BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K22

Length=584
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008453712.1|  PREDICTED: transmembrane and coiled-coil dom...    135   2e-33   Cucumis melo [Oriental melon]
ref|XP_004164664.1|  PREDICTED: transmembrane and coiled-coil dom...    130   2e-31   
ref|XP_004234544.1|  PREDICTED: transmembrane and coiled-coil dom...    127   1e-30   Solanum lycopersicum
ref|XP_010317300.1|  PREDICTED: uncharacterized protein LOC104646015    124   4e-30   
gb|EYU24080.1|  hypothetical protein MIMGU_mgv1a002505mg                126   5e-30   Erythranthe guttata [common monkey flower]
ref|XP_006343378.1|  PREDICTED: transmembrane and coiled-coil dom...    126   6e-30   Solanum tuberosum [potatoes]
ref|XP_007046758.1|  Transmembrane and coiled-coil domain-contain...    123   6e-29   
gb|KDO71092.1|  hypothetical protein CISIN_1g006082mg                   122   6e-29   Citrus sinensis [apfelsine]
gb|KDO71087.1|  hypothetical protein CISIN_1g006082mg                   122   1e-28   Citrus sinensis [apfelsine]
ref|XP_006466894.1|  PREDICTED: transmembrane and coiled-coil dom...    122   1e-28   
ref|XP_006425555.1|  hypothetical protein CICLE_v10025097mg             122   1e-28   
gb|KJB43386.1|  hypothetical protein B456_007G197400                    122   2e-28   Gossypium raimondii
ref|XP_007157950.1|  hypothetical protein PHAVU_002G111800g             122   2e-28   Phaseolus vulgaris [French bean]
ref|XP_010446814.1|  PREDICTED: transmembrane and coiled-coil dom...    120   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009600609.1|  PREDICTED: transmembrane and coiled-coil dom...    120   7e-28   Nicotiana tomentosiformis
ref|XP_010033460.1|  PREDICTED: transmembrane and coiled-coil dom...    119   1e-27   Eucalyptus grandis [rose gum]
ref|NP_001078500.2|  uncharacterized protein                            119   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KCW53100.1|  hypothetical protein EUGRSUZ_J02394                     119   1e-27   Eucalyptus grandis [rose gum]
ref|XP_009789372.1|  PREDICTED: transmembrane and coiled-coil dom...    119   2e-27   Nicotiana sylvestris
ref|XP_010437365.1|  PREDICTED: transmembrane and coiled-coil dom...    119   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_011090424.1|  PREDICTED: transmembrane and coiled-coil dom...    119   2e-27   Sesamum indicum [beniseed]
emb|CDP01935.1|  unnamed protein product                                118   3e-27   Coffea canephora [robusta coffee]
gb|KHG22516.1|  Transmembrane and coiled-coil domain-containing 4       118   3e-27   Gossypium arboreum [tree cotton]
ref|XP_010432190.1|  PREDICTED: transmembrane and coiled-coil dom...    118   4e-27   
gb|KDP46691.1|  hypothetical protein JCGZ_06479                         117   7e-27   Jatropha curcas
emb|CAN59788.1|  hypothetical protein VITISV_012480                     117   9e-27   Vitis vinifera
ref|XP_010649079.1|  PREDICTED: transmembrane and coiled-coil dom...    117   9e-27   Vitis vinifera
ref|XP_010649080.1|  PREDICTED: transmembrane and coiled-coil dom...    117   1e-26   
ref|XP_009615488.1|  PREDICTED: transmembrane and coiled-coil dom...    116   1e-26   Nicotiana tomentosiformis
ref|XP_011100949.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    116   2e-26   Sesamum indicum [beniseed]
gb|EYU31146.1|  hypothetical protein MIMGU_mgv1a002490mg                116   2e-26   Erythranthe guttata [common monkey flower]
ref|XP_009411496.1|  PREDICTED: transmembrane and coiled-coil dom...    116   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006412018.1|  hypothetical protein EUTSA_v10024597mg             115   4e-26   
emb|CDX69212.1|  BnaC01g02410D                                          115   5e-26   
gb|KFK30255.1|  hypothetical protein AALP_AA7G237500                    114   1e-25   Arabis alpina [alpine rockcress]
ref|XP_009757145.1|  PREDICTED: transmembrane and coiled-coil dom...    114   1e-25   Nicotiana sylvestris
ref|XP_003612113.1|  Transmembrane and coiled-coil domain-contain...    110   3e-25   
ref|XP_004287838.1|  PREDICTED: transmembrane and coiled-coil dom...    112   4e-25   Fragaria vesca subsp. vesca
gb|AES95070.2|  transmembrane and coiled-coil protein                   111   1e-24   Medicago truncatula
ref|XP_006340700.1|  PREDICTED: transmembrane and coiled-coil dom...    110   1e-24   Solanum tuberosum [potatoes]
ref|XP_003612112.1|  Transmembrane and coiled-coil domain-contain...    111   2e-24   
ref|XP_006283267.1|  hypothetical protein CARUB_v10004298mg             110   2e-24   Capsella rubella
ref|XP_004512102.1|  PREDICTED: transmembrane and coiled-coil dom...    108   4e-24   
emb|CDX75561.1|  BnaA01g01410D                                          108   5e-24   
ref|XP_009146060.1|  PREDICTED: transmembrane and coiled-coil dom...    109   6e-24   Brassica rapa
ref|XP_004512101.1|  PREDICTED: transmembrane and coiled-coil dom...    108   1e-23   
ref|XP_004512100.1|  PREDICTED: transmembrane and coiled-coil dom...    108   1e-23   Cicer arietinum [garbanzo]
ref|XP_010263882.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    107   4e-23   
ref|XP_010526787.1|  PREDICTED: transmembrane and coiled-coil dom...    106   8e-23   Tarenaya hassleriana [spider flower]
ref|XP_002533809.1|  conserved hypothetical protein                     105   1e-22   Ricinus communis
ref|XP_010113393.1|  hypothetical protein L484_026725                   103   7e-22   
ref|XP_011025906.1|  PREDICTED: transmembrane and coiled-coil dom...    103   8e-22   Populus euphratica
ref|XP_004146487.1|  PREDICTED: transmembrane and coiled-coil dom...    103   9e-22   
ref|XP_010933754.1|  PREDICTED: uncharacterized membrane protein ...    102   9e-22   
ref|XP_006573571.1|  PREDICTED: transmembrane and coiled-coil dom...    102   1e-21   
ref|XP_010933753.1|  PREDICTED: transmembrane and coiled-coil dom...    102   1e-21   
ref|XP_003548861.1|  PREDICTED: transmembrane and coiled-coil dom...    102   2e-21   Glycine max [soybeans]
gb|KHN41681.1|  Transmembrane and coiled-coil domain-containing p...    102   2e-21   Glycine soja [wild soybean]
ref|XP_010933752.1|  PREDICTED: transmembrane and coiled-coil dom...    102   2e-21   
ref|XP_003517195.1|  PREDICTED: transmembrane and coiled-coil dom...    102   2e-21   Glycine max [soybeans]
ref|XP_010933751.1|  PREDICTED: transmembrane and coiled-coil dom...    102   2e-21   Elaeis guineensis
ref|XP_007156109.1|  hypothetical protein PHAVU_003G259400g             102   2e-21   Phaseolus vulgaris [French bean]
ref|XP_006380790.1|  hypothetical protein POPTR_0007s13750g             101   3e-21   
ref|XP_008241785.1|  PREDICTED: transmembrane and coiled-coil dom...    101   4e-21   Prunus mume [ume]
ref|XP_006829156.1|  hypothetical protein AMTR_s00001p00269860          100   5e-21   Amborella trichopoda
ref|XP_002310840.1|  hypothetical protein POPTR_0007s13750g             100   6e-21   
ref|XP_011015560.1|  PREDICTED: transmembrane and coiled-coil dom...    100   7e-21   Populus euphratica
ref|XP_003629356.1|  hypothetical protein MTR_8g076240                97.8    1e-20   
ref|XP_003520272.1|  PREDICTED: transmembrane and coiled-coil dom...  98.6    4e-20   Glycine max [soybeans]
ref|XP_007204629.1|  hypothetical protein PRUPE_ppa002119mg           98.2    5e-20   Prunus persica
ref|XP_010679841.1|  PREDICTED: transmembrane and coiled-coil dom...  97.8    6e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009338652.1|  PREDICTED: transmembrane and coiled-coil dom...  97.8    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_009378211.1|  PREDICTED: transmembrane and coiled-coil dom...  97.8    7e-20   Pyrus x bretschneideri [bai li]
ref|XP_008372754.1|  PREDICTED: transmembrane and coiled-coil dom...  97.8    7e-20   Malus domestica [apple tree]
ref|XP_008796876.1|  PREDICTED: uncharacterized membrane protein ...  96.7    1e-19   
ref|XP_008796875.1|  PREDICTED: transmembrane and coiled-coil dom...  96.7    2e-19   Phoenix dactylifera
ref|XP_010526790.1|  PREDICTED: transmembrane and coiled-coil dom...  95.5    4e-19   Tarenaya hassleriana [spider flower]
ref|XP_010271491.1|  PREDICTED: transmembrane and coiled-coil dom...  94.4    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010271492.1|  PREDICTED: transmembrane and coiled-coil dom...  94.4    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_006409198.1|  hypothetical protein EUTSA_v10022586mg           93.6    1e-18   Eutrema salsugineum [saltwater cress]
ref|XP_003558988.1|  PREDICTED: transmembrane and coiled-coil dom...  93.2    2e-18   Brachypodium distachyon [annual false brome]
ref|XP_004986015.1|  PREDICTED: transmembrane and coiled-coil dom...  92.4    4e-18   Setaria italica
ref|XP_004509335.1|  PREDICTED: transmembrane and coiled-coil dom...  92.0    7e-18   Cicer arietinum [garbanzo]
ref|NP_001132355.1|  uncharacterized protein LOC100193799             91.7    8e-18   Zea mays [maize]
gb|AFW89821.1|  putative DUF26 domain receptor-like protein kinase    91.3    8e-18   
gb|ACN33345.1|  unknown                                               91.3    9e-18   Zea mays [maize]
ref|XP_008658122.1|  PREDICTED: uncharacterized protein LOC100193...  91.3    9e-18   Zea mays [maize]
ref|NP_001048731.1|  Os03g0112800                                     90.5    2e-17   
gb|AFW89820.1|  putative DUF26 domain receptor-like protein kinase    90.9    2e-17   
gb|EAY88253.1|  hypothetical protein OsI_09705                        90.5    2e-17   Oryza sativa Indica Group [Indian rice]
gb|AFW89818.1|  putative DUF26 domain receptor-like protein kinase    90.9    2e-17   
gb|ABF93615.1|  expressed protein                                     90.5    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|AFW89819.1|  putative DUF26 domain receptor-like protein kinase    90.9    2e-17   
ref|XP_002465997.1|  hypothetical protein SORBIDRAFT_01g049760        89.7    3e-17   
ref|XP_010061018.1|  PREDICTED: transmembrane and coiled-coil dom...  88.6    9e-17   Eucalyptus grandis [rose gum]
gb|KCW67917.1|  hypothetical protein EUGRSUZ_F01619                   88.6    1e-16   Eucalyptus grandis [rose gum]
gb|KFK40189.1|  hypothetical protein AALP_AA3G341700                  88.2    1e-16   Arabis alpina [alpine rockcress]
gb|KFK40188.1|  hypothetical protein AALP_AA3G341700                  88.2    1e-16   Arabis alpina [alpine rockcress]
gb|KHN36057.1|  Transmembrane and coiled-coil domain-containing p...  88.2    1e-16   Glycine soja [wild soybean]
emb|CDY30329.1|  BnaA09g09480D                                        88.6    1e-16   Brassica napus [oilseed rape]
gb|EMT20138.1|  hypothetical protein F775_14016                       87.0    3e-16   
ref|XP_006297154.1|  hypothetical protein CARUB_v10013157mg           87.0    3e-16   
ref|XP_006297155.1|  hypothetical protein CARUB_v10013157mg           86.7    4e-16   Capsella rubella
ref|XP_004291817.1|  PREDICTED: transmembrane and coiled-coil dom...  85.9    8e-16   Fragaria vesca subsp. vesca
ref|XP_010489507.1|  PREDICTED: transmembrane and coiled-coil dom...  85.5    1e-15   
ref|XP_010489505.1|  PREDICTED: transmembrane and coiled-coil dom...  85.1    1e-15   
ref|XP_010489506.1|  PREDICTED: transmembrane and coiled-coil dom...  85.1    1e-15   
dbj|BAJ94309.1|  predicted protein                                    85.1    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009112467.1|  PREDICTED: transmembrane and coiled-coil dom...  85.1    1e-15   Brassica rapa
gb|EPS66741.1|  hypothetical protein M569_08033                       84.7    2e-15   Genlisea aurea
emb|CDY53279.1|  BnaC09g09640D                                        84.3    2e-15   Brassica napus [oilseed rape]
gb|AFW89817.1|  putative DUF26 domain receptor-like protein kinase    82.8    6e-15   
gb|AFW89816.1|  putative DUF26 domain receptor-like protein kinase    82.4    7e-15   
gb|KJB29622.1|  hypothetical protein B456_005G110800                  81.3    2e-14   Gossypium raimondii
ref|XP_010413917.1|  PREDICTED: transmembrane and coiled-coil dom...  81.6    2e-14   
gb|KJB29619.1|  hypothetical protein B456_005G110800                  81.3    2e-14   Gossypium raimondii
gb|KJB29620.1|  hypothetical protein B456_005G110800                  81.3    3e-14   Gossypium raimondii
ref|XP_007226229.1|  hypothetical protein PRUPE_ppa016746mg           81.3    3e-14   
gb|KJB29621.1|  hypothetical protein B456_005G110800                  81.3    3e-14   Gossypium raimondii
ref|XP_008221322.1|  PREDICTED: transmembrane and coiled-coil dom...  80.9    3e-14   Prunus mume [ume]
ref|XP_004982627.1|  PREDICTED: transmembrane and coiled-coil dom...  80.9    3e-14   Setaria italica
gb|KEH36226.1|  transmembrane and coiled-coil protein                 80.5    5e-14   Medicago truncatula
ref|XP_003603726.1|  Transmembrane and coiled-coil domain-contain...  80.5    5e-14   Medicago truncatula
ref|XP_010467612.1|  PREDICTED: transmembrane and coiled-coil dom...  80.1    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004500958.1|  PREDICTED: transmembrane and coiled-coil dom...  80.1    6e-14   Cicer arietinum [garbanzo]
ref|XP_007017689.1|  Transmembrane and coiled-coil domain-contain...  80.1    6e-14   
ref|XP_007017690.1|  Transmembrane and coiled-coil domain-contain...  80.1    7e-14   
gb|KHG10124.1|  Transmembrane and coiled-coil domain-containing 4     79.7    8e-14   Gossypium arboreum [tree cotton]
ref|XP_002464384.1|  hypothetical protein SORBIDRAFT_01g017280        79.3    9e-14   
ref|XP_009420791.1|  PREDICTED: transmembrane and coiled-coil dom...  79.0    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAD20116.1|  unknown protein                                       79.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42809.1|  At2g18100                                             79.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179401.2|  uncharacterized protein                             79.0    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008668853.1|  PREDICTED: putative DUF726-domain family pro...  79.0    2e-13   
ref|NP_001130514.1|  putative DUF726-domain family protein            78.6    2e-13   Zea mays [maize]
ref|XP_008668907.1|  PREDICTED: putative DUF726-domain family pro...  78.6    2e-13   
gb|EMT23841.1|  hypothetical protein F775_21532                       77.4    5e-13   
ref|XP_008366768.1|  PREDICTED: uncharacterized protein LOC103430409  76.6    6e-13   
ref|XP_009335556.1|  PREDICTED: transmembrane and coiled-coil dom...  77.0    6e-13   Pyrus x bretschneideri [bai li]
gb|AAG13564.1|AC073867_10  hypothetical protein                       73.6    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002510477.1|  conserved hypothetical protein                   75.1    2e-12   
ref|XP_002884114.1|  hypothetical protein ARALYDRAFT_480715           75.1    2e-12   
ref|XP_003574182.1|  PREDICTED: transmembrane and coiled-coil dom...  75.1    3e-12   Brachypodium distachyon [annual false brome]
ref|NP_001176237.1|  Os10g0512100                                     72.8    1e-11   
gb|EAY79183.1|  hypothetical protein OsI_34294                        72.8    2e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_006661949.1|  PREDICTED: transmembrane and coiled-coil dom...  71.2    5e-11   Oryza brachyantha
ref|XP_010317700.1|  PREDICTED: transmembrane and coiled-coil dom...  69.7    2e-10   Solanum lycopersicum
gb|KHN09111.1|  Transmembrane and coiled-coil domain-containing p...  67.4    9e-10   Glycine soja [wild soybean]
ref|XP_003527670.1|  PREDICTED: transmembrane and coiled-coil dom...  67.4    9e-10   
ref|XP_008778296.1|  PREDICTED: uncharacterized protein LOC103698100  65.9    1e-09   Phoenix dactylifera
gb|ACN33374.1|  unknown                                               65.5    2e-09   Zea mays [maize]
ref|XP_006650970.1|  PREDICTED: transmembrane and coiled-coil dom...  65.5    4e-09   
ref|XP_010934561.1|  PREDICTED: transmembrane and coiled-coil dom...  65.5    4e-09   
ref|XP_010934563.1|  PREDICTED: transmembrane and coiled-coil dom...  65.1    5e-09   
ref|XP_010934560.1|  PREDICTED: transmembrane and coiled-coil dom...  65.1    5e-09   Elaeis guineensis
ref|XP_010934564.1|  PREDICTED: transmembrane and coiled-coil dom...  63.5    1e-08   
gb|KHN00498.1|  Transmembrane and coiled-coil domain-containing p...  61.6    7e-08   Glycine soja [wild soybean]
ref|XP_002968294.1|  hypothetical protein SELMODRAFT_170005           57.8    1e-06   
ref|XP_002976085.1|  hypothetical protein SELMODRAFT_104378           57.8    1e-06   Selaginella moellendorffii
ref|XP_007136056.1|  hypothetical protein PHAVU_009G014300g           53.5    3e-05   Phaseolus vulgaris [French bean]
ref|XP_009112468.1|  PREDICTED: transmembrane and coiled-coil dom...  51.2    2e-04   Brassica rapa



>ref|XP_008453712.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Cucumis melo]
Length=666

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 112/140 (80%), Gaps = 3/140 (2%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            +LAPTQRYA+ AL  LAL+QAQIHQTRPLG P D  +   ++R SS S SSSDSVSEDP+
Sbjct  6    LLAPTQRYASGALFALALHQAQIHQTRPLGFPDD--DARAEERTSSCSGSSSDSVSEDPE  63

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH+SS LLRPVF+FLEID  AW+GLEETAG+G A  H+GAFLRLLSE   D SSE++E
Sbjct  64   LWVHESSGLLRPVFRFLEIDSSAWSGLEETAGSGTAKHHIGAFLRLLSE-DNDNSSEMIE  122

Query  516  REITLANSIDSMASSIEKTV  575
            +E+ L+ S+D +A ++EK +
Sbjct  123  QELALSKSVDGIAENMEKNI  142



>ref|XP_004164664.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Cucumis sativus]
 gb|KGN53277.1| hypothetical protein Csa_4G043930 [Cucumis sativus]
Length=673

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 110/140 (79%), Gaps = 3/140 (2%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             LAPTQRYA  AL  LAL+QAQIHQTRPLG   D  +   ++R SS S SSSDSVSEDP+
Sbjct  19   FLAPTQRYATGALFALALHQAQIHQTRPLGFSDD--DARAEERTSSCSGSSSDSVSEDPE  76

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH+SS+LLRPVF+FLEID  AW+GLEETAG+G A  H+GAFLRLLSE   + SSE++E
Sbjct  77   LWVHESSALLRPVFRFLEIDSAAWSGLEETAGSGTAKHHIGAFLRLLSE-DNENSSEMIE  135

Query  516  REITLANSIDSMASSIEKTV  575
            +E+ L+ S+D++  ++EK +
Sbjct  136  QELALSKSVDAIEENMEKNI  155



>ref|XP_004234544.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Solanum lycopersicum]
Length=661

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 107/143 (75%), Gaps = 6/143 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            +L PT RYAA AL GLAL+QAQIHQT PLG P    E+       S S SS+DSVS+DPQ
Sbjct  6    MLTPTHRYAAGALFGLALHQAQIHQTCPLGFPDTPPEE------RSSSCSSADSVSDDPQ  59

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH+SS+LLRP+FKFLEID  AW+GLEETA + P   HVGAFLRLLSE S D SSE  +
Sbjct  60   LWVHESSALLRPIFKFLEIDDKAWSGLEETAASTPPKHHVGAFLRLLSEESDDGSSEAAD  119

Query  516  REITLANSIDSMASSIEKTVDLE  584
             E+ LAN +D+MASS+EKT D E
Sbjct  120  MELALANGVDAMASSMEKTSDDE  142



>ref|XP_010317300.1| PREDICTED: uncharacterized protein LOC104646015 [Solanum lycopersicum]
Length=344

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 103/140 (74%), Gaps = 9/140 (6%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L P QRYAA AL GLAL+QA IHQT PLG PSD      +DRIS+GSS+ S S  EDPQL
Sbjct  6    LTPMQRYAAGALFGLALHQAHIHQTCPLGFPSD-----EEDRISNGSSNDSVS--EDPQL  58

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL--SEGSGDASSEVL  512
            WVH+SS LLRP+FKFLEID  AW+GLEETAG+     HVGA LR L  SE   ++S E  
Sbjct  59   WVHESSGLLRPIFKFLEIDKKAWSGLEETAGSSSPKHHVGALLRSLSVSEEGAESSKEAA  118

Query  513  EREITLANSIDSMASSIEKT  572
            ++E+ LA +ID+MASS+E+T
Sbjct  119  DKELDLAKAIDAMASSMERT  138



>gb|EYU24080.1| hypothetical protein MIMGU_mgv1a002505mg [Erythranthe guttata]
Length=665

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 103/139 (74%), Gaps = 3/139 (2%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            +L PTQ+Y A AL  +AL+Q QIHQT  LG+P DG     ++R+SSGS S+SDS  EDPQ
Sbjct  8    MLTPTQKYGAGALFAMALHQTQIHQTIQLGLP-DGGGGAAEERLSSGSGSNSDS--EDPQ  64

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH+SS LLRP+FKFLEID  AW GLEETA   PAN H GAFLRLL + + D SSE  E
Sbjct  65   LWVHESSGLLRPIFKFLEIDGSAWLGLEETAACSPANNHFGAFLRLLVDENRDVSSETAE  124

Query  516  REITLANSIDSMASSIEKT  572
            +E+ L   ID+M++S+EK+
Sbjct  125  KEVALVKGIDAMSASMEKS  143



>ref|XP_006343378.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Solanum tuberosum]
Length=661

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 107/143 (75%), Gaps = 6/143 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            +L PT RYAA AL GLAL+QAQIHQT PLG P    E+       S S SS+DSVS+DPQ
Sbjct  6    MLPPTHRYAAGALFGLALHQAQIHQTCPLGFPDTPPEE------RSSSGSSADSVSDDPQ  59

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH+SS+LLRP+FKFLEID  AW+GLEETA + P   HVGAFLRLLSE S D SSE  +
Sbjct  60   LWVHESSALLRPIFKFLEIDDKAWSGLEETAASTPPKHHVGAFLRLLSEESDDGSSEAAD  119

Query  516  REITLANSIDSMASSIEKTVDLE  584
             E+ LAN +D+MASS+E+T D E
Sbjct  120  MELALANGVDAMASSMERTSDNE  142



>ref|XP_007046758.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
 ref|XP_007046759.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
 gb|EOX90915.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
 gb|EOX90916.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
Length=670

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 105/137 (77%), Gaps = 2/137 (1%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             LAPTQRYAA AL  +A++QAQ+HQTRPLG+P++  +D         SSSSSDSVSEDP+
Sbjct  8    FLAPTQRYAAGALFAIAVHQAQMHQTRPLGLPTE--DDDPSSEERMSSSSSSDSVSEDPE  65

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH +S LLRP+F+FL+ID  AW GLEETAG+ PA  HVGAFLRLL+E S D SSE L+
Sbjct  66   LWVHGNSGLLRPIFRFLDIDSAAWLGLEETAGSSPAKHHVGAFLRLLAEESEDGSSERLD  125

Query  516  REITLANSIDSMASSIE  566
            +E+ L+ ++D+M   +E
Sbjct  126  QEVALSKAVDTMTLGME  142



>gb|KDO71092.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
Length=609

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 108/137 (79%), Gaps = 4/137 (3%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L+PTQRYAA AL  +AL+QAQ +QTRPLG+PS+ + ++ +    S SSSSSDSV+EDP+
Sbjct  6    FLSPTQRYAAGALFAIALHQAQNNQTRPLGLPSEDDSNMER----SSSSSSSDSVAEDPK  61

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH++S LLRPVF+FL+ID  AW+GLEETAG  PA  H+GAFLRLLSE +GD S++  +
Sbjct  62   LWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSD  121

Query  516  REITLANSIDSMASSIE  566
            +E  L+ ++D+ A S+E
Sbjct  122  QEFALSKAVDATAVSLE  138



>gb|KDO71087.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
 gb|KDO71088.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
 gb|KDO71089.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
Length=662

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 108/137 (79%), Gaps = 4/137 (3%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L+PTQRYAA AL  +AL+QAQ +QTRPLG+PS+ + ++ +    S SSSSSDSV+EDP+
Sbjct  6    FLSPTQRYAAGALFAIALHQAQNNQTRPLGLPSEDDSNMER----SSSSSSSDSVAEDPK  61

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH++S LLRPVF+FL+ID  AW+GLEETAG  PA  H+GAFLRLLSE +GD S++  +
Sbjct  62   LWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSD  121

Query  516  REITLANSIDSMASSIE  566
            +E  L+ ++D+ A S+E
Sbjct  122  QEFALSKAVDATAVSLE  138



>ref|XP_006466894.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Citrus sinensis]
 ref|XP_006466895.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Citrus sinensis]
 ref|XP_006466896.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Citrus sinensis]
 ref|XP_006466897.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X4 [Citrus sinensis]
 ref|XP_006466898.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X5 [Citrus sinensis]
Length=662

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 108/137 (79%), Gaps = 4/137 (3%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L+PTQRYAA AL  +AL+QAQ +QTRPLG+PS+ + ++ +    S SSSSSDSV+EDP+
Sbjct  6    FLSPTQRYAAGALFAIALHQAQNNQTRPLGLPSEDDSNMER----SSSSSSSDSVAEDPE  61

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH++S LLRPVF+FL+ID  AW+GLEETAG  PA  H+GAFLRLLSE +GD S++  +
Sbjct  62   LWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSD  121

Query  516  REITLANSIDSMASSIE  566
            +E  L+ ++D+ A S+E
Sbjct  122  QEFALSKAVDATAVSLE  138



>ref|XP_006425555.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
 ref|XP_006425556.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
 gb|ESR38795.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
 gb|ESR38796.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
Length=662

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 108/137 (79%), Gaps = 4/137 (3%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L+PTQRYAA AL  +AL+QAQ +QTRPLG+PS+ + ++ +    S SSSSSDSV+EDP+
Sbjct  6    FLSPTQRYAAGALFAIALHQAQNNQTRPLGLPSEDDSNMER----SSSSSSSDSVAEDPE  61

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH++S LLRPVF+FL+ID  AW+GLEETAG  PA  H+GAFLRLLSE +GD S++  +
Sbjct  62   LWVHENSGLLRPVFRFLDIDSAAWSGLEETAGCFPAKHHIGAFLRLLSEEAGDGSAQSSD  121

Query  516  REITLANSIDSMASSIE  566
            +E  L+ ++D+ A S+E
Sbjct  122  QEFALSKAVDATAVSLE  138



>gb|KJB43386.1| hypothetical protein B456_007G197400 [Gossypium raimondii]
Length=671

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 102/137 (74%), Gaps = 2/137 (1%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L PTQRY A AL   A+ QAQIHQTRPLG+P + +   T +R  + SSSS++SVS+DP 
Sbjct  8    FLTPTQRYGAGALFAFAVNQAQIHQTRPLGLPFEDDHHSTGER--TSSSSSNESVSDDPD  65

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWV++ S LLRPVF+FL+ID  AW GLEETAG   A  HVGAF+RL++E S + SSE LE
Sbjct  66   LWVNERSGLLRPVFRFLDIDSAAWLGLEETAGTSRATNHVGAFMRLIAEQSEEGSSERLE  125

Query  516  REITLANSIDSMASSIE  566
            +EI L+ ++D+MA S+E
Sbjct  126  QEIALSKAVDAMAFSME  142



>ref|XP_007157950.1| hypothetical protein PHAVU_002G111800g [Phaseolus vulgaris]
 gb|ESW29944.1| hypothetical protein PHAVU_002G111800g [Phaseolus vulgaris]
Length=665

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 101/136 (74%), Gaps = 6/136 (4%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA AL GLAL QAQIHQT PLG+ +D   D   D   S  +SS  +VSEDP L
Sbjct  7    LTPTQRYAAGALFGLALNQAQIHQTHPLGLSTD---DFPSD---SEKTSSKLAVSEDPNL  60

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH+  +LLRPVFK+L+IDP+AW+GLEETAG+  A+RHVG FLRLLSE  GD  S+  ++
Sbjct  61   WVHEHHALLRPVFKYLDIDPVAWSGLEETAGSSSASRHVGPFLRLLSEDFGDDCSQRSDK  120

Query  519  EITLANSIDSMASSIE  566
            E+ L+ ++D+M  S+E
Sbjct  121  ELALSGAVDAMVLSLE  136



>ref|XP_010446814.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=672

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA AL  +AL QAQI+QT+PLG+PS  ++D   D     + SS DSVS+DP L
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGIPSAEDDD-GGDEERRSNCSSGDSVSDDPSL  66

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH++S LLRPVF+ LEID  AW GLE+TA + PA  H+GAF RLLSE + DAS E++E+
Sbjct  67   WVHETSCLLRPVFRCLEIDSPAWLGLEQTACSTPAKHHIGAFTRLLSEEASDASVEMVEQ  126

Query  519  EITLANSIDSMASSIEKTVDLE  584
            E+ LA + DSM  +I+ +V ++
Sbjct  127  EMALAKAADSMVYNIQSSVSID  148



>ref|XP_009600609.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana tomentosiformis]
Length=661

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 103/142 (73%), Gaps = 9/142 (6%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L P QRYAA AL GLAL+QAQIHQT PLG PSD  ED   DRIS+ SSS S S  E PQL
Sbjct  6    LTPMQRYAAGALFGLALHQAQIHQTSPLGFPSD--ED---DRISNSSSSDSVS--EGPQL  58

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL--SEGSGDASSEVL  512
            WV++S  LLRP+F+FLEID  AW GLEETAG+     HVGAFLR L  SE  GD  SE  
Sbjct  59   WVNESCGLLRPLFQFLEIDKKAWPGLEETAGSSSPKHHVGAFLRSLSVSEEGGDTFSEAA  118

Query  513  EREITLANSIDSMASSIEKTVD  578
            E+E+ LA +ID+M SS+EKT+D
Sbjct  119  EKELDLAKAIDAMTSSMEKTLD  140



>ref|XP_010033460.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Eucalyptus grandis]
 gb|KCW53099.1| hypothetical protein EUGRSUZ_J02394 [Eucalyptus grandis]
Length=675

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 100/143 (70%), Gaps = 6/143 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNED------LTQDRIssgsssssds  317
             L+PTQRYAA AL  LAL+QAQIHQ RPLG  +  +ED        +    S SS   DS
Sbjct  8    FLSPTQRYAAGALFALALHQAQIHQARPLGSFAASDEDDGDGASGERTSSGSSSSGGGDS  67

Query  318  vsEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDA  497
            VSEDP LWVH+S+ LL PVF+FL+I+  AW GLEETAG+ PA  HVGAFLRLLSE   D 
Sbjct  68   VSEDPDLWVHESAGLLLPVFRFLDINQAAWLGLEETAGSSPAKHHVGAFLRLLSEDCADD  127

Query  498  SSEVLEREITLANSIDSMASSIE  566
            +SE LE++  LA +IDSMA S+E
Sbjct  128  TSERLEQQFALAKAIDSMALSME  150



>ref|NP_001078500.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE86635.1| uncharacterized protein AT4G36210 [Arabidopsis thaliana]
Length=672

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA AL  +AL QAQI+QT+PLG P+  ++D   D     + SS DSVS+DP L
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGTPAAEDDD-GGDEERRSNCSSGDSVSDDPSL  66

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH++S LLRPVF+ LEID  AW GLE+TA + PA  H+GAF RLLSE + DAS+E++E+
Sbjct  67   WVHETSGLLRPVFRCLEIDSPAWLGLEQTACSSPAKHHIGAFTRLLSEEANDASAEMVEQ  126

Query  519  EITLANSIDSMASSIEKTVDLE  584
            E+ LA + D+M  SI+ +V ++
Sbjct  127  EMALAKAADAMVHSIQCSVSID  148



>gb|KCW53100.1| hypothetical protein EUGRSUZ_J02394 [Eucalyptus grandis]
Length=702

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 100/143 (70%), Gaps = 6/143 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNED------LTQDRIssgsssssds  317
             L+PTQRYAA AL  LAL+QAQIHQ RPLG  +  +ED        +    S SS   DS
Sbjct  8    FLSPTQRYAAGALFALALHQAQIHQARPLGSFAASDEDDGDGASGERTSSGSSSSGGGDS  67

Query  318  vsEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDA  497
            VSEDP LWVH+S+ LL PVF+FL+I+  AW GLEETAG+ PA  HVGAFLRLLSE   D 
Sbjct  68   VSEDPDLWVHESAGLLLPVFRFLDINQAAWLGLEETAGSSPAKHHVGAFLRLLSEDCADD  127

Query  498  SSEVLEREITLANSIDSMASSIE  566
            +SE LE++  LA +IDSMA S+E
Sbjct  128  TSERLEQQFALAKAIDSMALSME  150



>ref|XP_009789372.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana sylvestris]
Length=661

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 105/143 (73%), Gaps = 11/143 (8%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L P QRYAA AL GLAL+QAQIHQT PLG PSD  ED   DRIS+ SSS S S  E PQL
Sbjct  6    LTPMQRYAAGALFGLALHQAQIHQTSPLGFPSD--ED---DRISNSSSSDSVS--EGPQL  58

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLS---EGSGDASSEV  509
            WV++S  LLRPVF+FLEID  AW GLEETAG+     HVGAFLR LS   EGS D  SE 
Sbjct  59   WVNESCGLLRPVFQFLEIDKKAWPGLEETAGSSSPKHHVGAFLRPLSVSEEGS-DTFSEP  117

Query  510  LEREITLANSIDSMASSIEKTVD  578
             E+E+ LA +ID+MASS+EKT+D
Sbjct  118  AEKELDLAKAIDAMASSMEKTLD  140



>ref|XP_010437365.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=672

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA AL  +AL QAQI+QT+PLG+PS  ++D  ++     + SS DSVS+DP L
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGIPSAEDDDGGEEE-RRSNCSSGDSVSDDPGL  66

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH++S LLRPVF+ LEID  AW GLE+TA + PA  H+GAF RLLSE + DAS E++E+
Sbjct  67   WVHETSCLLRPVFRCLEIDSPAWLGLEQTACSSPAKHHIGAFTRLLSEAASDASVEMVEQ  126

Query  519  EITLANSIDSMASSIEKTVDLE  584
            E+ LA + D+M  +I+ ++ ++
Sbjct  127  EMALAKAADAMVYNIQSSLSID  148



>ref|XP_011090424.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Sesamum indicum]
 ref|XP_011090425.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Sesamum indicum]
Length=672

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 87/122 (71%), Gaps = 5/122 (4%)
 Frame = +3

Query  222  IHQTRPLGVPS---DGNEDLTQDRIssgsssssdsvsEDPQLWVHQSSSLLRPVFKFLEI  392
            +HQ  PLG PS   D   D  ++R    +SSSSD VS+DPQLWVHQS+ LLRPVFKFLEI
Sbjct  29   LHQIHPLGFPSHDDDDGSDPPEER--VSTSSSSDFVSDDPQLWVHQSAGLLRPVFKFLEI  86

Query  393  DPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDSMASSIEKT  572
            D  AW  LEET    PA  HVGAFLRLLSE SG+ S E++++E+ LA +ID+M  S+EK+
Sbjct  87   DSRAWGALEETVAYSPAKHHVGAFLRLLSEESGNISEEIVDKELALAAAIDAMCLSMEKS  146

Query  573  VD  578
             D
Sbjct  147  PD  148



>emb|CDP01935.1| unnamed protein product [Coffea canephora]
Length=656

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            +L+PTQRYAA AL GLAL+Q+QI QT  LG  +D +   T DR +S  SSSSDSV++DPQ
Sbjct  12   MLSPTQRYAAGALFGLALHQSQILQTSQLG-SNDDDAGPTHDR-TSSGSSSSDSVADDPQ  69

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVHQSS LLRP+FK+L++D  AW+GLEET+   P   HVGAFLRLLSE +GD SSE  +
Sbjct  70   LWVHQSSHLLRPIFKYLDLDSKAWSGLEETSACTPVKHHVGAFLRLLSEETGDRSSEAAD  129

Query  516  REITLANSIDSMASSIEKT-VDLE  584
            +E+ L+  +D+MASS E + VD E
Sbjct  130  KELALSRGVDAMASSFESSPVDYE  153



>gb|KHG22516.1| Transmembrane and coiled-coil domain-containing 4 [Gossypium 
arboreum]
Length=619

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 101/137 (74%), Gaps = 3/137 (2%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L PTQRY A AL   A+ QAQIHQT PLG+P D +   T +R  + SSSS++SVS+DP 
Sbjct  8    FLTPTQRYGAGALFAFAVNQAQIHQTHPLGLPFDDHHS-TGER--TSSSSSNESVSDDPD  64

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWV++ S LLRPVF+FL+ID  AW GLEETAG   A  HVGAF+RL++E S + SSE LE
Sbjct  65   LWVNERSGLLRPVFRFLDIDSAAWLGLEETAGTSRATNHVGAFMRLIAEQSEEGSSERLE  124

Query  516  REITLANSIDSMASSIE  566
            +EI L+ ++D+MA S+E
Sbjct  125  QEIALSKAVDAMAFSME  141



>ref|XP_010432190.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=729

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA AL  +AL QAQI+QT+PLG+PS  ++D  ++     + SS DSVS+DP L
Sbjct  65   LTPTQRYAAGALFAIALNQAQINQTQPLGIPSAEDDDGGEEE-RRSNCSSGDSVSDDPSL  123

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH++S LLRPVF+ LEID  AW GLE+TA + PA  H+GAF RLLSE + DAS E++E+
Sbjct  124  WVHETSCLLRPVFRCLEIDSPAWLGLEQTACSSPAKHHIGAFTRLLSEEASDASVEMVEQ  183

Query  519  EITLANSIDSMASSIEKTVDLE  584
            E+ LA + D+M  +I+ ++ ++
Sbjct  184  EMALAKAADAMVYNIQSSLSID  205



>gb|KDP46691.1| hypothetical protein JCGZ_06479 [Jatropha curcas]
Length=609

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            +L+ TQ+YAA AL  +A++QAQIHQ++PLG  +D N    + RISS SS+SSDSVSEDP 
Sbjct  10   LLSSTQKYAAGALFAIAVHQAQIHQSQPLGFFTDDNPTEEEQRISSSSSNSSDSVSEDPD  69

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH+ S LLRPVF+FL+++  AW GLEETAG+ PA  H+G FLRLLSE   DA+S   +
Sbjct  70   LWVHKYSGLLRPVFRFLDVESAAWHGLEETAGSSPAKHHIGPFLRLLSEDGNDANSHSSD  129

Query  516  REITLANSIDSMASSIE  566
            +E+ L+ ++D M+ ++E
Sbjct  130  QELALSKAVDVMSQTME  146



>emb|CAN59788.1| hypothetical protein VITISV_012480 [Vitis vinifera]
Length=670

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L PTQRYAA ALLGLAL QAQIHQTRPLG   + +E ++          SSDSVSEDPQ
Sbjct  4    FLTPTQRYAAGALLGLALQQAQIHQTRPLGSSIEEDERISSGS-------SSDSVSEDPQ  56

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH++S LLRPVFK L+I+  AWTGLEETAG+ PA  HVGAFLRL+SE S ++S+++ +
Sbjct  57   LWVHENSGLLRPVFKSLKIENKAWTGLEETAGSSPAKHHVGAFLRLISEESAESSADMKD  116

Query  516  REITLANSIDSMASSIEKT  572
             E+ L+ ++D M  S+E T
Sbjct  117  AELALSKAVDVMELSMETT  135



>ref|XP_010649079.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Vitis vinifera]
 emb|CBI17412.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L PTQRYAA ALLGLAL QAQIHQTRPLG   + +E ++          SSDSVSEDPQ
Sbjct  4    FLTPTQRYAAGALLGLALQQAQIHQTRPLGSSIEEDERISSGS-------SSDSVSEDPQ  56

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH++S LLRPVFK L+I+  AWTGLEETAG+ PA  HVGAFLRL+SE S ++S+++ +
Sbjct  57   LWVHENSGLLRPVFKSLKIENKAWTGLEETAGSSPAKHHVGAFLRLISEESAESSADMKD  116

Query  516  REITLANSIDSMASSIEKT  572
             E+ L+ ++D M  S+E T
Sbjct  117  AELALSKAVDVMELSMETT  135



>ref|XP_010649080.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Vitis vinifera]
Length=662

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 103/139 (74%), Gaps = 7/139 (5%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L PTQRYAA ALLGLAL QAQIHQTRPLG   + +E ++          SSDSVSEDPQ
Sbjct  4    FLTPTQRYAAGALLGLALQQAQIHQTRPLGSSIEEDERISSGS-------SSDSVSEDPQ  56

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH++S LLRPVFK L+I+  AWTGLEETAG+ PA  HVGAFLRL+SE S ++S+++ +
Sbjct  57   LWVHENSGLLRPVFKSLKIENKAWTGLEETAGSSPAKHHVGAFLRLISEESAESSADMKD  116

Query  516  REITLANSIDSMASSIEKT  572
             E+ L+ ++D M  S+E T
Sbjct  117  AELALSKAVDVMELSMETT  135



>ref|XP_009615488.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana tomentosiformis]
Length=662

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 112/143 (78%), Gaps = 4/143 (3%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            +L PT +YAA AL+GL L+QAQIHQT PLG PSD  + L+++R  S + SSSDSVS+DP 
Sbjct  5    MLTPTHKYAAGALIGLGLHQAQIHQTCPLGFPSD--DSLSEER--SSNGSSSDSVSDDPH  60

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH+SS+LLRP+FKFLEID  AW+GLEETA + P   HVGAFLRLLSE S D SSE  +
Sbjct  61   LWVHESSALLRPIFKFLEIDEKAWSGLEETAASTPPKHHVGAFLRLLSEESSDDSSEAAD  120

Query  516  REITLANSIDSMASSIEKTVDLE  584
             E+ LAN +D+MASS+E+T D E
Sbjct  121  MELALANGVDAMASSMERTSDNE  143



>ref|XP_011100949.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane and coiled-coil 
domain-containing protein 4-like [Sesamum indicum]
Length=661

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 102/141 (72%), Gaps = 7/141 (5%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLG-VPSDGNEDLTQDRIssgsssssdsvsEDP  332
            +L P Q+YAA AL  LAL+Q QIHQT PLG +PS  ++     R+ S   SS+DSVSEDP
Sbjct  7    MLTPKQKYAAGALFALALHQVQIHQTLPLGFLPSAPDQ-----RVFSAIDSSTDSVSEDP  61

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPAN-RHVGAFLRLLSEGSGDASSEV  509
             LW HQSS LLRPVFKFLEID   W GLEETA +  A+ RHVGAFLR L + SGD SSE 
Sbjct  62   HLWAHQSSGLLRPVFKFLEIDNKEWAGLEETATHSSADRRHVGAFLRQLMDESGDMSSEA  121

Query  510  LEREITLANSIDSMASSIEKT  572
             E+E+++AN ID+M+  ++KT
Sbjct  122  AEKEVSVANGIDAMSLGMQKT  142



>gb|EYU31146.1| hypothetical protein MIMGU_mgv1a002490mg [Erythranthe guttata]
Length=667

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 99/141 (70%), Gaps = 2/141 (1%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDL--TQDRIssgsssssdsvsED  329
            +L PTQRYAA AL  LAL+QAQ HQT PLG PS  +ED           SSSSSD+VS+D
Sbjct  1    MLTPTQRYAAGALFSLALHQAQEHQTSPLGFPSHQDEDGGGESSEERVSSSSSSDAVSDD  60

Query  330  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEV  509
             QLWVHQSS LLRPVFKFLEID  AW GLEETA   P+  HVGAFLRLL+E + D S   
Sbjct  61   TQLWVHQSSGLLRPVFKFLEIDSRAWGGLEETAAYSPSKHHVGAFLRLLAEETSDVSEGA  120

Query  510  LEREITLANSIDSMASSIEKT  572
             E E+ L NSI++M+ S+E T
Sbjct  121  AEMELALMNSIEAMSLSMENT  141



>ref|XP_009411496.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Musa acuminata subsp. malaccensis]
Length=685

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 102/140 (73%), Gaps = 2/140 (1%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            +L PT RYAA ALL LAL QAQIHQTRPLG   D  +   Q R S+GS++SS+   +DP+
Sbjct  5    LLNPTHRYAAGALLALALRQAQIHQTRPLGY--DDPDPDAQGRCSTGSATSSEGGGDDPE  62

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LW H+S  LLRPVF+FL+IDP AW+GLEETA +  A  H+GA+LR++ E   ++SSE  E
Sbjct  63   LWTHESCGLLRPVFRFLDIDPKAWSGLEETAASSMAKHHIGAYLRIIFEEDIESSSEKYE  122

Query  516  REITLANSIDSMASSIEKTV  575
            +E+TLA ++D+MA S+E   
Sbjct  123  QELTLAEAVDAMAVSLEAAC  142



>ref|XP_006412018.1| hypothetical protein EUTSA_v10024597mg [Eutrema salsugineum]
 gb|ESQ53471.1| hypothetical protein EUTSA_v10024597mg [Eutrema salsugineum]
Length=676

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 108/148 (73%), Gaps = 8/148 (5%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNED------LTQDRIssgsssssdsv  320
            L PTQRYAA AL  +AL QAQI+QT+PLG+P+  ++D       ++DR    +SSS DSV
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGIPAAKDDDEECENRRSEDR--KSNSSSGDSV  65

Query  321  sEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDAS  500
            S+DP LWVH+ S LLRPVF+ L+I P AW GLEETA + PA  H+GAF RLLSE + DAS
Sbjct  66   SDDPGLWVHEKSGLLRPVFRCLDIQPSAWLGLEETANSSPAKHHIGAFTRLLSEEASDAS  125

Query  501  SEVLEREITLANSIDSMASSIEKTVDLE  584
            +E++E+E+ LA + D+M  SI+ ++ ++
Sbjct  126  AEMMEQEMALAKAADAMVHSIQSSLSVD  153



>emb|CDX69212.1| BnaC01g02410D [Brassica napus]
Length=634

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssd--svsEDP  332
            L PTQRYAA AL  +AL QAQI+QT+PLG+P+  ++D   DR     S+ S   SVS+DP
Sbjct  9    LTPTQRYAAGALFAIALNQAQINQTQPLGIPAALDDDEECDRSEERRSNCSSGDSVSDDP  68

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
             LWVH++S LLRPVF+ L+ID  AW GLEETA + PA  H+GAF RLLSE + +AS E++
Sbjct  69   NLWVHETSGLLRPVFRCLDIDSSAWLGLEETANSSPAKHHIGAFTRLLSEEASEASVEMV  128

Query  513  EREITLANSIDSMASSIEKT  572
            E+E+ LA + D+M +  E++
Sbjct  129  EQEMALAKAADAMVNDKEES  148



>gb|KFK30255.1| hypothetical protein AALP_AA7G237500 [Arabis alpina]
Length=671

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L  TQRYAA AL  +AL QAQI+QT+PLG+P+  N+D   D     +SSS DSVS+DP L
Sbjct  8    LTSTQRYAAGALFAIALNQAQINQTQPLGIPASENDDEDGDN-RRSNSSSGDSVSDDPHL  66

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH++S LLRPVF+ LEI+  AW GLEETA + PA  H+GAF RLLSE + DAS E++E 
Sbjct  67   WVHETSGLLRPVFRCLEIESSAWLGLEETANSSPAKHHIGAFTRLLSEEASDASKEMIEL  126

Query  519  EITLANSIDSMASSIEKTVDLE  584
            E+ LA + D+M  SI+ ++ ++
Sbjct  127  EMALAKAADAMVQSIQSSLSID  148



>ref|XP_009757145.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana sylvestris]
Length=678

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 110/143 (77%), Gaps = 4/143 (3%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            IL PT +YAA AL GL+L+QAQIHQT PLG P D  + L+++R  S + SSSDSVS+DP 
Sbjct  5    ILTPTHKYAAGALFGLSLHQAQIHQTCPLGFPPD--DSLSEER--SSNGSSSDSVSDDPH  60

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH+SS+LLRP+FKFLEID  AW+GLEETA + P   HVGAFLRLLSE S D SSE  +
Sbjct  61   LWVHESSALLRPIFKFLEIDEKAWSGLEETAASTPPKHHVGAFLRLLSEESSDDSSEAAD  120

Query  516  REITLANSIDSMASSIEKTVDLE  584
             E+ LAN +D+M SS+E+T D E
Sbjct  121  MELALANGVDAMVSSMERTSDNE  143



>ref|XP_003612113.1| Transmembrane and coiled-coil domain-containing protein [Medicago 
truncatula]
Length=447

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 100/138 (72%), Gaps = 7/138 (5%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L PTQRYAA AL GLAL+QAQ+HQT PLG+ +D       D  S  SS+S+ +V EDP 
Sbjct  15   YLTPTQRYAAGALFGLALHQAQLHQTHPLGLSTD-------DFPSPSSSTSTGAVFEDPD  67

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +++ L+
Sbjct  68   LWVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSVATRHVGPFLRLLSEEYDDDNAKRLD  127

Query  516  REITLANSIDSMASSIEK  569
            +E+ L+ ++D++  S+EK
Sbjct  128  QELALSEAVDALVLSLEK  145



>ref|XP_004287838.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Fragaria vesca subsp. vesca]
Length=689

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 102/140 (73%), Gaps = 5/140 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L PTQRY A AL   AL+QAQIHQTRPLG+ +   +  T DR  + S SS+DSVS+DP 
Sbjct  7    FLTPTQRYGAGALFAFALHQAQIHQTRPLGLLTH-EDSTTLDR--TTSCSSADSVSDDPL  63

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDAS--SEV  509
            LW++  S LL PVF+FLEIDP AW+GL+ETA + PA+ HVGAFLRLL+E  GD    SE 
Sbjct  64   LWINDKSGLLPPVFRFLEIDPAAWSGLQETAASSPASNHVGAFLRLLAEAGGDEKNGSEN  123

Query  510  LEREITLANSIDSMASSIEK  569
             ++++ L+ ++D+MA S+E+
Sbjct  124  ADQQLALSRAVDAMARSMEQ  143



>gb|AES95070.2| transmembrane and coiled-coil protein [Medicago truncatula]
Length=672

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 100/137 (73%), Gaps = 7/137 (5%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA AL GLAL+QAQ+HQT PLG+ +D       D  S  SS+S+ +V EDP L
Sbjct  16   LTPTQRYAAGALFGLALHQAQLHQTHPLGLSTD-------DFPSPSSSTSTGAVFEDPDL  68

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +++ L++
Sbjct  69   WVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSVATRHVGPFLRLLSEEYDDDNAKRLDQ  128

Query  519  EITLANSIDSMASSIEK  569
            E+ L+ ++D++  S+EK
Sbjct  129  ELALSEAVDALVLSLEK  145



>ref|XP_006340700.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Solanum tuberosum]
Length=679

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 9/140 (6%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L P QRYAA AL GLAL+QA IHQT PLG PSD      +DRIS+GSS+ S S  +DPQL
Sbjct  26   LTPMQRYAAGALFGLALHQAHIHQTCPLGFPSD-----EEDRISNGSSNDSVS--DDPQL  78

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL--SEGSGDASSEVL  512
            WVH+SS LLRP+FKFLEID  AW+GLEETAG+     HVGA LR L  SE   ++SSE  
Sbjct  79   WVHESSGLLRPIFKFLEIDKKAWSGLEETAGSSSPKHHVGALLRSLSVSEEGAESSSEAE  138

Query  513  EREITLANSIDSMASSIEKT  572
            ++E+ LA +ID+MASS+E+T
Sbjct  139  DKELDLAKAIDAMASSMERT  158



>ref|XP_003612112.1| Transmembrane and coiled-coil domain-containing protein [Medicago 
truncatula]
Length=717

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 100/137 (73%), Gaps = 7/137 (5%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA AL GLAL+QAQ+HQT PLG+ +D       D  S  SS+S+ +V EDP L
Sbjct  16   LTPTQRYAAGALFGLALHQAQLHQTHPLGLSTD-------DFPSPSSSTSTGAVFEDPDL  68

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +++ L++
Sbjct  69   WVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSVATRHVGPFLRLLSEEYDDDNAKRLDQ  128

Query  519  EITLANSIDSMASSIEK  569
            E+ L+ ++D++  S+EK
Sbjct  129  ELALSEAVDALVLSLEK  145



>ref|XP_006283267.1| hypothetical protein CARUB_v10004298mg [Capsella rubella]
 gb|EOA16165.1| hypothetical protein CARUB_v10004298mg [Capsella rubella]
Length=672

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA+AL  +AL QAQI+QT+PLG+P+   +D   D     +SSS DSVS+DP L
Sbjct  8    LTPTQRYAASALFAIALNQAQINQTQPLGIPASDVDD-GADEERRSNSSSGDSVSDDPSL  66

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH++S LLRPVF+ LEID  AW GLE+TA + PA  H+GAF RLLSE + +AS E++E+
Sbjct  67   WVHETSGLLRPVFRCLEIDSPAWLGLEQTACSSPAKHHIGAFTRLLSEEASEASVEMVEQ  126

Query  519  EITLANSIDSMASSIEKTVDL  581
            EI LA + D+M  SI+ ++ +
Sbjct  127  EIALAKAADAMVHSIQSSLSI  147



>ref|XP_004512102.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Cicer arietinum]
Length=515

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 100/137 (73%), Gaps = 8/137 (6%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L+ TQRYAA ALLGLAL+Q+Q+HQT PLG        L+ D   S SS ++ +VSEDP+L
Sbjct  9    LSSTQRYAAGALLGLALHQSQLHQTHPLG--------LSPDEFPSPSSPTTVAVSEDPEL  60

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +S+ L+ 
Sbjct  61   WVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSFATRHVGPFLRLLSEEFDDDNSQRLDE  120

Query  519  EITLANSIDSMASSIEK  569
            E+ L+ ++D++  S+EK
Sbjct  121  ELALSEAVDALVVSLEK  137



>emb|CDX75561.1| BnaA01g01410D [Brassica napus]
Length=592

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 5/141 (4%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA AL  +AL QAQI+QT+PLG+P+  ++D  +D  SSG S S     +DP L
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGIPAAPDDDDDKDNCSSGDSVS-----DDPNL  62

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH++S LLRPVF+ L+ID  AW GLEETA + PA  H+GAF RLLSE + +AS E++E+
Sbjct  63   WVHETSGLLRPVFRCLDIDSSAWLGLEETANSSPAKHHIGAFTRLLSEEASEASVEMVEQ  122

Query  519  EITLANSIDSMASSIEKTVDL  581
            E+ LA + D+M  S    V L
Sbjct  123  EMALAKAADAMVKSKADVVLL  143



>ref|XP_009146060.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Brassica rapa]
Length=677

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 106/148 (72%), Gaps = 8/148 (5%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE------DLTQDRIssgsssssdsv  320
            L PTQRYAA AL  +AL QAQI+QT+PLG+P+  ++      D +++R    + SS DSV
Sbjct  8    LTPTQRYAAGALFAIALNQAQINQTQPLGIPAAPDDDDDKECDRSEER--RSNCSSGDSV  65

Query  321  sEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDAS  500
            S+DP LWVH++S LLRPVF+ L+ID  AW GLEETA + PA  H+GAF RLLSE + +AS
Sbjct  66   SDDPNLWVHETSGLLRPVFRCLDIDSSAWLGLEETANSSPAKHHIGAFTRLLSEEASEAS  125

Query  501  SEVLEREITLANSIDSMASSIEKTVDLE  584
             E++E+E+ LA + D+M  SI  ++ ++
Sbjct  126  VEMVEQEMALAKAADAMVHSIRSSLSID  153



>ref|XP_004512101.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Cicer arietinum]
Length=609

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 100/137 (73%), Gaps = 8/137 (6%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L+ TQRYAA ALLGLAL+Q+Q+HQT PLG        L+ D   S SS ++ +VSEDP+L
Sbjct  9    LSSTQRYAAGALLGLALHQSQLHQTHPLG--------LSPDEFPSPSSPTTVAVSEDPEL  60

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +S+ L+ 
Sbjct  61   WVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSFATRHVGPFLRLLSEEFDDDNSQRLDE  120

Query  519  EITLANSIDSMASSIEK  569
            E+ L+ ++D++  S+EK
Sbjct  121  ELALSEAVDALVVSLEK  137



>ref|XP_004512100.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Cicer arietinum]
Length=666

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 100/137 (73%), Gaps = 8/137 (6%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L+ TQRYAA ALLGLAL+Q+Q+HQT PLG        L+ D   S SS ++ +VSEDP+L
Sbjct  9    LSSTQRYAAGALLGLALHQSQLHQTHPLG--------LSPDEFPSPSSPTTVAVSEDPEL  60

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVH +S LLRPVF FL+ID  AW+GLEET+G+  A RHVG FLRLLSE   D +S+ L+ 
Sbjct  61   WVHHTSGLLRPVFIFLDIDSAAWSGLEETSGSSFATRHVGPFLRLLSEEFDDDNSQRLDE  120

Query  519  EITLANSIDSMASSIEK  569
            E+ L+ ++D++  S+EK
Sbjct  121  ELALSEAVDALVVSLEK  137



>ref|XP_010263882.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane and coiled-coil 
domain-containing protein 4-like [Nelumbo nucifera]
Length=675

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 105/141 (74%), Gaps = 10/141 (7%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLG--VPSDGNEDLTQDRIssgsssssdsvsED  329
            IL PTQRYAA ALL LAL+QAQIHQT PL   +PSD  +D  ++R  + S SS+DSV+ED
Sbjct  7    ILTPTQRYAAGALLSLALHQAQIHQT-PLASLLPSD--DDTAEER--TSSGSSTDSVTED  61

Query  330  PQ---LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDAS  500
            P    LW+HQ+ +LLRPVF+FL+IDP AWTGLEETA + PA   VGAF RLLSE + + S
Sbjct  62   PHISHLWIHQNFALLRPVFRFLQIDPKAWTGLEETARSSPAKHRVGAFFRLLSEDNDETS  121

Query  501  SEVLEREITLANSIDSMASSI  563
            SE L++E+ LA ++D+   S+
Sbjct  122  SERLDQELALAKAVDATEMSM  142



>ref|XP_010526787.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526788.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526789.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Tarenaya hassleriana]
Length=693

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 94/137 (69%), Gaps = 6/137 (4%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVP------SDGNEDLTQDRIssgsssssdsv  320
            L PTQRYAA AL  +A+ QAQI QT+PLG P        G  +  +    S S SS+DSV
Sbjct  8    LTPTQRYAAGALFAIAVNQAQIPQTQPLGSPVADEDDEGGGGESRRSGERSSSGSSNDSV  67

Query  321  sEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDAS  500
            SEDP LWVH+ S LLRPVF+ L ID  AW GLEETAG+ PA  HVGAF+RLLSE + D S
Sbjct  68   SEDPGLWVHECSGLLRPVFRGLHIDSSAWNGLEETAGSSPAKHHVGAFMRLLSEEASDVS  127

Query  501  SEVLEREITLANSIDSM  551
            SE+ E+E  LA ++D+M
Sbjct  128  SEMAEKEEALAKAVDAM  144



>ref|XP_002533809.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28578.1| conserved hypothetical protein [Ricinus communis]
Length=713

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 7/144 (5%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQ---DRIssgsssssdsvsE  326
             L+PTQRYAA AL  +AL+QAQ HQTRPLG   D +    Q   DR S  SS+SSDSVSE
Sbjct  24   FLSPTQRYAAGALFAIALHQAQTHQTRPLGFSPDVDPTEPQQQGDRTSCSSSNSSDSVSE  83

Query  327  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGS----GD  494
            DP LWVH++  LLRPVF+FLEID  AW GLEETAG+ PA  HVGAFLRLL+E +      
Sbjct  84   DPDLWVHETLGLLRPVFRFLEIDSNAWHGLEETAGSSPAKYHVGAFLRLLAENNDDDNAS  143

Query  495  ASSEVLEREITLANSIDSMASSIE  566
            +S    ++E+ L+ ++D M+ ++E
Sbjct  144  SSQSSSDQELALSKAVDVMSQNME  167



>ref|XP_010113393.1| hypothetical protein L484_026725 [Morus notabilis]
 gb|EXC35400.1| hypothetical protein L484_026725 [Morus notabilis]
Length=663

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 96/136 (71%), Gaps = 6/136 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L PTQRYAA AL  LAL+QAQ++QTRPLG   +  +D         S  S+DSV+  P 
Sbjct  6    CLTPTQRYAAGALFALALHQAQVNQTRPLGSDDESADD------RPSSCGSTDSVANHPD  59

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH+ S L+RPVF+FLEI+ +AW+GLEETAG+ PA  HVGAFLRLL+E +   +S+  +
Sbjct  60   LWVHELSGLVRPVFRFLEIESVAWSGLEETAGSSPAKHHVGAFLRLLAEENDGTTSQNSD  119

Query  516  REITLANSIDSMASSI  563
            +E+ L+ ++D+M  S+
Sbjct  120  QELALSRAVDAMWRSM  135



>ref|XP_011025906.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Populus euphratica]
Length=681

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 100/137 (73%), Gaps = 5/137 (4%)
 Frame = +3

Query  168  TQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDPQLW  341
            TQRYAA AL  +AL+QAQIHQTRPLG+  D +E  + T    S  + SSSDSVSEDP LW
Sbjct  16   TQRYAAGALFAIALHQAQIHQTRPLGLSHDDSEQEERTSCSSSHSNGSSSDSVSEDPDLW  75

Query  342  VHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASSEVL  512
            +H++S LLRPVF+FLE++ +AWTGLEETAG  PA  HVGAFLRLL   S  +  +SS+  
Sbjct  76   IHENSGLLRPVFRFLEVESVAWTGLEETAGGSPAKHHVGAFLRLLSEESGNASSSSSQSS  135

Query  513  EREITLANSIDSMASSI  563
            ++E+ L+ ++D M  ++
Sbjct  136  DQEVALSKAVDVMEETM  152



>ref|XP_004146487.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Cucumis sativus]
Length=673

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 99/140 (71%), Gaps = 3/140 (2%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             LAPTQRYA  AL  LAL+QAQIHQTRPLG   D      ++R SS S SSSDSVSEDP+
Sbjct  19   FLAPTQRYATGALFALALHQAQIHQTRPLGFSDDDAR--AEERTSSCSGSSSDSVSEDPE  76

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH+SS+LLRPVF+FLEID  AW+G++           +  FLRLLSE   + SSE++E
Sbjct  77   LWVHESSALLRPVFRFLEIDSAAWSGMKVVVSLKKKKNLLSQFLRLLSE-DNENSSEMIE  135

Query  516  REITLANSIDSMASSIEKTV  575
            +E+ L+ S+D++  ++EK +
Sbjct  136  QELALSKSVDAIEENMEKNI  155



>ref|XP_010933754.1| PREDICTED: uncharacterized membrane protein YFL034W-like isoform 
X4 [Elaeis guineensis]
Length=541

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 95/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGV--PSDGNEDLTQDRIssgsssssdsvsEDP  332
            L+PTQRYAA ALL LAL QAQIHQT+PL    P  G+ D      +S S+SSS+   +  
Sbjct  7    LSPTQRYAAGALLALALRQAQIHQTQPLDDDDPDAGSRDRCSSASASSSTSSSEGDGDSC  66

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
             LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE  
Sbjct  67   HLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDEKSSERF  126

Query  513  EREITLANSIDSMASSIEKTV  575
            E+E+ LA ++D+M  S+E ++
Sbjct  127  EKELALAKAVDAMVMSLEASL  147



>ref|XP_006573571.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Glycine max]
Length=536

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 98/140 (70%), Gaps = 10/140 (7%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L  TQRYAA AL GLAL+QAQ+HQT PLG+ +D   D   D      +SS+ +VSE P L
Sbjct  8    LTGTQRYAAGALFGLALHQAQLHQTHPLGLSTD---DFPSD----SETSSTLAVSEHPNL  60

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSE---GSGDASSEV  509
            WVH +S LLRPV K+L+I+  AW+GLEETAG   A+RHVG FLRLLSE      D SS+ 
Sbjct  61   WVHHNSGLLRPVLKYLDINSAAWSGLEETAGFSSASRHVGPFLRLLSEDFDDDDDDSSQR  120

Query  510  LEREITLANSIDSMASSIEK  569
            L++E+ L+ ++D+M  S+EK
Sbjct  121  LDQELALSEAVDAMVHSLEK  140



>ref|XP_010933753.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Elaeis guineensis]
Length=622

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 95/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGV--PSDGNEDLTQDRIssgsssssdsvsEDP  332
            L+PTQRYAA ALL LAL QAQIHQT+PL    P  G+ D      +S S+SSS+   +  
Sbjct  7    LSPTQRYAAGALLALALRQAQIHQTQPLDDDDPDAGSRDRCSSASASSSTSSSEGDGDSC  66

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
             LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE  
Sbjct  67   HLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDEKSSERF  126

Query  513  EREITLANSIDSMASSIEKTV  575
            E+E+ LA ++D+M  S+E ++
Sbjct  127  EKELALAKAVDAMVMSLEASL  147



>ref|XP_003548861.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Glycine max]
Length=676

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +3

Query  168  TQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQLWVH  347
            TQRYAA AL GLAL++A ++QT PL +P+  +    + R SS S SSSDSVSEDP LWVH
Sbjct  18   TQRYAAGALFGLALHEAHLNQTNPLPLPASEDSLSEEQRTSSSSGSSSDSVSEDPDLWVH  77

Query  348  QSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREIT  527
             +S LLRPVFKFL+ID  AW+GLEETAG+  A  HVG FLRLLS+   D SS+ L++E  
Sbjct  78   SNSGLLRPVFKFLDIDSAAWSGLEETAGSSSATHHVGPFLRLLSQELDDGSSQRLDQERA  137

Query  528  LANSIDSMA  554
            L++++D +A
Sbjct  138  LSSAVDGIA  146



>gb|KHN41681.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=677

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = +3

Query  168  TQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQLWVH  347
            TQRYAA AL GLAL++A ++QT PL +P+  +    + R SS S SSSDSVSEDP LWVH
Sbjct  19   TQRYAAGALFGLALHEAHLNQTNPLPLPASEDSLSEEQRTSSSSGSSSDSVSEDPDLWVH  78

Query  348  QSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREIT  527
             +S LLRPVFKFL+ID  AW+GLEETAG+  A  HVG FLRLLS+   D SS+ L++E  
Sbjct  79   SNSGLLRPVFKFLDIDSAAWSGLEETAGSSSATHHVGPFLRLLSQELDDGSSQRLDQERA  138

Query  528  LANSIDSMA  554
            L++++D +A
Sbjct  139  LSSAVDGIA  147



>ref|XP_010933752.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Elaeis guineensis]
Length=633

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 95/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGV--PSDGNEDLTQDRIssgsssssdsvsEDP  332
            L+PTQRYAA ALL LAL QAQIHQT+PL    P  G+ D      +S S+SSS+   +  
Sbjct  7    LSPTQRYAAGALLALALRQAQIHQTQPLDDDDPDAGSRDRCSSASASSSTSSSEGDGDSC  66

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
             LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE  
Sbjct  67   HLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDEKSSERF  126

Query  513  EREITLANSIDSMASSIEKTV  575
            E+E+ LA ++D+M  S+E ++
Sbjct  127  EKELALAKAVDAMVMSLEASL  147



>ref|XP_003517195.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Glycine max]
Length=667

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 98/140 (70%), Gaps = 10/140 (7%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L  TQRYAA AL GLAL+QAQ+HQT PLG+ +D   D   D      +SS+ +VSE P L
Sbjct  8    LTGTQRYAAGALFGLALHQAQLHQTHPLGLSTD---DFPSD----SETSSTLAVSEHPNL  60

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSE---GSGDASSEV  509
            WVH +S LLRPV K+L+I+  AW+GLEETAG   A+RHVG FLRLLSE      D SS+ 
Sbjct  61   WVHHNSGLLRPVLKYLDINSAAWSGLEETAGFSSASRHVGPFLRLLSEDFDDDDDDSSQR  120

Query  510  LEREITLANSIDSMASSIEK  569
            L++E+ L+ ++D+M  S+EK
Sbjct  121  LDQELALSEAVDAMVHSLEK  140



>ref|XP_010933751.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Elaeis guineensis]
Length=673

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 95/141 (67%), Gaps = 2/141 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGV--PSDGNEDLTQDRIssgsssssdsvsEDP  332
            L+PTQRYAA ALL LAL QAQIHQT+PL    P  G+ D      +S S+SSS+   +  
Sbjct  7    LSPTQRYAAGALLALALRQAQIHQTQPLDDDDPDAGSRDRCSSASASSSTSSSEGDGDSC  66

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
             LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE  
Sbjct  67   HLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDEKSSERF  126

Query  513  EREITLANSIDSMASSIEKTV  575
            E+E+ LA ++D+M  S+E ++
Sbjct  127  EKELALAKAVDAMVMSLEASL  147



>ref|XP_007156109.1| hypothetical protein PHAVU_003G259400g [Phaseolus vulgaris]
 gb|ESW28103.1| hypothetical protein PHAVU_003G259400g [Phaseolus vulgaris]
Length=668

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 102/141 (72%), Gaps = 5/141 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            +L+PTQRYAA AL GLAL++AQ++QT PL +P        +    + SSSSSDSVSEDP 
Sbjct  11   LLSPTQRYAAGALFGLALHEAQLNQTNPLPLPVT-----EESEQRTSSSSSSDSVSEDPD  65

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH +S LLRPVFKFLEID  AW GLEETAG+  A  HVG FLRLLS+   D SS+ L+
Sbjct  66   LWVHNNSGLLRPVFKFLEIDSAAWLGLEETAGSSSATHHVGPFLRLLSQELDDGSSQTLD  125

Query  516  REITLANSIDSMASSIEKTVD  578
            +E+ L++++D +   +++ ++
Sbjct  126  QELALSSAVDGITHEMQQNLE  146



>ref|XP_006380790.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
 gb|ERP58587.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
Length=621

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  168  TQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDPQLW  341
            TQRYAA AL  +AL+QAQIHQTRPLG+  D +E  + T    S  + SSSDSVSEDP LW
Sbjct  16   TQRYAAGALFAIALHQAQIHQTRPLGLFHDDSEQEERTSCSSSHSNGSSSDSVSEDPDLW  75

Query  342  VHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL  476
            +H++S LLRPVF+FLE++ +AWTGLEETAG  PA  HVGAFLRLL
Sbjct  76   IHENSGLLRPVFRFLEVESVAWTGLEETAGGSPAKHHVGAFLRLL  120



>ref|XP_008241785.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Prunus mume]
Length=713

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 100/142 (70%), Gaps = 6/142 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L PTQRYAA AL   AL+QAQIHQT PL + S   E   +    + S SS+DSVS+ P+
Sbjct  6    FLTPTQRYAAGALFAFALHQAQIHQTHPLRLSSGEEESTEE---RTSSVSSADSVSDGPE  62

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDA---SSE  506
            LWVH++S LL PVF+FLEID  AW+GL+E+A   PA+ HVGAFLRLL+E  GD     S+
Sbjct  63   LWVHENSGLLPPVFRFLEIDSAAWSGLQESAATSPASHHVGAFLRLLAEEGGDGDKDGSQ  122

Query  507  VLEREITLANSIDSMASSIEKT  572
              ++E+ L+ ++D+MA S+EKT
Sbjct  123  SADQELALSRTVDAMALSMEKT  144



>ref|XP_006829156.1| hypothetical protein AMTR_s00001p00269860 [Amborella trichopoda]
 gb|ERM96572.1| hypothetical protein AMTR_s00001p00269860 [Amborella trichopoda]
Length=674

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 89/136 (65%), Gaps = 4/136 (3%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L  TQRYAA AL+GLAL QAQIHQTRPLG P +   +  ++              E  QL
Sbjct  6    LNSTQRYAAGALMGLALRQAQIHQTRPLGFPPN---NDEEEESHHHHDDLHVLPEELSQL  62

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDA-SSEVLE  515
            W H +  L+RP+F+FL+IDPIAWTGLEETA +  A  H+GAFLRLLSE + D  SSE +E
Sbjct  63   WTHPNYGLVRPIFRFLDIDPIAWTGLEETALSSSAKHHIGAFLRLLSEENCDKDSSEKIE  122

Query  516  REITLANSIDSMASSI  563
            +E  L+ ++D+   S+
Sbjct  123  QEFALSKAVDAATMSL  138



>ref|XP_002310840.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
 gb|EEE91290.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
Length=681

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +3

Query  168  TQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDPQLW  341
            TQRYAA AL  +AL+QAQIHQTRPLG+  D +E  + T    S  + SSSDSVSEDP LW
Sbjct  16   TQRYAAGALFAIALHQAQIHQTRPLGLFHDDSEQEERTSCSSSHSNGSSSDSVSEDPDLW  75

Query  342  VHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL  476
            +H++S LLRPVF+FLE++ +AWTGLEETAG  PA  HVGAFLRLL
Sbjct  76   IHENSGLLRPVFRFLEVESVAWTGLEETAGGSPAKHHVGAFLRLL  120



>ref|XP_011015560.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Populus euphratica]
Length=681

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 99/137 (72%), Gaps = 5/137 (4%)
 Frame = +3

Query  168  TQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDPQLW  341
            TQRYAA AL  +AL+QAQIHQTRPLG+  D +E  + T    S  + SSSDSVSE P LW
Sbjct  16   TQRYAAGALFAIALHQAQIHQTRPLGLSHDDSEQEERTSCSSSHSNGSSSDSVSEAPDLW  75

Query  342  VHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASSEVL  512
            +H++S LLRPVF+FLE++ +AWTGLEETAG  PA  HVGAFLRLL   S  +  +SS+  
Sbjct  76   IHENSGLLRPVFRFLEVESVAWTGLEETAGGSPAKHHVGAFLRLLSEESGNASSSSSQSS  135

Query  513  EREITLANSIDSMASSI  563
            ++E+ L+ ++D M  ++
Sbjct  136  DQEVALSKAVDVMEETM  152



>ref|XP_003629356.1| hypothetical protein MTR_8g076240 [Medicago truncatula]
 gb|AET03832.1| transmembrane protein, putative [Medicago truncatula]
Length=409

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 104/143 (73%), Gaps = 3/143 (2%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L+ TQRYAAAAL GL+L+ +QI+QTR L +P+  +     +RISS SSSSSDSVS+DP 
Sbjct  12   FLSSTQRYAAAALFGLSLHDSQINQTRILPLPASDDSISNINRISSSSSSSSDSVSDDPH  71

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEV--  509
            LWVH  S LLRPVFKFL+ID  AW GLEETAG+  A  HVG F+RLLS+ S D S+E   
Sbjct  72   LWVHHHSGLLRPVFKFLDIDSSAWYGLEETAGSPSATHHVGPFMRLLSQESDDNSAESAQ  131

Query  510  -LEREITLANSIDSMASSIEKTV  575
             LE+E+ L+ ++D++   +EK +
Sbjct  132  RLEQELALSKAVDAIVLEMEKNL  154



>ref|XP_003520272.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Glycine max]
Length=680

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 105/139 (76%), Gaps = 1/139 (1%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVP-SDGNEDLTQDRIssgsssssdsvsEDP  332
             L+PTQRYAAAAL GLAL++A ++QT P  +P S+ +  +++ R S+ SSS SDSVS+DP
Sbjct  15   FLSPTQRYAAAALFGLALHEAHLNQTSPFPLPASEDSLSVSEQRTSNSSSSGSDSVSDDP  74

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
             LWVH +S LLRPVFKFL+ID  AW+GLEETAG+  A  HVG FLRLLS+   D SS+ L
Sbjct  75   DLWVHSNSGLLRPVFKFLDIDSAAWSGLEETAGSSSATHHVGPFLRLLSQELDDGSSQRL  134

Query  513  EREITLANSIDSMASSIEK  569
            ++E  L++++D +A  +++
Sbjct  135  DQERALSSAVDGIALDMQR  153



>ref|XP_007204629.1| hypothetical protein PRUPE_ppa002119mg [Prunus persica]
 gb|EMJ05828.1| hypothetical protein PRUPE_ppa002119mg [Prunus persica]
Length=713

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 99/142 (70%), Gaps = 6/142 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L PTQRYAA AL   AL+QAQIHQT PL + S   E   +    + S SS+DSVS+ P+
Sbjct  6    FLTPTQRYAAGALFAFALHQAQIHQTHPLRLSSGEEESTEE---RTSSVSSADSVSDGPE  62

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDA---SSE  506
            LWVH++S LL PVF+FLEID  AW+GL+E+A   PA+ HVGAFLRLL+E   D     S+
Sbjct  63   LWVHENSGLLPPVFRFLEIDSAAWSGLQESAATSPASHHVGAFLRLLAEEGDDGDKDGSQ  122

Query  507  VLEREITLANSIDSMASSIEKT  572
              ++E+ L+ ++D+MA S+EKT
Sbjct  123  SADQELALSRTVDAMALSMEKT  144



>ref|XP_010679841.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Beta vulgaris subsp. vulgaris]
Length=671

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 108/146 (74%), Gaps = 4/146 (3%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDG-NEDLTQD---RIssgsssssdsvs  323
             L+PT+RYAA  L GLAL+QA IHQ+RPLG+     N+D+  D   RIS+GSSSSSDSVS
Sbjct  5    FLSPTERYAAGTLFGLALHQAHIHQSRPLGLHHQHQNDDVEFDDHHRISNGSSSSSDSVS  64

Query  324  EDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASS  503
            EDP LWVH  SSLLRP+ KFL+I+  AW+G+EET+G   A RHVGAFLRLLSE   ++SS
Sbjct  65   EDPHLWVHPHSSLLRPILKFLQIESTAWSGIEETSGASGATRHVGAFLRLLSEEREESSS  124

Query  504  EVLEREITLANSIDSMASSIEKTVDL  581
            E  ++E+ LA  +D M +S++ + D 
Sbjct  125  EKKDQELALAKGVDCMKASMDSSTDF  150



>ref|XP_009338652.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Pyrus x bretschneideri]
Length=713

 Score = 97.8 bits (242),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 100/140 (71%), Gaps = 6/140 (4%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA AL   AL+QAQIHQTRPL + S   E   +    + S SS+DSVS+DP L
Sbjct  7    LTPTQRYAAGALFAFALHQAQIHQTRPLRLSSQEEESTEE---RTSSVSSADSVSDDPDL  63

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGS---GDASSEV  509
            WVH++S LL PVF+FLEID  AW+GL+E+A   PA+ HVGAFLRLL+E     G  +SE 
Sbjct  64   WVHENSGLLPPVFRFLEIDSAAWSGLQESAATSPASHHVGAFLRLLAEEGGRDGKDASEN  123

Query  510  LEREITLANSIDSMASSIEK  569
             ++E+ L+  ID+MASS+EK
Sbjct  124  SDQELALSKGIDAMASSMEK  143



>ref|XP_009378211.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Pyrus x bretschneideri]
Length=713

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 100/140 (71%), Gaps = 6/140 (4%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA AL   AL+QAQIHQTRPL + S   E   +    + S SS+DSVS+DP L
Sbjct  7    LTPTQRYAAGALFAFALHQAQIHQTRPLRLSSQEEESTEE---RTSSVSSADSVSDDPDL  63

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGS---GDASSEV  509
            WVH++S LL PVF+FLEID  AW+GL+E+A   PA+ HVGAFLRLL+E     G  +SE 
Sbjct  64   WVHENSGLLPPVFRFLEIDSAAWSGLQESAATSPASHHVGAFLRLLAEEGGRDGKDASEN  123

Query  510  LEREITLANSIDSMASSIEK  569
             ++E+ L+  ID+MASS+EK
Sbjct  124  SDQELALSKGIDAMASSMEK  143



>ref|XP_008372754.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Malus domestica]
Length=713

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 100/140 (71%), Gaps = 6/140 (4%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L PTQRYAA AL   AL+QAQIHQTRPL + S   E   +    + S SS+DSVS+DP L
Sbjct  7    LTPTQRYAAGALFAFALHQAQIHQTRPLRLSSQEEESTEE---RTSSVSSADSVSDDPDL  63

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGS---GDASSEV  509
            WVH++S LL PVF+FLEID  AW+GL+E+A   PA+ HVGAFLRLL+E     G  +SE 
Sbjct  64   WVHENSGLLPPVFRFLEIDSAAWSGLQESAATSPASHHVGAFLRLLAEEGGRDGKDASEN  123

Query  510  LEREITLANSIDSMASSIEK  569
             ++E+ L+  ID+MASS+EK
Sbjct  124  SDQELALSKGIDAMASSMEK  143



>ref|XP_008796876.1| PREDICTED: uncharacterized membrane protein YFL034W-like isoform 
X2 [Phoenix dactylifera]
Length=557

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 92/139 (66%), Gaps = 3/139 (2%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSD---GNEDLTQDRIssgsssssdsvsED  329
            L+PTQ+YAA ALL LAL QAQI QT+PL    D   G  D      +S S+SSS+   +D
Sbjct  23   LSPTQKYAAGALLALALRQAQIQQTQPLDDDDDPDAGTRDRCSSASASSSTSSSEGGGDD  82

Query  330  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEV  509
              LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE 
Sbjct  83   SSLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDENSSER  142

Query  510  LEREITLANSIDSMASSIE  566
             E+E+ LA ++D+M  S+E
Sbjct  143  FEKELALAKAVDAMVMSLE  161



>ref|XP_008796875.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Phoenix dactylifera]
Length=690

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 92/139 (66%), Gaps = 3/139 (2%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSD---GNEDLTQDRIssgsssssdsvsED  329
            L+PTQ+YAA ALL LAL QAQI QT+PL    D   G  D      +S S+SSS+   +D
Sbjct  23   LSPTQKYAAGALLALALRQAQIQQTQPLDDDDDPDAGTRDRCSSASASSSTSSSEGGGDD  82

Query  330  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEV  509
              LW H+S  LLRPVF+FL+IDP AW GLEETA +     HVGA+LR++ E   + SSE 
Sbjct  83   SSLWTHESRGLLRPVFRFLDIDPKAWPGLEETAASSIIKHHVGAYLRIIFEEDDENSSER  142

Query  510  LEREITLANSIDSMASSIE  566
             E+E+ LA ++D+M  S+E
Sbjct  143  FEKELALAKAVDAMVMSLE  161



>ref|XP_010526790.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Tarenaya hassleriana]
Length=690

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 91/137 (66%), Gaps = 9/137 (7%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVP------SDGNEDLTQDRIssgsssssdsv  320
            L PTQRYAA AL  +A+ QAQI QT+PLG P        G  +  +    S S SS+DSV
Sbjct  8    LTPTQRYAAGALFAIAVNQAQIPQTQPLGSPVADEDDEGGGGESRRSGERSSSGSSNDSV  67

Query  321  sEDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDAS  500
            SEDP LWVH+ S LLRPVF+ L ID  AW GLEETAG+ PA  H   F+RLLSE + D S
Sbjct  68   SEDPGLWVHECSGLLRPVFRGLHIDSSAWNGLEETAGSSPAKHH---FMRLLSEEASDVS  124

Query  501  SEVLEREITLANSIDSM  551
            SE+ E+E  LA ++D+M
Sbjct  125  SEMAEKEEALAKAVDAM  141



>ref|XP_010271491.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nelumbo nucifera]
Length=670

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 94/139 (68%), Gaps = 5/139 (4%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L P QRYAA ALL LAL+QAQIHQ R   +P   +E+ T  R  + +   SDS SE+PQL
Sbjct  7    LTPKQRYAAGALLALALHQAQIHQARLFILP---DEETTNGR--TNNGRGSDSPSEEPQL  61

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            W+H++S LLRPVF+ LEID   W  LEETA   PA  HVGA LRLLS+ +G+ SSE L++
Sbjct  62   WIHENSGLLRPVFRSLEIDCEDWPRLEETARFSPAKDHVGALLRLLSKENGETSSERLDQ  121

Query  519  EITLANSIDSMASSIEKTV  575
            E+ L  ++D+M   ++  +
Sbjct  122  ELALTKAVDAMEMKMQTKI  140



>ref|XP_010271492.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Nelumbo nucifera]
Length=669

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 94/139 (68%), Gaps = 5/139 (4%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L P QRYAA ALL LAL+QAQIHQ R   +P   +E+ T  R  + +   SDS SE+PQL
Sbjct  7    LTPKQRYAAGALLALALHQAQIHQARLFILP---DEETTNGR--TNNGRGSDSPSEEPQL  61

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            W+H++S LLRPVF+ LEID   W  LEETA   PA  HVGA LRLLS+ +G+ SSE L++
Sbjct  62   WIHENSGLLRPVFRSLEIDCEDWPRLEETARFSPAKDHVGALLRLLSKENGETSSERLDQ  121

Query  519  EITLANSIDSMASSIEKTV  575
            E+ L  ++D+M   ++  +
Sbjct  122  ELALTKAVDAMEMKMQTKI  140



>ref|XP_006409198.1| hypothetical protein EUTSA_v10022586mg [Eutrema salsugineum]
 gb|ESQ50651.1| hypothetical protein EUTSA_v10022586mg [Eutrema salsugineum]
Length=660

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 91/141 (65%), Gaps = 8/141 (6%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPS--DGNEDLTQDRIssgsssssdsvsEDP  332
            L P+QRYAA+AL  +AL QAQI QT+PLG+PS   G +D    R    SS   D +SED 
Sbjct  8    LTPSQRYAASALFAIALNQAQISQTKPLGIPSTDHGGDDGESIR----SSGGGDPISEDA  63

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD--ASSE  506
             LWVH+ S LLRPVF+ L+ID   W GLEE A +  A  H+GA ++LLSE + D    SE
Sbjct  64   DLWVHEVSGLLRPVFRCLQIDSSVWHGLEEIAASSLAKDHIGALIKLLSEDASDDNGCSE  123

Query  507  VLEREITLANSIDSMASSIEK  569
            ++E+E  LA   ++M  SI++
Sbjct  124  MVEKETALAKGAEAMVQSIQR  144



>ref|XP_003558988.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Brachypodium distachyon]
Length=634

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 88/137 (64%), Gaps = 2/137 (1%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssds--vsEDP  332
            L PTQRYAA ALL LAL QAQIHQ+  LG PS        +R S  SSS+      + D 
Sbjct  5    LTPTQRYAAGALLALALRQAQIHQSVLLGSPSASASASDDERASGSSSSAGSGEDAAADA  64

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
            +LW H S  LLRPVF+FLEIDP AW GLEETA +  A  H+GAFLR++ E  G++SS   
Sbjct  65   ELWTHDSRGLLRPVFRFLEIDPAAWAGLEETAASPEAKHHIGAFLRIIFEEDGESSSHES  124

Query  513  EREITLANSIDSMASSI  563
            ++E+ LA  +D M  S+
Sbjct  125  DQELALAKGVDVMIMSL  141



>ref|XP_004986015.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Setaria italica]
Length=681

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LW H S  LLRPVF+FLEIDP AW GLEETA +  A  H+GAFLR++ E  G++SS+ LE
Sbjct  106  LWTHDSRGLLRPVFRFLEIDPKAWAGLEETAASTEAKHHIGAFLRIIFEEDGESSSDRLE  165

Query  516  REITLANSIDSMASSI  563
            +E  LA ++D M  S+
Sbjct  166  QEHALAKAVDVMVMSL  181



>ref|XP_004509335.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Cicer arietinum]
Length=697

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 106/144 (74%), Gaps = 5/144 (3%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
             L+PTQRYAAAAL GL+L+++Q++QTR L +P+  ++ L+ +  +S SSSS+DSVS+DP 
Sbjct  12   FLSPTQRYAAAALFGLSLHESQVNQTRSLLLPAS-DDSLSNNERTSTSSSSNDSVSDDPD  70

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD----ASS  503
            LWVH  S LLR VFKFL+ID  AW GLEETAG+  +  HVG F+RLLS+ S D     S+
Sbjct  71   LWVHHHSGLLRSVFKFLDIDSSAWYGLEETAGSSSSTHHVGPFMRLLSQDSDDDGSAESA  130

Query  504  EVLEREITLANSIDSMASSIEKTV  575
            + L++E+ L+ ++D++   IEK +
Sbjct  131  QRLDQELALSKAVDALLLDIEKNL  154



>ref|NP_001132355.1| uncharacterized protein LOC100193799 [Zea mays]
 gb|ACF81166.1| unknown [Zea mays]
Length=650

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  332
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SSS    +   
Sbjct  5    LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSSGSDTTSGA  64

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  509
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  65   GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  124

Query  510  LEREITLANSIDSMASSI  563
            LE+EI LA ++D M  S+
Sbjct  125  LEQEIALAKAVDVMVMSL  142



>gb|AFW89821.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=626

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  332
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  509
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  510  LEREITLANSIDSMASSI  563
            LE+EI LA ++D M  S+
Sbjct  432  LEQEIALAKAVDVMVMSL  449



>gb|ACN33345.1| unknown [Zea mays]
Length=647

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  332
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  5    LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  64

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  509
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  65   GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  124

Query  510  LEREITLANSIDSMASSI  563
            LE+EI LA ++D M  S+
Sbjct  125  LEQEIALAKAVDVMVMSL  142



>ref|XP_008658122.1| PREDICTED: uncharacterized protein LOC100193799 isoform X1 [Zea 
mays]
Length=647

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  332
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  5    LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  64

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  509
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  65   GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  124

Query  510  LEREITLANSIDSMASSI  563
            LE+EI LA ++D M  S+
Sbjct  125  LEQEIALAKAVDVMVMSL  142



>ref|NP_001048731.1| Os03g0112800 [Oryza sativa Japonica Group]
 gb|ABF93614.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF10645.1| Os03g0112800 [Oryza sativa Japonica Group]
 gb|EAZ25332.1| hypothetical protein OsJ_09144 [Oryza sativa Japonica Group]
 dbj|BAG94661.1| unnamed protein product [Oryza sativa Japonica Group]
Length=661

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  327  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSE  506
            D  LW H S  LLRPVF+FLEIDP AW+GLEETA +  A  H+GAFLR++ E  G++SS+
Sbjct  70   DADLWTHDSHGLLRPVFRFLEIDPKAWSGLEETAASSEAKHHIGAFLRIIFEEDGESSSD  129

Query  507  VLEREITLANSIDSMASSI  563
               +E+ LA  +D M  S+
Sbjct  130  RSVQELALAKGVDVMVMSL  148



>gb|AFW89820.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=853

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  332
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  509
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  510  LEREITLANSIDSMASSI  563
            LE+EI LA ++D M  S+
Sbjct  432  LEQEIALAKAVDVMVMSL  449



>gb|EAY88253.1| hypothetical protein OsI_09705 [Oryza sativa Indica Group]
Length=661

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  327  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSE  506
            D  LW H S  LLRPVF+FLEIDP AW+GLEETA +  A  H+GAFLR++ E  G++SS+
Sbjct  70   DADLWTHDSHGLLRPVFRFLEIDPKAWSGLEETAASSEAKHHIGAFLRIIFEEDGESSSD  129

Query  507  VLEREITLANSIDSMASSI  563
               +E+ LA  +D M  S+
Sbjct  130  RSVQELALAKGVDVMVMSL  148



>gb|AFW89818.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=709

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  332
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  509
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  510  LEREITLANSIDSMASSI  563
            LE+EI LA ++D M  S+
Sbjct  432  LEQEIALAKAVDVMVMSL  449



>gb|ABF93615.1| expressed protein [Oryza sativa Japonica Group]
Length=689

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  327  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSE  506
            D  LW H S  LLRPVF+FLEIDP AW+GLEETA +  A  H+GAFLR++ E  G++SS+
Sbjct  70   DADLWTHDSHGLLRPVFRFLEIDPKAWSGLEETAASSEAKHHIGAFLRIIFEEDGESSSD  129

Query  507  VLEREITLANSIDSMASSI  563
               +E+ LA  +D M  S+
Sbjct  130  RSVQELALAKGVDVMVMSL  148



>gb|AFW89819.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=954

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  332
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  509
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  510  LEREITLANSIDSMASSI  563
            LE+EI LA ++D M  S+
Sbjct  432  LEQEIALAKAVDVMVMSL  449



>ref|XP_002465997.1| hypothetical protein SORBIDRAFT_01g049760 [Sorghum bicolor]
 gb|EER92995.1| hypothetical protein SORBIDRAFT_01g049760 [Sorghum bicolor]
Length=652

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 90/143 (63%), Gaps = 8/143 (6%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGV----PSDGNEDLTQDRIssgsssssdsvsE  326
            L PTQRYAA ALL LAL QAQIHQ+ PLG     P   +E+       S SS+++ S   
Sbjct  5    LTPTQRYAAGALLALALRQAQIHQSAPLGSGSTDPGPDDEERASSASGSSSSTATISSGS  64

Query  327  DPQ----LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD  494
            D      LW H S  LLRPVF+FLEI+P+AW G+EETA +  A  H+GAFLR+L E   +
Sbjct  65   DTASGAGLWTHDSRGLLRPVFRFLEIEPMAWAGIEETAASPDAKHHIGAFLRILFEEDSE  124

Query  495  ASSEVLEREITLANSIDSMASSI  563
            +SS+ L +E  LA ++D M  S+
Sbjct  125  SSSDRLSQESPLAKAVDVMVMSM  147



>ref|XP_010061018.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Eucalyptus grandis]
Length=668

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 88/141 (62%), Gaps = 6/141 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsss-ssdsvsEDP  332
            IL  TQRYAAA L  LAL+ +Q HQTRP    SD    L ++ I  G S     S SE P
Sbjct  5    ILTATQRYAAAGLFALALHHSQRHQTRP----SDALAPLEEEPIGRGVSVDRGASASERP  60

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDASSEV  509
            +LW+H  S LLRPVF+F ++D  +W GL+ETAG+    R HVGAFLRLL E   +   E 
Sbjct  61   ELWIHGGSGLLRPVFRFFKVDERSWDGLKETAGSSSQVRHHVGAFLRLLVEDGEETCPER  120

Query  510  LEREITLANSIDSMASSIEKT  572
             ++E+ LA ++D+M  S+E +
Sbjct  121  TDKELALAKAVDAMVLSVETS  141



>gb|KCW67917.1| hypothetical protein EUGRSUZ_F01619 [Eucalyptus grandis]
Length=669

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 88/141 (62%), Gaps = 6/141 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsss-ssdsvsEDP  332
            IL  TQRYAAA L  LAL+ +Q HQTRP    SD    L ++ I  G S     S SE P
Sbjct  5    ILTATQRYAAAGLFALALHHSQRHQTRP----SDALAPLEEEPIGRGVSVDRGASASERP  60

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDASSEV  509
            +LW+H  S LLRPVF+F ++D  +W GL+ETAG+    R HVGAFLRLL E   +   E 
Sbjct  61   ELWIHGGSGLLRPVFRFFKVDERSWDGLKETAGSSSQVRHHVGAFLRLLVEDGEETCPER  120

Query  510  LEREITLANSIDSMASSIEKT  572
             ++E+ LA ++D+M  S+E +
Sbjct  121  TDKELALAKAVDAMVLSVETS  141



>gb|KFK40189.1| hypothetical protein AALP_AA3G341700 [Arabis alpina]
Length=636

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 92/145 (63%), Gaps = 8/145 (6%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDG-NEDLTQDRIssgsssssdsvsEDP-  332
            L P+QRYAA+AL  +AL QAQI QT+ LG+P+   N+   ++R+     S+  S  +DP 
Sbjct  12   LTPSQRYAASALFAIALNQAQISQTKLLGIPTTSVNDGEPENRLIREPISTGSSNGDDPI  71

Query  333  ----QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSG--D  494
                  WVH+ S LLRPVF+ L+ID  AW GLEE A + PA  H+G+ ++LL+E +   D
Sbjct  72   SDEADFWVHEVSGLLRPVFRCLQIDSSAWHGLEEIAASSPAKHHIGSLIKLLAEDASETD  131

Query  495  ASSEVLEREITLANSIDSMASSIEK  569
             SSE  E+E  LA + ++M  +I++
Sbjct  132  DSSEKEEKETALAKAAEAMVQNIKQ  156



>gb|KFK40188.1| hypothetical protein AALP_AA3G341700 [Arabis alpina]
Length=633

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 92/145 (63%), Gaps = 8/145 (6%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDG-NEDLTQDRIssgsssssdsvsEDP-  332
            L P+QRYAA+AL  +AL QAQI QT+ LG+P+   N+   ++R+     S+  S  +DP 
Sbjct  12   LTPSQRYAASALFAIALNQAQISQTKLLGIPTTSVNDGEPENRLIREPISTGSSNGDDPI  71

Query  333  ----QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSG--D  494
                  WVH+ S LLRPVF+ L+ID  AW GLEE A + PA  H+G+ ++LL+E +   D
Sbjct  72   SDEADFWVHEVSGLLRPVFRCLQIDSSAWHGLEEIAASSPAKHHIGSLIKLLAEDASETD  131

Query  495  ASSEVLEREITLANSIDSMASSIEK  569
             SSE  E+E  LA + ++M  +I++
Sbjct  132  DSSEKEEKETALAKAAEAMVQNIKQ  156



>gb|KHN36057.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=628

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 94/139 (68%), Gaps = 9/139 (6%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L  TQRYAA AL GLAL+QAQ+HQT PLG+ +D   D   D      +SS+ +VSE P L
Sbjct  8    LTGTQRYAAGALFGLALHQAQLHQTHPLGLSTD---DFPSD----SETSSTLAVSEHPNL  60

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLR--LLSEGSGDASSEVL  512
            WVH +S LLRPV K+L+I+  AW+GLEETAG   A+RHVG FLR         D SS+ L
Sbjct  61   WVHHNSGLLRPVLKYLDINSAAWSGLEETAGFSSASRHVGPFLRLLSEDFDDDDDSSQRL  120

Query  513  EREITLANSIDSMASSIEK  569
            ++E+ L+ ++D+M  S+EK
Sbjct  121  DQELALSEAVDAMVHSLEK  139



>emb|CDY30329.1| BnaA09g09480D [Brassica napus]
Length=1407

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 88/138 (64%), Gaps = 5/138 (4%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVP-SDGNEDLTQDRIssgsssssdsvsEDPQ  335
            L P+QRYAA+AL  +AL QAQI QT+PLG+  +D   D     +   S   S    ED  
Sbjct  806  LTPSQRYAASALFAIALNQAQISQTKPLGISNTDHGGDNGDSELGVTSGGDSVPQDED--  863

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LW+H+ S LLRPVF+ L+ID  AW G+EE AG+ PA  H+GA ++LLS+   D S +++E
Sbjct  864  LWIHEVSGLLRPVFRCLQIDSSAWHGIEEIAGSSPAKHHMGALIKLLSD--DDGSGDMVE  921

Query  516  REITLANSIDSMASSIEK  569
            +E  LA + ++M   I++
Sbjct  922  KETALAKAAEAMVQGIQQ  939



>gb|EMT20138.1| hypothetical protein F775_14016 [Aegilops tauschii]
Length=623

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 90/145 (62%), Gaps = 9/145 (6%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVP----SDGNEDLTQDRIssgsssssdsvs  323
            +L PTQRYAA ALL LAL QAQIHQ+  LG P    +D  E  +     SGSSSS+    
Sbjct  5    LLTPTQRYAAGALLALALRQAQIHQSVLLGSPLTSAADDEERASSASGGSGSSSSTGGSG  64

Query  324  EDPQ-----LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGS  488
            ED +     LW H S  LLRPVF+FLEIDP AW GLEETA +  A  H+GAFLR++ +  
Sbjct  65   EDAEAAAKALWTHDSRGLLRPVFRFLEIDPAAWPGLEETAASPEAKHHIGAFLRMIFQED  124

Query  489  GDASSEVLEREITLANSIDSMASSI  563
             ++S +  ++E  LA  +D M  S+
Sbjct  125  AESSPDKSDQEHALAKGVDVMVMSL  149



>ref|XP_006297154.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
 gb|EOA30052.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
Length=626

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 90/156 (58%), Gaps = 26/156 (17%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNED---LTQDRIssgsssssdsvsED  329
            + P+QRYAA+AL  +AL QAQI QTRPL +P+  + D   ++ D                
Sbjct  8    MTPSQRYAASALFAIALNQAQISQTRPLEIPATTDHDGEPISSD------------GDTI  55

Query  330  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD-----  494
              LWVH+ S LLRPVF+ L+ID  AW GLEE A +  A  H+GAF++LLSE + +     
Sbjct  56   SDLWVHEVSGLLRPVFRCLQIDSSAWHGLEEIAASSQAKDHIGAFIKLLSEDASNDDDDD  115

Query  495  -----ASSEVLEREITLANSIDSMASSIE-KTVDLE  584
                  SSE++E+E  LA + D+M  +I   TV +E
Sbjct  116  DDDDDDSSEMVEKETALAKAADAMVQNIRSSTVSVE  151



>ref|XP_006297155.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
 gb|EOA30053.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
Length=661

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 90/156 (58%), Gaps = 26/156 (17%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNED---LTQDRIssgsssssdsvsED  329
            + P+QRYAA+AL  +AL QAQI QTRPL +P+  + D   ++ D                
Sbjct  8    MTPSQRYAASALFAIALNQAQISQTRPLEIPATTDHDGEPISSD------------GDTI  55

Query  330  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD-----  494
              LWVH+ S LLRPVF+ L+ID  AW GLEE A +  A  H+GAF++LLSE + +     
Sbjct  56   SDLWVHEVSGLLRPVFRCLQIDSSAWHGLEEIAASSQAKDHIGAFIKLLSEDASNDDDDD  115

Query  495  -----ASSEVLEREITLANSIDSMASSIE-KTVDLE  584
                  SSE++E+E  LA + D+M  +I   TV +E
Sbjct  116  DDDDDDSSEMVEKETALAKAADAMVQNIRSSTVSVE  151



>ref|XP_004291817.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Fragaria vesca subsp. vesca]
Length=721

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 87/139 (63%), Gaps = 5/139 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            +L  TQRYAA AL  LAL+Q QIHQT+PL       E+   D +  G + S     +DP 
Sbjct  41   VLTQTQRYAAGALFALALHQTQIHQTKPLNALLPLEEETINDGVGIGRTVSVS---DDPG  97

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGD-ASSEV  509
            LW+H+SS LL PV +FL ++  +W GL+ETAG+    R HVGAFL LL E + + AS+E 
Sbjct  98   LWIHESSGLLYPVLRFLGVEDKSWKGLKETAGSSSQVRHHVGAFLTLLKEETAEVASAEK  157

Query  510  LEREITLANSIDSMASSIE  566
             E+E+ L  ++D+M  S E
Sbjct  158  SEKEVALTKTVDTMVRSEE  176



>ref|XP_010489507.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Camelina sativa]
Length=660

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 94/142 (66%), Gaps = 7/142 (5%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPS----DGNEDLTQDRIssgsssssdsvsE  326
            + P+QRYAA+AL  +AL QAQI QT+PLG+P+    DG++  +++R  S SS     +S+
Sbjct  1    MTPSQRYAASALFAIALNQAQISQTKPLGIPATTDHDGDDGESENRRESISSDGDIPISD  60

Query  327  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDA  497
            D  LWVH+ S LLRPVF+ L+ID  AW GLE+ A +  A  H+GAF++LL        D 
Sbjct  61   DADLWVHEVSGLLRPVFRCLQIDSSAWHGLEKIAASSQAKDHIGAFVKLLSEDVSNDDDD  120

Query  498  SSEVLEREITLANSIDSMASSI  563
            SSE++E+E  LA + ++M  +I
Sbjct  121  SSEMVEKETALAKAAEAMDQNI  142



>ref|XP_010489505.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Camelina sativa]
Length=663

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 94/142 (66%), Gaps = 7/142 (5%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPS----DGNEDLTQDRIssgsssssdsvsE  326
            + P+QRYAA+AL  +AL QAQI QT+PLG+P+    DG++  +++R  S SS     +S+
Sbjct  1    MTPSQRYAASALFAIALNQAQISQTKPLGIPATTDHDGDDGESENRRESISSDGDIPISD  60

Query  327  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDA  497
            D  LWVH+ S LLRPVF+ L+ID  AW GLE+ A +  A  H+GAF++LL        D 
Sbjct  61   DADLWVHEVSGLLRPVFRCLQIDSSAWHGLEKIAASSQAKDHIGAFVKLLSEDVSNDDDD  120

Query  498  SSEVLEREITLANSIDSMASSI  563
            SSE++E+E  LA + ++M  +I
Sbjct  121  SSEMVEKETALAKAAEAMDQNI  142



>ref|XP_010489506.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Camelina sativa]
Length=661

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 94/142 (66%), Gaps = 7/142 (5%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPS----DGNEDLTQDRIssgsssssdsvsE  326
            + P+QRYAA+AL  +AL QAQI QT+PLG+P+    DG++  +++R  S SS     +S+
Sbjct  1    MTPSQRYAASALFAIALNQAQISQTKPLGIPATTDHDGDDGESENRRESISSDGDIPISD  60

Query  327  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDA  497
            D  LWVH+ S LLRPVF+ L+ID  AW GLE+ A +  A  H+GAF++LL        D 
Sbjct  61   DADLWVHEVSGLLRPVFRCLQIDSSAWHGLEKIAASSQAKDHIGAFVKLLSEDVSNDDDD  120

Query  498  SSEVLEREITLANSIDSMASSI  563
            SSE++E+E  LA + ++M  +I
Sbjct  121  SSEMVEKETALAKAAEAMDQNI  142



>dbj|BAJ94309.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=657

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LW H S  LLRPVF+FLEIDP AW GLEETA +  A  H+GAFLR++ E   ++SS+  +
Sbjct  77   LWTHDSRGLLRPVFRFLEIDPAAWPGLEETAASPEAKHHIGAFLRMIFEEDAESSSDSQD  136

Query  516  REITLANSIDSMASSI  563
            +E  LA  +D M  S+
Sbjct  137  QEHALAKGVDVMVMSL  152



>ref|XP_009112467.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Brassica rapa]
Length=656

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 89/139 (64%), Gaps = 7/139 (5%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvs--EDP  332
            L P+QRYAA+ALL +AL QAQI QT+PLG+    N D   D   S    +S   S  +D 
Sbjct  8    LTPSQRYAASALLAIALNQAQISQTKPLGIS---NTDHGGDNGGSEHGVTSGGDSVPQDE  64

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
             LWVH+ S LLRPVF+ L+ID  AW G+EE A + PA  H+GA ++LLS+   D S +++
Sbjct  65   DLWVHEVSGLLRPVFRCLQIDSSAWHGIEEIAASSPAKPHIGALIKLLSD--DDGSGDMV  122

Query  513  EREITLANSIDSMASSIEK  569
            E+E  LA + ++M   I++
Sbjct  123  EKETALAKAAEAMVQGIQQ  141



>gb|EPS66741.1| hypothetical protein M569_08033, partial [Genlisea aurea]
Length=659

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +3

Query  222  IHQTRPLGVPSDGNED-LTQDRIssgsssssdsvsEDPQLWVHQSSSLLRPVFKFLEIDP  398
            IHQ  PLG  +D ++    +    S SSSS DSVS+DPQLWVH SS LLRPVF++L+ID 
Sbjct  19   IHQISPLGFHTDSDDGPERRSDERSSSSSSGDSVSDDPQLWVHPSSCLLRPVFRYLDIDR  78

Query  399  IAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDSMASSIE  566
             AW GLEET+   PA  H+GAFLRLL+E SG+AS E  E E+ L   +D MAS++E
Sbjct  79   RAWEGLEETSAASPAKNHIGAFLRLLAEESGEASEEAAEEELALVKGVDGMASTME  134



>emb|CDY53279.1| BnaC09g09640D [Brassica napus]
Length=634

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 92/137 (67%), Gaps = 6/137 (4%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            L P+QRYAA+ALL +AL QAQI QT+PL V   G ++   +    G +S  DS+S+D  L
Sbjct  8    LTPSQRYAASALLAIALNQAQISQTKPL-VTDHGRDNGDSEH---GLTSGGDSISQDEDL  63

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            WVHQ S LLRPVF+ L+ID  AW G+EE A + PA  H+GA ++LLS+   D S +++E+
Sbjct  64   WVHQVSGLLRPVFRCLQIDSSAWHGIEEIAASSPAKPHIGALIKLLSD--NDGSGDMVEK  121

Query  519  EITLANSIDSMASSIEK  569
            E  LA + ++M   I++
Sbjct  122  ETALAKAAEAMVQGIQQ  138



>gb|AFW89817.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=534

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 80/128 (63%), Gaps = 3/128 (2%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  332
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  509
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  510  LEREITLA  533
            LE+EI LA
Sbjct  432  LEQEIALA  439



>gb|AFW89816.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=506

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 80/128 (63%), Gaps = 3/128 (2%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNE--DLTQDRIssgsssssdsvsEDP  332
            L PTQRYAA  LL LAL QAQIHQ+ PLG   D  E         SS  SS+    +   
Sbjct  312  LTPTQRYAAGTLLALALRQAQIHQSEPLGSGPDDEERASSASGSSSSTISSTGSDTTSGA  371

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEV  509
             LW H S  LLRPVF+FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ 
Sbjct  372  GLWTHDSRGLLRPVFRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDR  431

Query  510  LEREITLA  533
            LE+EI LA
Sbjct  432  LEQEIALA  439



>gb|KJB29622.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=579

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 95/144 (66%), Gaps = 6/144 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  332
            +L+ TQ+YAA+AL  +AL+ +Q+HQTRP    +     L ++ I  G+S+SS     D P
Sbjct  5    LLSSTQKYAASALFAVALHHSQLHQTRP----TTRLLSLEEEPIGEGASNSSTISVSDFP  60

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  509
             LW+H +S LL PVF+F+E++  AW GL+ETAG +  A  HVG+F+ LLSE + + SS +
Sbjct  61   HLWIHDNSGLLLPVFRFMEVEDQAWEGLKETAGVSTQARHHVGSFMTLLSETNDEVSSGI  120

Query  510  LEREITLANSIDSMASSIEKTVDL  581
             E+E+ L  ++D+   S+E ++ L
Sbjct  121  REKELALLKAVDATMLSMESSLVL  144



>ref|XP_010413917.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=661

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 88/137 (64%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            + P+QRYAA+AL  +AL QAQI QT+PLG+P+  + D   D     SS     +S+D  L
Sbjct  8    MTPSQRYAASALFAIALNQAQISQTKPLGIPATTDHD--GDDGEPISSDGDIPISDDADL  65

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL--SEGSGDASSEVL  512
            WVH+ S LLRPVF+ L+ID  AW GLEE A +  +  H+GAF++LL       D SSE++
Sbjct  66   WVHEVSGLLRPVFRCLQIDTSAWHGLEEIAASSQSKDHIGAFIKLLSEDVSDDDDSSEMV  125

Query  513  EREITLANSIDSMASSI  563
            E+E  LA + ++M  +I
Sbjct  126  EKETALAKAAEAMGQNI  142



>gb|KJB29619.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=615

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 95/144 (66%), Gaps = 6/144 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  332
            +L+ TQ+YAA+AL  +AL+ +Q+HQTRP    +     L ++ I  G+S+SS     D P
Sbjct  5    LLSSTQKYAASALFAVALHHSQLHQTRP----TTRLLSLEEEPIGEGASNSSTISVSDFP  60

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  509
             LW+H +S LL PVF+F+E++  AW GL+ETAG +  A  HVG+F+ LLSE + + SS +
Sbjct  61   HLWIHDNSGLLLPVFRFMEVEDQAWEGLKETAGVSTQARHHVGSFMTLLSETNDEVSSGI  120

Query  510  LEREITLANSIDSMASSIEKTVDL  581
             E+E+ L  ++D+   S+E ++ L
Sbjct  121  REKELALLKAVDATMLSMESSLVL  144



>gb|KJB29620.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=666

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 95/144 (66%), Gaps = 6/144 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  332
            +L+ TQ+YAA+AL  +AL+ +Q+HQTRP    +     L ++ I  G+S+SS     D P
Sbjct  5    LLSSTQKYAASALFAVALHHSQLHQTRP----TTRLLSLEEEPIGEGASNSSTISVSDFP  60

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  509
             LW+H +S LL PVF+F+E++  AW GL+ETAG +  A  HVG+F+ LLSE + + SS +
Sbjct  61   HLWIHDNSGLLLPVFRFMEVEDQAWEGLKETAGVSTQARHHVGSFMTLLSETNDEVSSGI  120

Query  510  LEREITLANSIDSMASSIEKTVDL  581
             E+E+ L  ++D+   S+E ++ L
Sbjct  121  REKELALLKAVDATMLSMESSLVL  144



>ref|XP_007226229.1| hypothetical protein PRUPE_ppa016746mg [Prunus persica]
 gb|EMJ27428.1| hypothetical protein PRUPE_ppa016746mg [Prunus persica]
Length=671

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 93/143 (65%), Gaps = 8/143 (6%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLG--VPSDGNEDLTQDRIssgsssssdsvsED  329
            IL PT +YAA AL  LAL+Q+QIHQ RP    +PS   E +++      S   + SVS++
Sbjct  5    ILTPTHKYAAGALFALALHQSQIHQARPSTPPLPSLEKETISEG----ASIGKTVSVSDN  60

Query  330  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDA-SS  503
              LW+H++S L+ PVF+FL +D  +W G++ETAG+    R HVGA + LLSEG+ D  SS
Sbjct  61   SDLWIHENSGLIYPVFRFLGVDEQSWKGIKETAGSSSQVRHHVGALMTLLSEGTTDGPSS  120

Query  504  EVLEREITLANSIDSMASSIEKT  572
            E  ++E  L  ++D+MA S E++
Sbjct  121  EKTDKECALTKTVDAMALSEEES  143



>gb|KJB29621.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=671

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 95/144 (66%), Gaps = 6/144 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  332
            +L+ TQ+YAA+AL  +AL+ +Q+HQTRP    +     L ++ I  G+S+SS     D P
Sbjct  5    LLSSTQKYAASALFAVALHHSQLHQTRP----TTRLLSLEEEPIGEGASNSSTISVSDFP  60

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  509
             LW+H +S LL PVF+F+E++  AW GL+ETAG +  A  HVG+F+ LLSE + + SS +
Sbjct  61   HLWIHDNSGLLLPVFRFMEVEDQAWEGLKETAGVSTQARHHVGSFMTLLSETNDEVSSGI  120

Query  510  LEREITLANSIDSMASSIEKTVDL  581
             E+E+ L  ++D+   S+E ++ L
Sbjct  121  REKELALLKAVDATMLSMESSLVL  144



>ref|XP_008221322.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Prunus mume]
Length=707

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 94/144 (65%), Gaps = 8/144 (6%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLG--VPSDGNEDLTQDRIssgsssssdsvsED  329
            IL PT +YAA AL  LAL+Q+QIHQ RP    +PS   E +++      S   + SVS++
Sbjct  41   ILIPTHKYAAGALFALALHQSQIHQARPSTPPLPSLEKETISEG----ASIGKTVSVSDN  96

Query  330  PQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDA-SS  503
              LW+H++S L+ PVF+FL +D  +W G++ETAG+    R HVGA + LLSEG+ D  SS
Sbjct  97   SDLWIHENSGLIYPVFRFLGVDEQSWKGIKETAGSSSQVRHHVGALMTLLSEGTTDGPSS  156

Query  504  EVLEREITLANSIDSMASSIEKTV  575
            E  ++E  L  ++D+MA S E+++
Sbjct  157  EKTDKECALTKTVDAMALSEEESL  180



>ref|XP_004982627.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Setaria italica]
Length=619

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 3/83 (4%)
 Frame = +3

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASSE  506
            LW H+S  LLRPV +FLEIDP AW G+E+TA +     H+GAFLR + E   D   A SE
Sbjct  59   LWTHESRGLLRPVLRFLEIDPKAWAGVEKTAASSDPKHHIGAFLRKVVEDEDDDEKARSE  118

Query  507  VLEREITLANSIDSMASSIEKTV  575
              ++E+ LA ++D+MA  +E ++
Sbjct  119  RSDQELALAKAVDAMAMGLESSI  141



>gb|KEH36226.1| transmembrane and coiled-coil protein [Medicago truncatula]
Length=598

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 62/87 (71%), Gaps = 3/87 (3%)
 Frame = +3

Query  324  EDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDAS  500
            ++P+LW+H +S LL PVF+FLE+D  AW GL+ETAG+    R H+G F ++LSE  GDAS
Sbjct  56   DNPELWIHDNSGLLLPVFRFLEVDEQAWHGLKETAGSSSQFRHHLGDFFKVLSE-EGDAS  114

Query  501  S-EVLEREITLANSIDSMASSIEKTVD  578
            S + L++E  L N++D+  +S++   D
Sbjct  115  SKDRLDKEAALTNAVDATEASMKSIAD  141



>ref|XP_003603726.1| Transmembrane and coiled-coil domain-containing protein [Medicago 
truncatula]
 gb|AES73977.1| transmembrane and coiled-coil protein [Medicago truncatula]
Length=663

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 62/87 (71%), Gaps = 3/87 (3%)
 Frame = +3

Query  324  EDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDAS  500
            ++P+LW+H +S LL PVF+FLE+D  AW GL+ETAG+    R H+G F ++LSE  GDAS
Sbjct  56   DNPELWIHDNSGLLLPVFRFLEVDEQAWHGLKETAGSSSQFRHHLGDFFKVLSE-EGDAS  114

Query  501  S-EVLEREITLANSIDSMASSIEKTVD  578
            S + L++E  L N++D+  +S++   D
Sbjct  115  SKDRLDKEAALTNAVDATEASMKSIAD  141



>ref|XP_010467612.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=661

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 88/137 (64%), Gaps = 4/137 (3%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQL  338
            + P+QRYAA+ALL +AL QAQI QT PLG+P+  + D   D     SS     +S+D  L
Sbjct  8    MTPSQRYAASALLAIALNQAQISQTTPLGIPATTDHD--GDDGEPISSDGDIPISDDADL  65

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL--SEGSGDASSEVL  512
            WVH+ S LLRPVF+ L+ID  AW GLEE A +  A  H+GAF++LL       D SSE++
Sbjct  66   WVHEVSGLLRPVFRCLQIDTSAWHGLEEIAASSQAKDHIGAFIKLLSEDASDDDDSSEMV  125

Query  513  EREITLANSIDSMASSI  563
            E+E  LA + ++M  +I
Sbjct  126  EKETALAKAAEAMGQNI  142



>ref|XP_004500958.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Cicer arietinum]
Length=662

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 88/142 (62%), Gaps = 6/142 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            IL P Q YAAAAL  +AL+Q+QIHQ      P  G  D     I   SS S     ++P+
Sbjct  7    ILLPAQTYAAAALFAIALHQSQIHQGLTPASPRAGGGDAPTPSIVDASSVS-----DNPE  61

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDASSEVL  512
            LW++++S LL P+F+FL +D  AW GL+ETAG+   +R H+  F +LLSE     S+E L
Sbjct  62   LWINENSGLLWPIFRFLGVDEKAWHGLKETAGSSSQSRHHLRDFFKLLSEEGDAISTERL  121

Query  513  EREITLANSIDSMASSIEKTVD  578
            ++E  LAN+ID+  + ++KT D
Sbjct  122  DKEAALANAIDATEAGMKKTAD  143



>ref|XP_007017689.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
 gb|EOY14914.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
Length=653

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 91/142 (64%), Gaps = 6/142 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  332
            IL+PTQ+YAA+AL  LAL+ +Q+ Q RP    ++    +  + I  G+S+       D P
Sbjct  5    ILSPTQKYAASALFALALHHSQVRQKRP----TNALVSMKDEPIGEGASTHKTLSVSDHP  60

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  509
            QLW+H++S LL PVF+ + ++  AW GL+ETAG +  A  HVG+FL LLSE + +AS E 
Sbjct  61   QLWIHENSGLLLPVFRLMGVEDQAWDGLKETAGVSTQARHHVGSFLTLLSEETDEASEER  120

Query  510  LEREITLANSIDSMASSIEKTV  575
             E+E+ L  ++D+   SIE ++
Sbjct  121  REKELALLKAVDATMLSIESSL  142



>ref|XP_007017690.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
2 [Theobroma cacao]
 gb|EOY14915.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
2 [Theobroma cacao]
Length=668

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 91/142 (64%), Gaps = 6/142 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  332
            IL+PTQ+YAA+AL  LAL+ +Q+ Q RP    ++    +  + I  G+S+       D P
Sbjct  5    ILSPTQKYAASALFALALHHSQVRQKRP----TNALVSMKDEPIGEGASTHKTLSVSDHP  60

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  509
            QLW+H++S LL PVF+ + ++  AW GL+ETAG +  A  HVG+FL LLSE + +AS E 
Sbjct  61   QLWIHENSGLLLPVFRLMGVEDQAWDGLKETAGVSTQARHHVGSFLTLLSEETDEASEER  120

Query  510  LEREITLANSIDSMASSIEKTV  575
             E+E+ L  ++D+   SIE ++
Sbjct  121  REKELALLKAVDATMLSIESSL  142



>gb|KHG10124.1| Transmembrane and coiled-coil domain-containing 4 [Gossypium 
arboreum]
 gb|KHG17468.1| Transmembrane and coiled-coil domain-containing 4 [Gossypium 
arboreum]
Length=648

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 95/144 (66%), Gaps = 6/144 (4%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsED-P  332
            +L+ TQ+YAA+AL  LAL+ +Q+HQTRP    +     L ++ I  G+S+SS     D P
Sbjct  5    LLSSTQKYAASALFALALHHSQLHQTRP----TTRLLSLEEEPIGEGASNSSTISVSDFP  60

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAG-NGPANRHVGAFLRLLSEGSGDASSEV  509
             LW+H +S LL PVF+F+E++  AW GL+ETAG +  A  HVG+F+ LLSE + + SS +
Sbjct  61   HLWIHDNSGLLLPVFRFMEVEDQAWEGLKETAGVSTQARHHVGSFMTLLSETNDEVSSGI  120

Query  510  LEREITLANSIDSMASSIEKTVDL  581
             E+E+ L  ++D+   S+E ++ L
Sbjct  121  REKELALLKAVDATMLSMESSLVL  144



>ref|XP_002464384.1| hypothetical protein SORBIDRAFT_01g017280 [Sorghum bicolor]
 gb|EER91382.1| hypothetical protein SORBIDRAFT_01g017280 [Sorghum bicolor]
Length=578

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 3/83 (4%)
 Frame = +3

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASSE  506
            LW H+S  LLRPV +FLEIDP AW G+E+TA +     H+GAFLR + E   D   A SE
Sbjct  58   LWTHESRGLLRPVLRFLEIDPKAWVGVEKTAASSDPKHHIGAFLRKVIEDEDDDDKARSE  117

Query  507  VLEREITLANSIDSMASSIEKTV  575
              ++E+ LA ++D+MA  +E  V
Sbjct  118  RSDQELALAKAVDAMAMGLECGV  140



>ref|XP_009420791.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Musa acuminata subsp. malaccensis]
Length=642

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = +3

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
            +LW HQS  LLRPVF+FLEID   W  LEETA +    RH+  FLR + + +G ASSE  
Sbjct  54   RLWTHQSRGLLRPVFRFLEIDSNVWAELEETALSSSPERHIDGFLRTIFDCNG-ASSEKS  112

Query  513  EREITLANSIDSMASSIEKTVD  578
            ++E+  A ++DSMA S++   D
Sbjct  113  DQEVAFAKAVDSMALSLQTDAD  134



>gb|AAD20116.1| unknown protein [Arabidopsis thaliana]
Length=655

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 91/143 (64%), Gaps = 14/143 (10%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGN--EDLTQDRIssgsssssdsvsEDP  332
            L P+QRYAA+AL  +AL QAQI Q++PLG+P+ G+  E ++ D         SD +S++ 
Sbjct  8    LTPSQRYAASALFAIALNQAQISQSKPLGIPATGSTGEPISSD---------SDPISDEA  58

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASS  503
             LWVH+ S LLRPV + L+ID  AW GLEE A +  A  H+GAF++LL        D SS
Sbjct  59   DLWVHEVSGLLRPVLRCLQIDSSAWHGLEEIAASTQAKDHIGAFIKLLSEDVSDDDDDSS  118

Query  504  EVLEREITLANSIDSMASSIEKT  572
            E++E+E  LA + D+M  +I  +
Sbjct  119  EMVEKETALAKAADAMDQNIRSS  141



>gb|AAO42809.1| At2g18100 [Arabidopsis thaliana]
 dbj|BAE99624.1| hypothetical protein [Arabidopsis thaliana]
Length=656

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 91/143 (64%), Gaps = 14/143 (10%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGN--EDLTQDRIssgsssssdsvsEDP  332
            L P+QRYAA+AL  +AL QAQI Q++PLG+P+ G+  E ++ D         SD +S++ 
Sbjct  8    LTPSQRYAASALFAIALNQAQISQSKPLGIPATGSTGEPISSD---------SDPISDEA  58

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASS  503
             LWVH+ S LLRPV + L+ID  AW GLEE A +  A  H+GAF++LL        D SS
Sbjct  59   DLWVHEVSGLLRPVLRCLQIDSSAWHGLEEIAASTQAKDHIGAFIKLLSEDVSDDDDDSS  118

Query  504  EVLEREITLANSIDSMASSIEKT  572
            E++E+E  LA + D+M  +I  +
Sbjct  119  EMVEKETALAKAADAMDQNIRSS  141



>ref|NP_179401.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC06726.1| uncharacterized protein AT2G18100 [Arabidopsis thaliana]
Length=656

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 91/143 (64%), Gaps = 14/143 (10%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPSDGN--EDLTQDRIssgsssssdsvsEDP  332
            L P+QRYAA+AL  +AL QAQI Q++PLG+P+ G+  E ++ D         SD +S++ 
Sbjct  8    LTPSQRYAASALFAIALNQAQISQSKPLGIPATGSTGEPISSD---------SDPISDEA  58

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDASS  503
             LWVH+ S LLRPV + L+ID  AW GLEE A +  A  H+GAF++LL        D SS
Sbjct  59   DLWVHEVSGLLRPVLRCLQIDSSAWHGLEEIAASTQAKDHIGAFIKLLSEDVSDDDDDSS  118

Query  504  EVLEREITLANSIDSMASSIEKT  572
            E++E+E  LA + D+M  +I  +
Sbjct  119  EMVEKETALAKAADAMDQNIRSS  141



>ref|XP_008668853.1| PREDICTED: putative DUF726-domain family protein isoform X1 [Zea 
mays]
Length=621

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = +3

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASSE  506
            LW H+S  LLRPV +FLEIDP AW G+E+TA +     H+GAFLR + E   D   A SE
Sbjct  58   LWTHESRGLLRPVLRFLEIDPKAWVGVEKTAASSDPKHHIGAFLRKVFEDEDDDEKARSE  117

Query  507  VLEREITLANSIDSMASSIE  566
              + E+ LA ++D+MA  +E
Sbjct  118  RSDHELALAKAVDAMAMGLE  137



>ref|NP_001130514.1| putative DUF726-domain family protein [Zea mays]
 gb|ACF78760.1| unknown [Zea mays]
 tpg|DAA49326.1| TPA: putative DUF726-domain family protein [Zea mays]
Length=624

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = +3

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASSE  506
            LW H+S  LLRPV +FLEIDP AW G+E+TA +     H+GAFLR + E   D   A SE
Sbjct  58   LWTHESRGLLRPVLRFLEIDPKAWVGVEKTAASSDPKHHIGAFLRKVFEDEDDDEKARSE  117

Query  507  VLEREITLANSIDSMASSIE  566
              + E+ LA ++D+MA  +E
Sbjct  118  RSDHELALAKAVDAMAMGLE  137



>ref|XP_008668907.1| PREDICTED: putative DUF726-domain family protein isoform X2 [Zea 
mays]
Length=605

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = +3

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASSE  506
            LW H+S  LLRPV +FLEIDP AW G+E+TA +     H+GAFLR + E   D   A SE
Sbjct  58   LWTHESRGLLRPVLRFLEIDPKAWVGVEKTAASSDPKHHIGAFLRKVFEDEDDDEKARSE  117

Query  507  VLEREITLANSIDSMASSIE  566
              + E+ LA ++D+MA  +E
Sbjct  118  RSDHELALAKAVDAMAMGLE  137



>gb|EMT23841.1| hypothetical protein F775_21532 [Aegilops tauschii]
Length=610

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = +3

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LW H S  LLRPV +FLEIDP AW G+E+TA       H+GAFLR + E   D      +
Sbjct  60   LWTHDSRGLLRPVLRFLEIDPKAWPGVEKTAATSEPKHHIGAFLRKVFEDEDDGEKAAAD  119

Query  516  R---EITLANSIDSMASSIEKTV  575
            R   E+ LA ++D+MA  +E  V
Sbjct  120  RSDLELALAKAVDAMAMGLENDV  142



>ref|XP_008366768.1| PREDICTED: uncharacterized protein LOC103430409 [Malus domestica]
Length=504

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 19/156 (12%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTR----PLGVPSDGNEDLTQDRIssgsssssdsvs  323
            IL PT +YAA AL  LAL+Q+Q+HQTR    PL  PS   E + +      S   S SVS
Sbjct  43   ILTPTHKYAAGALFALALHQSQVHQTRQSTPPL--PSLKEETIGEG----ASVGKSVSVS  96

Query  324  EDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDAS  500
            ++  LWVH++S LL P+F+FL +D  +W GL+ETAG+    R HVGAFL LLSE +   S
Sbjct  97   DNDGLWVHENSGLLYPIFRFLGVDDQSWKGLKETAGSSSQVRHHVGAFLTLLSEEADVPS  156

Query  501  SEVLEREITLANSIDSM--------ASSIEKTVDLE  584
             E  ++E  L  ++D+M        ASS EK V+ E
Sbjct  157  EEKSDKERALTKTVDAMVLTEEDSPASSAEKPVNAE  192



>ref|XP_009335556.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Pyrus x bretschneideri]
Length=712

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 19/156 (12%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTR----PLGVPSDGNEDLTQDRIssgsssssdsvs  323
            IL PT +YAA AL  LAL+Q+Q+HQTR    PL  PS   E + +      S   S SVS
Sbjct  43   ILTPTHKYAAGALFALALHQSQVHQTRQSTPPL--PSLKEETIGEG----ASVGKSVSVS  96

Query  324  EDPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDAS  500
            ++  LWVH++S LL P+F+FL +D  +W GL+ETAG+    R HVGAFL LLSE +   S
Sbjct  97   DNDGLWVHENSGLLYPIFRFLGVDDQSWKGLKETAGSSSQVRHHVGAFLTLLSEEADVPS  156

Query  501  SEVLEREITLANSIDSM--------ASSIEKTVDLE  584
             E  ++E  L  ++D+M        ASS EK V+ E
Sbjct  157  EEKTDKERALTKTVDAMVLTEEDSPASSAEKPVNAE  192



>gb|AAG13564.1|AC073867_10 hypothetical protein [Oryza sativa Japonica Group]
Length=306

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = +3

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASS  503
             LW H S  LLRPV +FLEID  AW G+E TA       H+GAFLR + E   D   A++
Sbjct  60   HLWTHDSHGLLRPVLRFLEIDHKAWPGVETTAATSEPKHHIGAFLRKVFEDEDDGEAAAA  119

Query  504  EVLEREITLANSIDSMASSIEKTV  575
            E  E+E+ LA ++++MA  +E  V
Sbjct  120  ERSEQELALAKAVEAMAMGLENDV  143



>ref|XP_002510477.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52664.1| conserved hypothetical protein [Ricinus communis]
Length=624

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 90/140 (64%), Gaps = 4/140 (3%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            IL PTQ+YAAAAL  LAL+Q+Q+HQTRP       NE+  +  I+     S     ++P 
Sbjct  5    ILTPTQKYAAAALFSLALHQSQVHQTRPSNSLKPLNEEAIEGVITFSDKFSVS---DNPH  61

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDASSEVL  512
            LW+H++S LL P+ + L +D  AW GL+ETAG+    R H+GAFL+LLSE S    SE  
Sbjct  62   LWIHENSGLLLPILRLLGVDDQAWDGLKETAGSSSQVRHHIGAFLKLLSEESEGTCSERS  121

Query  513  EREITLANSIDSMASSIEKT  572
            +REI L N++++ A ++E +
Sbjct  122  DREIALTNTVNATALTLENS  141



>ref|XP_002884114.1| hypothetical protein ARALYDRAFT_480715 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60373.1| hypothetical protein ARALYDRAFT_480715 [Arabidopsis lyrata subsp. 
lyrata]
Length=667

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 87/142 (61%), Gaps = 7/142 (5%)
 Frame = +3

Query  159  LAPTQRyaaaallglalyqaqIHQTRPLGVPS----DGNEDLTQDRIssgsssssdsvsE  326
            L P+QRYAA+AL  +AL QAQI QT+  G+P+     GN +          SS  D +S+
Sbjct  8    LTPSQRYAASALFAIALNQAQISQTKLFGIPAIDHGGGNGESENSHTREPISSDGDPISD  67

Query  327  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLL---SEGSGDA  497
            D  LWVH+ S L+RPVF+ L+ID  AW GLEE + +  A  H+GAF++LL        D 
Sbjct  68   DADLWVHEVSGLIRPVFRCLQIDSSAWHGLEEISASTQAKDHIGAFIKLLSEDVSDDDDN  127

Query  498  SSEVLEREITLANSIDSMASSI  563
            SS+++E+E  LA + ++M  +I
Sbjct  128  SSDMVEKETALAKAAEAMVQNI  149



>ref|XP_003574182.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Brachypodium distachyon]
Length=632

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = +3

Query  324  EDP---QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD  494
            +DP   +LW H+S +LL PV +FLEIDP AW G+E+TA       H+GAFLR + E   D
Sbjct  56   DDPDGRELWTHESRALLLPVLRFLEIDPKAWPGVEKTAATSDPKHHIGAFLRKVFEDEDD  115

Query  495  ASSEVLER---EITLANSIDSMASSIE  566
                  +R   E+ LA ++D+MA  +E
Sbjct  116  GEKAAADRSDLELALAKAVDAMAMGLE  142



>ref|NP_001176237.1| Os10g0512100 [Oryza sativa Japonica Group]
 gb|AAP54584.2| hypothetical protein LOC_Os10g36830 [Oryza sativa Japonica Group]
 gb|EAZ16662.1| hypothetical protein OsJ_32136 [Oryza sativa Japonica Group]
 dbj|BAH94965.1| Os10g0512100 [Oryza sativa Japonica Group]
Length=636

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = +3

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASS  503
             LW H S  LLRPV +FLEID  AW G+E TA       H+GAFLR + E   D   A++
Sbjct  60   HLWTHDSHGLLRPVLRFLEIDHKAWPGVETTAATSEPKHHIGAFLRKVFEDEDDGEAAAA  119

Query  504  EVLEREITLANSIDSMASSIEKTV  575
            E  E+E+ LA ++++MA  +E  V
Sbjct  120  ERSEQELALAKAVEAMAMGLENDV  143



>gb|EAY79183.1| hypothetical protein OsI_34294 [Oryza sativa Indica Group]
Length=639

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = +3

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGD---ASS  503
             LW H S  LLRPV +FLEID  AW G+E TA       H+GAFLR + E   D   A++
Sbjct  60   HLWTHDSHGLLRPVLRFLEIDHKAWPGVETTAATSEPKHHIGAFLRKVFEDEDDGEAAAA  119

Query  504  EVLEREITLANSIDSMASSIEKTV  575
            E  E+E+ LA ++++MA  +E  V
Sbjct  120  ERSEQELALAKAVEAMAMGLENDV  143



>ref|XP_006661949.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Oryza brachyantha]
Length=623

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 46/84 (55%), Gaps = 3/84 (4%)
 Frame = +3

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
             LW H S  LLRPV +FLEID  AW G+E TA       H+GAFLR + E   D      
Sbjct  58   HLWTHDSHGLLRPVLRFLEIDHKAWPGVETTAATSDPKHHIGAFLRKVFEDEDDGEKAAG  117

Query  513  ER---EITLANSIDSMASSIEKTV  575
            ER   E+ LA ++D+M   +E  V
Sbjct  118  ERSDHELALAKAVDAMVMGLENDV  141



>ref|XP_010317700.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Solanum lycopersicum]
Length=631

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 84/143 (59%), Gaps = 36/143 (25%)
 Frame = +3

Query  156  ILAPTQRyaaaallglalyqaqIHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQ  335
            +L PT RYAA AL GLAL+QAQIHQT PLG P    E+       S S SS+DSVS+DPQ
Sbjct  6    MLTPTHRYAAGALFGLALHQAQIHQTCPLGFPDTPPEE------RSSSCSSADSVSDDPQ  59

Query  336  LWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLE  515
            LWVH+SS+LLRP+FK                              LLSE S D SSE  +
Sbjct  60   LWVHESSALLRPIFK------------------------------LLSEESDDGSSEAAD  89

Query  516  REITLANSIDSMASSIEKTVDLE  584
             E+ LAN +D+MASS+EKT D E
Sbjct  90   MELALANGVDAMASSMEKTSDDE  112



>gb|KHN09111.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=630

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 64/119 (54%), Gaps = 24/119 (20%)
 Frame = +3

Query  222  IHQTRPLGVPSDGNEDLTQDRIssgsssssdsvsEDPQLWVHQSSSLLRPVFKFLEIDPI  401
            IHQ R  G+ S  N                     +P+LW+  +S LL P+F+FL +D  
Sbjct  29   IHQIRISGIASVSN---------------------NPELWIKHNSDLLCPIFRFLGVDDQ  67

Query  402  AWTGLEETA-GNGPANRHVGAFLRLLSEGSGDASS-EVLEREITLANSIDSMASSIEKT  572
            +W GLE TA  +     H+G+FL+LLSE  GDA++ E L++E  L  +ID+ A S+  T
Sbjct  68   SWHGLEATATSSSQLGHHLGSFLQLLSE-EGDATTPEGLDKESALTKAIDASAMSMNDT  125



>ref|XP_003527670.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Glycine max]
Length=630

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = +3

Query  327  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETA-GNGPANRHVGAFLRLLSEGSGDASS  503
            +P+LW+  +S LL P+F+FL +D  +W GLE TA  +     H+G+FL+LLSE  GDA++
Sbjct  43   NPELWIKHNSDLLCPIFRFLGVDDQSWHGLEATATSSSQLGHHLGSFLQLLSE-EGDATT  101

Query  504  -EVLEREITLANSIDSMASSIEKT  572
             E L++E  L+ +ID+ A S+  T
Sbjct  102  PEGLDKESALSKAIDASAMSMNDT  125



>ref|XP_008778296.1| PREDICTED: uncharacterized protein LOC103698100 [Phoenix dactylifera]
Length=340

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +3

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
            QLW H+S  LLRPVF+FLEID  AW  LE+ A + PA   V  FL+ + +   +A SE  
Sbjct  117  QLWTHESHGLLRPVFRFLEIDSKAWPVLEKAAVSSPAREQVVMFLKTIFDDE-EACSERS  175

Query  513  EREITLANSIDSMASSIE  566
             +E  L  ++D M   ++
Sbjct  176  NQEFALTEAVDYMVKDLQ  193



>gb|ACN33374.1| unknown [Zea mays]
Length=322

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +3

Query  372  VFKFLEIDPIAWTGLEETAGN-GPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDS  548
             ++FLEI+P AW G+EETA +   A  H+GAF+ +L E  G++SS+ LE+EI LA ++D 
Sbjct  2    CYRFLEIEPKAWAGMEETAASPDAAKHHIGAFISILFEEDGESSSDRLEQEIALAKAVDV  61

Query  549  MASSI  563
            M  S+
Sbjct  62   MVMSL  66



>ref|XP_006650970.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Oryza brachyantha]
Length=615

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  381  FLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDSMASS  560
            FLEIDP AW+GLEETA +  A  H+GAFLR++ E  G++SS+   +E+ LA  +D M  S
Sbjct  43   FLEIDPKAWSGLEETAASSEAKHHIGAFLRIIFEEDGESSSDRSLQELALAKGVDVMVMS  102

Query  561  I  563
            +
Sbjct  103  L  103



>ref|XP_010934561.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Elaeis guineensis]
Length=652

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +3

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
            QLW H+S  LL PVF+FLEID  AW  LE+ A + PA + V  FL+ + +   +ASSE  
Sbjct  117  QLWTHESHGLLHPVFRFLEIDSKAWPELEKVAVSTPARQQVVMFLKTIFDDK-EASSERS  175

Query  513  EREITLANSIDSMASSIEKT  572
             +E  L  ++DSM   ++ +
Sbjct  176  NQEFALTEAVDSMVKDLQTS  195



>ref|XP_010934563.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Elaeis guineensis]
Length=629

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +3

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
            QLW H+S  LL PVF+FLEID  AW  LE+ A + PA + V  FL+ + +   +ASSE  
Sbjct  43   QLWTHESHGLLHPVFRFLEIDSKAWPELEKVAVSTPARQQVVMFLKTIFDDK-EASSERS  101

Query  513  EREITLANSIDSMASSIEKT  572
             +E  L  ++DSM   ++ +
Sbjct  102  NQEFALTEAVDSMVKDLQTS  121



>ref|XP_010934560.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Elaeis guineensis]
Length=703

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +3

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
            QLW H+S  LL PVF+FLEID  AW  LE+ A + PA + V  FL+ + +   +ASSE  
Sbjct  117  QLWTHESHGLLHPVFRFLEIDSKAWPELEKVAVSTPARQQVVMFLKTIFDDK-EASSERS  175

Query  513  EREITLANSIDSMASSIEKT  572
             +E  L  ++DSM   ++ +
Sbjct  176  NQEFALTEAVDSMVKDLQTS  195



>ref|XP_010934564.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X4 [Elaeis guineensis]
Length=568

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = +3

Query  333  QLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVL  512
            QLW H+S  LL PVF+FLEID  AW  LE+ A + PA + V  FL+ + +   +ASSE  
Sbjct  117  QLWTHESHGLLHPVFRFLEIDSKAWPELEKVAVSTPARQQVVMFLKTIFDDK-EASSERS  175

Query  513  EREITLANSIDSM  551
             +E  L  ++DSM
Sbjct  176  NQEFALTEAVDSM  188



>gb|KHN00498.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=608

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  381  FLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDSMASS  560
            F  ID  AW+GLEETAG+  A  HVG FLRLLS+   D SS+ L++E  L++++D +A  
Sbjct  17   FSNIDSAAWSGLEETAGSSSATHHVGPFLRLLSQELDDGSSQRLDQERALSSAVDGIALD  76

Query  561  IEK  569
            +++
Sbjct  77   MQR  79



>ref|XP_002968294.1| hypothetical protein SELMODRAFT_170005 [Selaginella moellendorffii]
 gb|EFJ30548.1| hypothetical protein SELMODRAFT_170005 [Selaginella moellendorffii]
Length=607

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +3

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            W  +   L + VF++L+I+  +W GLE TA +  A  H+GAFLRLLSE     +SE L  
Sbjct  52   WSSEEFGLAQHVFRYLDIEKKSWMGLETTAISPDAKHHIGAFLRLLSEEDVPTTSETLP-  110

Query  519  EITLANSIDSMASSIEKT  572
            E  LA +ID+M+  +E++
Sbjct  111  EDDLAKAIDAMSLKLEES  128



>ref|XP_002976085.1| hypothetical protein SELMODRAFT_104378 [Selaginella moellendorffii]
 gb|EFJ22990.1| hypothetical protein SELMODRAFT_104378 [Selaginella moellendorffii]
Length=607

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +3

Query  339  WVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLER  518
            W  +   L + VF++L+I+  +W GLE TA +  A  H+GAFLRLLSE     +SE L  
Sbjct  52   WSSEEFGLAQHVFRYLDIEKKSWMGLETTAISPDAKHHIGAFLRLLSEEDVPTTSETLP-  110

Query  519  EITLANSIDSMASSIEKT  572
            E  LA +ID+M+  +E++
Sbjct  111  EDDLAKAIDAMSLKLEES  128



>ref|XP_007136056.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
 ref|XP_007136057.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
 gb|ESW08050.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
 gb|ESW08051.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
Length=623

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 1/83 (1%)
 Frame = +3

Query  327  DPQLWVHQSSSLLRPVFKFLEIDPIAWTGLEETAGNGPANR-HVGAFLRLLSEGSGDASS  503
            D  LW HQ+  LL  VF+FL +D  +W G++ETA +    R +V +FL  LSE  G  SS
Sbjct  43   DSDLWFHQNIHLLCSVFRFLGVDEDSWQGIKETACSSSHFRDNVRSFLTSLSEEGGATSS  102

Query  504  EVLEREITLANSIDSMASSIEKT  572
            E  ++E  L  ++   A ++  T
Sbjct  103  EESKKEAELTEAVHESALTLNDT  125



>ref|XP_009112468.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Brassica rapa]
Length=587

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 2/62 (3%)
 Frame = +3

Query  384  LEIDPIAWTGLEETAGNGPANRHVGAFLRLLSEGSGDASSEVLEREITLANSIDSMASSI  563
             +ID  AW G+EE A + PA  H+GA ++LLS+   D S +++E+E  LA + ++M   I
Sbjct  13   FQIDSSAWHGIEEIAASSPAKPHIGALIKLLSD--DDGSGDMVEKETALAKAAEAMVQGI  70

Query  564  EK  569
            ++
Sbjct  71   QQ  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455