kinase A...    195   4e-57   Prunus mume [ume]
ref|XP_008388407.1|  PREDICTED: serine/threonine-protein kinase A...    192   4e-56   Malus domestica [apple tree]
emb|CDP06356.1|  unnamed protein product                                192   7e-56   Coffea canephora [robusta coffee]
ref|XP_010044463.1|  PREDICTED: serine/threonine-protein kinase A...    192   9e-56   
ref|XP_010278903.1|  PREDICTED: serine/threonine-protein kinase A...    189   7e-55   Nelumbo nucifera [Indian lotus]
ref|XP_011018915.1|  PREDICTED: serine/threonine-protein kinase A...    189   1e-54   Populus euphratica
gb|KDP21817.1|  hypothetical protein JCGZ_00604                         189   1e-54   Jatropha curcas
ref|XP_011006228.1|  PREDICTED: serine/threonine-protein kinase A...    189   2e-54   Populus euphratica
ref|XP_004302496.1|  PREDICTED: serine/threonine-protein kinase A...    188   2e-54   Fragaria vesca subsp. vesca
gb|EYU26701.1|  hypothetical protein MIMGU_mgv1a006846mg                188   2e-54   Erythranthe guttata [common monkey flower]
gb|EYU26700.1|  hypothetical protein MIMGU_mgv1a006846mg                188   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_011077494.1|  PREDICTED: serine/threonine-protein kinase A...    187   6e-54   Sesamum indicum [beniseed]
ref|XP_006429669.1|  hypothetical protein CICLE_v10011776mg             187   9e-54   Citrus clementina [clementine]
ref|XP_002519978.1|  Protein kinase APK1B, chloroplast precursor,...    188   1e-53   
ref|XP_007205277.1|  hypothetical protein PRUPE_ppa006509mg             186   2e-53   
ref|XP_007032290.1|  Kinase superfamily protein isoform 1               185   5e-53   
ref|XP_009606106.1|  PREDICTED: serine/threonine-protein kinase A...    184   7e-53   
gb|EPS64243.1|  hypothetical protein M569_10538                         182   3e-52   Genlisea aurea
ref|XP_009410482.1|  PREDICTED: serine/threonine-protein kinase A...    181   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381351.1|  PREDICTED: serine/threonine-protein kinase A...    181   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008804652.1|  PREDICTED: serine/threonine-protein kinase A...    179   5e-51   Phoenix dactylifera
ref|XP_010922836.1|  PREDICTED: serine/threonine-protein kinase A...    179   9e-51   Elaeis guineensis
tpg|DAA39303.1|  TPA: putative protein kinase superfamily protein       170   2e-50   
ref|XP_002450171.1|  hypothetical protein SORBIDRAFT_05g001450          176   7e-50   Sorghum bicolor [broomcorn]
ref|XP_006381288.1|  hypothetical protein POPTR_0006s11430g             176   9e-50   
ref|XP_002441774.1|  hypothetical protein SORBIDRAFT_08g002100          175   2e-49   
ref|XP_009383280.1|  PREDICTED: serine/threonine-protein kinase A...    173   1e-48   
dbj|BAK05812.1|  predicted protein                                      173   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA39302.1|  TPA: putative protein kinase superfamily protein       169   2e-48   
gb|EEC68754.1|  hypothetical protein OsI_37277                          171   4e-48   Oryza sativa Indica Group [Indian rice]
gb|EEE52663.1|  hypothetical protein OsJ_35037                          171   4e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579009.1|  PREDICTED: serine/threonine-protein kinase A...    171   8e-48   Brachypodium distachyon [annual false brome]
ref|NP_001065612.1|  Os11g0121400                                       171   1e-47   
ref|NP_001140687.1|  uncharacterized LOC100272762                       169   2e-47   Zea mays [maize]
ref|XP_006662686.1|  PREDICTED: serine/threonine-protein kinase A...    169   3e-47   
emb|CAQ58609.1|  ATP binding / kinase/ protein kinase/ protein se...    168   1e-46   Vitis vinifera
ref|XP_002265437.1|  PREDICTED: serine/threonine-protein kinase A...    168   1e-46   Vitis vinifera
emb|CBI31134.3|  unnamed protein product                                168   2e-46   Vitis vinifera
ref|XP_003577860.1|  PREDICTED: serine/threonine-protein kinase A...    166   3e-46   Brachypodium distachyon [annual false brome]
emb|CAN82885.1|  hypothetical protein VITISV_023156                     169   4e-46   Vitis vinifera
gb|EMT28395.1|  Putative serine/threonine-protein kinase NAK            162   1e-45   
gb|KJB27592.1|  hypothetical protein B456_005G001500                    162   3e-45   Gossypium raimondii
ref|NP_001065613.1|  Os11g0121500                                       156   5e-45   
gb|KJB27594.1|  hypothetical protein B456_005G001500                    163   8e-45   Gossypium raimondii
gb|AFW64654.1|  putative protein kinase superfamily protein             159   8e-45   
gb|KJB27591.1|  hypothetical protein B456_005G001500                    162   1e-44   Gossypium raimondii
ref|XP_010931422.1|  PREDICTED: serine/threonine-protein kinase A...    161   4e-44   Elaeis guineensis
ref|XP_007032291.1|  Kinase superfamily protein isoform 2               160   8e-44   
ref|NP_001149711.1|  serine/threonine-protein kinase NAK                159   1e-43   Zea mays [maize]
ref|XP_003534620.1|  PREDICTED: serine/threonine-protein kinase A...    159   3e-43   
ref|XP_008788035.1|  PREDICTED: serine/threonine-protein kinase A...    155   6e-43   Phoenix dactylifera
ref|XP_006842637.1|  hypothetical protein AMTR_s00077p00187600          155   4e-42   Amborella trichopoda
ref|XP_006602747.1|  PREDICTED: serine/threonine-protein kinase A...    156   6e-42   Glycine max [soybeans]
emb|CAQ58633.1|  ATP binding / serine-threonine kinase                  154   2e-41   Vitis vinifera
ref|XP_007140016.1|  hypothetical protein PHAVU_008G077200g             154   2e-41   Phaseolus vulgaris [French bean]
ref|XP_010922837.1|  PREDICTED: serine/threonine-protein kinase A...    154   2e-41   
gb|AFK33487.1|  unknown                                                 152   8e-41   Medicago truncatula
ref|XP_003623694.1|  Protein kinase 2B                                  152   8e-41   Medicago truncatula
ref|XP_010693044.1|  PREDICTED: serine/threonine-protein kinase A...    150   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010693043.1|  PREDICTED: serine/threonine-protein kinase A...    150   5e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009410484.1|  PREDICTED: serine/threonine-protein kinase A...    148   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010553184.1|  PREDICTED: serine/threonine-protein kinase A...    147   4e-39   Tarenaya hassleriana [spider flower]
gb|KFK24698.1|  hypothetical protein AALP_AA8G013200                    145   2e-38   Arabis alpina [alpine rockcress]
ref|XP_004492609.1|  PREDICTED: serine/threonine-protein kinase A...    145   5e-38   Cicer arietinum [garbanzo]
ref|XP_006279336.1|  hypothetical protein CARUB_v10012732mg             144   1e-37   Capsella rubella
ref|NP_195722.2|  serine/threonine-protein kinase                       143   3e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CAB99493.1|  protein kinase-like protein                            142   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872982.1|  kinase family protein                              142   4e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_006398549.1|  hypothetical protein EUTSA_v10013688mg             142   4e-37   Eutrema salsugineum [saltwater cress]
gb|ACN35685.1|  unknown                                                 142   6e-37   Zea mays [maize]
ref|XP_010424023.1|  PREDICTED: serine/threonine-protein kinase A...    139   4e-36   Camelina sativa [gold-of-pleasure]
gb|ACN35838.1|  unknown                                                 134   1e-35   Zea mays [maize]
gb|KJB27593.1|  hypothetical protein B456_005G001500                    137   2e-35   Gossypium raimondii
gb|ABA91212.1|  protein kinase family protein, putative                 132   8e-35   Oryza sativa Japonica Group [Japonica rice]
gb|EEE51545.1|  hypothetical protein OsJ_32755                          131   9e-35   Oryza sativa Japonica Group [Japonica rice]
gb|AFW64652.1|  putative protein kinase superfamily protein             134   2e-34   
ref|NP_001066022.2|  Os12g0121100                                       129   1e-32   
ref|XP_009133583.1|  PREDICTED: serine/threonine-protein kinase A...    129   3e-32   Brassica rapa
emb|CDX83496.1|  BnaA03g20100D                                          129   4e-32   
gb|ABR16273.1|  unknown                                                 127   1e-31   Picea sitchensis
ref|XP_002517790.1|  hypothetical protein RCOM_0964990                  114   2e-29   
emb|CDY68189.1|  BnaCnng57950D                                          120   2e-29   Brassica napus [oilseed rape]
ref|NP_001176324.1|  Os11g0121800                                       111   4e-27   
gb|ABA91216.1|  hypothetical protein LOC_Os11g02860                     105   5e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEE51546.1|  hypothetical protein OsJ_32758                          104   5e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011089173.1|  PREDICTED: probable receptor-like protein ki...  90.9    1e-18   Sesamum indicum [beniseed]
ref|XP_004504211.1|  PREDICTED: probable receptor-like protein ki...  89.4    4e-18   Cicer arietinum [garbanzo]
emb|CBI16559.3|  unnamed protein product                              86.3    3e-17   Vitis vinifera
ref|XP_002285747.1|  PREDICTED: probable receptor-like protein ki...  86.7    4e-17   Vitis vinifera
ref|NP_001058289.1|  Os06g0663200                                     87.4    4e-17   
ref|XP_003629925.1|  Protein kinase 2B                                87.0    4e-17   
gb|EAZ01978.1|  hypothetical protein OsI_24012                        87.4    4e-17   Oryza sativa Indica Group [Indian rice]
gb|AET04401.2|  receptor Serine/Threonine kinase                      86.7    4e-17   Medicago truncatula
gb|KHN48075.1|  Putative receptor-like protein kinase                 86.3    5e-17   Glycine soja [wild soybean]
gb|ACU18671.1|  unknown                                               86.3    5e-17   Glycine max [soybeans]
ref|NP_001239855.1|  probable receptor-like protein kinase At5g56...  86.3    5e-17   Glycine max [soybeans]
ref|XP_006445568.1|  hypothetical protein CICLE_v10015549mg           85.9    1e-16   Citrus clementina [clementine]
ref|XP_002523402.1|  Protein kinase APK1B, chloroplast precursor,...  85.5    1e-16   Ricinus communis
ref|XP_004228947.1|  PREDICTED: probable receptor-like protein ki...  85.5    1e-16   Solanum lycopersicum
ref|XP_008451006.1|  PREDICTED: probable receptor-like protein ki...  85.1    2e-16   Cucumis melo [Oriental melon]
ref|XP_004144068.1|  PREDICTED: probable receptor-like protein ki...  85.1    2e-16   Cucumis sativus [cucumbers]
ref|XP_008451007.1|  PREDICTED: probable receptor-like protein ki...  85.1    2e-16   Cucumis melo [Oriental melon]
ref|XP_008451005.1|  PREDICTED: probable receptor-like protein ki...  85.1    2e-16   Cucumis melo [Oriental melon]
ref|XP_008451004.1|  PREDICTED: probable receptor-like protein ki...  85.1    2e-16   
gb|KDP30626.1|  hypothetical protein JCGZ_16191                       84.7    2e-16   Jatropha curcas
ref|XP_010032846.1|  PREDICTED: probable receptor-like protein ki...  84.7    2e-16   Eucalyptus grandis [rose gum]
ref|XP_009339196.1|  PREDICTED: probable receptor-like protein ki...  84.0    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_007014086.1|  Kinase superfamily protein isoform 1             84.3    4e-16   Theobroma cacao [chocolate]
ref|XP_002303981.2|  kinase family protein                            84.0    4e-16   
emb|CAN77488.1|  hypothetical protein VITISV_020249                   83.6    5e-16   Vitis vinifera
dbj|BAK03343.1|  predicted protein                                    85.5    5e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007159552.1|  hypothetical protein PHAVU_002G247100g           83.2    6e-16   Phaseolus vulgaris [French bean]
ref|XP_010103098.1|  putative receptor-like protein kinase            83.6    7e-16   Morus notabilis
ref|XP_006656337.1|  PREDICTED: serine/threonine-protein kinase A...  84.0    8e-16   Oryza brachyantha
ref|XP_010536824.1|  PREDICTED: probable receptor-like protein ki...  83.2    9e-16   Tarenaya hassleriana [spider flower]
ref|XP_009376055.1|  PREDICTED: probable receptor-like protein ki...  82.8    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_004141437.1|  PREDICTED: putative receptor-like protein ki...  83.2    1e-15   Cucumis sativus [cucumbers]
ref|XP_009405653.1|  PREDICTED: probable receptor-like protein ki...  82.4    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY65103.1|  BnaAnng20210D                                        79.7    2e-15   Brassica napus [oilseed rape]
ref|XP_003563358.1|  PREDICTED: serine/threonine-protein kinase A...  82.8    2e-15   Brachypodium distachyon [annual false brome]
emb|CDY48175.1|  BnaA04g15390D                                        79.7    3e-15   Brassica napus [oilseed rape]
gb|KDO54485.1|  hypothetical protein CISIN_1g014189mg                 82.0    3e-15   Citrus sinensis [apfelsine]
gb|KHN06478.1|  Putative receptor-like protein kinase                 81.6    3e-15   Glycine soja [wild soybean]
ref|XP_003524997.1|  PREDICTED: probable receptor-like protein ki...  81.6    3e-15   Glycine max [soybeans]
ref|XP_008384377.1|  PREDICTED: probable receptor-like protein ki...  81.6    3e-15   
gb|KJB20549.1|  hypothetical protein B456_003G154000                  79.7    4e-15   Gossypium raimondii
ref|XP_006397106.1|  hypothetical protein EUTSA_v10028670mg           81.6    4e-15   Eutrema salsugineum [saltwater cress]
emb|CDP18581.1|  unnamed protein product                              81.3    5e-15   Coffea canephora [robusta coffee]
ref|XP_010276402.1|  PREDICTED: probable receptor-like protein ki...  80.9    5e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006359196.1|  PREDICTED: probable receptor-like protein ki...  80.9    5e-15   Solanum tuberosum [potatoes]
ref|XP_010032848.1|  PREDICTED: probable receptor-like protein ki...  80.5    5e-15   Eucalyptus grandis [rose gum]
ref|XP_009398617.1|  PREDICTED: serine/threonine-protein kinase A...  81.3    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010032847.1|  PREDICTED: probable receptor-like protein ki...  80.5    6e-15   Eucalyptus grandis [rose gum]
ref|XP_011025119.1|  PREDICTED: probable receptor-like protein ki...  80.9    6e-15   Populus euphratica
gb|KJB20547.1|  hypothetical protein B456_003G154000                  79.7    6e-15   Gossypium raimondii
gb|KDP40693.1|  hypothetical protein JCGZ_24692                       81.3    6e-15   Jatropha curcas
ref|XP_010917721.1|  PREDICTED: probable receptor-like protein ki...  80.5    6e-15   Elaeis guineensis
ref|XP_010541952.1|  PREDICTED: serine/threonine-protein kinase A...  81.3    7e-15   Tarenaya hassleriana [spider flower]
ref|XP_010651398.1|  PREDICTED: probable receptor-like protein ki...  80.1    8e-15   Vitis vinifera
gb|KJB20548.1|  hypothetical protein B456_003G154000                  79.7    9e-15   Gossypium raimondii
emb|CBI20734.3|  unnamed protein product                              80.5    1e-14   Vitis vinifera
ref|XP_002280196.1|  PREDICTED: serine/threonine-protein kinase A...  80.9    1e-14   Vitis vinifera
gb|KFK40688.1|  hypothetical protein AALP_AA2G028500                  80.5    1e-14   Arabis alpina [alpine rockcress]
ref|XP_009140739.1|  PREDICTED: serine/threonine-protein kinase A...  80.5    1e-14   Brassica rapa
gb|AAC69121.1|  putative protein kinase                               80.5    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010245737.1|  PREDICTED: serine/threonine-protein kinase A...  80.5    1e-14   Nelumbo nucifera [Indian lotus]
ref|NP_178731.2|  putative serine/threonine kinase                    80.5    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008797332.1|  PREDICTED: probable receptor-like protein ki...  79.3    1e-14   Phoenix dactylifera
ref|XP_009415296.1|  PREDICTED: probable receptor-like protein ki...  79.3    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010418127.1|  PREDICTED: serine/threonine-protein kinase A...  80.1    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_011089708.1|  PREDICTED: probable receptor-like protein ki...  79.3    2e-14   Sesamum indicum [beniseed]
gb|KJB20550.1|  hypothetical protein B456_003G154000                  79.7    2e-14   Gossypium raimondii
emb|CDO97843.1|  unnamed protein product                              80.1    2e-14   Coffea canephora [robusta coffee]
ref|XP_009419222.1|  PREDICTED: probable receptor-like protein ki...  79.3    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW76094.1|  putative protein kinase superfamily protein           77.0    2e-14   
gb|KJB20546.1|  hypothetical protein B456_003G154000                  79.3    2e-14   Gossypium raimondii
gb|KJB83342.1|  hypothetical protein B456_013G242000                  79.7    2e-14   Gossypium raimondii
ref|XP_008812837.1|  PREDICTED: probable receptor-like protein ki...  77.8    2e-14   Phoenix dactylifera
ref|XP_009124636.1|  PREDICTED: serine/threonine-protein kinase A...  79.3    3e-14   Brassica rapa
ref|XP_009785799.1|  PREDICTED: probable receptor-like protein ki...  79.0    3e-14   Nicotiana sylvestris
gb|EMT12212.1|  Protein kinase APK1B, chloroplastic                   80.5    3e-14   
ref|XP_006302292.1|  hypothetical protein CARUB_v10020339mg           79.3    3e-14   Capsella rubella
ref|XP_009124635.1|  PREDICTED: serine/threonine-protein kinase A...  79.3    3e-14   Brassica rapa
ref|XP_004294946.1|  PREDICTED: probable receptor-like protein ki...  79.0    3e-14   Fragaria vesca subsp. vesca
ref|XP_008221745.1|  PREDICTED: probable receptor-like protein ki...  79.0    3e-14   Prunus mume [ume]
ref|XP_010245738.1|  PREDICTED: serine/threonine-protein kinase A...  79.3    3e-14   Nelumbo nucifera [Indian lotus]
gb|EYU32831.1|  hypothetical protein MIMGU_mgv1a008384mg              78.6    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_004965638.1|  PREDICTED: serine/threonine-protein kinase A...  79.3    4e-14   Setaria italica
ref|XP_008452794.1|  PREDICTED: putative receptor-like protein ki...  79.0    4e-14   Cucumis melo [Oriental melon]
gb|KFK39078.1|  hypothetical protein AALP_AA3G198000                  79.0    4e-14   Arabis alpina [alpine rockcress]
emb|CDY47586.1|  BnaA01g22720D                                        78.6    5e-14   Brassica napus [oilseed rape]
ref|XP_010473366.1|  PREDICTED: serine/threonine-protein kinase A...  78.6    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006826299.1|  hypothetical protein AMTR_s00004p00068890        78.2    5e-14   
ref|XP_006294280.1|  hypothetical protein CARUB_v10023277mg           78.6    6e-14   Capsella rubella
ref|XP_006850988.1|  hypothetical protein AMTR_s00025p00212270        79.0    6e-14   Amborella trichopoda
ref|XP_010540703.1|  PREDICTED: serine/threonine-protein kinase A...  78.6    6e-14   Tarenaya hassleriana [spider flower]
emb|CDY26353.1|  BnaA03g60290D                                        78.2    6e-14   Brassica napus [oilseed rape]
ref|XP_009104830.1|  PREDICTED: serine/threonine-protein kinase A...  78.2    6e-14   Brassica rapa
ref|XP_007205337.1|  hypothetical protein PRUPE_ppa007026mg           77.8    6e-14   Prunus persica
ref|XP_010429651.1|  PREDICTED: serine/threonine-protein kinase A...  78.2    7e-14   Camelina sativa [gold-of-pleasure]
gb|KDP40692.1|  hypothetical protein JCGZ_24691                       77.8    8e-14   Jatropha curcas
ref|XP_006391990.1|  hypothetical protein EUTSA_v10023477mg           77.8    8e-14   Eutrema salsugineum [saltwater cress]
ref|XP_002516154.1|  Protein kinase APK1A, chloroplast precursor,...  78.2    8e-14   Ricinus communis
gb|AAS20959.1|  tyrosine kinase                                       75.9    8e-14   Hyacinthus orientalis [common hyacinth]
emb|CDY03843.1|  BnaC01g29600D                                        76.6    8e-14   
ref|NP_001168686.1|  uncharacterized LOC100382475                     78.2    9e-14   Zea mays [maize]
ref|XP_006408733.1|  hypothetical protein EUTSA_v10002210mg           77.8    9e-14   
ref|XP_010913798.1|  PREDICTED: serine/threonine-protein kinase A...  77.8    9e-14   Elaeis guineensis
ref|XP_010472657.1|  PREDICTED: serine/threonine-protein kinase A...  75.9    1e-13   Camelina sativa [gold-of-pleasure]
gb|KDO73664.1|  hypothetical protein CISIN_1g040050mg                 77.4    1e-13   Citrus sinensis [apfelsine]
ref|XP_009623825.1|  PREDICTED: probable receptor-like protein ki...  77.4    1e-13   Nicotiana tomentosiformis
ref|XP_006452974.1|  hypothetical protein CICLE_v10010608mg           77.4    1e-13   
ref|XP_006474675.1|  PREDICTED: putative receptor-like protein ki...  77.4    1e-13   
ref|XP_006408732.1|  hypothetical protein EUTSA_v10002290mg           77.4    1e-13   
ref|XP_010417417.1|  PREDICTED: serine/threonine-protein kinase A...  77.4    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_011036441.1|  PREDICTED: putative receptor-like protein ki...  77.4    1e-13   Populus euphratica
ref|NP_001150204.1|  protein kinase APK1B                             77.4    1e-13   Zea mays [maize]
ref|XP_002304131.1|  hypothetical protein POPTR_0003s06450g           77.4    1e-13   
gb|KJB07389.1|  hypothetical protein B456_001G019500                  77.4    1e-13   Gossypium raimondii
ref|XP_010261848.1|  PREDICTED: serine/threonine-protein kinase A...  77.4    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_011010264.1|  PREDICTED: serine/threonine-protein kinase A...  77.4    2e-13   Populus euphratica
ref|NP_180197.1|  root-specific kinase 1                              77.0    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019948.1|  PREDICTED: serine/threonine-protein kinase A...  77.4    2e-13   Populus euphratica
gb|KJB83341.1|  hypothetical protein B456_013G242000                  76.6    2e-13   Gossypium raimondii
gb|KJB07390.1|  hypothetical protein B456_001G019500                  77.0    2e-13   Gossypium raimondii
ref|XP_002297616.2|  kinase family protein                            76.6    2e-13   
ref|XP_002886527.1|  hypothetical protein ARALYDRAFT_475168           77.0    2e-13   
ref|XP_010098385.1|  Serine/threonine-protein kinase                  77.0    2e-13   Morus notabilis
gb|AAA81538.1|  serine/threonine protein kinase                       77.0    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KDP34015.1|  hypothetical protein JCGZ_07586                       76.6    2e-13   Jatropha curcas
ref|XP_010548490.1|  PREDICTED: serine/threonine-protein kinase A...  76.6    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_002880775.1|  root-specific kinase 1                           76.6    2e-13   
ref|XP_006586718.1|  PREDICTED: serine/threonine-protein kinase A...  76.6    2e-13   Glycine max [soybeans]
ref|XP_010928728.1|  PREDICTED: serine/threonine-protein kinase A...  76.3    2e-13   
ref|XP_011010263.1|  PREDICTED: serine/threonine-protein kinase A...  77.0    3e-13   Populus euphratica
ref|XP_011010265.1|  PREDICTED: serine/threonine-protein kinase A...  77.0    3e-13   Populus euphratica
ref|XP_011019949.1|  PREDICTED: serine/threonine-protein kinase A...  76.6    3e-13   Populus euphratica
ref|XP_011019947.1|  PREDICTED: serine/threonine-protein kinase A...  76.6    3e-13   Populus euphratica
ref|XP_010928727.1|  PREDICTED: serine/threonine-protein kinase A...  76.3    3e-13   
ref|NP_001240045.1|  serine/threonine-protein kinase At5g01020-like   76.3    3e-13   Glycine max [soybeans]
gb|AAL87287.1|  putative protein kinase                               76.6    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008789617.1|  PREDICTED: serine/threonine-protein kinase A...  75.9    3e-13   Phoenix dactylifera
ref|XP_008802464.1|  PREDICTED: serine/threonine-protein kinase A...  76.3    3e-13   
ref|XP_006849707.1|  hypothetical protein AMTR_s00024p00242070        76.3    3e-13   
ref|XP_010467147.1|  PREDICTED: serine/threonine-protein kinase A...  76.3    3e-13   
gb|KDO73358.1|  hypothetical protein CISIN_1g046893mg                 76.6    3e-13   Citrus sinensis [apfelsine]
ref|XP_010490188.1|  PREDICTED: serine/threonine-protein kinase A...  74.7    3e-13   
ref|XP_002438802.1|  hypothetical protein SORBIDRAFT_10g026500        76.6    3e-13   Sorghum bicolor [broomcorn]
ref|XP_006453166.1|  hypothetical protein CICLE_v10008173mg           76.6    3e-13   Citrus clementina [clementine]
ref|XP_006453165.1|  hypothetical protein CICLE_v10008173mg           76.6    3e-13   
ref|XP_009410246.1|  PREDICTED: serine/threonine-protein kinase A...  75.9    4e-13   
ref|XP_009381911.1|  PREDICTED: serine/threonine-protein kinase A...  75.1    4e-13   
ref|XP_010413117.1|  PREDICTED: serine/threonine-protein kinase A...  75.9    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_011017590.1|  PREDICTED: serine/threonine-protein kinase A...  76.3    5e-13   Populus euphratica
ref|XP_003516498.1|  PREDICTED: serine/threonine-protein kinase A...  75.9    5e-13   Glycine max [soybeans]
ref|XP_006372245.1|  hypothetical protein POPTR_0018s14590g           76.3    5e-13   
ref|XP_011017591.1|  PREDICTED: serine/threonine-protein kinase A...  76.3    5e-13   Populus euphratica
gb|KHG06266.1|  hypothetical protein F383_01154                       75.9    5e-13   Gossypium arboreum [tree cotton]
ref|XP_007138656.1|  hypothetical protein PHAVU_009G2270000g          73.9    5e-13   Phaseolus vulgaris [French bean]
ref|XP_008781709.1|  PREDICTED: serine/threonine-protein kinase A...  75.9    6e-13   Phoenix dactylifera
ref|XP_008781710.1|  PREDICTED: serine/threonine-protein kinase A...  75.5    6e-13   Phoenix dactylifera
gb|KHN41751.1|  Serine/threonine-protein kinase                       75.5    6e-13   Glycine soja [wild soybean]
ref|XP_006279410.1|  hypothetical protein CARUB_v10007944mg           75.5    6e-13   Capsella rubella
ref|XP_006279409.1|  hypothetical protein CARUB_v10007944mg           75.5    6e-13   Capsella rubella
gb|KDP27741.1|  hypothetical protein JCGZ_19770                       75.5    7e-13   Jatropha curcas
ref|XP_006426670.1|  hypothetical protein CICLE_v10025595mg           75.5    7e-13   Citrus clementina [clementine]
gb|KJB65394.1|  hypothetical protein B456_010G093000                  75.1    8e-13   Gossypium raimondii
ref|NP_176353.1|  putative receptor-like cytoplasmic kinase           75.1    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152853.1|  PREDICTED: serine/threonine-protein kinase A...  74.7    8e-13   Cucumis sativus [cucumbers]
ref|XP_002516271.1|  Protein kinase APK1B, chloroplast precursor,...  75.1    9e-13   Ricinus communis
ref|XP_010413118.1|  PREDICTED: serine/threonine-protein kinase A...  75.1    9e-13   Camelina sativa [gold-of-pleasure]
ref|XP_011019325.1|  PREDICTED: serine/threonine-protein kinase A...  74.7    1e-12   Populus euphratica
ref|NP_200457.1|  probable receptor-like protein kinase               74.3    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010669600.1|  PREDICTED: serine/threonine-protein kinase A...  74.7    2e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG16114.1|  hypothetical protein F383_07817                       74.3    2e-12   Gossypium arboreum [tree cotton]
gb|KHG06741.1|  hypothetical protein F383_33276                       74.3    2e-12   Gossypium arboreum [tree cotton]
ref|XP_002309029.1|  hypothetical protein POPTR_0006s07940g           74.7    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010932748.1|  PREDICTED: probable receptor-like protein ki...  73.6    2e-12   Elaeis guineensis
ref|XP_010533019.1|  PREDICTED: serine/threonine-protein kinase A...  74.3    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_004985627.1|  PREDICTED: probable receptor-like protein ki...  73.6    2e-12   Setaria italica
ref|XP_011035727.1|  PREDICTED: putative receptor-like protein ki...  73.9    2e-12   Populus euphratica
ref|XP_008450489.1|  PREDICTED: serine/threonine-protein kinase A...  73.6    2e-12   Cucumis melo [Oriental melon]
ref|XP_010656713.1|  PREDICTED: serine/threonine-protein kinase A...  73.9    2e-12   Vitis vinifera
ref|XP_006369136.1|  hypothetical protein POPTR_0001s16810g           73.9    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_002864456.1|  hypothetical protein ARALYDRAFT_331952           73.6    2e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_002519898.1|  receptor serine-threonine protein kinase, pu...  73.6    3e-12   
ref|XP_009801603.1|  PREDICTED: serine/threonine-protein kinase A...  73.6    3e-12   Nicotiana sylvestris
ref|XP_003523655.1|  PREDICTED: serine/threonine-protein kinase A...  73.2    3e-12   
ref|XP_002309457.2|  hypothetical protein POPTR_0006s23590g           73.6    3e-12   
ref|XP_004252518.1|  PREDICTED: putative receptor-like protein ki...  73.6    3e-12   
ref|XP_009598888.1|  PREDICTED: serine/threonine-protein kinase A...  73.2    3e-12   
ref|XP_009408069.1|  PREDICTED: serine/threonine-protein kinase A...  73.2    3e-12   
ref|XP_009392754.1|  PREDICTED: serine/threonine-protein kinase A...  73.6    4e-12   
emb|CBW30202.1|  Protein kinase APK1B                                 73.2    4e-12   
emb|CDX86877.1|  BnaA09g22670D                                        73.2    4e-12   
ref|XP_007012454.1|  Root-specific kinase 1                           73.2    4e-12   
ref|XP_010666301.1|  PREDICTED: serine/threonine-protein kinase A...  73.2    4e-12   
ref|XP_006649431.1|  PREDICTED: probable receptor-like protein ki...  72.4    5e-12   
ref|XP_006361336.1|  PREDICTED: putative receptor-like protein ki...  72.8    5e-12   
ref|XP_003547504.1|  PREDICTED: serine/threonine-protein kinase A...  73.2    5e-12   
ref|XP_002885827.1|  hypothetical protein ARALYDRAFT_480233           72.8    5e-12   
gb|KHN06069.1|  Serine/threonine-protein kinase                       73.2    5e-12   
ref|XP_010412805.1|  PREDICTED: serine/threonine-protein kinase A...  72.8    5e-12   
ref|XP_009392361.1|  PREDICTED: probable receptor-like protein ki...  72.8    5e-12   
ref|XP_010488785.1|  PREDICTED: serine/threonine-protein kinase A...  72.8    6e-12   
ref|XP_010488784.1|  PREDICTED: serine/threonine-protein kinase A...  72.8    6e-12   
ref|NP_178651.1|  RPM1-induced protein kinase                         72.8    6e-12   
ref|XP_010467109.1|  PREDICTED: serine/threonine-protein kinase A...  72.8    6e-12   
gb|KJB57039.1|  hypothetical protein B456_009G146200                  72.8    6e-12   
ref|XP_007158107.1|  hypothetical protein PHAVU_002G124700g           72.4    6e-12   
ref|XP_002468472.1|  hypothetical protein SORBIDRAFT_01g046520        72.0    7e-12   
gb|KFK27216.1|  hypothetical protein AALP_AA8G352500                  72.4    7e-12   
ref|XP_010933044.1|  PREDICTED: serine/threonine-protein kinase A...  72.4    7e-12   
ref|XP_008242244.1|  PREDICTED: serine/threonine-protein kinase A...  72.4    7e-12   
ref|XP_010090162.1|  Serine/threonine-protein kinase                  72.4    8e-12   
gb|KFK22322.1|  hypothetical protein AALP_AAs55656U000100             72.4    8e-12   
ref|XP_006297624.1|  hypothetical protein CARUB_v10013644mg           72.4    8e-12   
ref|XP_010046876.1|  PREDICTED: serine/threonine-protein kinase A...  72.4    8e-12   
ref|XP_010049411.1|  PREDICTED: serine/threonine-protein kinase A...  72.4    8e-12   
gb|KCW78588.1|  hypothetical protein EUGRSUZ_C00060                   72.4    9e-12   
ref|XP_011046009.1|  PREDICTED: serine/threonine-protein kinase A...  72.4    9e-12   
ref|XP_010443299.1|  PREDICTED: probable receptor-like protein ki...  72.0    9e-12   
ref|XP_006395963.1|  hypothetical protein EUTSA_v10004211mg           72.0    9e-12   
gb|KJB74833.1|  hypothetical protein B456_012G009800                  72.0    9e-12   
ref|XP_009370035.1|  PREDICTED: serine/threonine-protein kinase A...  72.0    9e-12   
ref|XP_006381619.1|  kinase family protein                            72.0    1e-11   
ref|XP_003527759.1|  PREDICTED: serine/threonine-protein kinase A...  71.6    1e-11   
gb|KHG16004.1|  hypothetical protein F383_02714                       72.0    1e-11   
emb|CBI24068.3|  unnamed protein product                              72.0    1e-11   
gb|KHN32159.1|  Serine/threonine-protein kinase                       71.6    1e-11   
gb|EYU25990.1|  hypothetical protein MIMGU_mgv1a020767mg              70.1    1e-11   
ref|XP_010483123.1|  PREDICTED: probable receptor-like protein ki...  71.6    1e-11   
ref|XP_004287640.1|  PREDICTED: serine/threonine-protein kinase A...  72.0    1e-11   
gb|KFK39885.1|  hypothetical protein AALP_AA3G301300                  72.0    1e-11   
ref|XP_004507998.1|  PREDICTED: putative receptor-like protein ki...  72.0    1e-11   
ref|XP_010244204.1|  PREDICTED: serine/threonine-protein kinase A...  71.6    1e-11   
gb|KHN22814.1|  Putative serine/threonine-protein kinase NAK          70.5    1e-11   
ref|XP_002885808.1|  hypothetical protein ARALYDRAFT_899389           72.0    1e-11   
gb|KDP39727.1|  hypothetical protein JCGZ_02747                       71.6    1e-11   
ref|XP_003612555.1|  Protein kinase 2B                                71.6    1e-11   
ref|XP_003533786.2|  PREDICTED: serine/threonine-protein kinase A...  72.0    1e-11   
ref|XP_009120160.1|  PREDICTED: probable receptor-like protein ki...  71.6    1e-11   
gb|KHN12282.1|  Serine/threonine-protein kinase                       72.0    1e-11   
ref|XP_006396126.1|  hypothetical protein EUTSA_v10002520mg           72.0    1e-11   
ref|XP_009120159.1|  PREDICTED: probable receptor-like protein ki...  71.6    1e-11   
gb|EMT21896.1|  Protein kinase APK1A, chloroplastic                   70.9    1e-11   
ref|XP_009345282.1|  PREDICTED: serine/threonine-protein kinase A...  71.6    1e-11   
ref|XP_010095204.1|  Serine/threonine-protein kinase                  72.0    1e-11   
ref|XP_010451185.1|  PREDICTED: probable receptor-like protein ki...  71.2    1e-11   
emb|CDY47750.1|  BnaCnng15410D                                        71.6    1e-11   
emb|CDY32778.1|  BnaA10g10710D                                        71.6    1e-11   
ref|XP_006465911.1|  PREDICTED: putative receptor-like protein ki...  71.2    2e-11   
ref|XP_009388437.1|  PREDICTED: serine/threonine-protein kinase A...  71.2    2e-11   
gb|KEH32432.1|  receptor-like kinase                                  71.6    2e-11   
ref|XP_006465910.1|  PREDICTED: putative receptor-like protein ki...  71.6    2e-11   
ref|XP_009411289.1|  PREDICTED: probable receptor-like protein ki...  70.9    2e-11   
ref|XP_008450497.1|  PREDICTED: serine/threonine-protein kinase A...  70.9    2e-11   
ref|XP_004163061.1|  PREDICTED: serine/threonine-protein kinase A...  70.9    2e-11   
emb|CAN69043.1|  hypothetical protein VITISV_022341                   71.2    2e-11   
ref|XP_009124269.1|  PREDICTED: serine/threonine-protein kinase A...  71.2    2e-11   
ref|XP_002265959.2|  PREDICTED: serine/threonine-protein kinase A...  71.2    2e-11   
ref|XP_010450389.1|  PREDICTED: serine/threonine-protein kinase A...  71.2    2e-11   
ref|XP_004512358.1|  PREDICTED: serine/threonine-protein kinase A...  70.9    2e-11   
gb|KDP33918.1|  hypothetical protein JCGZ_07489                       71.2    2e-11   
ref|XP_009800306.1|  PREDICTED: serine/threonine-protein kinase A...  70.9    3e-11   
ref|XP_006281761.1|  hypothetical protein CARUB_v10027923mg           70.5    3e-11   
ref|XP_010435442.1|  PREDICTED: serine/threonine-protein kinase A...  70.9    3e-11   
ref|XP_010112273.1|  Serine/threonine-protein kinase                  70.9    3e-11   
ref|XP_003530528.1|  PREDICTED: serine/threonine-protein kinase A...  70.5    3e-11   
ref|XP_010673456.1|  PREDICTED: probable receptor-like protein ki...  70.5    3e-11   
ref|XP_011082139.1|  PREDICTED: serine/threonine-protein kinase A...  70.5    3e-11   
ref|XP_004245036.1|  PREDICTED: serine/threonine-protein kinase A...  70.5    3e-11   
ref|XP_006401315.1|  hypothetical protein EUTSA_v10015701mg           70.5    3e-11   
ref|XP_009362032.1|  PREDICTED: serine/threonine-protein kinase A...  70.5    3e-11   
ref|XP_006580500.1|  PREDICTED: serine/threonine-protein kinase A...  70.1    3e-11   
ref|XP_009599916.1|  PREDICTED: putative receptor-like protein ki...  70.5    3e-11   
ref|XP_007040918.1|  Kinase superfamily protein                       70.5    3e-11   
ref|XP_010049350.1|  PREDICTED: serine/threonine-protein kinase A...  70.5    4e-11   
emb|CAN82003.1|  hypothetical protein VITISV_023198                   70.5    4e-11   
ref|XP_006353843.1|  PREDICTED: serine/threonine-protein kinase A...  70.5    4e-11   
ref|XP_003548706.1|  PREDICTED: serine/threonine-protein kinase A...  70.1    4e-11   
ref|XP_009362034.1|  PREDICTED: serine/threonine-protein kinase A...  70.1    4e-11   
gb|KJB21008.1|  hypothetical protein B456_003G177700                  70.1    5e-11   
gb|KDO46394.1|  hypothetical protein CISIN_1g014736mg                 70.1    5e-11   
gb|KJB21927.1|  hypothetical protein B456_004G022200                  70.1    5e-11   
ref|XP_009127940.1|  PREDICTED: putative receptor-like protein ki...  70.1    5e-11   
ref|XP_006432865.1|  hypothetical protein CICLE_v10003320mg           70.1    5e-11   
ref|XP_003525321.1|  PREDICTED: serine/threonine-protein kinase A...  69.7    5e-11   
ref|XP_009128724.1|  PREDICTED: serine/threonine-protein kinase A...  70.1    5e-11   
ref|XP_007203720.1|  hypothetical protein PRUPE_ppa019028mg           69.7    5e-11   
emb|CDX94273.1|  BnaC02g29330D                                        69.7    5e-11   
emb|CDY41127.1|  BnaA02g23490D                                        69.7    6e-11   
ref|XP_006368257.1|  kinase family protein                            69.7    6e-11   
ref|XP_006452809.1|  hypothetical protein CICLE_v10008248mg           69.7    6e-11   
ref|XP_008657974.1|  PREDICTED: uncharacterized LOC100193907 isof...  68.6    6e-11   
emb|CDY66556.1|  BnaCnng51430D                                        69.7    6e-11   
ref|XP_004488084.1|  PREDICTED: putative receptor-like protein ki...  69.7    6e-11   
ref|XP_010440738.1|  PREDICTED: serine/threonine-protein kinase A...  69.7    6e-11   
emb|CDY33401.1|  BnaA07g04380D                                        69.7    6e-11   
emb|CDP14231.1|  unnamed protein product                              69.7    6e-11   
ref|XP_009359732.1|  PREDICTED: serine/threonine-protein kinase A...  69.7    7e-11   
ref|XP_010541992.1|  PREDICTED: serine/threonine-protein kinase A...  69.7    7e-11   
ref|XP_009102353.1|  PREDICTED: serine/threonine-protein kinase A...  69.7    7e-11   
ref|XP_002277991.1|  PREDICTED: serine/threonine-protein kinase A...  69.7    7e-11   
gb|KJB82991.1|  hypothetical protein B456_013G224000                  69.7    7e-11   
gb|KJB82992.1|  hypothetical protein B456_013G224000                  69.7    7e-11   
dbj|BAK00266.1|  predicted protein                                    69.3    7e-11   
ref|XP_008337855.1|  PREDICTED: serine/threonine-protein kinase A...  69.7    7e-11   
emb|CDY65349.1|  BnaCnng46760D                                        69.3    8e-11   
ref|XP_008802984.1|  PREDICTED: serine/threonine-protein kinase A...  69.3    8e-11   
ref|XP_007012630.1|  Kinase superfamily protein                       69.3    8e-11   
ref|XP_006474726.1|  PREDICTED: serine/threonine-protein kinase A...  69.3    8e-11   
gb|KDO73907.1|  hypothetical protein CISIN_1g012832mg                 69.3    8e-11   
emb|CDP16592.1|  unnamed protein product                              69.3    8e-11   
ref|XP_011018376.1|  PREDICTED: serine/threonine-protein kinase A...  69.3    9e-11   
ref|XP_007136898.1|  hypothetical protein PHAVU_009G083300g           67.8    9e-11   
ref|XP_004503560.1|  PREDICTED: serine/threonine-protein kinase A...  68.9    9e-11   
ref|XP_011027996.1|  PREDICTED: serine/threonine-protein kinase A...  68.9    9e-11   
ref|XP_004503561.1|  PREDICTED: serine/threonine-protein kinase A...  68.9    1e-10   
emb|CDX96417.1|  BnaA07g30280D                                        69.3    1e-10   
gb|EYU26564.1|  hypothetical protein MIMGU_mgv1a006383mg              68.9    1e-10   
ref|XP_006282611.1|  hypothetical protein CARUB_v10004829mg           68.9    1e-10   
ref|XP_004300399.1|  PREDICTED: serine/threonine-protein kinase A...  68.9    1e-10   
ref|XP_002522939.1|  Protein kinase APK1B, chloroplast precursor,...  68.9    1e-10   
ref|XP_006353761.1|  PREDICTED: serine/threonine-protein kinase A...  68.9    1e-10   
ref|XP_010428693.1|  PREDICTED: probable serine/threonine-protein...  68.9    1e-10   
ref|XP_009343208.1|  PREDICTED: serine/threonine-protein kinase A...  68.6    1e-10   
ref|XP_011072653.1|  PREDICTED: putative receptor-like protein ki...  68.9    1e-10   
ref|NP_001049027.1|  Os03g0159100                                     68.6    1e-10   
ref|XP_008220586.1|  PREDICTED: serine/threonine-protein kinase A...  68.6    1e-10   
ref|XP_004243677.1|  PREDICTED: serine/threonine-protein kinase A...  68.6    1e-10   
ref|XP_002868426.1|  hypothetical protein ARALYDRAFT_355547           68.6    1e-10   
ref|XP_004246044.1|  PREDICTED: serine/threonine-protein kinase A...  68.6    2e-10   
ref|XP_009371832.1|  PREDICTED: serine/threonine-protein kinase A...  68.6    2e-10   
gb|EPS67912.1|  hypothetical protein M569_06861                       68.2    2e-10   
gb|KJB54494.1|  hypothetical protein B456_009G036100                  68.6    2e-10   
ref|NP_001132451.1|  uncharacterized LOC100193907                     68.2    2e-10   
ref|XP_002521318.1|  Protein kinase APK1B, chloroplast precursor,...  68.6    2e-10   
ref|XP_007024642.1|  Kinase superfamily protein                       68.6    2e-10   
ref|XP_010471786.1|  PREDICTED: probable serine/threonine-protein...  68.6    2e-10   
ref|XP_006363868.1|  PREDICTED: serine/threonine-protein kinase A...  68.6    2e-10   
ref|XP_007223042.1|  hypothetical protein PRUPE_ppa006919mg           68.2    2e-10   
gb|AFK35776.1|  unknown                                               66.2    2e-10   
ref|XP_008351370.1|  PREDICTED: serine/threonine-protein kinase A...  67.0    2e-10   
ref|XP_010537625.1|  PREDICTED: putative receptor-like protein ki...  68.2    2e-10   
ref|XP_008373497.1|  PREDICTED: serine/threonine-protein kinase A...  68.2    2e-10   
ref|XP_008360478.1|  PREDICTED: serine/threonine-protein kinase A...  68.2    2e-10   
gb|KHG00343.1|  hypothetical protein F383_18271                       68.2    2e-10   
dbj|BAB09992.1|  serine/threonine protein kinase-like                 68.2    2e-10   
ref|XP_009600575.1|  PREDICTED: serine/threonine-protein kinase A...  68.2    2e-10   
emb|CDP03082.1|  unnamed protein product                              68.2    2e-10   
ref|XP_007216399.1|  hypothetical protein PRUPE_ppa022600mg           68.2    2e-10   
gb|AAN06845.1|  Putative protein kinase                               67.4    2e-10   
ref|XP_010416550.1|  PREDICTED: probable serine/threonine-protein...  68.2    2e-10   
ref|XP_007136897.1|  hypothetical protein PHAVU_009G083300g           67.8    2e-10   
ref|XP_008351966.1|  PREDICTED: probable receptor-like protein ki...  67.0    2e-10   
ref|NP_198408.2|  Ser/Thr protein kinase ACIK1b                       68.2    3e-10   
ref|XP_007014087.1|  Kinase superfamily protein isoform 2             67.4    3e-10   
gb|AAP03880.2|  Avr9/Cf-9 induced kinase 1                            67.8    3e-10   
ref|XP_009113594.1|  PREDICTED: serine/threonine-protein kinase A...  67.8    3e-10   
gb|EMT29813.1|  Protein kinase APK1B, chloroplastic                   67.4    3e-10   
ref|XP_009769768.1|  PREDICTED: serine/threonine-protein kinase A...  67.8    3e-10   
ref|XP_009105915.1|  PREDICTED: putative receptor-like protein ki...  67.8    3e-10   
emb|CDX72925.1|  BnaC06g33730D                                        67.8    3e-10   
ref|XP_010939901.1|  PREDICTED: serine/threonine-protein kinase A...  67.8    3e-10   
dbj|BAD94092.1|  serine/threonine protein kinase-like                 67.8    3e-10   
ref|XP_009612481.1|  PREDICTED: putative receptor-like protein ki...  67.8    3e-10   
ref|XP_009390860.1|  PREDICTED: serine/threonine-protein kinase A...  67.8    3e-10   
ref|XP_004149002.1|  PREDICTED: serine/threonine-protein kinase A...  67.4    3e-10   
ref|XP_007154576.1|  hypothetical protein PHAVU_003G130400g           67.8    3e-10   
ref|XP_010056140.1|  PREDICTED: serine/threonine-protein kinase A...  67.4    3e-10   
ref|XP_002303478.1|  kinase family protein                            67.4    3e-10   
ref|XP_009390859.1|  PREDICTED: serine/threonine-protein kinase A...  67.4    3e-10   
ref|XP_008238029.1|  PREDICTED: serine/threonine-protein kinase A...  67.4    3e-10   
gb|KEH21307.1|  Serine/Threonine kinase family protein                67.4    3e-10   
ref|XP_009395875.1|  PREDICTED: serine/threonine-protein kinase A...  67.8    4e-10   
ref|XP_007211110.1|  hypothetical protein PRUPE_ppa024820mg           67.4    4e-10   
ref|XP_011464693.1|  PREDICTED: serine/threonine-protein kinase A...  67.4    4e-10   
ref|XP_007014619.1|  Kinase superfamily protein                       67.0    4e-10   
ref|XP_009610758.1|  PREDICTED: putative receptor-like protein ki...  67.4    4e-10   
ref|XP_009409118.1|  PREDICTED: serine/threonine-protein kinase A...  67.4    4e-10   
ref|XP_004299749.1|  PREDICTED: serine/threonine-protein kinase A...  67.4    4e-10   
ref|XP_010047471.1|  PREDICTED: serine/threonine-protein kinase A...  67.4    4e-10   
gb|KHG02002.1|  Protein kinase APK1A, chloroplastic -like protein     64.3    4e-10   
ref|XP_008223936.1|  PREDICTED: serine/threonine-protein kinase A...  67.0    5e-10   
ref|XP_007160211.1|  hypothetical protein PHAVU_002G302300g           66.6    5e-10   
ref|XP_009762767.1|  PREDICTED: putative receptor-like protein ki...  67.0    5e-10   
ref|XP_009786277.1|  PREDICTED: serine/threonine-protein kinase A...  67.0    5e-10   
ref|XP_008451906.1|  PREDICTED: serine/threonine-protein kinase A...  67.0    5e-10   
ref|XP_008223935.1|  PREDICTED: serine/threonine-protein kinase A...  67.0    5e-10   
gb|KFK41680.1|  hypothetical protein AALP_AA2G158900                  67.0    6e-10   
ref|XP_003542362.1|  PREDICTED: putative receptor-like protein ki...  67.0    6e-10   
ref|XP_004157966.1|  PREDICTED: putative receptor-like protein ki...  66.2    6e-10   
ref|XP_011094012.1|  PREDICTED: serine/threonine-protein kinase A...  66.6    7e-10   
ref|XP_004141072.1|  PREDICTED: putative receptor-like protein ki...  66.2    7e-10   
ref|XP_009618425.1|  PREDICTED: serine/threonine-protein kinase A...  66.6    7e-10   
gb|KGN60504.1|  hypothetical protein Csa_2G000130                     66.2    7e-10   
dbj|BAE71262.1|  putative protein kinase APK1A                        66.2    7e-10   
ref|XP_008459841.1|  PREDICTED: serine/threonine-protein kinase A...  66.2    8e-10   
ref|XP_003527639.1|  PREDICTED: probable serine/threonine-protein...  66.2    8e-10   
gb|KHN16703.1|  Serine/threonine-protein kinase                       65.9    9e-10   
ref|XP_003562054.1|  PREDICTED: probable receptor-like protein ki...  66.2    9e-10   
ref|XP_003595279.1|  Kinase-like protein                              66.6    9e-10   
emb|CDY41811.1|  BnaC02g12220D                                        66.2    9e-10   
ref|XP_006390647.1|  hypothetical protein EUTSA_v10018537mg           66.2    9e-10   
ref|XP_010273843.1|  PREDICTED: serine/threonine-protein kinase A...  66.2    9e-10   
ref|XP_004498840.1|  PREDICTED: putative receptor-like protein ki...  65.9    9e-10   
emb|CDY20721.1|  BnaA02g08610D                                        66.2    9e-10   



>ref|XP_009606105.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X1 [Nicotiana tomentosiformis]
Length=428

 Score =   221 bits (562),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 118/125 (94%), Gaps = 3/125 (2%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVG--AEKKHSHSRSTSDLSDPSTPRDV  288
            MGNCGTREESAV+S AH QVQQQ QG+S+ N+N+G  A+++HSHSRSTSDLS+PSTPR++
Sbjct  1    MGNCGTREESAVISNAHHQVQQQ-QGISLPNRNLGGDAKRQHSHSRSTSDLSEPSTPRNL  59

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            EDFRKN VLYTH+IAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV
Sbjct  60   EDFRKNAVLYTHIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  119

Query  469  AVKVL  483
            AVKVL
Sbjct  120  AVKVL  124



>ref|XP_009801690.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Nicotiana 
sylvestris]
Length=427

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 4/125 (3%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVG--AEKKHSHSRSTSDLSDPSTPRDV  288
            MGNCGTREESAV+S AH QVQQQ  G+S+ N+N+G  A+++HSHSRSTSDLS+PSTPR++
Sbjct  1    MGNCGTREESAVISNAHHQVQQQ--GISLPNRNLGGDAKRQHSHSRSTSDLSEPSTPRNL  58

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            EDFRKN VLYTH+IAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV
Sbjct  59   EDFRKNAVLYTHIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  118

Query  469  AVKVL  483
            AVKVL
Sbjct  119  AVKVL  123



>ref|XP_004249015.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Solanum 
lycopersicum]
Length=426

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVVS AH QVQQQ QGLS+ ++     KKHSHSRSTSDLSDPSTPR++ED
Sbjct  1    MGNCGTREESAVVSNAHHQVQQQ-QGLSLGSRIGIDSKKHSHSRSTSDLSDPSTPRNLED  59

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
            FRKN VLYTH+IAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  60   FRKNAVLYTHIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  119

Query  475  KVL  483
            KVL
Sbjct  120  KVL  122



>ref|XP_006362327.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Solanum 
tuberosum]
Length=426

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVVS AH QVQQQ QGLS+ ++     KKH+HSRSTSDLSDPSTPR++ED
Sbjct  1    MGNCGTREESAVVSNAHHQVQQQ-QGLSLGSRIGIDSKKHNHSRSTSDLSDPSTPRNLED  59

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
            FRKN VLYTH+IAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  60   FRKNAVLYTHIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  119

Query  475  KVL  483
            KVL
Sbjct  120  KVL  122



>ref|XP_008355748.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
At5g01020-like [Malus domestica]
Length=284

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 108/123 (88%), Gaps = 3/123 (2%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVV+ A  QVQQ L  L+ + KN G E+K +HSRS SDLSDPSTPR+ ED
Sbjct  1    MGNCGTREESAVVTNA--QVQQ-LSTLASSVKNGGGERKQNHSRSISDLSDPSTPRNFED  57

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN VLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  58   ARKNAVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  117

Query  475  KVL  483
            KVL
Sbjct  118  KVL  120



>ref|XP_008370313.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
Length=419

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 108/123 (88%), Gaps = 3/123 (2%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVV+ A  QVQQ L  L+ + KN G E+K +HSRS SDLSDPSTPR+ ED
Sbjct  1    MGNCGTREESAVVTNA--QVQQ-LSTLASSVKNGGGERKQNHSRSISDLSDPSTPRNFED  57

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN VLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  58   ARKNAVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  117

Query  475  KVL  483
            KVL
Sbjct  118  KVL  120



>ref|XP_009370852.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=419

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 108/123 (88%), Gaps = 3/123 (2%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVV+ A  QVQQ L  L+ + KN G E+K +HSRS SDLSDPSTPR+ ED
Sbjct  1    MGNCGTREESAVVTNA--QVQQ-LSTLASSVKNGGGERKQNHSRSISDLSDPSTPRNFED  57

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN VLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  58   ARKNAVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  117

Query  475  KVL  483
            KVL
Sbjct  118  KVL  120



>ref|XP_004160326.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
At5g01020-like [Cucumis sativus]
Length=426

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGA-EKKHSHSRSTSDLSDPSTPRDVE  291
            MGNCGTREESAVVS A  Q       L+V N N  A +K+H H+RS SDLSDPSTPR++E
Sbjct  1    MGNCGTREESAVVSNAQVQQLHTSSSLAVKNANNNATDKRHIHNRSISDLSDPSTPRNLE  60

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
            DFRKN VLYTHVIAFTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA
Sbjct  61   DFRKNSVLYTHVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  120

Query  472  VKVL  483
            VKVL
Sbjct  121  VKVL  124



>ref|XP_008442306.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Cucumis 
melo]
Length=426

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGA-EKKHSHSRSTSDLSDPSTPRDVE  291
            MGNCGTREESAVVS A  Q       L+V N N  A +K+H H+RS SDLSDPSTPR++E
Sbjct  1    MGNCGTREESAVVSNAQVQQLHTSSSLAVKNANNNATDKRHIHNRSISDLSDPSTPRNLE  60

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
            DFRKN VLYTHVIAFTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA
Sbjct  61   DFRKNSVLYTHVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  120

Query  472  VKVL  483
            VKVL
Sbjct  121  VKVL  124



>ref|XP_004137666.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Cucumis 
sativus]
Length=426

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGA-EKKHSHSRSTSDLSDPSTPRDVE  291
            MGNCGTREESAVVS A  Q       L+V N N  A +K+H H+RS SDLSDPSTPR++E
Sbjct  1    MGNCGTREESAVVSNAQVQQLHTSSSLAVKNANNNATDKRHIHNRSISDLSDPSTPRNLE  60

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
            DFRKN VLYTHVIAFTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA
Sbjct  61   DFRKNSVLYTHVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  120

Query  472  VKVL  483
            VKVL
Sbjct  121  VKVL  124



>gb|KGN58674.1| hypothetical protein Csa_3G727920 [Cucumis sativus]
Length=537

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGA-EKKHSHSRSTSDLSDPSTPRDVE  291
            MGNCGTREESAVVS A  Q       L+V N N  A +K+H H+RS SDLSDPSTPR++E
Sbjct  112  MGNCGTREESAVVSNAQVQQLHTSSSLAVKNANNNATDKRHIHNRSISDLSDPSTPRNLE  171

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
            DFRKN VLYTHVIAFTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA
Sbjct  172  DFRKNSVLYTHVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  231

Query  472  VKVL  483
            VKVL
Sbjct  232  VKVL  235



>ref|XP_009337839.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
 ref|XP_009337840.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
 ref|XP_009337841.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Pyrus 
x bretschneideri]
Length=416

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 105/123 (85%), Gaps = 6/123 (5%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVV+ A  QVQQ    LS   KN G E+K +HSRS SDL DPSTPR+ ED
Sbjct  1    MGNCGTREESAVVTNA--QVQQ----LSTLVKNGGGERKQNHSRSISDLIDPSTPRNFED  54

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN VLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  55   ARKNAVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  114

Query  475  KVL  483
            KVL
Sbjct  115  KVL  117



>ref|XP_008244257.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Prunus 
mume]
Length=418

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 107/123 (87%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVV+ A  QVQQ L  LS + KN   EKK +HSRS SDLSDPSTPR+ ED
Sbjct  1    MGNCGTREESAVVTNA--QVQQ-LSTLSSSVKN--GEKKQNHSRSISDLSDPSTPRNFED  55

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN VLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  56   ARKNAVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_008388407.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
 ref|XP_008388408.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
 ref|XP_008388409.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Malus 
domestica]
Length=416

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 104/123 (85%), Gaps = 6/123 (5%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVV+ A  QVQQ    LS   KN G E+K + SRS SDL DPSTPR+ ED
Sbjct  1    MGNCGTREESAVVTNA--QVQQ----LSTLVKNGGGERKQNQSRSISDLIDPSTPRNFED  54

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN VLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  55   ARKNAVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  114

Query  475  KVL  483
            KVL
Sbjct  115  KVL  117



>emb|CDP06356.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   192 bits (489),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 107/129 (83%), Gaps = 7/129 (5%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVA-NKN----VGAEKKHSHSRSTSDLS-DPST  276
            MGNCGTREESAVVS AH QVQQ LQ LS A ++N      A+K+H H RSTSDLS DP T
Sbjct  1    MGNCGTREESAVVSGAHHQVQQ-LQALSAAASRNPFPCAPADKRHGHGRSTSDLSSDPCT  59

Query  277  PRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLK  456
            PR  EDF  N  LYTHVIAF+LFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLK
Sbjct  60   PRHFEDFTNNSFLYTHVIAFSLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLK  119

Query  457  SLPVAVKVL  483
            SLPVAVKVL
Sbjct  120  SLPVAVKVL  128



>ref|XP_010044463.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Eucalyptus 
grandis]
Length=425

 Score =   192 bits (487),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 105/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVV+ AH QVQQ LQ LS        E+KHS  RSTSDLSD STPR+ ED
Sbjct  1    MGNCGTREESAVVANAHAQVQQ-LQILSPLPVKNPPERKHS--RSTSDLSDCSTPRNFED  57

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN VLYTHVIAFTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  58   SRKNAVLYTHVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  117

Query  475  KVL  483
            KVL
Sbjct  118  KVL  120



>ref|XP_010278903.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Nelumbo 
nucifera]
Length=410

 Score =   189 bits (480),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 8/123 (7%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVV  AH QVQQ    + +  KN+ +EK+H+  RS SDLSD STPR++ED
Sbjct  1    MGNCGTREESAVV--AHAQVQQ----VPLPAKNITSEKRHN--RSFSDLSDSSTPRNIED  52

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN +LYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  53   LRKNAMLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  112

Query  475  KVL  483
            KVL
Sbjct  113  KVL  115



>ref|XP_011018915.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Populus 
euphratica]
Length=427

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 104/124 (84%), Gaps = 3/124 (2%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDP-STPRDVE  291
            MGNCGTREESAVVSTA  QVQQQL  +S +      +    HSRS SDLSDP STPR+ E
Sbjct  1    MGNCGTREESAVVSTA--QVQQQLHIISSSASIKNGQSDKKHSRSVSDLSDPTSTPRNFE  58

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
            D RKN +LYTHVIAFTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA
Sbjct  59   DSRKNALLYTHVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  118

Query  472  VKVL  483
            VKVL
Sbjct  119  VKVL  122



>gb|KDP21817.1| hypothetical protein JCGZ_00604 [Jatropha curcas]
Length=433

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 108/128 (84%), Gaps = 9/128 (7%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGL----SVANKNVGAEKKHSHSRSTSDLSDPS-TP  279
            MGNCGTREESAVVS A  QVQQQL  +    SV  KN  +EKKHS  RS SDLSDPS TP
Sbjct  1    MGNCGTREESAVVSNA--QVQQQLHHMLSTSSVGVKNGVSEKKHS--RSISDLSDPSSTP  56

Query  280  RDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKS  459
            R+ ED RKN +LYTHVIAFTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKS
Sbjct  57   RNFEDSRKNALLYTHVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKS  116

Query  460  LPVAVKVL  483
            LPVAVKVL
Sbjct  117  LPVAVKVL  124



>ref|XP_011006228.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Populus 
euphratica]
Length=432

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 104/124 (84%), Gaps = 3/124 (2%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDP-STPRDVE  291
            MGNCGTREESAVVSTA  QVQQQL  LS +      +    H+RS SDLSDP STPR+ E
Sbjct  1    MGNCGTREESAVVSTA--QVQQQLHILSSSTSIKNGQSDKKHTRSVSDLSDPASTPRNFE  58

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
            D RKN +LYTHVIAFTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKS+PVA
Sbjct  59   DSRKNALLYTHVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSIPVA  118

Query  472  VKVL  483
            VKVL
Sbjct  119  VKVL  122



>ref|XP_004302496.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Fragaria 
vesca subsp. vesca]
Length=416

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 104/123 (85%), Gaps = 6/123 (5%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVV+ A  QVQQ    LS    +V  +K  +HSRS SDLSDPSTPR+ ED
Sbjct  1    MGNCGTREESAVVTNA--QVQQ----LSSLPSSVKGDKTKNHSRSISDLSDPSTPRNFED  54

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN VLYTHVI+FTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  55   ARKNAVLYTHVISFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  114

Query  475  KVL  483
            KVL
Sbjct  115  KVL  117



>gb|EYU26701.1| hypothetical protein MIMGU_mgv1a006846mg [Erythranthe guttata]
Length=428

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 107/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVA--NKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNCGTREESAVVSTAH+  Q Q Q   +    +N   +KKHS  RSTSDLSDPSTPR+ 
Sbjct  1    MGNCGTREESAVVSTAHQHHQVQQQLQVLPLPTRNPAIDKKHS--RSTSDLSDPSTPRNF  58

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            EDFRKN +LYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV
Sbjct  59   EDFRKNALLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  118

Query  469  AVKVL  483
            AVKVL
Sbjct  119  AVKVL  123



>gb|EYU26700.1| hypothetical protein MIMGU_mgv1a006846mg [Erythranthe guttata]
Length=429

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 107/125 (86%), Gaps = 4/125 (3%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVA--NKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNCGTREESAVVSTAH+  Q Q Q   +    +N   +KKHS  RSTSDLSDPSTPR+ 
Sbjct  1    MGNCGTREESAVVSTAHQHHQVQQQLQVLPLPTRNPAIDKKHS--RSTSDLSDPSTPRNF  58

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            EDFRKN +LYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV
Sbjct  59   EDFRKNALLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  118

Query  469  AVKVL  483
            AVKVL
Sbjct  119  AVKVL  123



>ref|XP_011077494.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Sesamum 
indicum]
Length=432

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 107/124 (86%), Gaps = 3/124 (2%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGL-SVANKNVGAEKKHSHSRSTSDLSDPSTPRDVE  291
            MGNCGTREESAVVSTAH+   QQ   + S+  +N  A+KKHS  RS SDLSDPSTPR+ E
Sbjct  1    MGNCGTREESAVVSTAHQHQVQQQLQVLSLPTRNPAADKKHS--RSASDLSDPSTPRNFE  58

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
            DFRKN  LYT+VIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA
Sbjct  59   DFRKNAQLYTNVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  118

Query  472  VKVL  483
            VKVL
Sbjct  119  VKVL  122



>ref|XP_006429669.1| hypothetical protein CICLE_v10011776mg [Citrus clementina]
 ref|XP_006481270.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Citrus 
sinensis]
 gb|ESR42909.1| hypothetical protein CICLE_v10011776mg [Citrus clementina]
 gb|KDO64217.1| hypothetical protein CISIN_1g014079mg [Citrus sinensis]
Length=431

 Score =   187 bits (474),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 105/123 (85%), Gaps = 6/123 (5%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVVST   QVQQ    L + + ++  + +  H+RS SDLSDPSTPR++ED
Sbjct  1    MGNCGTREESAVVSTV--QVQQ----LHMLSSSLPVKPERKHNRSISDLSDPSTPRNLED  54

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN VLYTHVIAF+LFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  55   SRKNAVLYTHVIAFSLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  114

Query  475  KVL  483
            KVL
Sbjct  115  KVL  117



>ref|XP_002519978.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF42302.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=534

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 107/126 (85%), Gaps = 7/126 (6%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGL--SVANKNVGAEKKHSHSRSTSDLSDP-STPRD  285
            MGNCGTREE+AVVS A  QVQQQL  +  S + KN   EKKHS  RS SDLSDP STPR+
Sbjct  1    MGNCGTREEAAVVSNA--QVQQQLHHMLSSSSVKNGLPEKKHS--RSISDLSDPTSTPRN  56

Query  286  VEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  465
             ED RKN VLYTHVIAFTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP
Sbjct  57   FEDSRKNAVLYTHVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  116

Query  466  VAVKVL  483
            VAVKVL
Sbjct  117  VAVKVL  122



>ref|XP_007205277.1| hypothetical protein PRUPE_ppa006509mg [Prunus persica]
 gb|EMJ06476.1| hypothetical protein PRUPE_ppa006509mg [Prunus persica]
Length=408

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 100/123 (81%), Gaps = 15/123 (12%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVV+ A  QV+               EKK +HSRS SDLSDPSTPR+ ED
Sbjct  1    MGNCGTREESAVVTNA--QVKN-------------GEKKQNHSRSISDLSDPSTPRNFED  45

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN VLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  46   ARKNAVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  105

Query  475  KVL  483
            KVL
Sbjct  106  KVL  108



>ref|XP_007032290.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY03216.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=426

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 103/123 (84%), Gaps = 11/123 (9%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAVV+  H QVQQ          ++ +EKK SH+R+ SDLSDP TPR+ ED
Sbjct  1    MGNCGTREESAVVT--HAQVQQL---------HILSEKKQSHNRTLSDLSDPCTPRNFED  49

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN +LYTHVIAFTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  50   SRKNSLLYTHVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  109

Query  475  KVL  483
            KVL
Sbjct  110  KVL  112



>ref|XP_009606106.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X2 [Nicotiana tomentosiformis]
Length=412

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 100/106 (94%), Gaps = 2/106 (2%)
 Frame = +1

Query  172  VQQQLQGLSVANKNVG--AEKKHSHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLF  345
            + +Q QG+S+ N+N+G  A+++HSHSRSTSDLS+PSTPR++EDFRKN VLYTH+IAFTLF
Sbjct  3    IIKQQQGISLPNRNLGGDAKRQHSHSRSTSDLSEPSTPRNLEDFRKNAVLYTHIIAFTLF  62

Query  346  ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL
Sbjct  63   ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  108



>gb|EPS64243.1| hypothetical protein M569_10538, partial [Genlisea aurea]
Length=401

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 102/127 (80%), Gaps = 12/127 (9%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQ----LQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPR  282
            MGNCGTREESAVVSTAH+  Q Q    L  L   ++         H RS SDLSDPSTPR
Sbjct  1    MGNCGTREESAVVSTAHQPQQVQQQFQLLSLPATDRK--------HPRSVSDLSDPSTPR  52

Query  283  DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL  462
            +VEDFR+N +LYTHVI FTLFELET+TKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL
Sbjct  53   NVEDFRRNSLLYTHVIEFTLFELETVTKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL  112

Query  463  PVAVKVL  483
            PVAVKVL
Sbjct  113  PVAVKVL  119



>ref|XP_009410482.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009410483.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=414

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 104/123 (85%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ LQ   +  KN   EKKH+  R+ SD+SDPSTPR +ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LQMFQIPVKNAPPEKKHT--RTLSDISDPSTPRHIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R N+ +YT VIAFTLFELETITKSFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   SR-NIAIYTDVIAFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_009381351.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ LQ   +  KN  +EKKH+  R++SD+SDPSTPR +ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LQIFQIPVKNAPSEKKHA--RTSSDISDPSTPRHIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R N+ +YT VIAFTLFELETITKSFR DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   SR-NIAIYTDVIAFTLFELETITKSFRPDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_008804652.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Phoenix 
dactylifera]
Length=414

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 104/123 (85%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ LQ   +  KN   EKKH   RS SD+S+PSTPR+VED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LQMFQLPAKNALPEKKHH--RSFSDMSEPSTPRNVED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R N+ +YT+VIAFTLFELETITKSFR DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   AR-NIAIYTNVIAFTLFELETITKSFRPDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_010922836.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Elaeis guineensis]
Length=414

 Score =   179 bits (453),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 104/123 (85%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ LQ   +  KN   EKKH   R+ SD+SDPSTPR+VED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LQMFQLPVKNALPEKKHH--RTISDVSDPSTPRNVED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R N+ +YT+VIAFTLFELETITKSFR DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   SR-NIAIYTNVIAFTLFELETITKSFRPDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>tpg|DAA39303.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=132

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ L  L    KN   ++KH+  R++SD+SDPSTPR  ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQNPAKNAIGDRKHN--RTSSDISDPSTPRKAED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y  VI FTLFELETITKSFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNDVIVFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_002450171.1| hypothetical protein SORBIDRAFT_05g001450 [Sorghum bicolor]
 gb|EES09159.1| hypothetical protein SORBIDRAFT_05g001450 [Sorghum bicolor]
Length=410

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ L  L    KN  A++KH+  R++SD+SDPSTPR+VED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQHPLKNANADRKHT--RTSSDISDPSTPRNVED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y  VIAFTLFELETITKSFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNDVIAFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_006381288.1| hypothetical protein POPTR_0006s11430g [Populus trichocarpa]
 gb|ERP59085.1| hypothetical protein POPTR_0006s11430g [Populus trichocarpa]
Length=414

 Score =   176 bits (446),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 101/125 (81%), Gaps = 18/125 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGL-SVANKNVGAEKKHSHSRSTSDLSDP-STPRDV  288
            MGNCGTREESAVVSTA        QGL S+ +K         HSRS SDLSDP STPR+ 
Sbjct  1    MGNCGTREESAVVSTA--------QGLISLLDKK--------HSRSVSDLSDPTSTPRNF  44

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            ED RKN +LYTHVIAFTL+ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV
Sbjct  45   EDSRKNALLYTHVIAFTLYELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  104

Query  469  AVKVL  483
            AVKVL
Sbjct  105  AVKVL  109



>ref|XP_002441774.1| hypothetical protein SORBIDRAFT_08g002100 [Sorghum bicolor]
 gb|EES15612.1| hypothetical protein SORBIDRAFT_08g002100 [Sorghum bicolor]
Length=410

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 104/123 (85%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ L  L    KN  A+KKH+  RS+SD+SDPSTP+ +ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQHPAKNALADKKHT--RSSSDISDPSTPKKIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y  VIAFTLFELETITKSFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNDVIAFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_009383280.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 101/123 (82%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTRE++AVV+ AH QVQQ LQ   +  KN   EKKH+  R+ SD+SDPSTPR +ED
Sbjct  1    MGNCGTREDNAVVA-AHAQVQQ-LQMFQLPVKNALPEKKHT--RTFSDMSDPSTPRHIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R N+ +Y  VIAFTLFELETITKSFR DY+LGEGGFG VYKGYIDENVRVGLKSLPVAV
Sbjct  57   SR-NIAIYNDVIAFTLFELETITKSFRPDYVLGEGGFGAVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>dbj|BAK05812.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 106/123 (86%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ L  L  ++KN  A++KH+  R++SD+SDP TP+ +ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQHSDKNALADRKHT--RTSSDVSDPPTPKKIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y +VIAFTLFELETITKSFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNNVIAFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>tpg|DAA39302.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=286

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ L  L    KN   ++KH+  R++SD+SDPSTPR  ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQNPAKNAIGDRKHN--RTSSDISDPSTPRKAED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y  VI FTLFELETITKSFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNDVIVFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>gb|EEC68754.1| hypothetical protein OsI_37277 [Oryza sativa Indica Group]
Length=413

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 102/123 (83%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ L  L    KN  AE+KH+  R +SD+SDPSTPR +ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQHPVKNAVAERKHT--RISSDMSDPSTPRKIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y  VI FTLFELETITKSFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNDVIDFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>gb|EEE52663.1| hypothetical protein OsJ_35037 [Oryza sativa Japonica Group]
Length=413

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 102/123 (83%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ L  L    KN  AE+KH+  R +SD+SDPSTPR +ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQHPVKNAVAERKHT--RISSDMSDPSTPRKIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y  VI FTLFELETITKSFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNDVIDFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_003579009.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Brachypodium 
distachyon]
Length=411

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 105/123 (85%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ L  L  + KN  A++KH+  R++SD+SDP TPR +ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQHSTKNALADRKHT--RTSSDVSDPPTPRKIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              +N+ +Y +VIAFTLFELETITKSFR+DY+LGEGGFGTVYKGYID+NVRVGLKSLPVAV
Sbjct  57   -AENISIYNNVIAFTLFELETITKSFRADYVLGEGGFGTVYKGYIDDNVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|NP_001065612.1| Os11g0121400 [Oryza sativa Japonica Group]
 gb|ABA91210.1| serine/threonine-protein kinase NAK, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27457.1| Os11g0121400 [Oryza sativa Japonica Group]
 dbj|BAG95471.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67564.1| hypothetical protein OsI_34907 [Oryza sativa Indica Group]
 gb|EEE51544.1| hypothetical protein OsJ_32754 [Oryza sativa Japonica Group]
Length=413

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ L  L    KN  AE+KH+  R +SD+SDPSTPR +ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQHPVKNAVAERKHT--RISSDMSDPSTPRKIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y  VI FTLFELETIT+SFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNDVIDFTLFELETITRSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|NP_001140687.1| uncharacterized LOC100272762 [Zea mays]
 gb|ACF78565.1| unknown [Zea mays]
 gb|ACF84379.1| unknown [Zea mays]
 gb|ACG32547.1| serine/threonine-protein kinase NAK [Zea mays]
 gb|ACN34214.1| unknown [Zea mays]
 gb|ACN34756.1| unknown [Zea mays]
 tpg|DAA39301.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=412

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 101/123 (82%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ L  L    KN   ++KH+  R++SD+SDPSTPR  ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQNPAKNAIGDRKHN--RTSSDISDPSTPRKAED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y  VI FTLFELETITKSFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNDVIVFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_006662686.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Oryza 
brachyantha]
 ref|XP_006663762.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Oryza 
brachyantha]
Length=413

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 101/123 (82%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ L  L    KN   E+KH+  R +SD+SDPSTPR +ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQHPVKNAVVERKHT--RISSDMSDPSTPRKIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y  VI FTLFELETITKSFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNDVIDFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>emb|CAQ58609.1| ATP binding / kinase/ protein kinase/ protein serine/threonine 
kinase/ protein-tyrosine kinase [Vitis vinifera]
Length=422

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 101/126 (80%), Gaps = 7/126 (6%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQ--LQGLSVANKNVGAEKKHSHSRSTSDLSDP-STPRD  285
            MGNCG+ E++ VVS  H QVQQ   L  LSV +      KKHS  RS SDLSD  STPR+
Sbjct  1    MGNCGSTEDNPVVS--HAQVQQLHILSSLSVKDAAPNCGKKHS--RSVSDLSDHHSTPRN  56

Query  286  VEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  465
            ++D  KN +LYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP
Sbjct  57   LDDSGKNSLLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  116

Query  466  VAVKVL  483
            VAVKVL
Sbjct  117  VAVKVL  122



>ref|XP_002265437.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
Length=432

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 101/126 (80%), Gaps = 7/126 (6%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQ--LQGLSVANKNVGAEKKHSHSRSTSDLSDP-STPRD  285
            MGNCG+ E++ VVS  H QVQQ   L  LSV +      KKHS  RS SDLSD  STPR+
Sbjct  1    MGNCGSTEDNPVVS--HAQVQQLHILSSLSVKDAAPNCGKKHS--RSVSDLSDHHSTPRN  56

Query  286  VEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  465
            ++D  KN +LYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP
Sbjct  57   LDDSGKNSLLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  116

Query  466  VAVKVL  483
            VAVKVL
Sbjct  117  VAVKVL  122



>emb|CBI31134.3| unnamed protein product [Vitis vinifera]
Length=450

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 101/126 (80%), Gaps = 7/126 (6%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQ--LQGLSVANKNVGAEKKHSHSRSTSDLSDP-STPRD  285
            MGNCG+ E++ VVS  H QVQQ   L  LSV +      KKHS  RS SDLSD  STPR+
Sbjct  1    MGNCGSTEDNPVVS--HAQVQQLHILSSLSVKDAAPNCGKKHS--RSVSDLSDHHSTPRN  56

Query  286  VEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  465
            ++D  KN +LYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP
Sbjct  57   LDDSGKNSLLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  116

Query  466  VAVKVL  483
            VAVKVL
Sbjct  117  VAVKVL  122



>ref|XP_003577860.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Brachypodium 
distachyon]
Length=410

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 103/123 (84%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH  VQQ L  L  + KN  A++KH+  R++SD+SDPSTP  +ED
Sbjct  1    MGNCGTREENAVVA-AHAHVQQ-LHLLQHSAKNPLADRKHN--RTSSDISDPSTPGKIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              K++ +Y +VIAFTLFELETITKSFR DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   V-KDISIYNNVIAFTLFELETITKSFRVDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>emb|CAN82885.1| hypothetical protein VITISV_023156 [Vitis vinifera]
Length=567

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 101/126 (80%), Gaps = 7/126 (6%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQ--LQGLSVANKNVGAEKKHSHSRSTSDLSDP-STPRD  285
            MGNCG+ E++ VVS  H QVQQ   L  LSV +      KKHS  RS SDLSD  STPR+
Sbjct  1    MGNCGSTEDNPVVS--HAQVQQLHILSSLSVKDAAPNCGKKHS--RSVSDLSDHHSTPRN  56

Query  286  VEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  465
            ++D  KN +LYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP
Sbjct  57   LDDSGKNSLLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  116

Query  466  VAVKVL  483
            VAVKVL
Sbjct  117  VAVKVL  122



>gb|EMT28395.1| Putative serine/threonine-protein kinase NAK [Aegilops tauschii]
Length=320

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 105/123 (85%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ    L  ++KN  A++KH+  R++SD+SDP TPR +ED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQVHL-LQQSDKNALADRKHT--RTSSDVSDPPTPRKIED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y +VIAFTLFELETITKSFR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   A-KNISIYNNVIAFTLFELETITKSFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>gb|KJB27592.1| hypothetical protein B456_005G001500 [Gossypium raimondii]
Length=338

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 97/123 (79%), Gaps = 9/123 (7%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREES VV+  H QVQQ L    +++K +   +  + +R+ SDLSD       ED
Sbjct  1    MGNCGTREESDVVT--HAQVQQ-LHNHILSDKKLTQSQSQTQNRTLSDLSD------FED  51

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN +LYTH+IAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  52   SRKNALLYTHIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  111

Query  475  KVL  483
            KVL
Sbjct  112  KVL  114



>ref|NP_001065613.1| Os11g0121500 [Oryza sativa Japonica Group]
 dbj|BAF27458.1| Os11g0121500 [Oryza sativa Japonica Group]
Length=145

 Score =   156 bits (394),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 99/124 (80%), Gaps = 6/124 (5%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVE-  291
            MGNCGTREE+AVV+ AH QVQQ L  L    KN  AE+KH+  R +SD+SDPSTPR +E 
Sbjct  1    MGNCGTREENAVVA-AHAQVQQ-LHLLQHPVKNAVAERKHT--RISSDMSDPSTPRKIEV  56

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
            +  KN+ +Y  VI   LFELETITKSFR+DY+LGEGGF TVYKGYIDENVRVGLKSLPVA
Sbjct  57   EDAKNISIYNDVIDL-LFELETITKSFRADYLLGEGGFVTVYKGYIDENVRVGLKSLPVA  115

Query  472  VKVL  483
            VKVL
Sbjct  116  VKVL  119



>gb|KJB27594.1| hypothetical protein B456_005G001500 [Gossypium raimondii]
Length=416

 Score =   163 bits (412),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 97/123 (79%), Gaps = 9/123 (7%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREES VV+  H QVQQ L    +++K +   +  + +R+ SDLSD       ED
Sbjct  1    MGNCGTREESDVVT--HAQVQQ-LHNHILSDKKLTQSQSQTQNRTLSDLSD------FED  51

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN +LYTH+IAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  52   SRKNALLYTHIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  111

Query  475  KVL  483
            KVL
Sbjct  112  KVL  114



>gb|AFW64654.1| putative protein kinase superfamily protein [Zea mays]
Length=254

 Score =   159 bits (401),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 101/123 (82%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH QVQQ    L   +KN  A++KH+    +SD+SDPSTPR VED
Sbjct  1    MGNCGTREENAVVA-AHAQVQQLHL-LQQPSKNANADRKHT--CMSSDISDPSTPRKVED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y  VIAFTLFELETITKSFR DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNDVIAFTLFELETITKSFRVDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>gb|KJB27591.1| hypothetical protein B456_005G001500 [Gossypium raimondii]
Length=425

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 97/123 (79%), Gaps = 9/123 (7%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREES VV+  H QVQQ L    +++K +   +  + +R+ SDLSD       ED
Sbjct  1    MGNCGTREESDVVT--HAQVQQ-LHNHILSDKKLTQSQSQTQNRTLSDLSD------FED  51

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             RKN +LYTH+IAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  52   SRKNALLYTHIIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  111

Query  475  KVL  483
            KVL
Sbjct  112  KVL  114



>ref|XP_010931422.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=414

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 102/123 (83%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+   +  Q Q+  L V  KN  AEKKH+  R+ SD+SDPSTPR+ ED
Sbjct  1    MGNCGTREENAVVAAHAQAQQLQMFQLPV--KNALAEKKHN--RTFSDISDPSTPRNFED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R N+ +YT+VI+FTLFELETITKSFR DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   SR-NIAIYTNVISFTLFELETITKSFRPDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_007032291.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
 gb|EOY03217.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
Length=405

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +1

Query  199  VANKNVGAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRS  378
            V   ++ +EKK SH+R+ SDLSDP TPR+ ED RKN +LYTHVIAFTL+ELETITKSFRS
Sbjct  1    VQQLHILSEKKQSHNRTLSDLSDPCTPRNFEDSRKNSLLYTHVIAFTLYELETITKSFRS  60

Query  379  DYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            DYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL
Sbjct  61   DYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  95



>ref|NP_001149711.1| serine/threonine-protein kinase NAK [Zea mays]
 gb|ACF85272.1| unknown [Zea mays]
 gb|ACG36476.1| serine/threonine-protein kinase NAK [Zea mays]
 gb|ACN28104.1| unknown [Zea mays]
 gb|AFW64653.1| putative protein kinase superfamily protein [Zea mays]
Length=410

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 100/123 (81%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+ AH    QQL  L   +KN  A++KH+    +SD+SDPSTPR VED
Sbjct  1    MGNCGTREENAVVA-AH-AQVQQLHLLQQPSKNANADRKHTCM--SSDISDPSTPRKVED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
              KN+ +Y  VIAFTLFELETITKSFR DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   -AKNISIYNDVIAFTLFELETITKSFRVDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_003534620.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Glycine 
max]
 gb|KHN29460.1| Serine/threonine-protein kinase [Glycine soja]
Length=432

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 98/128 (77%), Gaps = 9/128 (7%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSH----SRSTSDLSDP-STP  279
            MGNCG+REESAVVS A  QV QQL   +    +   +KKH+H    S   SDLS+  STP
Sbjct  1    MGNCGSREESAVVSKA--QVVQQLHHATSLGASARTDKKHAHRHNLSECASDLSESCSTP  58

Query  280  RDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKS  459
            R   +   N +LYTHVIAFTL+ELETITKSFR+DYILGEGGFGTVYKGYIDENVRVGLKS
Sbjct  59   RG--NNSSNTLLYTHVIAFTLYELETITKSFRADYILGEGGFGTVYKGYIDENVRVGLKS  116

Query  460  LPVAVKVL  483
            LPVAVKVL
Sbjct  117  LPVAVKVL  124



>ref|XP_008788035.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Phoenix 
dactylifera]
Length=289

 Score =   155 bits (391),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 101/123 (82%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREE+AVV+   +  Q Q+  L V  KN   EKK++  R+ SD+SDPSTPR+ ED
Sbjct  1    MGNCGTREENAVVAAHAQAQQLQVFQLPV--KNALPEKKYN--RTFSDISDPSTPRNFED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R N+ +YT+VI+FTLFELETITKSFR DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   SR-NIAIYTNVISFTLFELETITKSFRPDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_006842637.1| hypothetical protein AMTR_s00077p00187600 [Amborella trichopoda]
 gb|ERN04312.1| hypothetical protein AMTR_s00077p00187600 [Amborella trichopoda]
Length=415

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 100/123 (81%), Gaps = 5/123 (4%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTREESAV +   +  Q QL  L V  KN+ +EK+H+  RS+SD SDPSTPR+ ED
Sbjct  1    MGNCGTREESAVAAAQVQVQQLQLLALPV--KNIPSEKRHN--RSSSDFSDPSTPRNFED  56

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R +    T+VIAFTLFELETITKSFRSDY+LGEGGFGTVYKGYIDENVRVGLKSLPVAV
Sbjct  57   LRHSPG-STNVIAFTLFELETITKSFRSDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAV  115

Query  475  KVL  483
            KVL
Sbjct  116  KVL  118



>ref|XP_006602747.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
 gb|KHN40578.1| Serine/threonine-protein kinase [Glycine soja]
Length=441

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 100/137 (73%), Gaps = 18/137 (13%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQ-----GLSVANKNVGAEKKHSH--------SRSTS  255
            MGNCGTREESAVVS A  QV QQL      G S  ++N G+EKKH H        S   S
Sbjct  1    MGNCGTREESAVVSNA--QVVQQLHHATSLGASARSQNAGSEKKHGHGHGHRHNLSECAS  58

Query  256  DLSDP-STPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYID  432
            DLS+  STP    +   N +LYTHVIAFTL+ELETITKSFR DYILGEGGFGTVYKGYID
Sbjct  59   DLSESCSTPHG--NNSNNTLLYTHVIAFTLYELETITKSFRGDYILGEGGFGTVYKGYID  116

Query  433  ENVRVGLKSLPVAVKVL  483
            ENVRVGLKSLPVAVKVL
Sbjct  117  ENVRVGLKSLPVAVKVL  133



>emb|CAQ58633.1| ATP binding / serine-threonine kinase [Vitis vinifera]
Length=412

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 91/124 (73%), Gaps = 23/124 (19%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDP-STPRDVE  291
            MGNCG+ E++ VVS A  +                      HSRS SDLSD  STPR+++
Sbjct  1    MGNCGSTEDNPVVSHAQEK----------------------HSRSVSDLSDHHSTPRNLD  38

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
            D  KN +LYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA
Sbjct  39   DSGKNSLLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  98

Query  472  VKVL  483
            VKVL
Sbjct  99   VKVL  102



>ref|XP_007140016.1| hypothetical protein PHAVU_008G077200g [Phaseolus vulgaris]
 gb|ESW12010.1| hypothetical protein PHAVU_008G077200g [Phaseolus vulgaris]
Length=434

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 96/134 (72%), Gaps = 19/134 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQ----GLSVANKNVGAEKKHSH------SRSTSDLS  264
            MGNCGTREESAVVS A  QVQQ       G S  ++N G+EKKH H      S   SDLS
Sbjct  1    MGNCGTREESAVVSNA--QVQQLHHAASLGASARSQNAGSEKKHGHGHRHNLSECASDLS  58

Query  265  DP-STPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENV  441
            +  STPR       N    THVIAFTL+ELETITKSFR DYILGEGGFGTVYKGYIDENV
Sbjct  59   EACSTPRG------NNNNSTHVIAFTLYELETITKSFRGDYILGEGGFGTVYKGYIDENV  112

Query  442  RVGLKSLPVAVKVL  483
            RVGLKSLPVAVKVL
Sbjct  113  RVGLKSLPVAVKVL  126



>ref|XP_010922837.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Elaeis guineensis]
Length=405

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/102 (76%), Positives = 86/102 (84%), Gaps = 3/102 (3%)
 Frame = +1

Query  178  QQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELET  357
            QQLQ   +  KN   EKKH   R+ SD+SDPSTPR+VED R N+ +YT+VIAFTLFELET
Sbjct  11   QQLQMFQLPVKNALPEKKHH--RTISDVSDPSTPRNVEDSR-NIAIYTNVIAFTLFELET  67

Query  358  ITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            ITKSFR DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL
Sbjct  68   ITKSFRPDYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  109



>gb|AFK33487.1| unknown [Medicago truncatula]
Length=437

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 95/130 (73%), Gaps = 9/130 (7%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQG------LSVANKNVGAEKKHSHSRSTSDLSDP-S  273
            MGNCGTREESAVVS A  QVQ    G      LS   +   +  +H  + S SDLS+  S
Sbjct  1    MGNCGTREESAVVSNA--QVQHLPAGARNQTSLSGTGERKNSSLRHHLTDSASDLSETCS  58

Query  274  TPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGL  453
            TPR       N +LYTHVIAFTL+ELETITKSFR+DYILGEGGFGTVYKGYIDENVRVGL
Sbjct  59   TPRWNNANNNNTLLYTHVIAFTLYELETITKSFRADYILGEGGFGTVYKGYIDENVRVGL  118

Query  454  KSLPVAVKVL  483
            KSLPVAVKVL
Sbjct  119  KSLPVAVKVL  128



>ref|XP_003623694.1| Protein kinase 2B [Medicago truncatula]
 gb|AES79912.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=437

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 95/130 (73%), Gaps = 9/130 (7%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQG------LSVANKNVGAEKKHSHSRSTSDLSDP-S  273
            MGNCGTREESAVVS A  QVQ    G      LS   +   +  +H  + S SDLS+  S
Sbjct  1    MGNCGTREESAVVSNA--QVQHLPAGARNQTSLSGTGERKNSSLRHHLTDSASDLSETCS  58

Query  274  TPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGL  453
            TPR       N +LYTHVIAFTL+ELETITKSFR+DYILGEGGFGTVYKGYIDENVRVGL
Sbjct  59   TPRWNNANNNNTLLYTHVIAFTLYELETITKSFRADYILGEGGFGTVYKGYIDENVRVGL  118

Query  454  KSLPVAVKVL  483
            KSLPVAVKVL
Sbjct  119  KSLPVAVKVL  128



>ref|XP_010693044.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=366

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 99/140 (71%), Gaps = 19/140 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQ-----QLQGLSVANKNV-----GA-EKKHSHSRS---T  252
            MGNCGTREESAVVS  H QV Q      LQ  +  N N      GA EKK  HS +   +
Sbjct  1    MGNCGTREESAVVS--HAQVHQLHLLTSLQAAAATNGNSRNGHGGALEKKQQHSSNRSVS  58

Query  253  SDLSDPSTPRDV---EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKG  423
                  STPR +   ED R+NV LYT VIAFTL+ELETITKSFRSDYILGEGGFGTVYKG
Sbjct  59   DVSDPSSTPRLMGVEEDSRENVGLYTDVIAFTLYELETITKSFRSDYILGEGGFGTVYKG  118

Query  424  YIDENVRVGLKSLPVAVKVL  483
            YIDENVRVGLKSLPVAVKVL
Sbjct  119  YIDENVRVGLKSLPVAVKVL  138



>ref|XP_010693043.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=453

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 99/140 (71%), Gaps = 19/140 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQ-----QLQGLSVANKNV-----GA-EKKHSHSRS---T  252
            MGNCGTREESAVVS  H QV Q      LQ  +  N N      GA EKK  HS +   +
Sbjct  1    MGNCGTREESAVVS--HAQVHQLHLLTSLQAAAATNGNSRNGHGGALEKKQQHSSNRSVS  58

Query  253  SDLSDPSTPRDV---EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKG  423
                  STPR +   ED R+NV LYT VIAFTL+ELETITKSFRSDYILGEGGFGTVYKG
Sbjct  59   DVSDPSSTPRLMGVEEDSRENVGLYTDVIAFTLYELETITKSFRSDYILGEGGFGTVYKG  118

Query  424  YIDENVRVGLKSLPVAVKVL  483
            YIDENVRVGLKSLPVAVKVL
Sbjct  119  YIDENVRVGLKSLPVAVKVL  138



>ref|XP_009410484.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=391

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 3/92 (3%)
 Frame = +1

Query  208  KNVGAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYI  387
            KN   EKKH+  R+ SD+SDPSTPR +ED R N+ +YT VIAFTLFELETITKSFR+DY+
Sbjct  7    KNAPPEKKHT--RTLSDISDPSTPRHIEDSR-NIAIYTDVIAFTLFELETITKSFRADYV  63

Query  388  LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL
Sbjct  64   LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  95



>ref|XP_010553184.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=410

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 90/123 (73%), Gaps = 23/123 (19%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTR+E+AV +    QVQQ              +KKH   RS SDLSDPSTPR+   
Sbjct  1    MGNCGTRDEAAVFTPP--QVQQ-------------LQKKHF--RSVSDLSDPSTPRNA--  41

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
                ++ YT VIAFTLFELETITKSFR DYILGEGGFGTVYKGYID+N+RVGLKSLPVAV
Sbjct  42   ----LLPYTQVIAFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRVGLKSLPVAV  97

Query  475  KVL  483
            KVL
Sbjct  98   KVL  100



>gb|KFK24698.1| hypothetical protein AALP_AA8G013200 [Arabis alpina]
Length=401

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 87/124 (70%), Gaps = 22/124 (18%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQ-QQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVE  291
            MGNCGTR+E+AV +    Q Q QQLQ                HSRS SDLSDPSTPR   
Sbjct  1    MGNCGTRDEAAVFTP---QTQAQQLQ--------------RKHSRSVSDLSDPSTPR---  40

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
             F    + Y  VI FTLFELETITKSFR DYILGEGGFGTVYKGYID+N+R+GLKSLPVA
Sbjct  41   -FPDAPLSYAQVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRLGLKSLPVA  99

Query  472  VKVL  483
            VKVL
Sbjct  100  VKVL  103



>ref|XP_004492609.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Cicer 
arietinum]
Length=439

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 92/133 (69%), Gaps = 12/133 (9%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVG----AEKKHSHSR------STSDLS  264
            MGNCGTREESAVVS A  QVQQ        N+  G     E+K++  R       +    
Sbjct  1    MGNCGTREESAVVSNA--QVQQLHPAAGARNQTTGNGGAIERKNTSLRHNLSDSVSDLSD  58

Query  265  DPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVR  444
              STPR       N +LYTHVIAFTL+ELETITKSFR+DYILGEGGFGTVYKGYIDENVR
Sbjct  59   SCSTPRWNNSNNSNTLLYTHVIAFTLYELETITKSFRTDYILGEGGFGTVYKGYIDENVR  118

Query  445  VGLKSLPVAVKVL  483
            VGLKSLPVAVKVL
Sbjct  119  VGLKSLPVAVKVL  131



>ref|XP_006279336.1| hypothetical protein CARUB_v10012732mg [Capsella rubella]
 gb|EOA12234.1| hypothetical protein CARUB_v10012732mg [Capsella rubella]
Length=410

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 86/123 (70%), Gaps = 17/123 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTR+E+AV +   +  Q Q                  HSRS SDLSDPSTPR  ED
Sbjct  1    MGNCGTRDEAAVFTPQAQAQQLQ----------------KKHSRSVSDLSDPSTPRFRED  44

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R  +  Y  VI FTLFELETITKSFR DYILGEGGFGTVYKGYID+N+RVGLKSLPVAV
Sbjct  45   ARTPLS-YAQVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRVGLKSLPVAV  103

Query  475  KVL  483
            KVL
Sbjct  104  KVL  106



>ref|NP_195722.2| serine/threonine-protein kinase [Arabidopsis thaliana]
 sp|Q8GXZ3.1|Y5102_ARATH RecName: Full=Serine/threonine-protein kinase At5g01020 [Arabidopsis 
thaliana]
 dbj|BAC42590.1| putative protein kinase [Arabidopsis thaliana]
 gb|AED90288.1| serine/threonine-protein kinase [Arabidopsis thaliana]
Length=410

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 86/123 (70%), Gaps = 17/123 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTR+E+AV +   +  Q Q                  HSRS SDLSDPSTPR  +D
Sbjct  1    MGNCGTRDEAAVFTPQAQAQQLQ----------------KKHSRSVSDLSDPSTPRFRDD  44

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R  +  Y  VI FTLFELETITKSFR DYILGEGGFGTVYKGYID+N+RVGLKSLPVAV
Sbjct  45   SRTPIS-YAQVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRVGLKSLPVAV  103

Query  475  KVL  483
            KVL
Sbjct  104  KVL  106



>emb|CAB99493.1| protein kinase-like protein [Arabidopsis thaliana]
Length=410

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 86/123 (70%), Gaps = 17/123 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTR+E+AV +   +  Q Q                  HSRS SDLSDPSTPR  +D
Sbjct  1    MGNCGTRDEAAVFTPQAQAQQLQ----------------KKHSRSVSDLSDPSTPRFRDD  44

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R  +  Y  VI FTLFELETITKSFR DYILGEGGFGTVYKGYID+N+RVGLKSLPVAV
Sbjct  45   SRTPIS-YAQVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRVGLKSLPVAV  103

Query  475  KVL  483
            KVL
Sbjct  104  KVL  106



>ref|XP_002872982.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49241.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 86/123 (70%), Gaps = 17/123 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTR+E+AV +   +  Q Q                  HSRS SDLSDPSTPR  +D
Sbjct  1    MGNCGTRDEAAVFTPQAQAQQLQ----------------KKHSRSVSDLSDPSTPRFRDD  44

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R  +  Y  VI FTLFELETITKSFR DYILGEGGFGTVYKGYID+N+RVGLKSLPVAV
Sbjct  45   SRTPLS-YAQVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRVGLKSLPVAV  103

Query  475  KVL  483
            KVL
Sbjct  104  KVL  106



>ref|XP_006398549.1| hypothetical protein EUTSA_v10013688mg [Eutrema salsugineum]
 gb|ESQ40002.1| hypothetical protein EUTSA_v10013688mg [Eutrema salsugineum]
Length=410

 Score =   142 bits (358),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 86/123 (70%), Gaps = 17/123 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTR+E+AV +   +  Q Q                  HSRS SDLSDPSTPR  +D
Sbjct  1    MGNCGTRDEAAVFTPQAQAQQLQ----------------KKHSRSVSDLSDPSTPRFRDD  44

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R  +  Y  VI FTLFELETITKSFR DYILGEGGFGTVYKGYID+N+RVGLKSLPVAV
Sbjct  45   SRTPLS-YAQVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRVGLKSLPVAV  103

Query  475  KVL  483
            KVL
Sbjct  104  KVL  106



>gb|ACN35685.1| unknown [Zea mays]
 gb|AFW64655.1| putative protein kinase superfamily protein [Zea mays]
Length=426

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 80/93 (86%), Gaps = 3/93 (3%)
 Frame = +1

Query  205  NKNVGAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDY  384
            +KN  A++KH+    +SD+SDPSTPR VED  KN+ +Y  VIAFTLFELETITKSFR DY
Sbjct  45   SKNANADRKHTCM--SSDISDPSTPRKVEDA-KNISIYNDVIAFTLFELETITKSFRVDY  101

Query  385  ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            +LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL
Sbjct  102  VLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  134



>ref|XP_010424023.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Camelina 
sativa]
 ref|XP_010496821.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Camelina 
sativa]
Length=410

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 84/123 (68%), Gaps = 17/123 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNCGTR+E+AV +   +  Q Q                  HSRS SDLSDPSTPR   D
Sbjct  1    MGNCGTRDEAAVFTPQAQAQQLQ----------------KKHSRSVSDLSDPSTPR-FRD  43

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
                 + Y  VI FTLFELETITKSFR DYILGEGGFGTVYKGYID+N+RVGLKSLPVAV
Sbjct  44   DSCTPLSYAQVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRVGLKSLPVAV  103

Query  475  KVL  483
            KVL
Sbjct  104  KVL  106



>gb|ACN35838.1| unknown [Zea mays]
Length=243

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +1

Query  250  TSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYI  429
            +SD+SDPSTPR VED  KN+ +Y  VIAFTLFELETITKSFR DY+LGEGGFGTVYKGYI
Sbjct  2    SSDISDPSTPRKVED-AKNISIYNDVIAFTLFELETITKSFRVDYVLGEGGFGTVYKGYI  60

Query  430  DENVRVGLKSLPVAVKVL  483
            DENVRVGLKSLPVAVKVL
Sbjct  61   DENVRVGLKSLPVAVKVL  78



>gb|KJB27593.1| hypothetical protein B456_005G001500 [Gossypium raimondii]
Length=408

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 78/95 (82%), Gaps = 6/95 (6%)
 Frame = +1

Query  199  VANKNVGAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRS  378
            +++K +   +  + +R+ SDLSD       ED RKN +LYTH+IAFTLFELETITKSFRS
Sbjct  9    LSDKKLTQSQSQTQNRTLSDLSD------FEDSRKNALLYTHIIAFTLFELETITKSFRS  62

Query  379  DYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            DYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL
Sbjct  63   DYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  97



>gb|ABA91212.1| protein kinase family protein, putative [Oryza sativa Japonica 
Group]
Length=211

 Score =   132 bits (331),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 81/103 (79%), Gaps = 4/103 (4%)
 Frame = +1

Query  178  QQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVE-DFRKNVVLYTHVIAFTLFELE  354
            QQL  L    KN  AE+KH+  R +SD+SDPSTPR +E +  KN+ +Y  VI   LFELE
Sbjct  86   QQLHLLQHPVKNAVAERKHT--RISSDMSDPSTPRKIEVEDAKNISIYNDVIDL-LFELE  142

Query  355  TITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            TITKSFR+DY+LGEGGF TVYKGYIDENVRVGLKSLPVAVKVL
Sbjct  143  TITKSFRADYLLGEGGFVTVYKGYIDENVRVGLKSLPVAVKVL  185



>gb|EEE51545.1| hypothetical protein OsJ_32755 [Oryza sativa Japonica Group]
Length=209

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 81/103 (79%), Gaps = 4/103 (4%)
 Frame = +1

Query  178  QQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVE-DFRKNVVLYTHVIAFTLFELE  354
            QQL  L    KN  AE+KH+  R +SD+SDPSTPR +E +  KN+ +Y  VI   LFELE
Sbjct  86   QQLHLLQHPVKNAVAERKHT--RISSDMSDPSTPRKIEVEDAKNISIYNDVIDL-LFELE  142

Query  355  TITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            TITKSFR+DY+LGEGGF TVYKGYIDENVRVGLKSLPVAVKVL
Sbjct  143  TITKSFRADYLLGEGGFVTVYKGYIDENVRVGLKSLPVAVKVL  185



>gb|AFW64652.1| putative protein kinase superfamily protein [Zea mays]
Length=370

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +1

Query  250  TSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYI  429
            +SD+SDPSTPR VED  KN+ +Y  VIAFTLFELETITKSFR DY+LGEGGFGTVYKGYI
Sbjct  2    SSDISDPSTPRKVED-AKNISIYNDVIAFTLFELETITKSFRVDYVLGEGGFGTVYKGYI  60

Query  430  DENVRVGLKSLPVAVKVL  483
            DENVRVGLKSLPVAVKVL
Sbjct  61   DENVRVGLKSLPVAVKVL  78



>ref|NP_001066022.2| Os12g0121100 [Oryza sativa Japonica Group]
 gb|ABA95681.1| Protein kinase APK1B, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG86714.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF29041.2| Os12g0121100 [Oryza sativa Japonica Group]
Length=369

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = +1

Query  259  LSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDEN  438
            +SDPSTPR +ED  KN+ +Y  VI FTLFELETITKSFR+DY+LGEGGFGTVYKGYIDEN
Sbjct  1    MSDPSTPRKIED-AKNISIYNDVIDFTLFELETITKSFRADYVLGEGGFGTVYKGYIDEN  59

Query  439  VRVGLKSLPVAVKVL  483
            VRVGLKSLPVAVKVL
Sbjct  60   VRVGLKSLPVAVKVL  74



>ref|XP_009133583.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brassica 
rapa]
Length=404

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 82/123 (67%), Gaps = 22/123 (18%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC TR+E++V              L+   +    + +  HSRS SDLSDPSTP    D
Sbjct  1    MGNCNTRDEASV--------------LTPQAQAQAQQLQRKHSRSVSDLSDPSTP----D  42

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R        VI FTLFELETITKSFR DYILGEGGFGTVYKGYID+N+R+GLKSLPVAV
Sbjct  43   SRTP----PSVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRLGLKSLPVAV  98

Query  475  KVL  483
            KVL
Sbjct  99   KVL  101



>emb|CDX83496.1| BnaA03g20100D [Brassica napus]
Length=408

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 83/123 (67%), Gaps = 18/123 (15%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC TR+E++V++   +   Q              + +  HSRS SDLSDPSTP    D
Sbjct  1    MGNCNTRDEASVLTPQAQAQAQAQA----------QQLQRKHSRSVSDLSDPSTP----D  46

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R        VI FTLFELETITKSFR DYILGEGGFGTVYKGYID+N+R+GLKSLPVAV
Sbjct  47   SRTP----PSVIPFTLFELETITKSFRPDYILGEGGFGTVYKGYIDDNLRLGLKSLPVAV  102

Query  475  KVL  483
            KVL
Sbjct  103  KVL  105



>gb|ABR16273.1| unknown [Picea sitchensis]
Length=440

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 90/141 (64%), Gaps = 20/141 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAH--RQVQQQLQGLSVANKNVGA------EKKHSHSRSTSDLS--  264
            MGNCGTREESAV S     +    Q Q + +A+K          +   + SR  + +   
Sbjct  1    MGNCGTREESAVTSVVPIAKPGTVQTQPVPLAHKQEQQRKKEQQDPSPAISRKPTPVKRL  60

Query  265  --------DPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYK  420
                    +PSTPR VED R++    ++V+ FTLFELE ITKSFRSDYILGEGGFGTVYK
Sbjct  61   SLSSSDLSNPSTPRAVEDLRQDSG--SNVLVFTLFELEIITKSFRSDYILGEGGFGTVYK  118

Query  421  GYIDENVRVGLKSLPVAVKVL  483
            GYIDENVR GLK LPVAVKVL
Sbjct  119  GYIDENVRAGLKPLPVAVKVL  139



>ref|XP_002517790.1| hypothetical protein RCOM_0964990 [Ricinus communis]
 gb|EEF44597.1| hypothetical protein RCOM_0964990 [Ricinus communis]
Length=80

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 69/81 (85%), Gaps = 4/81 (5%)
 Frame = +1

Query  220  AEKKHSHSRSTSDLSDP-STPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGE  396
            +EKKHS  RS S ++DP STPR+ ++ RKNVVLYT VIAFT  +LET TKSFRSDYILGE
Sbjct  3    SEKKHS--RSISYMNDPTSTPRNFKNSRKNVVLYTRVIAFTFNKLET-TKSFRSDYILGE  59

Query  397  GGFGTVYKGYIDENVRVGLKS  459
            GGFGTVYK YIDENVRVGLKS
Sbjct  60   GGFGTVYKCYIDENVRVGLKS  80



>emb|CDY68189.1| BnaCnng57950D [Brassica napus]
Length=379

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 66/82 (80%), Gaps = 8/82 (10%)
 Frame = +1

Query  238  HSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVY  417
            HSRS SDLSDPSTP    D R        VI FTLFELETITKSFR DYILGEGGFGTVY
Sbjct  3    HSRSVSDLSDPSTP----DSRTP----PSVIPFTLFELETITKSFRPDYILGEGGFGTVY  54

Query  418  KGYIDENVRVGLKSLPVAVKVL  483
            KGYID+N+R+GLKSLPVAVKVL
Sbjct  55   KGYIDDNLRLGLKSLPVAVKVL  76



>ref|NP_001176324.1| Os11g0121800 [Oryza sativa Japonica Group]
 dbj|BAH95052.1| Os11g0121800 [Oryza sativa Japonica Group]
Length=182

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 76/124 (61%), Gaps = 40/124 (32%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            M NCGTREE+AVV+ AH Q + ++                              PR    
Sbjct  1    MDNCGTREENAVVA-AHAQGKLKM------------------------------PR----  25

Query  295  FRKNVVLYT-HVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
                   YT +VI FTLFELETITK+FR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVA
Sbjct  26   ----TSPYTRYVIDFTLFELETITKNFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVA  81

Query  472  VKVL  483
            VKVL
Sbjct  82   VKVL  85



>gb|ABA91216.1| hypothetical protein LOC_Os11g02860 [Oryza sativa Japonica Group]
Length=160

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  322  HVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            +VI FTLFELETITK+FR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL
Sbjct  10   YVIDFTLFELETITKNFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  63



>gb|EEE51546.1| hypothetical protein OsJ_32758 [Oryza sativa Japonica Group]
Length=151

 Score =   104 bits (260),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  322  HVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            +VI FTLFELETITK+FR+DY+LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL
Sbjct  10   YVIDFTLFELETITKNFRADYVLGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  63



>ref|XP_011089173.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Sesamum 
indicum]
Length=384

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 73/124 (59%), Gaps = 16/124 (13%)
 Frame = +1

Query  115  MGNCGTREESAV--VSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNC    E+++  VS+  +    + Q  S A +N  ++              PS P +V
Sbjct  1    MGNCCCGWETSIYRVSSNAKSESPKEQSPSEAERNAPSKL-------------PSNPEEV  47

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            ED R++      +IAFT  EL+ IT +FR DY+LG GGFG+VYKGYI +++R GL+ +PV
Sbjct  48   EDLRRSTAA-NPLIAFTFNELKNITDNFRQDYMLGGGGFGSVYKGYISQDLRQGLQPIPV  106

Query  469  AVKV  480
            AVKV
Sbjct  107  AVKV  110



>ref|XP_004504211.1| PREDICTED: probable receptor-like protein kinase At5g56460-like 
[Cicer arietinum]
Length=378

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 72/122 (59%), Gaps = 16/122 (13%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  R ES+           ++   + + KN   +++H  S+       PS P++VED
Sbjct  1    MGNCCYRLESS---------DYRVSSNAKSEKNQAIKERHDDSKL------PSNPKEVED  45

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E +R GL SLPVAV
Sbjct  46   LRRDSAA-NPLIAFTYKELKIITGNFRPDRVLGGGGFGSVYKGFISEELREGLPSLPVAV  104

Query  475  KV  480
            KV
Sbjct  105  KV  106



>emb|CBI16559.3| unnamed protein product [Vitis vinifera]
Length=277

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 67/126 (53%), Gaps = 20/126 (16%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD----PSTPR  282
            MGNC  R + ++   +                N  +E     S S   + D    PS P 
Sbjct  1    MGNCWCRWKPSIYRVS---------------SNAKSESPKDQSPSVKPMKDIRKLPSNPE  45

Query  283  DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL  462
            +VED R++      +I FT  EL+ IT +FR DY+LG GGFG+VYKG++ E++  GL+ L
Sbjct  46   EVEDLRRDSAA-NPLIVFTFNELKQITGNFRQDYVLGGGGFGSVYKGFVTEDLMEGLQPL  104

Query  463  PVAVKV  480
            PVAVKV
Sbjct  105  PVAVKV  110



>ref|XP_002285747.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X1 [Vitis vinifera]
Length=380

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 67/126 (53%), Gaps = 20/126 (16%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD----PSTPR  282
            MGNC  R + ++   +                N  +E     S S   + D    PS P 
Sbjct  1    MGNCWCRWKPSIYRVS---------------SNAKSESPKDQSPSVKPMKDIRKLPSNPE  45

Query  283  DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL  462
            +VED R++      +I FT  EL+ IT +FR DY+LG GGFG+VYKG++ E++  GL+ L
Sbjct  46   EVEDLRRDSAA-NPLIVFTFNELKQITGNFRQDYVLGGGGFGSVYKGFVTEDLMEGLQPL  104

Query  463  PVAVKV  480
            PVAVKV
Sbjct  105  PVAVKV  110



>ref|NP_001058289.1| Os06g0663200 [Oryza sativa Japonica Group]
 dbj|BAD45867.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF20203.1| Os06g0663200 [Oryza sativa Japonica Group]
 gb|EAZ37906.1| hypothetical protein OsJ_22256 [Oryza sativa Japonica Group]
Length=469

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 69/123 (56%), Gaps = 16/123 (13%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG C + EE       HR     LQG + A    G  K  S S++T+ +  P  P+DVED
Sbjct  1    MGGCFSLEE-------HR-----LQGKTEAGGPDGLRKCKSDSKATASVLAP--PKDVED  46

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             +  +  Y +V  FT  EL   TK+FR D ILGEGGFG VYKG IDENVR G  S  VAV
Sbjct  47   LQ--IEGYGNVNIFTYNELRAATKNFRPDQILGEGGFGVVYKGVIDENVRAGFPSTQVAV  104

Query  475  KVL  483
            K L
Sbjct  105  KEL  107



>ref|XP_003629925.1| Protein kinase 2B [Medicago truncatula]
Length=409

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 69/122 (57%), Gaps = 14/122 (11%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  + +S+    +     +Q Q        V  +++H  S+       PS P +VED
Sbjct  1    MGNCCYKWDSSDYRVSSNAKSEQNQ--------VAMKERHDDSKL------PSNPEEVED  46

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E +R  L SLPVAV
Sbjct  47   LRRDNSAANPLIAFTYDELKKITGNFRPDRVLGGGGFGSVYKGFISEELRDDLHSLPVAV  106

Query  475  KV  480
            KV
Sbjct  107  KV  108



>gb|EAZ01978.1| hypothetical protein OsI_24012 [Oryza sativa Indica Group]
Length=469

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 69/123 (56%), Gaps = 16/123 (13%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG C + EE       HR     LQG + A    G  K  S S++T+ +  P  P+DVED
Sbjct  1    MGGCFSLEE-------HR-----LQGKTEAGGPDGLRKCKSDSKATASVLAP--PKDVED  46

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             +  +  Y +V  FT  EL   TK+FR D ILGEGGFG VYKG IDENVR G  S  VAV
Sbjct  47   LQ--IEGYGNVNIFTYNELRAATKNFRPDQILGEGGFGVVYKGVIDENVRAGFPSTQVAV  104

Query  475  KVL  483
            K L
Sbjct  105  KEL  107



>gb|AET04401.2| receptor Serine/Threonine kinase [Medicago truncatula]
Length=382

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 69/122 (57%), Gaps = 14/122 (11%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  + +S+    +     +Q Q        V  +++H  S+       PS P +VED
Sbjct  1    MGNCCYKWDSSDYRVSSNAKSEQNQ--------VAMKERHDDSKL------PSNPEEVED  46

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E +R  L SLPVAV
Sbjct  47   LRRDNSAANPLIAFTYDELKKITGNFRPDRVLGGGGFGSVYKGFISEELRDDLHSLPVAV  106

Query  475  KV  480
            KV
Sbjct  107  KV  108



>gb|KHN48075.1| Putative receptor-like protein kinase [Glycine soja]
Length=381

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 68/122 (56%), Gaps = 16/122 (13%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  R ES+    +     +Q         N G +++H  S+       PS P +VED
Sbjct  1    MGNCWCRWESSEYRVSSNVKSEQ---------NQGTKQRHDDSKL------PSNPEEVED  45

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAFT  EL+ IT +FR D +LG GGFG VYKG+I E +R GL +L VAV
Sbjct  46   LRRDSAA-NPLIAFTYDELKIITANFRQDRVLGGGGFGRVYKGFISEELREGLPTLAVAV  104

Query  475  KV  480
            KV
Sbjct  105  KV  106



>gb|ACU18671.1| unknown [Glycine max]
Length=381

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 68/122 (56%), Gaps = 16/122 (13%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  R ES+    +     +Q         N G +++H  S+       PS P +VED
Sbjct  1    MGNCWCRWESSEYRVSSNVKSEQ---------NQGTKQRHDDSKL------PSNPEEVED  45

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAFT  EL+ IT +FR D +LG GGFG VYKG+I E +R GL +L VAV
Sbjct  46   LRRDSAA-NPLIAFTYGELKIITANFRQDRVLGGGGFGRVYKGFISEELREGLPTLAVAV  104

Query  475  KV  480
            KV
Sbjct  105  KV  106



>ref|NP_001239855.1| probable receptor-like protein kinase At5g56460-like [Glycine 
max]
 gb|ACM89488.1| protein kinase [Glycine max]
Length=381

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 68/122 (56%), Gaps = 16/122 (13%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  R ES+    +     +Q         N G +++H  S+       PS P +VED
Sbjct  1    MGNCWCRWESSEYRVSSNVKSEQ---------NQGTKQRHDDSKL------PSNPEEVED  45

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAFT  EL+ IT +FR D +LG GGFG VYKG+I E +R GL +L VAV
Sbjct  46   LRRDSAA-NPLIAFTYDELKIITANFRQDRVLGGGGFGRVYKGFISEELREGLPTLAVAV  104

Query  475  KV  480
            KV
Sbjct  105  KV  106



>ref|XP_006445568.1| hypothetical protein CICLE_v10015549mg [Citrus clementina]
 ref|XP_006488952.1| PREDICTED: probable receptor-like protein kinase At5g56460-like 
[Citrus sinensis]
 gb|ESR58808.1| hypothetical protein CICLE_v10015549mg [Citrus clementina]
 gb|KDO54484.1| hypothetical protein CISIN_1g014189mg [Citrus sinensis]
Length=389

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 70/122 (57%), Gaps = 12/122 (10%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  + E +V   +     +  +  S + K   A+K++S          PS P +VED
Sbjct  1    MGNCWCKWEPSVYIVSSNPKSESPKDESPSEK---AKKEYSKL--------PSNPEEVED  49

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAFT  EL  IT +FR D +LG GGFG VYKG+I E++R GL+ +PVAV
Sbjct  50   LRRDSAA-NPLIAFTYDELRIITANFRQDRVLGGGGFGCVYKGFISEDLREGLQPVPVAV  108

Query  475  KV  480
            KV
Sbjct  109  KV  110



>ref|XP_002523402.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF38981.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=385

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 68/122 (56%), Gaps = 12/122 (10%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  R E ++   +     +  +  S + K    ++K            PS P +VED
Sbjct  1    MGNCWCRWEPSIYRVSSNAKSESPKCESPSGKPRNDDRKL-----------PSNPEEVED  49

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      ++AFT  EL+ IT +FR D +LG GGFG+VYKG+I E +R GL+ LPVAV
Sbjct  50   LRRDSAA-NPLVAFTYDELKIITGNFRQDRLLGGGGFGSVYKGFITEELREGLEPLPVAV  108

Query  475  KV  480
            KV
Sbjct  109  KV  110



>ref|XP_004228947.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Solanum 
lycopersicum]
Length=386

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 70/122 (57%), Gaps = 12/122 (10%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  R + ++      +V    +  S  +K+     +  H++       PS P +VED
Sbjct  1    MGNCCCRGQPSIY-----RVSSNAKSESPKDKSPSQNARMDHTKM------PSNPEEVED  49

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAF+  EL+ IT +FR DY+LG GGFG VYKGYI E++R GL+ + VAV
Sbjct  50   LRRSSAT-NPLIAFSFDELKIITCNFRQDYMLGGGGFGNVYKGYITEDLREGLQPITVAV  108

Query  475  KV  480
            KV
Sbjct  109  KV  110



>ref|XP_008451006.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X3 [Cucumis melo]
Length=394

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 16/124 (13%)
 Frame = +1

Query  115  MGNCGTREESAV--VSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNC  R E  V  VS+  +    +++  S   +N      + H+        PS P++V
Sbjct  1    MGNCWYRWEPTVNRVSSNAKSESPKVESTSPYTRN------NEHNL-------PSNPKEV  47

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            ED R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R G+  LPV
Sbjct  48   EDLRRDSAT-NPLIAFTFDELKLITGNFRQDRVLGGGGFGSVYKGFITEDLREGIVPLPV  106

Query  469  AVKV  480
            AVKV
Sbjct  107  AVKV  110



>ref|XP_004144068.1| PREDICTED: probable receptor-like protein kinase At5g56460-like 
[Cucumis sativus]
 ref|XP_004159351.1| PREDICTED: probable receptor-like protein kinase At5g56460-like 
[Cucumis sativus]
 gb|KGN66350.1| hypothetical protein Csa_1G599440 [Cucumis sativus]
Length=390

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 16/124 (13%)
 Frame = +1

Query  115  MGNCGTREESAV--VSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNC  R E  V  VS+  +    +++  S   +N      + H+        PS P++V
Sbjct  1    MGNCWYRWEPTVNRVSSNAKSESPKVESTSPYTRN------NEHNL-------PSNPKEV  47

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            ED R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R G+  LPV
Sbjct  48   EDLRRDSAT-NPLIAFTFDELKLITGNFRQDRVLGGGGFGSVYKGFITEDLREGIVPLPV  106

Query  469  AVKV  480
            AVKV
Sbjct  107  AVKV  110



>ref|XP_008451007.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X4 [Cucumis melo]
Length=390

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 16/124 (13%)
 Frame = +1

Query  115  MGNCGTREESAV--VSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNC  R E  V  VS+  +    +++  S   +N      + H+        PS P++V
Sbjct  1    MGNCWYRWEPTVNRVSSNAKSESPKVESTSPYTRN------NEHNL-------PSNPKEV  47

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            ED R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R G+  LPV
Sbjct  48   EDLRRDSAT-NPLIAFTFDELKLITGNFRQDRVLGGGGFGSVYKGFITEDLREGIVPLPV  106

Query  469  AVKV  480
            AVKV
Sbjct  107  AVKV  110



>ref|XP_008451005.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X2 [Cucumis melo]
Length=395

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 72/124 (58%), Gaps = 16/124 (13%)
 Frame = +1

Query  115  MGNCGTREESAV--VSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNC  R E  V  VS+  +    +++  S   +N      + H+        PS P++V
Sbjct  1    MGNCWYRWEPTVNRVSSNAKSESPKVESTSPYTRN------NEHNL-------PSNPKEV  47

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            ED R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R G+  LPV
Sbjct  48   EDLRRDSAT-NPLIAFTFDELKLITGNFRQDRVLGGGGFGSVYKGFITEDLREGIVPLPV  106

Query  469  AVKV  480
            AVKV
Sbjct  107  AVKV  110



>ref|XP_008451004.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X1 [Cucumis melo]
Length=399

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 72/124 (58%), Gaps = 16/124 (13%)
 Frame = +1

Query  115  MGNCGTREESAV--VSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNC  R E  V  VS+  +    +++  S   +N             ++ + PS P++V
Sbjct  1    MGNCWYRWEPTVNRVSSNAKSESPKVESTSPYTRN-------------NEHNLPSNPKEV  47

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            ED R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R G+  LPV
Sbjct  48   EDLRRDSAT-NPLIAFTFDELKLITGNFRQDRVLGGGGFGSVYKGFITEDLREGIVPLPV  106

Query  469  AVKV  480
            AVKV
Sbjct  107  AVKV  110



>gb|KDP30626.1| hypothetical protein JCGZ_16191 [Jatropha curcas]
Length=385

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 68/126 (54%), Gaps = 20/126 (16%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD----PSTPR  282
            MGNC  R E +V   +                N  +E     S S + + D    PS P 
Sbjct  1    MGNCWCRGEPSVYRVS---------------SNAKSESPKDQSPSGNPIKDIKKLPSNPE  45

Query  283  DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL  462
            +VE  R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R GL+ L
Sbjct  46   EVEYLRRDSAA-NPLIAFTYDELKAITGNFRQDRVLGGGGFGSVYKGFITEDLREGLEPL  104

Query  463  PVAVKV  480
            PVAVKV
Sbjct  105  PVAVKV  110



>ref|XP_010032846.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X1 [Eucalyptus grandis]
 gb|KCW52338.1| hypothetical protein EUGRSUZ_J01755 [Eucalyptus grandis]
Length=381

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 69/124 (56%), Gaps = 16/124 (13%)
 Frame = +1

Query  115  MGNCGTREESAV--VSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNC  R E ++  VS+  +    +    SV            H R  S L  PS P +V
Sbjct  1    MGNCLCRWEPSIYRVSSNAKSESPKYGSPSV-----------KHKRDESKL--PSNPAEV  47

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            ED R++      +IAFT  EL  IT +FR D +LG GGFG+VYKG+I E++R GL+ L V
Sbjct  48   EDLRRDTAA-NPLIAFTYSELRIITANFRQDQVLGGGGFGSVYKGFISEDLREGLEPLQV  106

Query  469  AVKV  480
            AVKV
Sbjct  107  AVKV  110



>ref|XP_009339196.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Pyrus 
x bretschneideri]
Length=385

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 69/124 (56%), Gaps = 16/124 (13%)
 Frame = +1

Query  115  MGNCGTREESAV--VSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNC  R E +V  VS+  +    + Q  SV            H    S L  PS P +V
Sbjct  1    MGNCWYRWEPSVYRVSSNAKSESPKDQSPSV-----------KHREDDSKL--PSNPEEV  47

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            E  R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R G+  LPV
Sbjct  48   EILRRDSAA-NPLIAFTFSELKIITANFRQDRMLGGGGFGSVYKGFITEDLREGIDPLPV  106

Query  469  AVKV  480
            AVKV
Sbjct  107  AVKV  110



>ref|XP_007014086.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31705.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=438

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  268  PSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
            P T +DV+D R+N   Y +V  FT  E+  +TK FR DYILGEGGFG VYKG IDEN R 
Sbjct  39   PLTAKDVKDLRQNPG-YNNVDIFTYEEMRLVTKQFRPDYILGEGGFGVVYKGVIDENTRP  97

Query  448  GLKSLPVAVKVL  483
            G KS+ VAVK L
Sbjct  98   GYKSMAVAVKEL  109



>ref|XP_002303981.2| kinase family protein [Populus trichocarpa]
 gb|EEE78960.2| kinase family protein [Populus trichocarpa]
Length=389

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 68/124 (55%), Gaps = 20/124 (16%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHS-RSTSDLSD-PSTPRDV  288
            MGNC  R E                  SV N+   + K  S S R T D    PS P +V
Sbjct  1    MGNCCCRREP-----------------SVYNEKSESPKDQSPSGRPTKDDRKLPSNPEEV  43

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            ED R++      +IAFT  EL+ IT +FR D++LG GGFG+VYKG I E++R GL+ L V
Sbjct  44   EDLRRDSAA-NPLIAFTFAELKLITGNFRQDHLLGGGGFGSVYKGLITEDLREGLQPLQV  102

Query  469  AVKV  480
            AVKV
Sbjct  103  AVKV  106



>emb|CAN77488.1| hypothetical protein VITISV_020249 [Vitis vinifera]
Length=380

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 66/126 (52%), Gaps = 20/126 (16%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD----PSTPR  282
            MGNC  R + ++   +                N  +E     S S   + D    PS P 
Sbjct  1    MGNCWCRWKPSIYRVS---------------SNAKSESPKDQSPSVKPMKDIRKLPSNPE  45

Query  283  DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL  462
            +VED R++      +I FT  EL+ IT +FR DY+LG GGFG+VYKG++ E++  G + L
Sbjct  46   EVEDLRRDSAA-NPLIVFTFNELKQITGNFRQDYVLGGGGFGSVYKGFVTEDLMEGHQPL  104

Query  463  PVAVKV  480
            PVAVKV
Sbjct  105  PVAVKV  110



>dbj|BAK03343.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=892

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 55/123 (45%), Positives = 69/123 (56%), Gaps = 12/123 (10%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG C + EE        +++Q +    + A    G  K  S S++ S +  P  P+DVED
Sbjct  1    MGGCFSLEE--------QRLQSRTGTSAEAGGPDGLRKCKSDSKAISSVLAP--PKDVED  50

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             +     Y +V  FT  EL   TK+FR D ILGEGGFG VYKG IDENVR+G KS  VAV
Sbjct  51   LQTEG--YGNVNIFTYNELRAATKNFRPDQILGEGGFGVVYKGVIDENVRIGFKSTQVAV  108

Query  475  KVL  483
            K L
Sbjct  109  KEL  111



>ref|XP_007159552.1| hypothetical protein PHAVU_002G247100g [Phaseolus vulgaris]
 gb|ESW31546.1| hypothetical protein PHAVU_002G247100g [Phaseolus vulgaris]
Length=379

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 68/123 (55%), Gaps = 17/123 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKH-SHSRSTSDLSDPSTPRDVE  291
            MGNC  R ES+    +                NV +E+   +  R+  D   PS P +VE
Sbjct  1    MGNCWCRWESSDYRVS---------------SNVKSEQNQVTKQRNDYDSKLPSNPEEVE  45

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVA  471
            D R++      +I F+  EL+TIT +FR D +LG GGFG+VYKG+I E +R GL +L VA
Sbjct  46   DLRRDSAA-NPLIVFSYDELKTITANFRPDRVLGGGGFGSVYKGFISEELRQGLPTLAVA  104

Query  472  VKV  480
            VKV
Sbjct  105  VKV  107



>ref|XP_010103098.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB94821.1| putative receptor-like protein kinase [Morus notabilis]
Length=389

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 66/122 (54%), Gaps = 12/122 (10%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  R E ++   +     +  +  S + K     KK            PS P +VE 
Sbjct  1    MGNCCCRREPSIYRVSSNAKSESPKDQSPSVKPRKEVKKL-----------PSNPEEVES  49

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAFT  EL+ +T +FR D +LG GGFG+VYKG+I E +R GLK LPVAV
Sbjct  50   LRRDSAA-NPLIAFTFNELKQMTDNFRPDRMLGGGGFGSVYKGFITEGLREGLKPLPVAV  108

Query  475  KV  480
            KV
Sbjct  109  KV  110



>ref|XP_006656337.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Oryza 
brachyantha]
Length=471

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 67/123 (54%), Gaps = 16/123 (13%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG C + EE       HR     LQ  +      G  K  S S++T+ +  P  P+DVED
Sbjct  1    MGGCFSLEE-------HR-----LQSKTETGGPDGLRKCKSDSKATASVLAP--PKDVED  46

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             +     Y +V  FT  EL   TK+FR D ILGEGGFG VYKG IDENVRVG  S  VAV
Sbjct  47   LQTEG--YGNVNIFTYNELRAATKNFRPDQILGEGGFGVVYKGVIDENVRVGFPSTQVAV  104

Query  475  KVL  483
            K L
Sbjct  105  KEL  107



>ref|XP_010536824.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Tarenaya 
hassleriana]
Length=398

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 65/105 (62%), Gaps = 10/105 (10%)
 Frame = +1

Query  193  LSVANKNVGAEKKHSHSR--STSDLSD-------PSTPRDVEDFRKNVVLYTHVIAFTLF  345
            L  +N  V A  K    +  S+SD S        PS P++VED R++      +IAFT  
Sbjct  8    LEPSNHRVSANAKSESPKDQSSSDQSRRKEVHKLPSNPKEVEDLRRDSAA-NPLIAFTYG  66

Query  346  ELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKV  480
            EL+ IT +FR D +LG GGFG+VYKG+I E++R GL+ LPVAVKV
Sbjct  67   ELKIITGNFRQDRVLGGGGFGSVYKGFIAEDLREGLQPLPVAVKV  111



>ref|XP_009376055.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Pyrus 
x bretschneideri]
Length=382

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 69/124 (56%), Gaps = 16/124 (13%)
 Frame = +1

Query  115  MGNCGTREESAV--VSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNC  R E +V  VS+  +    + Q  SV            H    S L  PS P +V
Sbjct  1    MGNCCYRCEPSVYRVSSNAKSESPKDQSPSV-----------KHREDDSKL--PSNPEEV  47

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            E  R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R G+  LPV
Sbjct  48   EILRRDSAA-NPLIAFTFSELKIITANFRQDQMLGGGGFGSVYKGFITEDLREGIAPLPV  106

Query  469  AVKV  480
            AVKV
Sbjct  107  AVKV  110



>ref|XP_004141437.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cucumis sativus]
 ref|XP_004157407.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Cucumis sativus]
 gb|KGN55385.1| hypothetical protein Csa_4G648560 [Cucumis sativus]
Length=419

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 72/116 (62%), Gaps = 3/116 (3%)
 Frame = +1

Query  139  ESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVV-L  315
            +S ++ + +  V ++L       +   ++K  S   S SD S+PS+P  ++D   ++V  
Sbjct  10   KSMIIPSCYTAVHRRLSESEDDERRRLSKKGSSQRLSLSDASNPSSPLSIDDLSNSLVGP  69

Query  316  YTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
              H+ +F   EL TIT +F S  +LGEGGFG VYKG++D+N++ GL++ PVAVK+L
Sbjct  70   KLHIFSFA--ELRTITHNFASSNLLGEGGFGPVYKGFVDDNIKPGLEAQPVAVKLL  123



>ref|XP_009405653.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Musa 
acuminata subsp. malaccensis]
Length=373

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 69/125 (55%), Gaps = 17/125 (14%)
 Frame = +1

Query  115  MGNC---GTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRD  285
            MGNC   G+  +  V STA  +  +  Q  SV  +     K             PS P +
Sbjct  1    MGNCWFIGSPSKYRVSSTAKSESPKD-QSPSVKEEQKNGSKL------------PSNPEE  47

Query  286  VEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  465
            VED R N      +IAFT  E++TIT +FR DY+LG GGFG+VYKG+I  ++R GL+ L 
Sbjct  48   VEDLRGNTAT-NPLIAFTFDEVKTITGNFRQDYVLGGGGFGSVYKGFITRDLREGLQPLQ  106

Query  466  VAVKV  480
            VAVKV
Sbjct  107  VAVKV  111



>emb|CDY65103.1| BnaAnng20210D [Brassica napus]
Length=159

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +  VL   ++ F + EL+ IT+ F  +Y+LGEGGFG VYKGY
Sbjct  60   SFADLSRSSSARINEDLAE--VLGADLVDFQMCELKMITQCFSRNYLLGEGGFGKVYKGY  117

Query  427  IDENVRVGLKSLPVAVKVL  483
            IDEN+R  +K+ PVAVK+L
Sbjct  118  IDENLRQSIKAQPVAVKLL  136



>ref|XP_003563358.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brachypodium 
distachyon]
Length=473

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 68/123 (55%), Gaps = 12/123 (10%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG C + EE        +++Q +    + A    G  K  S S++ S +  P  P+DVED
Sbjct  1    MGGCFSLEE--------QRLQSRTGTSAEAGGPDGLRKCKSDSKAISSVLAP--PKDVED  50

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             +     Y +V  FT  EL   TK+FR D ILGEGGFG VYKG IDENVRVG  S  VAV
Sbjct  51   LQTEG--YGNVNIFTYNELRAATKNFRPDQILGEGGFGVVYKGVIDENVRVGFPSTQVAV  108

Query  475  KVL  483
            K L
Sbjct  109  KEL  111



>emb|CDY48175.1| BnaA04g15390D [Brassica napus]
Length=195

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P  V D   N      +  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  48   SLSDISDPSSPMSVMDDLSNSFTSQKLRMFTLSELRVITHNFSRSNMLGEGGFGPVYKGF  107

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ V+ GL++ PVAVK L
Sbjct  108  IDDKVKPGLEAQPVAVKAL  126



>gb|KDO54485.1| hypothetical protein CISIN_1g014189mg [Citrus sinensis]
Length=429

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +1

Query  157  TAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD-PSTPRDVEDFRKNVVLYTHVIA  333
            T  ++VQ   Q  S+++     + +    ++  + S  PS P +VED R++      +IA
Sbjct  43   TEMKKVQSFFQFQSISHCKESPKDESPSEKAKKEYSKLPSNPEEVEDLRRDSAA-NPLIA  101

Query  334  FTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKV  480
            FT  EL  IT +FR D +LG GGFG VYKG+I E++R GL+ +PVAVKV
Sbjct  102  FTYDELRIITANFRQDRVLGGGGFGCVYKGFISEDLREGLQPVPVAVKV  150



>gb|KHN06478.1| Putative receptor-like protein kinase [Glycine soja]
Length=382

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 69/123 (56%), Gaps = 17/123 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  R +S+    +     +Q         N G +++H  S+       PS P +VED
Sbjct  1    MGNCWCRWKSSEYRVSSNVKSEQ---------NQGTKQRHDDSKL------PSNPEEVED  45

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDEN-VRVGLKSLPVA  471
             R++      +IAFT  EL+ +T +FR D +LG GGFG+VYKG+I E  +R GL +L VA
Sbjct  46   LRRDTAA-NPLIAFTYDELKIVTANFRPDRVLGGGGFGSVYKGFISEELIRQGLPTLAVA  104

Query  472  VKV  480
            VKV
Sbjct  105  VKV  107



>ref|XP_003524997.1| PREDICTED: probable receptor-like protein kinase At5g56460-like 
[Glycine max]
Length=382

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 69/123 (56%), Gaps = 17/123 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  R +S+    +     +Q         N G +++H  S+       PS P +VED
Sbjct  1    MGNCWCRWKSSEYRVSSNVKSEQ---------NQGTKQRHDDSKL------PSNPEEVED  45

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDEN-VRVGLKSLPVA  471
             R++      +IAFT  EL+ +T +FR D +LG GGFG+VYKG+I E  +R GL +L VA
Sbjct  46   LRRDTAA-NPLIAFTYDELKIVTANFRPDRVLGGGGFGSVYKGFISEELIRQGLPTLAVA  104

Query  472  VKV  480
            VKV
Sbjct  105  VKV  107



>ref|XP_008384377.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Malus 
domestica]
Length=385

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 68/124 (55%), Gaps = 16/124 (13%)
 Frame = +1

Query  115  MGNCGTREESAV--VSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDV  288
            MGNC    E +V  VS+  +    + Q  SV            H    S L  PS P +V
Sbjct  1    MGNCWYSREPSVYRVSSNAKSESSKDQSPSV-----------KHREDDSKL--PSNPEEV  47

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            E  R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R G+  LPV
Sbjct  48   EILRRDSAA-NPLIAFTFSELKIITANFRQDRMLGGGGFGSVYKGFITEDLREGIDPLPV  106

Query  469  AVKV  480
            AVKV
Sbjct  107  AVKV  110



>gb|KJB20549.1| hypothetical protein B456_003G154000 [Gossypium raimondii]
Length=236

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 63/127 (50%), Gaps = 23/127 (18%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD-PSTPRDVE  291
            MGNC  + E  +                   KN  +E      R   + +  PS P +VE
Sbjct  1    MGNCWCKWEPTIY------------------KNPKSESPKEQERERREGTKLPSNPEEVE  42

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLK----S  459
            D R        +IAFT  EL+ IT +FR D +LG GGFG VYKG+I E++R GL+     
Sbjct  43   DLRGGDSAANPLIAFTFEELKIITANFRQDRVLGGGGFGNVYKGFIPEDLREGLQIQPLP  102

Query  460  LPVAVKV  480
            LPVAVKV
Sbjct  103  LPVAVKV  109



>ref|XP_006397106.1| hypothetical protein EUTSA_v10028670mg [Eutrema salsugineum]
 gb|ESQ38559.1| hypothetical protein EUTSA_v10028670mg [Eutrema salsugineum]
Length=436

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  268  PSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
            P  P++++D + N   Y +V  FT  E++T TK FR DYILGEGGFG VYKG ID+NVR 
Sbjct  48   PLAPKNIKDLQSNPG-YENVDVFTYEEMKTATKQFRPDYILGEGGFGVVYKGVIDDNVRA  106

Query  448  GLKSLPVAVKVL  483
            G KS  VA+K L
Sbjct  107  GYKSTKVAIKEL  118



>emb|CDP18581.1| unnamed protein product [Coffea canephora]
Length=391

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 71/125 (57%), Gaps = 16/125 (13%)
 Frame = +1

Query  115  MGNC---GTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRD  285
            MGNC   G R E ++      +V    +  S  +   G  +K        D   PS P +
Sbjct  1    MGNCWWFGRRWEPSIY-----RVSSNAKSESSKDSPSGMVRK-------DDRKLPSNPEE  48

Query  286  VEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  465
            VED R++      +I FT  EL+TIT +FR D++LG GGFG+V+KG+I E+++ GL+ +P
Sbjct  49   VEDLRRSSSA-NPLIVFTFNELKTITDNFRQDHMLGGGGFGSVFKGFIAEDLKKGLRPIP  107

Query  466  VAVKV  480
            VAVKV
Sbjct  108  VAVKV  112



>ref|XP_010276402.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Nelumbo 
nucifera]
Length=385

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 68/126 (54%), Gaps = 20/126 (16%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD----PSTPR  282
            MGNC  R + ++   +                NV +E     +    +  D    PS P 
Sbjct  1    MGNCWCRWKPSIYRVS---------------SNVKSESPKYQAPPVREGKDGQKLPSNPE  45

Query  283  DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL  462
            +VED R++      +IAF+  EL+ IT++FR D++LG GGFG+VYKG+I E+ R GL+ L
Sbjct  46   EVEDLRRDFAA-NPLIAFSYNELKIITENFRPDHVLGGGGFGSVYKGHISEDFREGLQPL  104

Query  463  PVAVKV  480
             VAVKV
Sbjct  105  QVAVKV  110



>ref|XP_006359196.1| PREDICTED: probable receptor-like protein kinase At5g56460-like 
[Solanum tuberosum]
Length=386

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 69/122 (57%), Gaps = 12/122 (10%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC    + ++      +V    +  S  +++   + +  H++       PS P +VED
Sbjct  1    MGNCCCWGQPSIY-----RVSSNAKSESPKDESPSKKARMDHTKM------PSNPEEVED  49

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAF+  EL+ IT +FR DY+LG GGFG VYKGYI E++R G + + VAV
Sbjct  50   LRRSSAT-NPLIAFSFDELKIITSNFRQDYMLGGGGFGNVYKGYITEDLREGFQPITVAV  108

Query  475  KV  480
            KV
Sbjct  109  KV  110



>ref|XP_010032848.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X3 [Eucalyptus grandis]
Length=364

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +1

Query  238  HSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVY  417
            H R  S L  PS P +VED R++      +IAFT  EL  IT +FR D +LG GGFG+VY
Sbjct  16   HKRDESKL--PSNPAEVEDLRRDTAA-NPLIAFTYSELRIITANFRQDQVLGGGGFGSVY  72

Query  418  KGYIDENVRVGLKSLPVAVKV  480
            KG+I E++R GL+ L VAVKV
Sbjct  73   KGFISEDLREGLEPLQVAVKV  93



>ref|XP_009398617.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=425

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 65/123 (53%), Gaps = 18/123 (15%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG+C +++E +  +   +Q  QQ              K        S L     P+DVED
Sbjct  1    MGSCLSQDEQSNAAGLPQQADQQ--------------KDPCQPNVVSLLP---LPKDVED  43

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R  V  Y +V  FT  EL   TK+FR+D +LGEGGFG VYKG IDENVR G +S  VAV
Sbjct  44   LRLTVG-YGNVYIFTYSELSAATKNFRADQVLGEGGFGIVYKGIIDENVRPGFESTQVAV  102

Query  475  KVL  483
            K L
Sbjct  103  KKL  105



>ref|XP_010032847.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X2 [Eucalyptus grandis]
Length=371

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +1

Query  238  HSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVY  417
            H R  S L  PS P +VED R++      +IAFT  EL  IT +FR D +LG GGFG+VY
Sbjct  23   HKRDESKL--PSNPAEVEDLRRDTAA-NPLIAFTYSELRIITANFRQDQVLGGGGFGSVY  79

Query  418  KGYIDENVRVGLKSLPVAVKV  480
            KG+I E++R GL+ L VAVKV
Sbjct  80   KGFISEDLREGLEPLQVAVKV  100



>ref|XP_011025119.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Populus 
euphratica]
Length=382

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 67/124 (54%), Gaps = 20/124 (16%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHS-RSTSDLSD-PSTPRDV  288
            MGNC  R E                  SV N+   + K  S S R T D    PS P +V
Sbjct  1    MGNCCCRREP-----------------SVYNEKSESPKDQSPSGRPTKDDRKLPSNPEEV  43

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            ED R++      +IAFT  EL+ IT +FR D++LG GGFG+VYKG I + +R GL+ L V
Sbjct  44   EDLRRDSAA-NPLIAFTFGELKLITGNFRQDHLLGGGGFGSVYKGLIAKGLREGLQPLQV  102

Query  469  AVKV  480
            AVKV
Sbjct  103  AVKV  106



>gb|KJB20547.1| hypothetical protein B456_003G154000 [Gossypium raimondii]
Length=300

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 63/127 (50%), Gaps = 23/127 (18%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD-PSTPRDVE  291
            MGNC  + E  +                   KN  +E      R   + +  PS P +VE
Sbjct  1    MGNCWCKWEPTIY------------------KNPKSESPKEQERERREGTKLPSNPEEVE  42

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLK----S  459
            D R        +IAFT  EL+ IT +FR D +LG GGFG VYKG+I E++R GL+     
Sbjct  43   DLRGGDSAANPLIAFTFEELKIITANFRQDRVLGGGGFGNVYKGFIPEDLREGLQIQPLP  102

Query  460  LPVAVKV  480
            LPVAVKV
Sbjct  103  LPVAVKV  109



>gb|KDP40693.1| hypothetical protein JCGZ_24692 [Jatropha curcas]
Length=461

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = +1

Query  235  SHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTV  414
            S   S S+ S P +P  + D   N +   HV  FTL ELE IT  F   Y+LGEGGFGTV
Sbjct  36   SQRLSLSEFSYPGSPLSLSDLSNNSIFNLHV--FTLKELEKITHQFSKSYVLGEGGFGTV  93

Query  415  YKGYIDENVRVGLKSLPVAVKVL  483
            YKG+I + +R GLK+  VAVKVL
Sbjct  94   YKGFITDKLRPGLKAQSVAVKVL  116



>ref|XP_010917721.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Elaeis 
guineensis]
Length=367

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 69/122 (57%), Gaps = 12/122 (10%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  R   ++      +V    +  S   ++ G E++   S+       PS P +VED
Sbjct  1    MGNCWFRGNPSIY-----RVSSNAKFESPKIQSPGKEEEKEGSKL------PSNPEEVED  49

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +I+FT  EL+ IT +FR DY LG GGFG+VYKG+I E++R GL+   VAV
Sbjct  50   LRRDTAA-NPLISFTFDELKIITANFRQDYYLGGGGFGSVYKGFITEDLREGLQPFQVAV  108

Query  475  KV  480
            KV
Sbjct  109  KV  110



>ref|XP_010541952.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=449

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 73/130 (56%), Gaps = 9/130 (7%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAH----RQVQQQLQGLSVANKN---VGAEKKHSHSRSTSDLSDPS  273
            MG C + EE    S  H    RQ  +++ G S  N     + ++++ S    +S  S P 
Sbjct  1    MGICLSTEEQYRYSQQHESQRRQYIKKMPGDSGNNSAAYLMNSDRQGSAGNKSSS-SLPL  59

Query  274  TPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGL  453
             P++++D + N   Y  V  FT  E++  TK FR DYILGEGGFG VYKG IDE+VR G 
Sbjct  60   APKNIKDLQLNPG-YKDVDIFTYEEMKLATKQFRPDYILGEGGFGVVYKGVIDESVRSGY  118

Query  454  KSLPVAVKVL  483
            KS  VA+K L
Sbjct  119  KSTKVAIKEL  128



>ref|XP_010651398.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X2 [Vitis vinifera]
Length=347

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +1

Query  268  PSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
            PS P +VED R++      +I FT  EL+ IT +FR DY+LG GGFG+VYKG++ E++  
Sbjct  8    PSNPEEVEDLRRDSAA-NPLIVFTFNELKQITGNFRQDYVLGGGGFGSVYKGFVTEDLME  66

Query  448  GLKSLPVAVKV  480
            GL+ LPVAVKV
Sbjct  67   GLQPLPVAVKV  77



>gb|KJB20548.1| hypothetical protein B456_003G154000 [Gossypium raimondii]
Length=335

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 63/127 (50%), Gaps = 23/127 (18%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD-PSTPRDVE  291
            MGNC  + E  +                   KN  +E      R   + +  PS P +VE
Sbjct  1    MGNCWCKWEPTIY------------------KNPKSESPKEQERERREGTKLPSNPEEVE  42

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLK----S  459
            D R        +IAFT  EL+ IT +FR D +LG GGFG VYKG+I E++R GL+     
Sbjct  43   DLRGGDSAANPLIAFTFEELKIITANFRQDRVLGGGGFGNVYKGFIPEDLREGLQIQPLP  102

Query  460  LPVAVKV  480
            LPVAVKV
Sbjct  103  LPVAVKV  109



>emb|CBI20734.3| unnamed protein product [Vitis vinifera]
Length=400

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SDLS+P +P  V+D   N ++ +++  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  39   SLSDLSNPGSPLSVDDI-SNSLIGSNLYTFTLAELREITHNFSPSNLLGEGGFGPVYKGF  97

Query  427  IDENVRVGLKSLPVAVKVL  483
            IDE +R  LK+ PVAVK+L
Sbjct  98   IDEKLRPKLKAQPVAVKLL  116



>ref|XP_002280196.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
 ref|XP_010648396.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
 ref|XP_010648397.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Vitis vinifera]
Length=440

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SDLS+P +P  V+D   N ++ +++  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  39   SLSDLSNPGSPLSVDDI-SNSLIGSNLYTFTLAELREITHNFSPSNLLGEGGFGPVYKGF  97

Query  427  IDENVRVGLKSLPVAVKVL  483
            IDE +R  LK+ PVAVK+L
Sbjct  98   IDEKLRPKLKAQPVAVKLL  116



>gb|KFK40688.1| hypothetical protein AALP_AA2G028500 [Arabis alpina]
Length=424

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+SF ++Y+LGEGGFG VYKGY
Sbjct  60   SFADLSRSSSARINEDLAQ--TLGADLVDFQMCELKMITQSFSANYLLGEGGFGKVYKGY  117

Query  427  IDENVRVGLKSLPVAVKVL  483
            +DEN+R  LK+ PVAVK+L
Sbjct  118  VDENLRQSLKAQPVAVKLL  136



>ref|XP_009140739.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brassica 
rapa]
Length=424

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P  V D   N      +  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  48   SLSDISDPSSPMSVMDDLSNSFTSQKLRMFTLSELRVITHNFSRSNMLGEGGFGPVYKGF  107

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ V+ GL++ PVAVK L
Sbjct  108  IDDKVKPGLEAQPVAVKAL  126



>gb|AAC69121.1| putative protein kinase [Arabidopsis thaliana]
Length=423

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  268  PSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
            P  P++++D + N   Y +V  FT  E++  TK FR DYILGEGGFG VYKG IDE+VRV
Sbjct  38   PLAPKNIKDLQSNPG-YENVDIFTYEEMKIATKQFRPDYILGEGGFGVVYKGVIDESVRV  96

Query  448  GLKSLPVAVKVL  483
            G KS  VA+K L
Sbjct  97   GFKSTKVAIKEL  108



>ref|XP_010245737.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X1 [Nelumbo nucifera]
Length=472

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 69/123 (56%), Gaps = 15/123 (12%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC T E+  V S          + + ++      E + ++   +  L    TP++V+D
Sbjct  12   MGNCFTAEDKPVKS----------KPVEISPSKNRLEAQTNNGNGSISL----TPKNVKD  57

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R+N   Y++V  FT  E+   TK+FR D ILGEGGFG VYKG +DENVR G KS  VA+
Sbjct  58   LRQNPG-YSNVDIFTYNEMRLATKNFRPDQILGEGGFGIVYKGILDENVRPGYKSTQVAI  116

Query  475  KVL  483
            K L
Sbjct  117  KEL  119



>ref|NP_178731.2| putative serine/threonine kinase [Arabidopsis thaliana]
 ref|NP_001189514.1| putative serine/threonine kinase [Arabidopsis thaliana]
 gb|AAN12999.1| putative protein kinase [Arabidopsis thaliana]
 dbj|BAE98906.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC06038.1| protein kinase domain-containing protein [Arabidopsis thaliana]
 gb|AEC06039.1| protein kinase domain-containing protein [Arabidopsis thaliana]
Length=442

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +1

Query  268  PSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
            P  P++++D + N   Y +V  FT  E++  TK FR DYILGEGGFG VYKG IDE+VRV
Sbjct  57   PLAPKNIKDLQSNPG-YENVDIFTYEEMKIATKQFRPDYILGEGGFGVVYKGVIDESVRV  115

Query  448  GLKSLPVAVKVL  483
            G KS  VA+K L
Sbjct  116  GFKSTKVAIKEL  127



>ref|XP_008797332.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Phoenix 
dactylifera]
Length=354

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +1

Query  268  PSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
            PSTP++VEDFR++      + +FT  EL+ IT +FR D +LG GGFG+VYKG+I E++R 
Sbjct  28   PSTPKEVEDFRRDTAA-NPLRSFTFDELKIITGNFRQDSVLGGGGFGSVYKGFITEDLRE  86

Query  448  GLKSLPVAVKV  480
            GL+ L VAVKV
Sbjct  87   GLQPLQVAVKV  97



>ref|XP_009415296.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Musa 
acuminata subsp. malaccensis]
Length=370

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 66/122 (54%), Gaps = 11/122 (9%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC  R++ ++   +     +  +  S   K    E          D   PS P +VED
Sbjct  1    MGNCWFRDQISIYRVSSNAKSESPKDQSPVVKEEAKE----------DSKLPSNPEEVED  50

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      ++AFT  EL+ IT +FR D +LG GGFG VYKG+I E++R GL+ L VAV
Sbjct  51   LRRDTAT-NPLVAFTFSELKKITGNFRQDNVLGVGGFGRVYKGFITEDLREGLQVLQVAV  109

Query  475  KV  480
            KV
Sbjct  110  KV  111



>ref|XP_010418127.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Camelina 
sativa]
 ref|XP_010430166.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=426

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+SF ++Y+LGEGGFG VYKGY
Sbjct  60   SFADLSRSSSARINEDLAQ--TLGADLVDFQMCELKMITQSFSANYLLGEGGFGKVYKGY  117

Query  427  IDENVRVGLKSLPVAVKVL  483
            +DEN+R  LK+ PVAVK+L
Sbjct  118  MDENLRQSLKAQPVAVKLL  136



>ref|XP_011089708.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Sesamum 
indicum]
Length=376

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 67/126 (53%), Gaps = 21/126 (17%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD----PSTPR  282
            MGNC    E     + HR            + NV +E     S S     D    PS P 
Sbjct  1    MGNCWCGWEP----SGHR-----------VSSNVKSESPKDQSPSEKMRKDIRKLPSNPE  45

Query  283  DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL  462
            +VED R+  +    +  F+  EL+T+T +FR DY+LG GGFG VYKGYI E+++ G++ +
Sbjct  46   EVEDLRR-CMAANPLTVFSFHELKTMTGNFRQDYMLGGGGFGNVYKGYISEDLK-GIEPI  103

Query  463  PVAVKV  480
            PVAVKV
Sbjct  104  PVAVKV  109



>gb|KJB20550.1| hypothetical protein B456_003G154000 [Gossypium raimondii]
Length=391

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 63/127 (50%), Gaps = 23/127 (18%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD-PSTPRDVE  291
            MGNC  + E  +                   KN  +E      R   + +  PS P +VE
Sbjct  1    MGNCWCKWEPTIY------------------KNPKSESPKEQERERREGTKLPSNPEEVE  42

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLK----S  459
            D R        +IAFT  EL+ IT +FR D +LG GGFG VYKG+I E++R GL+     
Sbjct  43   DLRGGDSAANPLIAFTFEELKIITANFRQDRVLGGGGFGNVYKGFIPEDLREGLQIQPLP  102

Query  460  LPVAVKV  480
            LPVAVKV
Sbjct  103  LPVAVKV  109



>emb|CDO97843.1| unnamed protein product [Coffea canephora]
Length=489

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = +1

Query  202  ANKNVGAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSD  381
            + K+V  +   +   S SD+SDP +P   +D   N ++ +++  FTL EL  +T  F S 
Sbjct  24   SKKHVPNQHSSAQRLSLSDISDPGSPLSADDI-SNSLIGSNLHIFTLAELRVLTHDFSSS  82

Query  382  YILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
              LGEGGFG VYKG++D+  R GLK+ PVAVK+L
Sbjct  83   NFLGEGGFGPVYKGFVDDRTRPGLKAQPVAVKLL  116



>ref|XP_009419222.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Musa 
acuminata subsp. malaccensis]
Length=368

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 68/125 (54%), Gaps = 17/125 (14%)
 Frame = +1

Query  115  MGNC---GTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRD  285
            MGNC   G+     V S A  + Q+      V N  V  E+K            PS P +
Sbjct  1    MGNCWFRGSPSSYRVSSNAKSECQK------VENPLVKEEEKEGSKL-------PSNPEE  47

Query  286  VEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLP  465
            VED R        +IAFT  EL+ IT +FR DY+LG GGFG+V+KG++ ++++ GL+ L 
Sbjct  48   VEDLRGTTAT-NLLIAFTFDELKAITGNFRQDYVLGGGGFGSVFKGFVTQDLKEGLQPLQ  106

Query  466  VAVKV  480
            VAVKV
Sbjct  107  VAVKV  111



>gb|AFW76094.1| putative protein kinase superfamily protein [Zea mays]
Length=168

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 67/123 (54%), Gaps = 15/123 (12%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG C ++EE       HR   +  +    A    G +K  S S++T+ +  P  P+ V D
Sbjct  1    MGGCFSQEE-------HRLQSRPAE----AAGPDGLQKSKSDSKATASVLAP--PKAVVD  47

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             +  V  Y +V  FT  EL   TK+FR D ILGEGGFG VYKG IDENVR G  S  VAV
Sbjct  48   LQ--VEGYGNVNIFTYDELSAATKNFRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAV  105

Query  475  KVL  483
            K L
Sbjct  106  KEL  108



>gb|KJB20546.1| hypothetical protein B456_003G154000 [Gossypium raimondii]
Length=399

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 63/127 (50%), Gaps = 23/127 (18%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD-PSTPRDVE  291
            MGNC  + E  +                   KN  +E      R   + +  PS P +VE
Sbjct  1    MGNCWCKWEPTIY------------------KNPKSESPKEQERERREGTKLPSNPEEVE  42

Query  292  DFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLK----S  459
            D R        +IAFT  EL+ IT +FR D +LG GGFG VYKG+I E++R GL+     
Sbjct  43   DLRGGDSAANPLIAFTFEELKIITANFRQDRVLGGGGFGNVYKGFIPEDLREGLQIQPLP  102

Query  460  LPVAVKV  480
            LPVAVKV
Sbjct  103  LPVAVKV  109



>gb|KJB83342.1| hypothetical protein B456_013G242000 [Gossypium raimondii]
Length=426

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 68/132 (52%), Gaps = 24/132 (18%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDP--STP---  279
            MG C + EE       HR         S++N   G  K  + SR     + P   TP   
Sbjct  1    MGTCFSIEEEP-----HR---------SLSNPPDGGRKTSASSRKEEMANSPITKTPSFI  46

Query  280  ----RDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
                +DV+D R+N   Y++V  F+  E+   TK FR DYILG+GGFG VYKG IDENVR 
Sbjct  47   ALTAKDVKDLRQNPG-YSNVDIFSYQEMRLATKQFRPDYILGDGGFGVVYKGVIDENVRP  105

Query  448  GLKSLPVAVKVL  483
              KS  VAVK L
Sbjct  106  AYKSTAVAVKEL  117



>ref|XP_008812837.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Phoenix 
dactylifera]
Length=260

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 52/71 (73%), Gaps = 1/71 (1%)
 Frame = +1

Query  268  PSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
            PS P++VED R++      +IAFTL EL+ IT +FR D++LG GGFG+VYKG+I E++R 
Sbjct  41   PSNPKEVEDLRRDGAA-NPLIAFTLNELKIITGNFRQDHVLGGGGFGSVYKGFITEDLRE  99

Query  448  GLKSLPVAVKV  480
             L  L VAVKV
Sbjct  100  DLHPLHVAVKV  110



>ref|XP_009124636.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Brassica rapa]
Length=415

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+ F  +Y+LGEGGFG VYKGY
Sbjct  60   SFADLSRSSSARINEDLAE--ALGADLVDFQMCELKMITQCFSRNYLLGEGGFGKVYKGY  117

Query  427  IDENVRVGLKSLPVAVKVL  483
            IDEN+R  LK+ PVAVK+L
Sbjct  118  IDENLRQSLKAQPVAVKLL  136



>ref|XP_009785799.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Nicotiana 
sylvestris]
Length=386

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 68/122 (56%), Gaps = 12/122 (10%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC    + ++   +     +  +G S + K      +  H++       PS P +VED
Sbjct  1    MGNCCCGGQPSIYRVSSNAKSESPKGHSPSQK-----ARIDHTKM------PSNPEEVED  49

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAF+  EL+ +T +FR DY+LG GGFG VYKGYI E++R G + + VAV
Sbjct  50   LRRSSAT-NPLIAFSFDELKIMTGNFRQDYMLGGGGFGNVYKGYITEDLREGFQQITVAV  108

Query  475  KV  480
            KV
Sbjct  109  KV  110



>gb|EMT12212.1| Protein kinase APK1B, chloroplastic [Aegilops tauschii]
Length=914

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 56/89 (63%), Gaps = 4/89 (4%)
 Frame = +1

Query  217  GAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGE  396
            G +K  S S++ S +  P  P+DVED +     Y +V  FT  EL   TK+FR D ILGE
Sbjct  94   GLKKCKSDSKAISSVLAP--PKDVEDLQTEG--YGNVNIFTYNELRAATKNFRPDQILGE  149

Query  397  GGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            GGFG VYKG IDENVR+G  S  VAVK L
Sbjct  150  GGFGVVYKGVIDENVRIGFPSRQVAVKEL  178



>ref|XP_006302292.1| hypothetical protein CARUB_v10020339mg [Capsella rubella]
 gb|EOA35190.1| hypothetical protein CARUB_v10020339mg [Capsella rubella]
Length=425

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+SF  +Y+LGEGGFG VYKGY
Sbjct  60   SFADLSRSSSARINEDLAQT--LGADLVDFQMCELKMITQSFSQNYLLGEGGFGKVYKGY  117

Query  427  IDENVRVGLKSLPVAVKVL  483
            IDEN+R  LK+ PVAVK+L
Sbjct  118  IDENLRQILKAQPVAVKLL  136



>ref|XP_009124635.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Brassica rapa]
Length=424

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+ F  +Y+LGEGGFG VYKGY
Sbjct  60   SFADLSRSSSARINEDLAE--ALGADLVDFQMCELKMITQCFSRNYLLGEGGFGKVYKGY  117

Query  427  IDENVRVGLKSLPVAVKVL  483
            IDEN+R  LK+ PVAVK+L
Sbjct  118  IDENLRQSLKAQPVAVKLL  136



>ref|XP_004294946.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Fragaria 
vesca subsp. vesca]
Length=387

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 65/126 (52%), Gaps = 18/126 (14%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD----PSTPR  282
            MGNC          + HR            + N  +E     S S +   D    PS P 
Sbjct  1    MGNCWCSWWGE--PSVHR-----------VSSNAKSESPKDQSPSLNPREDDRNLPSNPE  47

Query  283  DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL  462
            +VE  R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R GL  L
Sbjct  48   EVEILRRDSAA-NPLIAFTFNELKIITANFRQDRLLGGGGFGSVYKGFITEDLREGLSHL  106

Query  463  PVAVKV  480
            PVAVKV
Sbjct  107  PVAVKV  112



>ref|XP_008221745.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Prunus 
mume]
Length=385

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 65/126 (52%), Gaps = 20/126 (16%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD----PSTPR  282
            MGNC  R E +V   +                N  +E     S S +   D    PS P 
Sbjct  1    MGNCWFRWEPSVYRVS---------------SNAKSESPKDQSPSVNPREDDSKLPSNPE  45

Query  283  DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL  462
            +VE  R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R G+  L
Sbjct  46   EVEILRRDSAA-NPLIAFTFSELKIITGNFRQDRMLGGGGFGSVYKGFITEDLREGISPL  104

Query  463  PVAVKV  480
             VAVKV
Sbjct  105  AVAVKV  110



>ref|XP_010245738.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X2 [Nelumbo nucifera]
Length=469

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +1

Query  274  TPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGL  453
            TP++V+D R+N   Y++V  FT  E+   TK+FR D ILGEGGFG VYKG +DENVR G 
Sbjct  48   TPKNVKDLRQNPG-YSNVDIFTYNEMRLATKNFRPDQILGEGGFGIVYKGILDENVRPGY  106

Query  454  KSLPVAVKVL  483
            KS  VA+K L
Sbjct  107  KSTQVAIKEL  116



>gb|EYU32831.1| hypothetical protein MIMGU_mgv1a008384mg [Erythranthe guttata]
Length=375

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 57/97 (59%), Gaps = 5/97 (5%)
 Frame = +1

Query  202  ANKNVGAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSD  381
            A   +  EKK S      D   PS P +VED R   +    +  FT  EL TIT++FR D
Sbjct  21   AKSELEKEKKPSRKAKKDDYKLPSNPEEVEDLR-GCMAANQLTVFTFDELRTITENFRQD  79

Query  382  YILGEGGFGTVYKGYID--ENVRVG--LKSLPVAVKV  480
            Y+LG GGFG VYKGYI+  E+V+    LK +PVAVKV
Sbjct  80   YVLGGGGFGNVYKGYINITEDVKQEEVLKPIPVAVKV  116



>ref|XP_004965638.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Setaria 
italica]
Length=467

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 68/123 (55%), Gaps = 15/123 (12%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG C ++EE       HR    Q +    A  + G  K  S S++ + +  P  P+DV D
Sbjct  1    MGACFSQEE-------HRL---QSRPAEAAGPD-GLRKSKSDSKAIASVLAP--PKDVVD  47

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             +  V  Y +V  FT  EL   TK+FR D ILGEGGFG VYKG IDENVRVG  S  VAV
Sbjct  48   LQ--VEGYGNVNIFTYNELRAATKNFRPDQILGEGGFGVVYKGVIDENVRVGFPSRQVAV  105

Query  475  KVL  483
            K L
Sbjct  106  KEL  108



>ref|XP_008452794.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Cucumis 
melo]
Length=419

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +1

Query  139  ESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVV-L  315
            +S ++ + +  V + L       +   ++K  S   S SD S+PS+P  ++D   ++V  
Sbjct  10   KSMIIPSCYTAVHRGLSESEDDERRRLSKKGSSQRLSLSDASNPSSPLSIDDLSNSLVGP  69

Query  316  YTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
              H+ +F   EL TIT +F S  +LGEGGFG VYKG++D  ++ GL++ PVAVK+L
Sbjct  70   KLHIFSFA--ELRTITHNFASSNLLGEGGFGPVYKGFVDNKIKPGLEAQPVAVKLL  123



>gb|KFK39078.1| hypothetical protein AALP_AA3G198000 [Arabis alpina]
Length=433

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 70/123 (57%), Gaps = 6/123 (5%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG C + EE    S      Q++  G +     + +  K S  ++++    P  P++++D
Sbjct  1    MGICFSGEEQYQFSQ-----QKKKSGTNSHVYLMNSNCKDSVGKASASGGLPLAPKNIKD  55

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             + N   Y +V  FT  E++  TK FR DYILGEGGFG VYKG ID++VR+G KS  VA+
Sbjct  56   LQSNPG-YENVDVFTYDEMKIATKQFRPDYILGEGGFGVVYKGIIDDHVRIGYKSTKVAI  114

Query  475  KVL  483
            K L
Sbjct  115  KEL  117



>emb|CDY47586.1| BnaA01g22720D [Brassica napus]
Length=417

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+ F  +Y+LGEGGFG VYKGY
Sbjct  59   SFADLSRSSSARINEDLAE--ALGADLVDFQMCELKMITQCFSRNYLLGEGGFGKVYKGY  116

Query  427  IDENVRVGLKSLPVAVKVL  483
            IDEN R  LK+ PVAVK+L
Sbjct  117  IDENFRQSLKAQPVAVKLL  135



>ref|XP_010473366.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=426

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+SF ++Y+LGEGGFG V+KGY
Sbjct  60   SFADLSRSSSARINEDLAQ--TLGADLVDFQMCELKMITQSFSANYLLGEGGFGKVFKGY  117

Query  427  IDENVRVGLKSLPVAVKVL  483
            +DEN+R  LK+ PVAVK+L
Sbjct  118  MDENLRQSLKAQPVAVKLL  136



>ref|XP_006826299.1| hypothetical protein AMTR_s00004p00068890 [Amborella trichopoda]
 gb|ERM93536.1| hypothetical protein AMTR_s00004p00068890 [Amborella trichopoda]
Length=374

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +1

Query  268  PSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
            PS P+++ED  +N     H+I FT  EL+TIT +FR + +LGEGGFG+VYKG I  N+R 
Sbjct  51   PSDPKEIEDLCRNSAA-KHLIMFTYNELKTITGNFRLENVLGEGGFGSVYKGSIPRNIRE  109

Query  448  GLKSLPVAVKV  480
            GL+ L VAVKV
Sbjct  110  GLEPLQVAVKV  120



>ref|XP_006294280.1| hypothetical protein CARUB_v10023277mg [Capsella rubella]
 gb|EOA27178.1| hypothetical protein CARUB_v10023277mg [Capsella rubella]
Length=424

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P  V D   +      +  FTL EL TIT  F    +LGEGGFG VYKG+
Sbjct  47   SLSDISDPSSPMSVMDDLSHSFTSQKLRLFTLAELRTITHHFSRSNMLGEGGFGPVYKGF  106

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ ++ GL+  PVAVK L
Sbjct  107  IDDKIKPGLEPQPVAVKAL  125



>ref|XP_006850988.1| hypothetical protein AMTR_s00025p00212270 [Amborella trichopoda]
 gb|ERN12569.1| hypothetical protein AMTR_s00025p00212270 [Amborella trichopoda]
Length=515

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 49/73 (67%), Gaps = 3/73 (4%)
 Frame = +1

Query  268  PSTP-RDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVR  444
            P TP R+VED R+  V   H+  FT  E+   TK+FR D ILGEGGFG VYKG IDENVR
Sbjct  44   PLTPKREVEDLRQTSVSNVHI--FTYQEMRLATKNFRPDQILGEGGFGPVYKGLIDENVR  101

Query  445  VGLKSLPVAVKVL  483
             G +S  VA+K L
Sbjct  102  QGFQSTQVAIKEL  114



>ref|XP_010540703.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=422

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED   ++   + ++ F L EL+ IT++F  +Y+LGEGGFG VYKG+
Sbjct  57   SFADLSRSSSARINEDLAHSLGPESDLLDFQLCELKLITQNFSRNYLLGEGGFGKVYKGF  116

Query  427  IDENVRVGLKSLPVAVKVL  483
            +DEN+R GLKS  VAVK+L
Sbjct  117  VDENLRQGLKSQAVAVKLL  135



>emb|CDY26353.1| BnaA03g60290D [Brassica napus]
Length=424

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+ F  +Y+LGEGGFG VYKGY
Sbjct  60   SFADLSRSSSARINEDLAE--ALGADLVDFRMCELKMITQCFFRNYLLGEGGFGKVYKGY  117

Query  427  IDENVRVGLKSLPVAVKVL  483
            IDEN+R  LK+ PVAVK+L
Sbjct  118  IDENLRQSLKAQPVAVKLL  136



>ref|XP_009104830.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Brassica 
rapa]
Length=418

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+ F  +Y+LGEGGFG VYKGY
Sbjct  60   SFADLSRSSSARINEDLAE--ALGADLVDFQMCELKMITQCFSRNYLLGEGGFGKVYKGY  117

Query  427  IDENVRVGLKSLPVAVKVL  483
            IDEN R  LK+ PVAVK+L
Sbjct  118  IDENFRQSLKAQPVAVKLL  136



>ref|XP_007205337.1| hypothetical protein PRUPE_ppa007026mg [Prunus persica]
 gb|EMJ06536.1| hypothetical protein PRUPE_ppa007026mg [Prunus persica]
Length=385

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 65/126 (52%), Gaps = 20/126 (16%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSD----PSTPR  282
            MGNC  R + +V   +                N  +E     S S +   D    PS P 
Sbjct  1    MGNCWVRWKPSVYRVS---------------SNAKSESPKDQSPSVNPREDDSKLPSNPE  45

Query  283  DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSL  462
            +VE  R++      +IAFT  EL+ IT +FR D +LG GGFG+VYKG+I E++R G+  L
Sbjct  46   EVEILRRDSAA-NPLIAFTFSELKIITGNFRQDRMLGGGGFGSVYKGFITEDLREGISPL  104

Query  463  PVAVKV  480
             VAVKV
Sbjct  105  AVAVKV  110



>ref|XP_010429651.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=424

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P  V D   +      +  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  47   SLSDISDPSSPMSVMDDLSHSFTSQKLRMFTLSELRMITHNFSRSNMLGEGGFGPVYKGF  106

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ V+ GL++ PVAVK L
Sbjct  107  IDDKVKPGLEAQPVAVKAL  125



>gb|KDP40692.1| hypothetical protein JCGZ_24691 [Jatropha curcas]
Length=401

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 50/79 (63%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S S+ S P +P  + D   N +   HV  F L ELETIT  F   Y+LGEGGFGTVYKG+
Sbjct  40   SLSEFSYPGSPSSLSDLSTNSIFNLHV--FALKELETITHQFSKRYVLGEGGFGTVYKGF  97

Query  427  IDENVRVGLKSLPVAVKVL  483
            I + +R GLK+  VA KVL
Sbjct  98   ITDKLRPGLKAQSVAGKVL  116



>ref|XP_006391990.1| hypothetical protein EUTSA_v10023477mg [Eutrema salsugineum]
 gb|ESQ29276.1| hypothetical protein EUTSA_v10023477mg [Eutrema salsugineum]
Length=424

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+ F  +Y+LGEGGFG VYKGY
Sbjct  60   SFADLSRSSSVRINEDLAQT--LGVDLVDFQMCELKMITQCFSGNYLLGEGGFGKVYKGY  117

Query  427  IDENVRVGLKSLPVAVKVL  483
            IDEN+R  LK+ PVAVK+L
Sbjct  118  IDENLRQSLKAQPVAVKLL  136



>ref|XP_002516154.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF46156.1| Protein kinase APK1A, chloroplast precursor, putative [Ricinus 
communis]
Length=448

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = +1

Query  244  RSTSDLSDPSTPRDVEDFRKNVV-LYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYK  420
            RS S++S+PS+P  +ED   +      H+ AF   EL TIT+SF    +LGEGGFG VYK
Sbjct  37   RSLSEVSNPSSPLSIEDLSNSFAGPKLHIFAFA--ELRTITQSFSRSNLLGEGGFGPVYK  94

Query  421  GYIDENVRVGLKSLPVAVKVL  483
            G++D+ +R GL + PVAVK L
Sbjct  95   GFVDDKLRPGLAAQPVAVKSL  115



>gb|AAS20959.1| tyrosine kinase [Hyacinthus orientalis]
Length=232

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +1

Query  364  KSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            +SFRSDY+LGEGGFGTVYKGY DEN RVG KSLPVAVKVL
Sbjct  1    ESFRSDYVLGEGGFGTVYKGYTDENARVGSKSLPVAVKVL  40



>emb|CDY03843.1| BnaC01g29600D [Brassica napus]
Length=308

 Score = 76.6 bits (187),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+ F  +Y+LGEGGFG VYKGY
Sbjct  59   SFADLSRSSSARINEDLAE--ALGDDLVDFQMCELKMITQGFSRNYLLGEGGFGKVYKGY  116

Query  427  IDENVRVGLKSLPVAVKVL  483
            IDEN R  LK+ PVAVK+L
Sbjct  117  IDENFRQSLKAQPVAVKLL  135



>ref|NP_001168686.1| uncharacterized LOC100382475 [Zea mays]
 gb|ACN29194.1| unknown [Zea mays]
 gb|AFW87678.1| putative protein kinase superfamily protein [Zea mays]
Length=465

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 69/123 (56%), Gaps = 15/123 (12%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG C ++EE       HR +Q +    + A+   G  K  S S++ + +  P  P+DV D
Sbjct  1    MGGCLSQEE-------HR-LQSRPAEAAGAD---GLRKSKSDSKAVASVLAP--PKDVVD  47

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             +  V  Y +V  FT  EL   TK+FR D ILGEGGFG VYKG IDENVR G  S  VAV
Sbjct  48   LQ--VEGYGNVNIFTYDELRAATKNFRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAV  105

Query  475  KVL  483
            K L
Sbjct  106  KEL  108



>ref|XP_006408733.1| hypothetical protein EUTSA_v10002210mg [Eutrema salsugineum]
 gb|ESQ50186.1| hypothetical protein EUTSA_v10002210mg [Eutrema salsugineum]
Length=427

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P    D   N      +  F++ EL  IT +F    ILGEGGFG VYKG+
Sbjct  60   SLSDISDPSSPMSFMDDLSNSFTSDKLRLFSMSELRVITHNFSRLSILGEGGFGPVYKGF  119

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ V+ GLK+ PVAVK L
Sbjct  120  IDDKVKPGLKAQPVAVKAL  138



>ref|XP_010913798.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Elaeis 
guineensis]
Length=448

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  271  STPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVG  450
            + P+DVED R  +  Y +V  F+  EL   TK+FR D ILGEGGFG VYKG IDENVR G
Sbjct  36   APPKDVEDLRL-IGGYENVNVFSYNELRAATKNFRPDQILGEGGFGIVYKGVIDENVRPG  94

Query  451  LKSLPVAVKVL  483
             KS  VAVK L
Sbjct  95   FKSTYVAVKEL  105



>ref|XP_010472657.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=285

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +D+SDPS+P  V D   +      +  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  47   SLTDISDPSSPMSVMDDLSHSFTSQKLRLFTLSELRMITHNFSRSNMLGEGGFGPVYKGF  106

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ V+ GL++ PVAVK L
Sbjct  107  IDDKVKPGLEAQPVAVKAL  125



>gb|KDO73664.1| hypothetical protein CISIN_1g040050mg, partial [Citrus sinensis]
Length=401

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = +1

Query  211  NVGAEKKHSHSR-STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYI  387
            N   +K+ S  R   SD+S+PS+P   +D   N V+ + +  FTL EL  IT +F    +
Sbjct  26   NEQVDKQTSFQRLCLSDVSNPSSPLSADDL-SNSVIGSKLHVFTLAELRLITSNFSRSNL  84

Query  388  LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            LGEGGFG VYKG++DE ++ GL++ PVAVK L
Sbjct  85   LGEGGFGPVYKGFVDEKLKPGLEAQPVAVKAL  116



>ref|XP_009623825.1| PREDICTED: probable receptor-like protein kinase At5g56460 [Nicotiana 
tomentosiformis]
Length=386

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 69/122 (57%), Gaps = 12/122 (10%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MGNC    + ++      +V    +  S  +++   + +  H++       PS P +VED
Sbjct  1    MGNCCCGGQPSIY-----RVSSNAKSESPKDQSPSQKARIDHTKM------PSNPEEVED  49

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             R++      +IAF+  EL+ +T +FR DY+LG GGFG VYKGY+ E++R G + + VAV
Sbjct  50   LRRSSAA-NPLIAFSFDELKIMTGNFRQDYMLGGGGFGNVYKGYVTEDLRQGFQPITVAV  108

Query  475  KV  480
            KV
Sbjct  109  KV  110



>ref|XP_006452974.1| hypothetical protein CICLE_v10010608mg [Citrus clementina]
 gb|ESR66214.1| hypothetical protein CICLE_v10010608mg [Citrus clementina]
Length=418

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = +1

Query  211  NVGAEKKHSHSR-STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYI  387
            N   +K+ S  R   SD+S+PS+P   +D   N V+ + +  FTL EL  IT +F    +
Sbjct  26   NEQVDKQTSFQRLCLSDVSNPSSPLSADDL-SNSVIGSKLHVFTLAELRLITSNFSRSNL  84

Query  388  LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            LGEGGFG VYKG++DE ++ GL++ PVAVK L
Sbjct  85   LGEGGFGPVYKGFVDEKLKPGLEAQPVAVKAL  116



>ref|XP_006474675.1| PREDICTED: putative receptor-like protein kinase At1g72540-like 
[Citrus sinensis]
Length=418

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = +1

Query  211  NVGAEKKHSHSR-STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYI  387
            N   +K+ S  R   SD+S+PS+P   +D   N V+ + +  FTL EL  IT +F    +
Sbjct  26   NEQVDKQTSFQRLCLSDVSNPSSPLSADDL-SNSVIGSKLHVFTLAELRLITSNFSRSNL  84

Query  388  LGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            LGEGGFG VYKG++DE ++ GL++ PVAVK L
Sbjct  85   LGEGGFGPVYKGFVDEKLKPGLEAQPVAVKAL  116



>ref|XP_006408732.1| hypothetical protein EUTSA_v10002290mg [Eutrema salsugineum]
 gb|ESQ50185.1| hypothetical protein EUTSA_v10002290mg [Eutrema salsugineum]
Length=429

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P    D   N      +  F++ EL  IT +F    ILGEGGFG VYKG+
Sbjct  43   SLSDISDPSSPMSFMDDLSNSFTSDKLRLFSMSELRVITHNFSRLSILGEGGFGPVYKGF  102

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ V+ GLK+ PVAVK L
Sbjct  103  IDDKVKPGLKAQPVAVKAL  121



>ref|XP_010417417.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=424

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P  V D   +      +  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  47   SLSDISDPSSPMSVMDDLSHSFTSQKLRLFTLSELRMITHNFSRSNMLGEGGFGPVYKGF  106

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ V+ GL+  PVAVK L
Sbjct  107  IDDKVKPGLEPQPVAVKAL  125



>ref|XP_011036441.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Populus 
euphratica]
Length=449

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = +1

Query  235  SHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTV  414
            S   S SDLS+P +P    D   ++    HV  FTL EL+T+T  F     LGEGGFG V
Sbjct  30   SQRLSLSDLSNPVSPISFSDLSISI-FNLHV--FTLKELQTVTNEFSKSNYLGEGGFGAV  86

Query  415  YKGYIDENVRVGLKSLPVAVKVL  483
            YKG+ID+ +R GLK+ PVAVKVL
Sbjct  87   YKGFIDDKLRPGLKAQPVAVKVL  109



>ref|NP_001150204.1| protein kinase APK1B [Zea mays]
 ref|XP_008647910.1| PREDICTED: protein kinase APK1B isoform X1 [Zea mays]
 gb|ACG38242.1| protein kinase APK1B [Zea mays]
 gb|AFW76095.1| putative protein kinase superfamily protein [Zea mays]
Length=465

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 68/123 (55%), Gaps = 15/123 (12%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG C ++EE       HR    Q +    A  + G +K  S S++T+ +  P  P+ V D
Sbjct  1    MGGCFSQEE-------HRL---QSRPAEAAGPD-GLQKSKSDSKATASVLAP--PKAVVD  47

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             +  V  Y +V  FT  EL   TK+FR D ILGEGGFG VYKG IDENVR G  S  VAV
Sbjct  48   LQ--VEGYGNVNIFTYDELSAATKNFRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAV  105

Query  475  KVL  483
            K L
Sbjct  106  KEL  108



>ref|XP_002304131.1| hypothetical protein POPTR_0003s06450g [Populus trichocarpa]
 gb|EEE79110.1| hypothetical protein POPTR_0003s06450g [Populus trichocarpa]
Length=434

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = +1

Query  235  SHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTV  414
            S   S SDLS+P +P    D   ++    HV  FTL EL+T+T  F     LGEGGFG V
Sbjct  30   SQRLSLSDLSNPVSPISFSDLSISI-FNLHV--FTLKELQTVTNEFSKSNYLGEGGFGAV  86

Query  415  YKGYIDENVRVGLKSLPVAVKVL  483
            YKG+ID+ +R GLK+ PVAVKVL
Sbjct  87   YKGFIDDKLRPGLKAQPVAVKVL  109



>gb|KJB07389.1| hypothetical protein B456_001G019500 [Gossypium raimondii]
Length=422

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P  V D   ++   +++  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  41   SLSDVSDPSSPICVNDLSTSL-FGSNLYVFTLAELRLITHNFARCNLLGEGGFGPVYKGF  99

Query  427  IDENVRVGLKSLPVAVKVL  483
            +D+ +R GLK+ PVAVK L
Sbjct  100  VDDKLRPGLKAQPVAVKTL  118



>ref|XP_010261848.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Nelumbo 
nucifera]
Length=478

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +D+++P +P   +D   N V+ +++ AF L EL  IT+SF S  ILGEGGFG V+KG+
Sbjct  38   SLTDINNPGSPLSADDI-SNSVIGSNLHAFMLAELRVITQSFSSSNILGEGGFGPVHKGF  96

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ +R GLK+  VAVK+L
Sbjct  97   IDDKLRPGLKAQAVAVKLL  115



>ref|XP_011010264.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Populus euphratica]
Length=500

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 64/118 (54%), Gaps = 9/118 (8%)
 Frame = +1

Query  154  STAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSD--------LSDPSTPRDVEDFRKNV  309
            ST + ++ Q+ Q LS      G +   S + S            S PS P++V D R N 
Sbjct  20   STDNDKMPQERQRLSSKGNQAGHDYDQSPTISNGPELVEIKRTSSIPSIPKNVTDLR-NS  78

Query  310  VLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
              Y +V  FT  E+   TK FR DYILGEGGFG VYKG +DE+VR G K+  VA+K L
Sbjct  79   PGYGNVDIFTYKEMTLATKHFRPDYILGEGGFGAVYKGVLDESVRPGYKTTYVAIKEL  136



>ref|NP_180197.1| root-specific kinase 1 [Arabidopsis thaliana]
 gb|AAC14522.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEC07819.1| root-specific kinase 1 [Arabidopsis thaliana]
Length=424

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P  V D   +      +  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  47   SLSDISDPSSPMSVMDDLSHSFTSQKLRLFTLSELRVITHNFSRSNMLGEGGFGPVYKGF  106

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ V+ G+++ PVAVK L
Sbjct  107  IDDKVKPGIEAQPVAVKAL  125



>ref|XP_011019948.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Populus euphratica]
Length=483

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 64/118 (54%), Gaps = 9/118 (8%)
 Frame = +1

Query  154  STAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSD--------LSDPSTPRDVEDFRKNV  309
            ST + ++ Q+ Q LS      G +   S + S            S PS P++V D R N 
Sbjct  20   STDNDKMPQERQRLSSKGNQAGHDYDQSPTISNGPELVEIKRTSSIPSIPKNVTDLR-NS  78

Query  310  VLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
              Y +V  FT  E+   TK FR DYILGEGGFG VYKG +DE+VR G K+  VA+K L
Sbjct  79   PGYGNVDIFTYKEMTLATKHFRPDYILGEGGFGAVYKGVLDESVRPGYKTTYVAIKEL  136



>gb|KJB83341.1| hypothetical protein B456_013G242000 [Gossypium raimondii]
Length=393

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +1

Query  274  TPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGL  453
            T +DV+D R+N   Y++V  F+  E+   TK FR DYILG+GGFG VYKG IDENVR   
Sbjct  16   TAKDVKDLRQNPG-YSNVDIFSYQEMRLATKQFRPDYILGDGGFGVVYKGVIDENVRPAY  74

Query  454  KSLPVAVKVL  483
            KS  VAVK L
Sbjct  75   KSTAVAVKEL  84



>gb|KJB07390.1| hypothetical protein B456_001G019500 [Gossypium raimondii]
Length=448

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P  V D   ++   +++  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  41   SLSDVSDPSSPICVNDLSTSL-FGSNLYVFTLAELRLITHNFARCNLLGEGGFGPVYKGF  99

Query  427  IDENVRVGLKSLPVAVKVL  483
            +D+ +R GLK+ PVAVK L
Sbjct  100  VDDKLRPGLKAQPVAVKTL  118



>ref|XP_002297616.2| kinase family protein [Populus trichocarpa]
 gb|EEE82421.2| kinase family protein [Populus trichocarpa]
Length=398

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 68/124 (55%), Gaps = 20/124 (16%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVAN-KNVGAEKKHSHSRSTSDLSD-PSTPRDV  288
            MGNC  R E                 LSV N K+V  +++    R   D    PS P +V
Sbjct  1    MGNCCCRWE-----------------LSVYNAKSVSPKEQGPSGRPIQDDRKLPSNPEEV  43

Query  289  EDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPV  468
            ED R++      +IAFT  EL+ IT++FR D++LG GGFG+VYKG I ++ R  L+ L V
Sbjct  44   EDLRRDSAA-NPLIAFTFDELKLITENFRQDHLLGGGGFGSVYKGIIAKDSREELQPLQV  102

Query  469  AVKV  480
            AVKV
Sbjct  103  AVKV  106



>ref|XP_002886527.1| hypothetical protein ARALYDRAFT_475168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62786.1| hypothetical protein ARALYDRAFT_475168 [Arabidopsis lyrata subsp. 
lyrata]
Length=424

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S +DLS  S+ R  ED  +   L   ++ F + EL+ IT+SF  +Y+LGEGGFG VYKGY
Sbjct  60   SFTDLSRSSSARINEDLAQ--TLGADLVDFQMCELKMITQSFSGNYLLGEGGFGKVYKGY  117

Query  427  IDENVRVGLKSLPVAVKVL  483
            + EN+R  LK+ PVAVK+L
Sbjct  118  VHENLRQSLKAQPVAVKLL  136



>ref|XP_010098385.1| Serine/threonine-protein kinase [Morus notabilis]
 gb|EXB74909.1| Serine/threonine-protein kinase [Morus notabilis]
Length=430

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P   +D   N ++ + +  F+L EL+ IT +F    +LGEGGFG VYKG+
Sbjct  39   SISDVSDPSSPLFADDL-SNSLIGSKLHVFSLAELKDITNNFSWSNLLGEGGFGPVYKGF  97

Query  427  IDENVRVGLKSLPVAVKVL  483
            +DE +R GL + PVAVK+L
Sbjct  98   VDEKLRPGLVAQPVAVKLL  116



>gb|AAA81538.1| serine/threonine protein kinase [Arabidopsis thaliana]
Length=425

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P  V D   +      +  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  47   SLSDISDPSSPMSVMDDLSHSFTSQKLRLFTLSELRVITHNFSRSNMLGEGGFGPVYKGF  106

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ V+ G+++ PVAVK L
Sbjct  107  IDDKVKPGIEAQPVAVKAL  125



>gb|KDP34015.1| hypothetical protein JCGZ_07586 [Jatropha curcas]
Length=441

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 3/87 (3%)
 Frame = +1

Query  229  KHSHSR--STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGG  402
            KH+  R  S +D+S+PS+P  VED   N      +  FT  EL  IT+SF    +LGEGG
Sbjct  30   KHNSFRRLSLTDVSNPSSPLCVEDL-SNSFAGPKLHIFTFAELRIITQSFARINLLGEGG  88

Query  403  FGTVYKGYIDENVRVGLKSLPVAVKVL  483
            FG VYKG+ID+ +R GLK+ PVAVK L
Sbjct  89   FGPVYKGFIDDKLRPGLKAQPVAVKSL  115



>ref|XP_010548490.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Tarenaya 
hassleriana]
Length=429

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P  V D   N      +  FTL EL  IT  F    +LGEGGFG VYKG+
Sbjct  52   SLSDISDPSSPMSVVDDLSNSFTCQKLHVFTLSELRVITHGFSRSNMLGEGGFGPVYKGF  111

Query  427  IDENVRVGLKSLPVAVKVL  483
            +D+ ++ GL + PVAVK L
Sbjct  112  VDDKLKPGLDAQPVAVKAL  130



>ref|XP_002880775.1| root-specific kinase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57034.1| root-specific kinase 1 [Arabidopsis lyrata subsp. lyrata]
Length=423

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +1

Query  247  STSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGY  426
            S SD+SDPS+P  V D   +      +  FTL EL  IT +F    +LGEGGFG VYKG+
Sbjct  47   SLSDISDPSSPMSVMDDLSHSFTSQKLRLFTLSELRVITHNFSRSNMLGEGGFGPVYKGF  106

Query  427  IDENVRVGLKSLPVAVKVL  483
            ID+ V+ G+++ PVAVK L
Sbjct  107  IDDKVKPGIEAQPVAVKAL  125



>ref|XP_006586718.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Glycine max]
 gb|KHN11807.1| Serine/threonine-protein kinase [Glycine soja]
Length=423

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  325  VIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            +  F L EL  IT++F S+++LGEGGFGTV+KGYID+N+R+GLK+ PVAVK+L
Sbjct  78   LFDFQLIELRAITQNFSSNFLLGEGGFGTVHKGYIDDNLRLGLKAQPVAVKLL  130



>ref|XP_010928728.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Elaeis guineensis]
Length=379

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  271  STPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVG  450
            + P+DV+D R  +  Y +V  FT  EL   TK+FR D ILG+GGFG VYKG IDEN+R G
Sbjct  38   APPKDVDDLRL-IGGYGNVNVFTYSELRAATKNFRPDQILGQGGFGVVYKGVIDENIRTG  96

Query  451  LKSLPVAVKVL  483
             KS  VAVK L
Sbjct  97   FKSTHVAVKEL  107



>ref|XP_011010263.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Populus euphratica]
Length=501

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +1

Query  268  PSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
            PS P++V D R N   Y +V  FT  E+   TK FR DYILGEGGFG VYKG +DE+VR 
Sbjct  67   PSIPKNVTDLR-NSPGYGNVDIFTYKEMTLATKHFRPDYILGEGGFGAVYKGVLDESVRP  125

Query  448  GLKSLPVAVKVL  483
            G K+  VA+K L
Sbjct  126  GYKTTYVAIKEL  137



>ref|XP_011010265.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X3 [Populus euphratica]
Length=499

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +1

Query  262  SDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENV  441
            S PS P++V D R N   Y +V  FT  E+   TK FR DYILGEGGFG VYKG +DE+V
Sbjct  63   SIPSIPKNVTDLR-NSPGYGNVDIFTYKEMTLATKHFRPDYILGEGGFGAVYKGVLDESV  121

Query  442  RVGLKSLPVAVKVL  483
            R G K+  VA+K L
Sbjct  122  RPGYKTTYVAIKEL  135



>ref|XP_011019949.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X3 [Populus euphratica]
Length=482

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +1

Query  262  SDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENV  441
            S PS P++V D R N   Y +V  FT  E+   TK FR DYILGEGGFG VYKG +DE+V
Sbjct  63   SIPSIPKNVTDLR-NSPGYGNVDIFTYKEMTLATKHFRPDYILGEGGFGAVYKGVLDESV  121

Query  442  RVGLKSLPVAVKVL  483
            R G K+  VA+K L
Sbjct  122  RPGYKTTYVAIKEL  135



>ref|XP_011019947.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Populus euphratica]
Length=484

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +1

Query  262  SDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENV  441
            S PS P++V D R N   Y +V  FT  E+   TK FR DYILGEGGFG VYKG +DE+V
Sbjct  65   SIPSIPKNVTDLR-NSPGYGNVDIFTYKEMTLATKHFRPDYILGEGGFGAVYKGVLDESV  123

Query  442  RVGLKSLPVAVKVL  483
            R G K+  VA+K L
Sbjct  124  RPGYKTTYVAIKEL  137



>ref|XP_010928727.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Elaeis guineensis]
Length=392

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  271  STPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVG  450
            + P+DV+D R  +  Y +V  FT  EL   TK+FR D ILG+GGFG VYKG IDEN+R G
Sbjct  38   APPKDVDDLRL-IGGYGNVNVFTYSELRAATKNFRPDQILGQGGFGVVYKGVIDENIRTG  96

Query  451  LKSLPVAVKVL  483
             KS  VAVK L
Sbjct  97   FKSTHVAVKEL  107



>ref|NP_001240045.1| serine/threonine-protein kinase At5g01020-like [Glycine max]
 gb|ACM89551.1| protein kinase [Glycine max]
Length=420

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +1

Query  334  FTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            F L EL  IT++F S+++LGEGGFGTV+KGYID+N+R+GLK+ PVAVK+L
Sbjct  81   FQLIELRAITQNFSSNFLLGEGGFGTVHKGYIDDNLRLGLKAQPVAVKLL  130



>gb|AAL87287.1| putative protein kinase [Arabidopsis thaliana]
Length=442

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +1

Query  268  PSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
            P   ++++D + N   Y +V  FT  E++  TK FR DYILGEGGFG VYKG IDE+VRV
Sbjct  57   PLAQKNIKDLQSNPG-YENVDIFTYEEMKIATKQFRPDYILGEGGFGVVYKGVIDESVRV  115

Query  448  GLKSLPVAVKVL  483
            G KS  VA+K L
Sbjct  116  GFKSTKVAIKEL  127



>ref|XP_008789617.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Phoenix 
dactylifera]
Length=379

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +1

Query  241  SRSTSDL----SDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFG  408
            S++ SD+    S  + P+DV+D R  +  Y +V  FT  EL   TK+FR D ILGEGGFG
Sbjct  22   SKAASDVHGVVSVLAPPKDVDDLRL-IGGYGNVNIFTYRELRAATKNFRPDQILGEGGFG  80

Query  409  TVYKGYIDENVRVGLKSLPVAVKVL  483
             VYKG +DEN+R G KS  VAVK L
Sbjct  81   IVYKGVVDENIRTGFKSTHVAVKEL  105



>ref|XP_008802464.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Phoenix 
dactylifera]
Length=419

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 63/99 (64%), Gaps = 1/99 (1%)
 Frame = +1

Query  187  QGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITK  366
            +G SV  K + A++K     S SDLS+ +     ED   ++V  +++  FTL EL+  T+
Sbjct  23   EGPSVRPKKLAAKQKSLQRLSYSDLSNSTGMLSPEDLSISLV-GSNLYVFTLAELKVATQ  81

Query  367  SFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            SF +   LGEGGFG VYKG++DE V+ GLK+  VAVK+L
Sbjct  82   SFSTSNFLGEGGFGPVYKGFVDEKVKPGLKAQSVAVKLL  120



>ref|XP_006849707.1| hypothetical protein AMTR_s00024p00242070 [Amborella trichopoda]
 gb|ERN11288.1| hypothetical protein AMTR_s00024p00242070 [Amborella trichopoda]
Length=419

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 60/93 (65%), Gaps = 5/93 (5%)
 Frame = +1

Query  205  NKNVGAEKKHSHSRSTSDLSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDY  384
            NK V A++      S SDLSDP     VED   ++    H   FTL EL+ IT++F + +
Sbjct  23   NKRVVAKQTSFQRLSFSDLSDPFL---VEDLSLSLGSSLH--NFTLSELKAITQNFSASF  77

Query  385  ILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            +LGEGGFG V+KGYID+ +R GLK+  VAVK+L
Sbjct  78   LLGEGGFGPVHKGYIDDKLRPGLKAQAVAVKLL  110



>ref|XP_010467147.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Camelina 
sativa]
Length=407

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 1/70 (1%)
 Frame = +1

Query  274  TPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGL  453
             P++++D + N   Y +V  FT  E++  TK FR DYILGEGGFG VYKG IDE+VR G 
Sbjct  23   APKNIKDLQSNPG-YENVDIFTYEEMKVATKQFRPDYILGEGGFGVVYKGVIDESVRAGY  81

Query  454  KSLPVAVKVL  483
            KS  VA+K L
Sbjct  82   KSTKVAIKEL  91



>gb|KDO73358.1| hypothetical protein CISIN_1g046893mg [Citrus sinensis]
Length=464

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +1

Query  226  KKHSHSRSTSDLSDPSTPR-DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGG  402
            K  S S+ T     P  P+ +V D R+N   Y++V  FT  E++  TK FR DYILGEGG
Sbjct  46   KTASGSQVTPKNVTPVPPKKNVNDLRQNPG-YSNVDIFTYNEMKLATKFFRPDYILGEGG  104

Query  403  FGTVYKGYIDENVRVGLKSLPVAVKVL  483
            FG VYKG IDENVR G K+  VA+K L
Sbjct  105  FGVVYKGVIDENVRPGYKTTFVAIKEL  131



>ref|XP_010490188.1| PREDICTED: serine/threonine-protein kinase At5g01020-like, partial 
[Camelina sativa]
Length=270

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 66/135 (49%), Gaps = 24/135 (18%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPS-------  273
            MG C + EE    S      QQ  Q      K     KK +     SD  D S       
Sbjct  1    MGICFSAEEQYQFSQ-----QQNYQ------KKTTPGKKSAVYLMKSDCQDSSVGKVSAS  49

Query  274  -----TPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDEN  438
                  P++++D + N   Y +V  FT  E++  TK FR DYILGEGGFG VYKG ID++
Sbjct  50   GGLSLAPKNIKDLQSNPG-YENVDIFTYEEMKVATKQFRPDYILGEGGFGVVYKGVIDDS  108

Query  439  VRVGLKSLPVAVKVL  483
            VR G KS  VA+K L
Sbjct  109  VRAGYKSTKVAIKEL  123



>ref|XP_002438802.1| hypothetical protein SORBIDRAFT_10g026500 [Sorghum bicolor]
 gb|EER90169.1| hypothetical protein SORBIDRAFT_10g026500 [Sorghum bicolor]
Length=466

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 66/123 (54%), Gaps = 15/123 (12%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPSTPRDVED  294
            MG C ++EE       HR    Q +    A  + G  K  S S+  + +  P  P+DV D
Sbjct  1    MGGCFSQEE-------HRL---QSRPAEAAGPD-GLRKSKSDSKVIASVLAP--PKDVVD  47

Query  295  FRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAV  474
             +  V  Y +V  FT  EL   TK+FR D ILGEGGFG VYKG IDENVR G  S  VAV
Sbjct  48   LQ--VEGYGNVNIFTYDELRAATKNFRPDQILGEGGFGVVYKGVIDENVRAGFPSRQVAV  105

Query  475  KVL  483
            K L
Sbjct  106  KEL  108



>ref|XP_006453166.1| hypothetical protein CICLE_v10008173mg [Citrus clementina]
 ref|XP_006474344.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Citrus sinensis]
 gb|ESR66406.1| hypothetical protein CICLE_v10008173mg [Citrus clementina]
Length=474

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +1

Query  226  KKHSHSRSTSDLSDPSTPR-DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGG  402
            K  S S+ T     P  P+ +V D R+N   Y++V  FT  E++  TK FR DYILGEGG
Sbjct  56   KTASGSQVTPKNVTPVPPKKNVNDLRQNPG-YSNVDIFTYNEMKLATKFFRPDYILGEGG  114

Query  403  FGTVYKGYIDENVRVGLKSLPVAVKVL  483
            FG VYKG IDENVR G K+  VA+K L
Sbjct  115  FGVVYKGVIDENVRPGYKTTFVAIKEL  141



>ref|XP_006453165.1| hypothetical protein CICLE_v10008173mg [Citrus clementina]
 ref|XP_006474345.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X2 [Citrus sinensis]
 gb|ESR66405.1| hypothetical protein CICLE_v10008173mg [Citrus clementina]
Length=469

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +1

Query  226  KKHSHSRSTSDLSDPSTPR-DVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGG  402
            K  S S+ T     P  P+ +V D R+N   Y++V  FT  E++  TK FR DYILGEGG
Sbjct  51   KTASGSQVTPKNVTPVPPKKNVNDLRQNPG-YSNVDIFTYNEMKLATKFFRPDYILGEGG  109

Query  403  FGTVYKGYIDENVRVGLKSLPVAVKVL  483
            FG VYKG IDENVR G K+  VA+K L
Sbjct  110  FGVVYKGVIDENVRPGYKTTFVAIKEL  136



>ref|XP_009410246.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=410

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 1/75 (1%)
 Frame = +1

Query  259  LSDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDEN  438
            +S P T +DVEDFR+ +  Y +V  FT  EL   TK+FR D +LGEGGFG VYKG ID+N
Sbjct  53   VSLPVTIKDVEDFRQ-MPGYGNVQTFTYEELRLATKNFRPDLVLGEGGFGLVYKGTIDDN  111

Query  439  VRVGLKSLPVAVKVL  483
            VR G +   VAVK L
Sbjct  112  VRPGFEYTQVAVKRL  126



>ref|XP_009381911.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Musa 
acuminata subsp. malaccensis]
Length=355

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +1

Query  268  PSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRV  447
            P T +DVEDFR+ +  Y +V  FT  EL   T +FR+D ILGEGGFG VYKG ID N+R 
Sbjct  9    PVTIKDVEDFRQ-MPGYGNVQIFTYDELRLATNNFRADLILGEGGFGLVYKGVIDANIRP  67

Query  448  GLKSLPVAVKVL  483
            G K   VAVK L
Sbjct  68   GFKCTQVAVKKL  79



>ref|XP_010413117.1| PREDICTED: serine/threonine-protein kinase At5g01020-like isoform 
X1 [Camelina sativa]
Length=439

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 68/135 (50%), Gaps = 23/135 (17%)
 Frame = +1

Query  115  MGNCGTREESAVVSTAHRQVQQQLQGLSVANKNVGAEKKHSHSRSTSDLSDPS-------  273
            MG C + EE    S      QQQ    +   K   A KK +     SD  D S       
Sbjct  1    MGICFSAEEQYQFS------QQQ----NYQKKTSPAGKKTAVYLMKSDCQDSSVGKVSAS  50

Query  274  -----TPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDEN  438
                  P++++D + N   Y +V  FT  E++  TK FR DYILGEGGFG VYKG ID++
Sbjct  51   GGLSLAPKNIKDLQSNPG-YENVDIFTYEEMKVATKQFRPDYILGEGGFGVVYKGVIDDS  109

Query  439  VRVGLKSLPVAVKVL  483
            VR G KS  VA+K L
Sbjct  110  VRAGYKSTKVAIKEL  124



>ref|XP_011017590.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X1 [Populus euphratica]
Length=554

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +1

Query  262  SDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENV  441
            S PS P++V D R N   Y +V  FT  E++  TK FR DYILGEGGFG VYKG IDE+V
Sbjct  70   STPSVPKNVTDLR-NSPGYGNVDIFTYEEMKLATKQFRPDYILGEGGFGVVYKGVIDESV  128

Query  442  RVGLKSLPVAVKVL  483
            R   K+  VA+K L
Sbjct  129  RTLYKTTYVAIKEL  142



>ref|XP_003516498.1| PREDICTED: serine/threonine-protein kinase At5g01020-like [Glycine 
max]
Length=420

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  325  VIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            +  F L EL  IT++F S+++LGEGGFGTV+KGYID+N+R+GLK+ PVAVK+L
Sbjct  75   LFDFQLSELRAITQNFSSNFLLGEGGFGTVHKGYIDDNLRLGLKAQPVAVKLL  127



>ref|XP_006372245.1| hypothetical protein POPTR_0018s14590g [Populus trichocarpa]
 gb|ERP50042.1| hypothetical protein POPTR_0018s14590g [Populus trichocarpa]
Length=523

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +1

Query  262  SDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENV  441
            S PS P++V D R N   Y +V  FT  E++  TK FR DYILGEGGFG VYKG IDE+V
Sbjct  38   STPSVPKNVTDLR-NSPGYGNVDIFTYEEMKLATKQFRPDYILGEGGFGVVYKGVIDESV  96

Query  442  RVGLKSLPVAVKVL  483
            R   K+  VA+K L
Sbjct  97   RTLYKTTYVAIKEL  110



>ref|XP_011017591.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform 
X2 [Populus euphratica]
Length=553

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +1

Query  262  SDPSTPRDVEDFRKNVVLYTHVIAFTLFELETITKSFRSDYILGEGGFGTVYKGYIDENV  441
            S PS P++V D R N   Y +V  FT  E++  TK FR DYILGEGGFG VYKG IDE+V
Sbjct  69   STPSVPKNVTDLR-NSPGYGNVDIFTYEEMKLATKQFRPDYILGEGGFGVVYKGVIDESV  127

Query  442  RVGLKSLPVAVKVL  483
            R   K+  VA+K L
Sbjct  128  RTLYKTTYVAIKEL  141



>gb|KHG06266.1| hypothetical protein F383_01154 [Gossypium arboreum]
Length=440

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 60/105 (57%), Gaps = 10/105 (10%)
 Frame = +1

Query  196  SVANKNVGAEKKHSHSRSTSDLSDP--STP-------RDVEDFRKNVVLYTHVIAFTLFE  348
            S++N   G  K  + SR+    + P   TP       +DV+D R+N   Y++V  F+  E
Sbjct  14   SLSNPPDGGHKTSASSRNQEMANSPITKTPSFIALTAKDVKDLRQNPG-YSNVDIFSYQE  72

Query  349  LETITKSFRSDYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVL  483
            +   TK FR DYILG+GGFG VYKG ID NVR   KS  VAVK L
Sbjct  73   MRLATKQFRPDYILGDGGFGVVYKGVIDGNVRPAYKSTAVAVKEL  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550