BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K19

Length=556
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB08271.1|  hypothetical protein B456_001G074300                    326   3e-110   Gossypium raimondii
gb|KJB08275.1|  hypothetical protein B456_001G074300                    326   7e-110   Gossypium raimondii
gb|KHG21243.1|  Chlorophyll a-b binding 4, chloroplastic -like pr...    325   2e-109   Gossypium arboreum [tree cotton]
ref|XP_004236014.1|  PREDICTED: chlorophyll a-b binding protein 4...    323   5e-108   
ref|NP_001275056.1|  chlorophyll a-b binding protein 4, chloropla...    318   1e-106   Solanum tuberosum [potatoes]
ref|XP_009773617.1|  PREDICTED: chlorophyll a-b binding protein P...    316   7e-106   Nicotiana sylvestris
ref|XP_009618704.1|  PREDICTED: chlorophyll a-b binding protein P...    315   2e-105   Nicotiana tomentosiformis
gb|KDP31267.1|  hypothetical protein JCGZ_11643                         313   5e-105   Jatropha curcas
ref|XP_002284856.1|  PREDICTED: chlorophyll a-b binding protein 4...    313   6e-105   Vitis vinifera
ref|XP_007037388.1|  Light-harvesting chlorophyll-protein complex...    313   9e-105   
gb|KJB50940.1|  hypothetical protein B456_008G194000                    313   1e-104   Gossypium raimondii
ref|XP_003523016.2|  PREDICTED: chlorophyll a-b binding protein P...    313   4e-104   
gb|KHG01496.1|  Chlorophyll a-b binding P4, chloroplastic               311   5e-104   Gossypium arboreum [tree cotton]
ref|XP_003527087.2|  PREDICTED: chlorophyll a-b binding protein P...    313   6e-104   
gb|KHN26254.1|  Chlorophyll a-b binding protein P4, chloroplastic       311   6e-104   Glycine soja [wild soybean]
gb|KHN01874.1|  Chlorophyll a-b binding protein P4, chloroplastic       311   7e-104   Glycine soja [wild soybean]
ref|XP_007138174.1|  hypothetical protein PHAVU_009G186500g             310   1e-103   Phaseolus vulgaris [French bean]
ref|XP_010093602.1|  Chlorophyll a-b binding protein P4                 310   1e-103   Morus notabilis
gb|AGV54882.1|  chlorophyll A/B binding protein P4 chloroplastic-...    310   1e-103   Phaseolus vulgaris [French bean]
gb|AGZ15388.1|  PSI light-harvesting antenna chlorophyll a/b-bind...    310   1e-103   Phaseolus vulgaris [French bean]
gb|ACB05669.1|  chloroplast chlorophyll a/b binding protein             308   5e-103   Capsicum annuum
ref|XP_002514741.1|  chlorophyll A/B binding protein, putative          308   6e-103   Ricinus communis
emb|CBI15210.3|  unnamed protein product                                308   7e-103   Vitis vinifera
ref|XP_010030046.1|  PREDICTED: chlorophyll a-b binding protein 4...    309   2e-102   Eucalyptus grandis [rose gum]
ref|XP_006374461.1|  hypothetical protein POPTR_0015s07340g             305   3e-102   
ref|XP_006477466.1|  PREDICTED: chlorophyll a-b binding protein P...    306   3e-102   Citrus sinensis [apfelsine]
ref|XP_011047180.1|  PREDICTED: chlorophyll a-b binding protein P...    306   5e-102   Populus euphratica
ref|XP_006374462.1|  hypothetical protein POPTR_0015s07340g             305   6e-102   
ref|XP_006374463.1|  Chlorophyll a-b binding protein 4                  306   6e-102   
ref|XP_006374464.1|  hypothetical protein POPTR_0015s07340g             306   7e-102   
ref|XP_008453211.1|  PREDICTED: chlorophyll a-b binding protein P...    306   7e-102   Cucumis melo [Oriental melon]
ref|XP_010258312.1|  PREDICTED: chlorophyll a-b binding protein 4...    305   9e-102   Nelumbo nucifera [Indian lotus]
ref|XP_004138171.1|  PREDICTED: chlorophyll a-b binding protein P...    305   2e-101   Cucumis sativus [cucumbers]
ref|XP_008783815.1|  PREDICTED: chlorophyll a-b binding protein 4...    304   2e-101   Phoenix dactylifera
ref|XP_006354774.1|  PREDICTED: chlorophyll a-b binding protein 4...    304   3e-101   Solanum tuberosum [potatoes]
gb|ACJ85068.1|  unknown                                                 304   5e-101   Medicago truncatula
ref|XP_004513901.1|  PREDICTED: chlorophyll a-b binding protein P...    303   1e-100   Cicer arietinum [garbanzo]
ref|XP_004137413.1|  PREDICTED: chlorophyll a-b binding protein P...    302   2e-100   Cucumis sativus [cucumbers]
ref|XP_009587071.1|  PREDICTED: chlorophyll a-b binding protein P...    302   2e-100   Nicotiana tomentosiformis
gb|KDO55547.1|  hypothetical protein CISIN_1g025674mg                   300   4e-100   Citrus sinensis [apfelsine]
ref|XP_009369279.1|  PREDICTED: chlorophyll a-b binding protein P...    301   7e-100   
ref|XP_009804068.1|  PREDICTED: chlorophyll a-b binding protein 4...    300   8e-100   Nicotiana sylvestris
ref|XP_006404376.1|  hypothetical protein EUTSA_v10010659mg             300   9e-100   Eutrema salsugineum [saltwater cress]
ref|XP_011087238.1|  PREDICTED: chlorophyll a-b binding protein 4...    300   9e-100   Sesamum indicum [beniseed]
emb|CDP12284.1|  unnamed protein product                                300   1e-99    Coffea canephora [robusta coffee]
gb|KDO55546.1|  hypothetical protein CISIN_1g025674mg                   300   1e-99    Citrus sinensis [apfelsine]
ref|XP_010547822.1|  PREDICTED: chlorophyll a-b binding protein 4...    300   1e-99    Tarenaya hassleriana [spider flower]
gb|AFK37078.1|  unknown                                                 300   2e-99    Lotus japonicus
ref|XP_004299348.1|  PREDICTED: chlorophyll a-b binding protein P...    300   2e-99    Fragaria vesca subsp. vesca
ref|XP_008374556.1|  PREDICTED: chlorophyll a-b binding protein P...    300   2e-99    Malus domestica [apple tree]
ref|XP_010322569.1|  PREDICTED: chlorophyll a-b binding protein 4...    299   3e-99    
ref|XP_010546068.1|  PREDICTED: chlorophyll a-b binding protein 4...    299   4e-99    Tarenaya hassleriana [spider flower]
ref|XP_006440616.1|  hypothetical protein CICLE_v10021861mg             298   5e-99    Citrus clementina [clementine]
gb|KFK34045.1|  hypothetical protein AALP_AA5G094700                    298   7e-99    Arabis alpina [alpine rockcress]
ref|XP_010678492.1|  PREDICTED: chlorophyll a-b binding protein 4...    298   7e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009339094.1|  PREDICTED: chlorophyll a-b binding protein P...    298   8e-99    Pyrus x bretschneideri [bai li]
ref|XP_007209497.1|  hypothetical protein PRUPE_ppa010291mg             296   7e-98    Prunus persica
ref|XP_008393169.1|  PREDICTED: chlorophyll a-b binding protein P...    295   9e-98    
ref|XP_010939818.1|  PREDICTED: chlorophyll a-b binding protein 4...    294   2e-97    Elaeis guineensis
ref|XP_010937179.1|  PREDICTED: chlorophyll a-b binding protein 4...    294   3e-97    Elaeis guineensis
ref|NP_190331.3|  chlorophyll a-b binding protein 4                     293   5e-97    Arabidopsis thaliana [mouse-ear cress]
pdb|2WSC|4  Chain 4, Improved Model Of Plant Photosystem I              293   1e-96    Spinacia oleracea
sp|Q9SQL2.1|CB24_PEA  RecName: Full=Chlorophyll a-b binding prote...    293   1e-96    Pisum sativum [garden pea]
gb|KFK27969.1|  hypothetical protein AALP_AA8G455000                    292   2e-96    Arabis alpina [alpine rockcress]
ref|XP_008239927.1|  PREDICTED: chlorophyll a-b binding protein P...    292   2e-96    Prunus mume [ume]
ref|XP_010550595.1|  PREDICTED: chlorophyll a-b binding protein 4...    291   3e-96    Tarenaya hassleriana [spider flower]
ref|XP_009388762.1|  PREDICTED: chlorophyll a-b binding protein 4...    291   6e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU24360.1|  hypothetical protein MIMGU_mgv1a012416mg                290   7e-96    Erythranthe guttata [common monkey flower]
ref|XP_008802578.1|  PREDICTED: chlorophyll a-b binding protein 4...    290   1e-95    Phoenix dactylifera
ref|XP_010515052.1|  PREDICTED: chlorophyll a-b binding protein 4...    290   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010426187.1|  PREDICTED: chlorophyll a-b binding protein 4...    289   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010257811.1|  PREDICTED: chlorophyll a-b binding protein 4...    287   2e-94    Nelumbo nucifera [Indian lotus]
ref|XP_009149912.1|  PREDICTED: chlorophyll a-b binding protein 4...    286   3e-94    Brassica rapa
ref|XP_009398171.1|  PREDICTED: chlorophyll a-b binding protein 4...    286   5e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006291725.1|  hypothetical protein CARUB_v10017894mg             284   3e-93    Capsella rubella
gb|KJB08270.1|  hypothetical protein B456_001G074300                    280   5e-93    Gossypium raimondii
ref|XP_002877563.1|  chlorophyll a/b-binding protein                    279   2e-91    Arabidopsis lyrata subsp. lyrata
ref|XP_010550593.1|  PREDICTED: chlorophyll a-b binding protein 4...    278   2e-90    Tarenaya hassleriana [spider flower]
gb|AEZ49173.1|  chlorophyll a/b binding protein 4                       275   8e-90    Wolffia australiana
ref|XP_006827292.1|  hypothetical protein AMTR_s00010p00264770          268   3e-87    Amborella trichopoda
gb|ABV44672.1|  photosystem I light-harvesting complex type 4 pro...    262   6e-85    Bambusa oldhamii
gb|AFW62279.1|  hypothetical protein ZEAMMB73_290736                    259   1e-83    
gb|AFW62280.1|  hypothetical protein ZEAMMB73_290736                    258   2e-83    
gb|AFW62278.1|  chlorophyll a-b binding protein 4                       258   4e-83    
gb|EAZ07102.1|  hypothetical protein OsI_29351                          256   3e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_010235157.1|  PREDICTED: chlorophyll a-b binding protein 4...    255   4e-82    Brachypodium distachyon [annual false brome]
gb|AAR19267.2|  chlorophyll a/b binding protein presusor                255   5e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659431.1|  PREDICTED: chlorophyll a-b binding protein P...    254   1e-81    Oryza brachyantha
ref|NP_001061884.1|  Os08g0435900                                       254   1e-81    
ref|XP_004973512.1|  PREDICTED: chlorophyll a-b binding protein P...    254   2e-81    Setaria italica
gb|EAZ07099.1|  hypothetical protein OsI_29348                          253   5e-81    Oryza sativa Indica Group [Indian rice]
gb|ACA66262.1|  chloroplast chlorophyll a/b binding protein precu...    252   9e-81    Phyllostachys edulis [kikko-chiku]
gb|AAC67557.1|  chlorophyll a/b-binding protein presursor               251   2e-80    Oryza sativa Japonica Group [Japonica rice]
gb|ACG30344.1|  chlorophyll a-b binding protein 4                       251   2e-80    Zea mays [maize]
emb|CAA78932.1|  Lhca4 protein,Type 4 protein of light-harvesting...    248   4e-79    Pinus sylvestris [Scotch pine]
gb|ACF86037.1|  unknown                                                 244   1e-77    Zea mays [maize]
emb|CCI55399.1|  PSI antenna protein Lhca4                              243   2e-77    Marchantia polymorpha
emb|CAA78901.1|  Lhca4 protein,Type 4 protein of light-harvesting...    242   7e-77    Pinus sylvestris [Scotch pine]
ref|XP_002975356.1|  light-harvesting complex                           242   8e-77    Selaginella moellendorffii
ref|NP_001150371.1|  LOC100284001                                       241   1e-76    
gb|AGU28447.1|  light-harvesting chlorophyll-protein complex I su...    239   3e-76    Sinapis alba [bai jie]
gb|ABK24236.1|  unknown                                                 239   7e-76    Picea sitchensis
emb|CAC84491.1|  putative chlorophyll a/b-binding protein type 4        239   8e-76    Pinus pinaster [cluster pine]
gb|ACG35965.1|  chlorophyll a-b binding protein 4                       239   8e-76    Zea mays [maize]
gb|EPS72553.1|  chlorophyll a /b binding protein                        238   9e-76    Genlisea aurea
ref|XP_002964438.1|  light-harvesting complex                           239   1e-75    Selaginella moellendorffii
gb|ACN40598.1|  unknown                                                 238   2e-75    Picea sitchensis
pdb|4RKU|4  Chain 4, Crystal Structure Of Plant Photosystem I At ...    236   2e-75    Pisum sativum [garden pea]
gb|EMS64136.1|  Chlorophyll a-b binding protein 1B-20, chloroplastic    236   2e-74    Triticum urartu
dbj|BAJ89800.1|  predicted protein                                      233   3e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF90200.1|AF287276_2  chlorophyll a/b-binding protein precursor     229   5e-72    Hordeum vulgare [barley]
ref|XP_003578105.1|  PREDICTED: chlorophyll a-b binding protein 1...    228   2e-71    Brachypodium distachyon [annual false brome]
emb|CAA57877.1|  light-harvesting chlorophyll a /b binding protein      226   3e-71    Nicotiana tabacum [American tobacco]
gb|EMT16884.1|  hypothetical protein F775_43922                         230   3e-71    
gb|ACO87363.1|  chloroplast chlorophyll a-b binding protein 4           221   3e-70    Liquidambar formosana
gb|ACO87356.1|  chloroplast chlorophyll a-b binding protein 4           221   4e-70    Altingia chinensis
gb|ACO87375.1|  chloroplast chlorophyll a-b binding protein 4           219   2e-69    Semiliquidambar cathayensis
gb|ACO87368.1|  chloroplast chlorophyll a-b binding protein 4           219   4e-69    Semiliquidambar cathayensis
ref|WP_039310946.1|  hypothetical protein                               218   2e-68    
gb|KJB08274.1|  hypothetical protein B456_001G074300                    216   1e-67    Gossypium raimondii
ref|XP_006394395.1|  hypothetical protein EUTSA_v10005046mg             211   6e-66    
gb|ACI25416.1|  chloroplast chlorophyll a-b binding protein 4           210   7e-66    Semiliquidambar cathayensis
gb|ACI25388.1|  chloroplast chlorophyll a-b binding protein 4           210   1e-65    Liquidambar styraciflua [American sweet gum]
gb|KJB08272.1|  hypothetical protein B456_001G074300                    211   1e-65    Gossypium raimondii
gb|ACI25414.1|  chloroplast chlorophyll a-b binding protein 4           209   1e-65    Semiliquidambar cathayensis
gb|ACI25385.1|  chloroplast chlorophyll a-b binding protein 4           209   1e-65    Altingia obovata
gb|ACI25407.1|  chloroplast chlorophyll a-b binding protein 4           209   2e-65    Semiliquidambar cathayensis
gb|ACI25424.1|  chloroplast chlorophyll a-b binding protein 4           208   3e-65    Semiliquidambar cathayensis
gb|ACI25389.1|  chloroplast chlorophyll a-b binding protein 4           208   3e-65    Liquidambar styraciflua [American sweet gum]
gb|ACI25410.1|  chloroplast chlorophyll a-b binding protein 4           208   3e-65    Semiliquidambar cathayensis
gb|ACI25406.1|  chloroplast chlorophyll a-b binding protein 4           208   4e-65    Semiliquidambar cathayensis
gb|ACI25420.1|  chloroplast chlorophyll a-b binding protein 4           208   4e-65    Semiliquidambar cathayensis
gb|ACI25401.1|  chloroplast chlorophyll a-b binding protein 4           208   4e-65    Semiliquidambar cathayensis
gb|ACI25418.1|  chloroplast chlorophyll a-b binding protein 4           208   5e-65    Semiliquidambar cathayensis
gb|ACI25413.1|  chloroplast chlorophyll a-b binding protein 4           207   6e-65    Semiliquidambar cathayensis
gb|ACI25421.1|  chloroplast chlorophyll a-b binding protein 4           207   8e-65    Semiliquidambar cathayensis
gb|ACI25403.1|  chloroplast chlorophyll a-b binding protein 4           207   9e-65    Semiliquidambar cathayensis
gb|ACI25408.1|  chloroplast chlorophyll a-b binding protein 4           207   1e-64    Semiliquidambar cathayensis
gb|KEH33314.1|  light-harvesting complex I chlorophyll A/B-bindin...    208   1e-64    Medicago truncatula
gb|ACI25425.1|  chloroplast chlorophyll a-b binding protein 4           206   2e-64    Semiliquidambar cathayensis
gb|EYU24361.1|  hypothetical protein MIMGU_mgv1a012416mg                206   1e-63    Erythranthe guttata [common monkey flower]
ref|WP_033581582.1|  hypothetical protein                               190   1e-58    
sp|Q36718.1|CB120_HORVU  RecName: Full=Chlorophyll a-b binding pr...    184   2e-54    Hordeum vulgare [barley]
pdb|3LW5|4  Chain 4, Improved Model Of Plant Photosystem I              179   3e-53    unidentified
ref|NP_001060090.1|  Os07g0577600                                       182   3e-53    
ref|XP_002514914.1|  chlorophyll A/B binding protein, putative          179   3e-52    Ricinus communis
ref|XP_004510609.1|  PREDICTED: chlorophyll a-b binding protein 7...    179   4e-52    Cicer arietinum [garbanzo]
ref|XP_004510608.1|  PREDICTED: chlorophyll a-b binding protein 7...    179   7e-52    
gb|KDP26804.1|  hypothetical protein JCGZ_17962                         178   1e-51    Jatropha curcas
ref|XP_006352516.1|  PREDICTED: chlorophyll a-b binding protein 7...    178   1e-51    Solanum tuberosum [potatoes]
ref|XP_003548018.1|  PREDICTED: chlorophyll a-b binding protein 7...    177   3e-51    Glycine max [soybeans]
gb|AAB65793.1|  photosystem I antenna protein                           177   3e-51    Oryza sativa Indica Group [Indian rice]
ref|XP_010669087.1|  PREDICTED: chlorophyll a-b binding protein, ...    177   4e-51    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004248339.1|  PREDICTED: chlorophyll a-b binding protein 7...    176   6e-51    
ref|XP_003528751.1|  PREDICTED: chlorophyll a-b binding protein 7...    176   7e-51    Glycine max [soybeans]
ref|XP_009787153.1|  PREDICTED: chlorophyll a-b binding protein, ...    176   9e-51    Nicotiana sylvestris
gb|AFK45885.1|  unknown                                                 175   2e-50    Lotus japonicus
ref|XP_009587026.1|  PREDICTED: chlorophyll a-b binding protein, ...    174   2e-50    Nicotiana tomentosiformis
pdb|2O01|4  Chain 4, The Structure Of A Plant Photosystem I Super...    171   2e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002299309.1|  chlorophyll a/b-binding protein type II prec...    174   3e-50    
gb|ABK95596.1|  unknown                                                 174   4e-50    Populus trichocarpa [western balsam poplar]
gb|KDO81901.1|  hypothetical protein CISIN_1g024422mg                   173   7e-50    Citrus sinensis [apfelsine]
ref|XP_006484100.1|  PREDICTED: chlorophyll a-b binding protein, ...    173   8e-50    Citrus sinensis [apfelsine]
gb|KJB15537.1|  hypothetical protein B456_002G183400                    173   8e-50    Gossypium raimondii
gb|KJB15539.1|  hypothetical protein B456_002G183400                    173   8e-50    Gossypium raimondii
gb|KJB15538.1|  hypothetical protein B456_002G183400                    173   8e-50    Gossypium raimondii
emb|CAA57492.1|  Type II chlorophyll a/b binding protein from pho...    173   8e-50    Pisum sativum [garden pea]
pdb|2WSC|2  Chain 2, Improved Model Of Plant Photosystem I              173   8e-50    Spinacia oleracea
sp|P13869.1|CB12_PETHY  RecName: Full=Chlorophyll a-b binding pro...    173   9e-50    Petunia x hybrida [garden petunia]
ref|XP_007139044.1|  hypothetical protein PHAVU_009G260200g             173   1e-49    Phaseolus vulgaris [French bean]
ref|XP_007139043.1|  hypothetical protein PHAVU_009G260200g             173   1e-49    Phaseolus vulgaris [French bean]
gb|KJB15540.1|  hypothetical protein B456_002G183400                    173   1e-49    Gossypium raimondii
ref|XP_011036086.1|  PREDICTED: chlorophyll a-b binding protein 7...    172   2e-49    Populus euphratica
emb|CAA41406.1|  Type II chlorophyll a /b-binding protein               173   2e-49    Pinus sylvestris [Scotch pine]
gb|KJB50346.1|  hypothetical protein B456_008G165200                    172   2e-49    Gossypium raimondii
ref|XP_003637339.1|  Chlorophyll a-b binding protein                    172   2e-49    
emb|CAA59049.1|  LHCI-680, photosystem I antenna protein                172   2e-49    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011002123.1|  PREDICTED: chlorophyll a-b binding protein 7...    172   2e-49    Populus euphratica
ref|XP_008801837.1|  PREDICTED: chlorophyll a-b binding protein 7...    172   2e-49    Phoenix dactylifera
ref|XP_011020754.1|  PREDICTED: chlorophyll a-b binding protein 7...    172   2e-49    Populus euphratica
gb|KHG11922.1|  Chlorophyll a-b binding 7, chloroplastic                172   3e-49    Gossypium arboreum [tree cotton]
ref|XP_008805305.1|  PREDICTED: chlorophyll a-b binding protein 7...    172   3e-49    Phoenix dactylifera
emb|CDP13340.1|  unnamed protein product                                172   4e-49    Coffea canephora [robusta coffee]
ref|XP_010531194.1|  PREDICTED: chlorophyll a-b binding protein 7...    171   4e-49    Tarenaya hassleriana [spider flower]
gb|AFK35880.1|  unknown                                                 171   4e-49    Medicago truncatula
ref|XP_010905185.1|  PREDICTED: chlorophyll a-b binding protein 7...    171   5e-49    Elaeis guineensis
gb|KJB50347.1|  hypothetical protein B456_008G165200                    172   6e-49    Gossypium raimondii
ref|XP_006438030.1|  hypothetical protein CICLE_v10031886mg             173   9e-49    Citrus clementina [clementine]
ref|XP_010531186.1|  PREDICTED: chlorophyll a-b binding protein 7...    171   1e-48    Tarenaya hassleriana [spider flower]
gb|ABK95601.1|  unknown                                                 170   1e-48    Populus trichocarpa [western balsam poplar]
gb|AGV54278.1|  light-harvesting complex I protein Lhca2                170   1e-48    Phaseolus vulgaris [French bean]
gb|EMT28434.1|  hypothetical protein F775_43774                         170   1e-48    
ref|XP_010917526.1|  PREDICTED: chlorophyll a-b binding protein, ...    170   1e-48    Elaeis guineensis
ref|XP_007135346.1|  hypothetical protein PHAVU_010G121400g             170   1e-48    Phaseolus vulgaris [French bean]
ref|XP_006848348.1|  hypothetical protein AMTR_s00013p00180670          170   1e-48    Amborella trichopoda
gb|AGV54335.1|  chlorophyll A/B binding protein 7 chloroplastic-l...    170   1e-48    Phaseolus vulgaris [French bean]
ref|XP_002303791.1|  chlorophyll a/b-binding protein type II prec...    170   2e-48    Populus trichocarpa [western balsam poplar]
ref|XP_006657881.1|  PREDICTED: chlorophyll a-b binding protein 7...    169   2e-48    Oryza brachyantha
ref|XP_009405484.1|  PREDICTED: chlorophyll a-b binding protein 7...    171   2e-48    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010655886.1|  PREDICTED: chlorophyll a-b binding protein, ...    169   3e-48    Vitis vinifera
gb|KHN15861.1|  Chlorophyll a-b binding protein 7, chloroplastic        169   3e-48    Glycine soja [wild soybean]
ref|XP_010100230.1|  Chlorophyll a-b binding protein                    169   3e-48    
ref|XP_007044017.1|  Chlorophyll a-b binding protein 7, chloropla...    169   4e-48    Theobroma cacao [chocolate]
ref|XP_011086789.1|  PREDICTED: chlorophyll a-b binding protein, ...    169   5e-48    Sesamum indicum [beniseed]
gb|AHM26636.1|  a-b binding protein                                     166   6e-48    Pyrus x bretschneideri [bai li]
pdb|4RKU|2  Chain 2, Crystal Structure Of Plant Photosystem I At ...    166   7e-48    Pisum sativum [garden pea]
gb|AHM26638.1|  a-b binding protein                                     168   8e-48    Pyrus x bretschneideri [bai li]
gb|ABY63668.1|  chloroplast chlorophyll a/b binding protein             167   1e-47    Phyllostachys edulis [kikko-chiku]
gb|ABK21282.1|  unknown                                                 168   1e-47    Picea sitchensis
gb|KJB50348.1|  hypothetical protein B456_008G165200                    167   1e-47    Gossypium raimondii
ref|XP_009372280.1|  PREDICTED: chlorophyll a-b binding protein, ...    167   1e-47    Pyrus x bretschneideri [bai li]
ref|XP_001778557.1|  predicted protein                                  167   1e-47    
ref|XP_008446036.1|  PREDICTED: chlorophyll a-b binding protein 7...    167   2e-47    Cucumis melo [Oriental melon]
ref|NP_001239987.1|  uncharacterized protein LOC100794944               167   2e-47    Glycine max [soybeans]
emb|CCI55397.1|  PSI antenna protein Lhca2                              167   2e-47    Marchantia polymorpha
gb|EEC82322.1|  hypothetical protein OsI_26601                          171   2e-47    Oryza sativa Indica Group [Indian rice]
ref|XP_003562834.1|  PREDICTED: chlorophyll a-b binding protein 7...    167   2e-47    Brachypodium distachyon [annual false brome]
emb|CAC81065.1|  putative chlorophyll A-B binding protein of LHCI...    167   2e-47    Picea abies
ref|XP_007222715.1|  hypothetical protein PRUPE_ppa009903mg             167   2e-47    Prunus persica
ref|XP_008446035.1|  PREDICTED: chlorophyll a-b binding protein 7...    167   3e-47    
ref|XP_004135326.1|  PREDICTED: chlorophyll a-b binding protein 7...    167   3e-47    Cucumis sativus [cucumbers]
gb|ACF23028.1|  ST49-6                                                  165   3e-47    Eutrema halophilum
ref|XP_008340223.1|  PREDICTED: chlorophyll a-b binding protein, ...    167   3e-47    
ref|XP_001786080.1|  predicted protein                                  167   4e-47    
ref|NP_001147224.1|  chlorophyll a-b binding protein                    166   4e-47    
emb|CAA55864.1|  type II LHCI                                           165   6e-47    Lolium temulentum
ref|XP_009104311.1|  PREDICTED: chlorophyll a-b binding protein, ...    165   6e-47    Brassica rapa
ref|XP_001782439.1|  predicted protein                                  164   8e-47    
ref|XP_004310079.1|  PREDICTED: chlorophyll a-b binding protein, ...    165   9e-47    Fragaria vesca subsp. vesca
ref|XP_009138769.1|  PREDICTED: chlorophyll a-b binding protein, ...    165   9e-47    Brassica rapa
gb|ABO71660.2|  LhCa2 protein                                           165   1e-46    Brassica juncea [brown mustard]
ref|XP_008389866.1|  PREDICTED: chlorophyll a-b binding protein, ...    167   1e-46    
ref|XP_010044808.1|  PREDICTED: chlorophyll a-b binding protein 7...    165   1e-46    Eucalyptus grandis [rose gum]
ref|XP_010250717.1|  PREDICTED: chlorophyll a-b binding protein, ...    165   1e-46    Nelumbo nucifera [Indian lotus]
dbj|BAJ34383.1|  unnamed protein product                                164   2e-46    Eutrema halophilum
emb|CDY51572.1|  BnaCnng21010D                                          164   2e-46    Brassica napus [oilseed rape]
ref|XP_009415903.1|  PREDICTED: chlorophyll a-b binding protein 7...    164   2e-46    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006402477.1|  hypothetical protein EUTSA_v10006165mg             164   2e-46    
gb|EPS71951.1|  chlorophyll a-b binding protein 7, chloroplastic        164   3e-46    Genlisea aurea
gb|EYU25891.1|  hypothetical protein MIMGU_mgv1a025195mg                163   4e-46    Erythranthe guttata [common monkey flower]
gb|AAL74385.1|AF359117_1  LHC I type II chlorophyll binding protein     159   5e-46    Pinus sylvestris [Scotch pine]
pdb|2O01|2  Chain 2, The Structure Of A Plant Photosystem I Super...    160   7e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001758295.1|  predicted protein                                  163   7e-46    
ref|XP_010469082.1|  PREDICTED: chlorophyll a-b binding protein, ...    162   1e-45    Camelina sativa [gold-of-pleasure]
emb|CAN72005.1|  hypothetical protein VITISV_033663                     162   2e-45    Vitis vinifera
gb|KHN16392.1|  Chlorophyll a-b binding protein 7, chloroplastic        166   2e-45    Glycine soja [wild soybean]
tpg|DAA41205.1|  TPA: hypothetical protein ZEAMMB73_510089              159   2e-45    
tpg|DAA41204.1|  TPA: hypothetical protein ZEAMMB73_510089              159   3e-45    
ref|XP_002984998.1|  light-harvesting complex                           160   5e-45    Selaginella moellendorffii
ref|XP_002876615.1|  Lhca2 protein                                      160   6e-45    Arabidopsis lyrata subsp. lyrata
ref|XP_010512495.1|  PREDICTED: chlorophyll a-b binding protein, ...    160   7e-45    Camelina sativa [gold-of-pleasure]
ref|XP_006291716.1|  hypothetical protein CARUB_v10017882mg             160   7e-45    Capsella rubella
ref|XP_010413397.1|  PREDICTED: chlorophyll a-b binding protein, ...    160   7e-45    Camelina sativa [gold-of-pleasure]
ref|XP_002986188.1|  light-harvesting complex                           160   9e-45    Selaginella moellendorffii
ref|XP_001419664.1|  chlorophyll a/b binding, possibly photosyste...    159   1e-44    Ostreococcus lucimarinus CCE9901
gb|AGT16124.1|  chlorophyll a-b binding protein                         159   1e-44    Saccharum hybrid cultivar R570
emb|CAB71077.1|  Lhca2 protein                                          159   1e-44    Arabidopsis thaliana [mouse-ear cress]
ref|NP_191706.2|  photosystem I light harvesting complex protein        159   2e-44    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001130616.1|  chlorophyll a-b binding protein                    159   2e-44    Zea mays [maize]
ref|NP_001148893.1|  chlorophyll a-b binding protein                    159   2e-44    Zea mays [maize]
ref|XP_004958124.1|  PREDICTED: chlorophyll a-b binding protein 7...    159   2e-44    Setaria italica
ref|XP_008222160.1|  PREDICTED: chlorophyll a-b binding protein, ...    159   2e-44    Prunus mume [ume]
ref|XP_001782441.1|  predicted protein                                  158   3e-44    
emb|CEF99235.1|  Chlorophyll A-B binding protein, plant                 158   3e-44    Ostreococcus tauri
ref|XP_006452840.1|  hypothetical protein CICLE_v10009205mg             158   4e-44    Citrus clementina [clementine]
ref|XP_006452839.1|  hypothetical protein CICLE_v10009205mg             158   4e-44    Citrus clementina [clementine]
ref|XP_003637475.1|  Chlorophyll a-b binding protein                    159   5e-44    
ref|XP_009627312.1|  PREDICTED: chlorophyll a-b binding protein, ...    157   7e-44    Nicotiana tomentosiformis
ref|XP_003081427.1|  PSI-associated light-harvesting chlorophyll ...    157   7e-44    
emb|CDY53917.1|  BnaA07g38250D                                          166   1e-43    Brassica napus [oilseed rape]
ref|XP_004251698.1|  PREDICTED: chlorophyll a-b binding protein, ...    157   1e-43    Solanum lycopersicum
ref|XP_006474704.1|  PREDICTED: chlorophyll a-b binding protein, ...    157   1e-43    Citrus sinensis [apfelsine]
ref|XP_002505087.1|  chlorophyll a/b-binding protein, psi-associa...    155   3e-43    Micromonas commoda
ref|XP_007509312.1|  unknown                                            155   4e-43    Bathycoccus prasinos
gb|ABK96605.1|  unknown                                                 155   8e-43    Populus trichocarpa x Populus deltoides
ref|XP_006381597.1|  chlorophyll A-B binding family protein             155   9e-43    Populus trichocarpa [western balsam poplar]
ref|XP_010272798.1|  PREDICTED: chlorophyll a-b binding protein 7...    154   1e-42    Nelumbo nucifera [Indian lotus]
ref|XP_006345258.1|  PREDICTED: chlorophyll a-b binding protein, ...    153   4e-42    Solanum tuberosum [potatoes]
ref|XP_004291112.2|  PREDICTED: chlorophyll a-b binding protein P...    153   5e-42    Fragaria vesca subsp. vesca
ref|XP_009759850.1|  PREDICTED: chlorophyll a-b binding protein, ...    153   5e-42    
emb|CDX96677.1|  BnaA08g22200D                                          153   5e-42    
ref|XP_011039957.1|  PREDICTED: chlorophyll a-b binding protein, ...    152   6e-42    
ref|XP_010687546.1|  PREDICTED: chlorophyll a-b binding protein, ...    152   6e-42    
ref|XP_009110297.1|  PREDICTED: chlorophyll a-b binding protein, ...    152   6e-42    
emb|CDX83783.1|  BnaC08g18620D                                          152   6e-42    
ref|XP_009418009.1|  PREDICTED: chlorophyll a-b binding protein, ...    152   8e-42    
ref|XP_003075175.1|  PSI-associated light-harvesting chlorophyll ...    151   1e-41    
gb|AIF76016.1|  chloroplast LHC I type IV chlorophyll binding pro...    148   1e-41    
ref|XP_011093862.1|  PREDICTED: chlorophyll a-b binding protein, ...    151   2e-41    
ref|XP_007510507.1|  unknown                                            150   3e-41    
ref|XP_010459573.1|  PREDICTED: chlorophyll a-b binding protein, ...    151   3e-41    
ref|XP_010498326.1|  PREDICTED: chlorophyll a-b binding protein, ...    151   3e-41    
ref|XP_010099098.1|  Chlorophyll a-b binding protein                    152   3e-41    
ref|XP_007138637.1|  hypothetical protein PHAVU_009G225500g             150   4e-41    
ref|XP_006306445.1|  hypothetical protein CARUB_v10012387mg             151   4e-41    
gb|KIY93891.1|  chlorophyll A/B binding protein, putative               147   5e-41    
emb|CAN69989.1|  hypothetical protein VITISV_024400                     149   5e-41    
gb|AAO22627.1|  putative light-harvesting chlorophyll a/b binding...    150   6e-41    
ref|NP_173349.1|  PSI type II chlorophyll a/b-binding protein (Lh...    150   6e-41    
gb|AAF82226.1|AC069143_2  Contains similarity to a chlorophyll a/...    150   6e-41    
ref|XP_002277280.1|  PREDICTED: chlorophyll a-b binding protein, ...    150   7e-41    
ref|XP_007012597.1|  Photosystem I light harvesting complex gene ...    150   7e-41    
ref|XP_007012598.1|  Photosystem I light harvesting complex gene ...    150   8e-41    
ref|XP_010477121.1|  PREDICTED: chlorophyll a-b binding protein, ...    149   1e-40    
emb|CDP03055.1|  unnamed protein product                                149   1e-40    
ref|XP_008242266.1|  PREDICTED: chlorophyll a-b binding protein, ...    149   1e-40    
ref|XP_008242265.1|  PREDICTED: chlorophyll a-b binding protein, ...    149   1e-40    
gb|KJB08273.1|  hypothetical protein B456_001G074300                    145   2e-40    
ref|XP_006374459.1|  hypothetical protein POPTR_0015s07340g             145   2e-40    
ref|XP_008393806.1|  PREDICTED: chlorophyll a-b binding protein P...    148   3e-40    
ref|XP_009415902.1|  PREDICTED: chlorophyll a-b binding protein 7...    149   3e-40    
ref|XP_006474703.1|  PREDICTED: chlorophyll a-b binding protein, ...    148   3e-40    
ref|XP_006474702.1|  PREDICTED: chlorophyll a-b binding protein, ...    148   3e-40    
ref|XP_006368879.1|  hypothetical protein POPTR_0001s13800g             146   4e-40    
gb|KFK44053.1|  hypothetical protein AALP_AA1G210000                    148   4e-40    
gb|KDP33938.1|  hypothetical protein JCGZ_07509                         148   4e-40    
ref|XP_007202451.1|  hypothetical protein PRUPE_ppa010035mg             148   4e-40    
ref|XP_010932388.1|  PREDICTED: chlorophyll a-b binding protein, ...    147   4e-40    
gb|ABD37903.1|  light-harvesting chlorophyll-a/b binding protein ...    147   6e-40    
ref|XP_004144043.1|  PREDICTED: chlorophyll a-b binding protein, ...    147   6e-40    
ref|XP_004161120.1|  PREDICTED: chlorophyll a-b binding protein, ...    147   7e-40    
ref|XP_008450947.1|  PREDICTED: chlorophyll a-b binding protein, ...    147   7e-40    
ref|XP_001416356.1|  Photosystem I light harvesting complex, chlo...    145   7e-40    
ref|XP_001698519.1|  light-harvesting protein of photosystem I          147   7e-40    
dbj|BAD06918.1|  light-harvesting chlorophyll-a/b protein of phot...    147   8e-40    
ref|XP_009359490.1|  PREDICTED: chlorophyll a-b binding protein P...    146   1e-39    
ref|XP_002890321.1|  hypothetical protein ARALYDRAFT_472139             146   2e-39    
gb|AFK42470.1|  unknown                                                 146   2e-39    
gb|ACU22606.1|  unknown                                                 143   2e-39    
ref|XP_005651070.1|  hypothetical protein COCSUDRAFT_52367              145   2e-39    
gb|KJB06852.1|  hypothetical protein B456_001G016400                    146   2e-39    
ref|XP_010049390.1|  PREDICTED: chlorophyll a-b binding protein, ...    146   2e-39    
gb|AFK40780.1|  unknown                                                 145   2e-39    
gb|KDO81899.1|  hypothetical protein CISIN_1g024422mg                   145   2e-39    
gb|ADT81035.1|  LHC I type IV chlorophyll binding protein               141   4e-39    
ref|XP_006305539.1|  hypothetical protein CARUB_v10010062mg             145   4e-39    
gb|KHG29329.1|  Chlorophyll a-b binding, chloroplastic                  145   4e-39    
gb|AFH55007.1|  LHC I type IV chlorophyll binding protein               141   5e-39    
gb|AFH55009.1|  LHC I type IV chlorophyll binding protein               141   6e-39    
gb|AES65592.2|  light-harvesting complex I chlorophyll A/B-bindin...    145   6e-39    
gb|AFH54993.1|  LHC I type IV chlorophyll binding protein               141   6e-39    
ref|XP_010531966.1|  PREDICTED: chlorophyll a-b binding protein, ...    145   6e-39    
ref|XP_004488100.1|  PREDICTED: chlorophyll a-b binding protein 7...    145   6e-39    
gb|AFK45037.1|  unknown                                                 145   7e-39    
gb|AFH54999.1|  LHC I type IV chlorophyll binding protein               141   7e-39    
ref|XP_010538121.1|  PREDICTED: chlorophyll a-b binding protein 4...    144   7e-39    
gb|KHN12296.1|  Chlorophyll a-b binding protein, chloroplastic          144   7e-39    
ref|NP_001276216.1|  chlorophyll a-b binding protein, chloroplast...    144   8e-39    
gb|KHN42786.1|  Chlorophyll a-b binding protein, chloroplastic          144   9e-39    
ref|XP_004488099.1|  PREDICTED: chlorophyll a-b binding protein 7...    145   1e-38    
ref|XP_002947520.1|  light harvesting complex A                         144   1e-38    
ref|NP_001289223.1|  chlorophyll a-b binding protein, chloroplastic     144   1e-38    
ref|XP_008389009.1|  PREDICTED: chlorophyll a-b binding protein, ...    144   1e-38    
ref|XP_003546513.1|  PREDICTED: chlorophyll a-b binding protein, ...    144   2e-38    
ref|XP_008784474.1|  PREDICTED: chlorophyll a-b binding protein, ...    144   2e-38    
ref|XP_002516245.1|  chlorophyll A/B binding protein, putative          144   2e-38    
ref|XP_008220221.1|  PREDICTED: chlorophyll a-b binding protein P...    143   2e-38    
ref|XP_007222188.1|  hypothetical protein PRUPE_ppa010039mg             143   2e-38    
dbj|BAJ94030.1|  predicted protein                                      143   3e-38    
gb|AFW62277.1|  hypothetical protein ZEAMMB73_290736                    139   3e-38    
dbj|BAJ86784.1|  predicted protein                                      143   3e-38    
ref|XP_003595341.1|  Chlorophyll a-b binding protein                    143   3e-38    
gb|ABF56176.1|  CAB11                                                   137   4e-38    
dbj|BAJ88556.1|  predicted protein                                      143   4e-38    
gb|AAG40364.1|AF325012_1  AT3g47470                                     139   7e-38    
ref|XP_006393637.1|  hypothetical protein EUTSA_v10011725mg             142   7e-38    
ref|XP_006416532.1|  hypothetical protein EUTSA_v10008493mg             142   9e-38    
ref|XP_004954021.1|  PREDICTED: chlorophyll a-b binding protein P...    143   1e-37    
ref|XP_004288997.1|  PREDICTED: chlorophyll a-b binding protein, ...    142   1e-37    
ref|XP_002891322.1|  light-harvesting complex protein                   141   1e-37    
gb|ABN10530.1|  Lhca5 protein                                           141   2e-37    
ref|XP_009107445.1|  PREDICTED: chlorophyll a-b binding protein 4...    140   2e-37    
gb|ACF84895.1|  unknown                                                 137   3e-37    
ref|XP_004956925.1|  PREDICTED: chlorophyll a-b binding protein 7...    140   3e-37    
gb|EYU25834.1|  hypothetical protein MIMGU_mgv1a012037mg                140   3e-37    
ref|XP_008444623.1|  PREDICTED: chlorophyll a-b binding protein P...    140   3e-37    
gb|EYU25833.1|  hypothetical protein MIMGU_mgv1a012037mg                140   3e-37    
ref|NP_001141336.1|  hypothetical protein                               140   3e-37    
ref|XP_008667517.1|  PREDICTED: uncharacterized protein LOC100273...    140   4e-37    
emb|CDP01357.1|  unnamed protein product                                140   4e-37    
ref|XP_004150882.1|  PREDICTED: chlorophyll a-b binding protein 4...    140   4e-37    
gb|KDP38340.1|  hypothetical protein JCGZ_04265                         140   4e-37    
ref|XP_002507489.1|  chlorophyll a/b-binding protein, chloroplast...    139   4e-37    
ref|XP_010108606.1|  Chlorophyll a-b binding protein P4                 140   4e-37    
gb|AAM65689.1|  light-harvesting complex protein                        140   4e-37    
gb|KFK36161.1|  hypothetical protein AALP_AA4G086000                    140   4e-37    
ref|NP_175137.1|  photosystem I light harvesting complex protein 5      140   5e-37    
ref|NP_001063275.1|  Os09g0439500                                       140   5e-37    
dbj|BAH19631.1|  AT1G45474                                              139   6e-37    
ref|XP_010675790.1|  PREDICTED: chlorophyll a-b binding protein 4...    139   6e-37    
gb|AHM26631.1|  a-b binding protein                                     147   7e-37    
gb|KCW66427.1|  hypothetical protein EUGRSUZ_F00228                     137   7e-37    
gb|EYU25420.1|  hypothetical protein MIMGU_mgv1a011943mg                139   7e-37    
emb|CDY43213.1|  BnaC08g04860D                                          139   1e-36    
emb|CDY17055.1|  BnaA08g04190D                                          139   1e-36    
ref|XP_002284724.1|  PREDICTED: chlorophyll a-b binding protein 4...    139   1e-36    
ref|XP_004956926.1|  PREDICTED: chlorophyll a-b binding protein 7...    139   1e-36    
gb|EEC84641.1|  hypothetical protein OsI_31519                          138   2e-36    
gb|ABD37882.1|  light-harvesting chlorophyll-a/b binding protein ...    138   2e-36    
gb|AAD28768.1|AF134121_1  Lhca5 protein                                 138   2e-36    
ref|XP_004956924.1|  PREDICTED: chlorophyll a-b binding protein 7...    139   2e-36    
gb|EAZ44873.1|  hypothetical protein OsJ_29513                          137   2e-36    
ref|XP_003576571.1|  PREDICTED: chlorophyll a-b binding protein 7...    138   2e-36    
gb|KCW66426.1|  hypothetical protein EUGRSUZ_F00228                     137   3e-36    
ref|XP_002510221.1|  chlorophyll A/B binding protein, putative          138   3e-36    
ref|XP_010270018.1|  PREDICTED: chlorophyll a-b binding protein 4...    138   3e-36    
gb|AAB40979.1|  light harvesting complex a                              138   3e-36    
ref|XP_006828393.1|  hypothetical protein AMTR_s00060p00031820          137   3e-36    
ref|XP_010059937.1|  PREDICTED: chlorophyll a-b binding protein 4...    138   3e-36    
ref|XP_010238211.1|  PREDICTED: chlorophyll a-b binding protein 7...    138   3e-36    
ref|XP_006434777.1|  hypothetical protein CICLE_v10002178mg             135   4e-36    
ref|XP_006647960.1|  PREDICTED: chlorophyll a-b binding protein 7...    137   4e-36    
tpg|DAA40157.1|  TPA: hypothetical protein ZEAMMB73_160322              136   5e-36    
ref|XP_011083846.1|  PREDICTED: chlorophyll a-b binding protein 4...    137   6e-36    
ref|XP_010500206.1|  PREDICTED: chlorophyll a-b binding protein 4...    137   6e-36    
ref|XP_010479098.1|  PREDICTED: chlorophyll a-b binding protein 4...    136   1e-35    
ref|XP_008797264.1|  PREDICTED: chlorophyll a-b binding protein 4...    136   2e-35    
dbj|BAJ98426.1|  predicted protein                                      135   2e-35    
ref|XP_009760096.1|  PREDICTED: chlorophyll a-b binding protein P...    135   2e-35    
gb|AAL74395.1|AF359127_1  LHC I type IV chlorophyll binding protein     131   2e-35    
ref|XP_006434781.1|  hypothetical protein CICLE_v10002178mg             134   3e-35    
ref|XP_006434778.1|  hypothetical protein CICLE_v10002178mg             134   5e-35    
gb|KJB14577.1|  hypothetical protein B456_002G132100                    133   7e-35    
gb|ABD37879.1|  light-harvesting chlorophyll-a/b binding protein ...    134   7e-35    
gb|KJB14575.1|  hypothetical protein B456_002G132100                    134   7e-35    
ref|XP_010461501.1|  PREDICTED: chlorophyll a-b binding protein 4...    134   7e-35    
ref|XP_001780681.1|  predicted protein                                  132   8e-35    
ref|XP_005849804.1|  hypothetical protein CHLNCDRAFT_59626              134   8e-35    
gb|AHJ90294.1|  type IV chlorophyll binding protein                     130   8e-35    
gb|KJB14578.1|  hypothetical protein B456_002G132100                    134   8e-35    
gb|AHJ90368.1|  type IV chlorophyll binding protein                     130   9e-35    
tpg|DAA05920.1|  TPA: chloroplast light-harvesting complex I prot...    133   1e-34    
gb|KIZ03631.1|  chlorophyll A/B binding protein, putative               134   1e-34    
ref|XP_007017245.1|  Light-harvesting complex I protein Lhca5 iso...    134   1e-34    
ref|XP_003603038.1|  Chlorophyll a-b binding protein                    134   1e-34    
ref|XP_007017246.1|  Photosystem I light harvesting complex gene ...    133   1e-34    
ref|XP_003570571.1|  PREDICTED: chlorophyll a-b binding protein 4...    133   2e-34    
ref|XP_002961446.1|  light-harvesting complex                           133   2e-34    
ref|NP_001048216.1|  Os02g0764500                                       133   2e-34    
ref|XP_010939425.1|  PREDICTED: chlorophyll a-b binding protein 4...    133   2e-34    
gb|KHG00964.1|  Chlorophyll a-b binding P4, chloroplastic               132   3e-34    
tpg|DAA05942.1|  TPA: chloroplast light-harvesting complex I prot...    132   3e-34    
gb|KIZ07395.1|  Chlorophyll a-b binding protein                         132   3e-34    
ref|XP_006473329.1|  PREDICTED: chlorophyll a-b binding protein P...    132   4e-34    
gb|EEC74057.1|  hypothetical protein OsI_09055                          132   4e-34    
gb|ABN49455.1|  photosystem I chlorophyll a/b binding protein           129   4e-34    
gb|AAA57542.1|  PSI type II chlorophyll a/b-binding protein             132   6e-34    
ref|XP_007136682.1|  hypothetical protein PHAVU_009G064900g             131   7e-34    
ref|XP_011029950.1|  PREDICTED: chlorophyll a-b binding protein 4...    131   9e-34    
gb|ABK23846.1|  unknown                                                 128   1e-33    
pdb|3LW5|2  Chain 2, Improved Model Of Plant Photosystem I              129   1e-33    unidentified
gb|KIY93777.1|  hypothetical protein MNEG_14186                         130   1e-33    
ref|XP_005645059.1|  light harvesting complex a protein                 130   1e-33    
ref|XP_009409310.1|  PREDICTED: chlorophyll a-b binding protein 4...    131   1e-33    
gb|AHJ90348.1|  type IV chlorophyll binding protein                     127   1e-33    
gb|ACF86226.1|  unknown                                                 130   2e-33    
ref|NP_001148187.1|  LOC100281795                                       130   2e-33    
gb|AFK43193.1|  unknown                                                 129   3e-33    
gb|KHN04502.1|  Chlorophyll a-b binding protein 7, chloroplastic        127   3e-33    
ref|XP_004501571.1|  PREDICTED: chlorophyll a-b binding protein 4...    130   3e-33    
ref|XP_003528272.2|  PREDICTED: chlorophyll a-b binding protein 7...    129   6e-33    
ref|XP_002454598.1|  hypothetical protein SORBIDRAFT_04g034130          129   8e-33    
gb|AFW73581.1|  chlorophyll a-b binding protein 4                       130   8e-33    
tpg|DAA05901.1|  TPA: chloroplast light-harvesting complex I prot...    127   9e-33    
gb|AFK47516.1|  unknown                                                 128   1e-32    
ref|XP_006374944.1|  chlorophyll A-B binding family protein             128   2e-32    
gb|KIZ02809.1|  Chlorophyll a-b binding protein                         127   4e-32    
ref|XP_005649543.1|  light-harvesting chlorophyll a/b-binding pro...    126   1e-31    
ref|XP_005844196.1|  hypothetical protein CHLNCDRAFT_32710              125   1e-31    
gb|ABD37883.1|  light-harvesting chlorophyll-a/b binding protein ...    123   2e-31    
gb|EMS52019.1|  Chlorophyll a-b binding protein P4, chloroplastic       125   2e-31    
ref|XP_001698070.1|  light-harvesting protein of photosystem I          125   2e-31    
ref|XP_006465467.1|  PREDICTED: chlorophyll a-b binding protein 7...    122   3e-31    
ref|XP_003056428.1|  chlorophyll a/b-binding protein, chloroplast...    124   3e-31    
tpg|DAA05902.1|  TPA: chloroplast light-harvesting complex I prot...    123   4e-31    
gb|AAO16495.1|  light-harvesting complex I protein                      123   8e-31    
dbj|BAD06924.1|  light-harvesting chlorophyll-a/b protein of phot...    123   8e-31    
gb|ABA01130.1|  chloroplast light harvesting complex I protein          122   1e-30    
ref|XP_001691959.1|  light-harvesting protein of photosystem I          124   1e-30    
gb|ABD37907.1|  light-harvesting chlorophyll-a/b binding protein ...    122   2e-30    
gb|ABD37906.1|  light-harvesting chlorophyll-a/b binding protein ...    122   2e-30    
ref|XP_001696202.1|  light-harvesting protein of photosystem I          122   2e-30    
ref|XP_005645057.1|  light-harvesting complex I protein                 122   3e-30    
gb|EMS51363.1|  putative polygalacturonase                              124   1e-29    
ref|XP_002957416.1|  light-harvesting protein of photosystem I          119   2e-29    
ref|XP_006343439.1|  PREDICTED: chlorophyll a-b binding protein P...    120   2e-29    
ref|XP_002946247.1|  hypothetical protein VOLCADRAFT_108856             119   3e-29    
ref|XP_002955817.1|  hypothetical protein VOLCADRAFT_106964             119   5e-29    
ref|XP_002950368.1|  light harvesting complex a protein                 116   1e-28    
ref|XP_004242951.1|  PREDICTED: chlorophyll a-b binding protein 4...    117   1e-28    
ref|XP_009630364.1|  PREDICTED: chlorophyll a-b binding protein P...    117   1e-28    
gb|ABX71549.1|  chloroplast chlorophyll a/b binding protein             114   2e-28    
gb|EMS53700.1|  Chlorophyll a-b binding protein 7, chloroplastic        116   2e-28    
ref|XP_002945875.1|  light harvesting complex a protein                 116   4e-28    
ref|XP_005651069.1|  light-harvesting chlorophyll-a/b protein of ...    116   5e-28    
gb|AHH02373.1|  putative chlorophyll a /b-binding protein               110   5e-28    
ref|XP_001702730.1|  light-harvesting protein of photosystem I          115   8e-28    
gb|ABD37905.1|  light-harvesting chlorophyll-a/b binding protein ...    115   1e-27    
gb|AHJ90292.1|  type IV chlorophyll binding protein                     111   1e-27    
ref|XP_001692548.1|  light-harvesting protein of photosystem I          113   2e-27    



>gb|KJB08271.1| hypothetical protein B456_001G074300 [Gossypium raimondii]
Length=221

 Score =   326 bits (836),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCASKTRFLTGSSGKLNR+VSF+   S+S  SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASKTRFLTGSSGKLNRDVSFKPVASTSTSSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  61   PSPAYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>gb|KJB08275.1| hypothetical protein B456_001G074300 [Gossypium raimondii]
Length=252

 Score =   326 bits (836),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/172 (91%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCASKTRFLTGSSGKLNR+VSF+   S+S  SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASKTRFLTGSSGKLNRDVSFKPVASTSTSSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  61   PSPAYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>gb|KHG21243.1| Chlorophyll a-b binding 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=252

 Score =   325 bits (832),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCASKTRFLTGSSGKLNR+VSF+   ++S  SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASKTRFLTGSSGKLNRDVSFKPVAATSTSSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  61   PSPAYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>ref|XP_004236014.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Solanum 
lycopersicum]
Length=287

 Score =   323 bits (827),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = +1

Query  16   THQNFSSENMATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEA  192
            T++ F  E MATVT Q SAA+FRPCAS+TRFLTGSSGKLNREVSFR ST SS  SFK+EA
Sbjct  28   TNKLFKLEKMATVTTQASAAIFRPCASRTRFLTGSSGKLNREVSFRPSTFSSYNSFKVEA  87

Query  193  KKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLL  372
            KKG+WLPGL SP YLDGSLPGDNGFDPLGLAEDPENL+W++QAELVNGRWAMLGVAGMLL
Sbjct  88   KKGQWLPGLASPDYLDGSLPGDNGFDPLGLAEDPENLKWFIQAELVNGRWAMLGVAGMLL  147

Query  373  PEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPI  552
            PEVFT IGI+N PKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPI
Sbjct  148  PEVFTSIGILNVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPI  207

Query  553  F  555
            F
Sbjct  208  F  208



>ref|NP_001275056.1| chlorophyll a-b binding protein 4, chloroplastic-like [Solanum 
tuberosum]
 emb|CAK24966.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=251

 Score =   318 bits (814),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPCAS+TRFLTGSSGKLNREVSFR STSSS  SFK+EAKKG+WLPGL
Sbjct  1    MATVTTQASAAIFRPCASRTRFLTGSSGKLNREVSFRPSTSSSYNSFKVEAKKGQWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YLDGSLPGDNGFDPLGLAEDPENL+W++QAELVNGRWAMLGVAGMLLPEVFT IGI
Sbjct  61   ASPDYLDGSLPGDNGFDPLGLAEDPENLKWFIQAELVNGRWAMLGVAGMLLPEVFTSIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +N PKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  LNVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>ref|XP_009773617.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Nicotiana sylvestris]
Length=251

 Score =   316 bits (809),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 160/172 (93%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPCASKTRFLTGSSGKLNREVSF+  TSSS  SFK+EAKKG+WLPGL
Sbjct  1    MATVTTQASAAIFRPCASKTRFLTGSSGKLNREVSFKPLTSSSYNSFKVEAKKGQWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YLDGSLPGDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT IGI
Sbjct  61   ASPTYLDGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTNIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +N PKWYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  LNVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>ref|XP_009618704.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Nicotiana tomentosiformis]
Length=251

 Score =   315 bits (806),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 160/172 (93%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPCASKTRFL+GSSGKLNREVSF+  TSSS  SFK+EAKKG+WLPGL
Sbjct  1    MATVTTQASAAIFRPCASKTRFLSGSSGKLNREVSFKPLTSSSYNSFKVEAKKGQWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YLDGSLPGDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT IGI
Sbjct  61   ASPTYLDGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTNIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +N PKWYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  LNVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>gb|KDP31267.1| hypothetical protein JCGZ_11643 [Jatropha curcas]
Length=249

 Score =   313 bits (803),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 163/172 (95%), Gaps = 4/172 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCAS++RFL+GS  KLNREVSF+ +TSSS   FK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASRSRFLSGSPNKLNREVSFKPTTSSS---FKVEAKKGEWLPGL  57

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  58   PSPAYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGI  117

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  118  INAPQWYDAGKVEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  169



>ref|XP_002284856.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Vitis 
vinifera]
 emb|CAN79984.1| hypothetical protein VITISV_038035 [Vitis vinifera]
Length=252

 Score =   313 bits (803),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 161/172 (94%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCASK+RFLTGSSGKL REVS +  TSSS  SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASKSRFLTGSSGKLGREVSVKPMTSSSYRSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP+YLDGSLPGDNGFDPLGLAEDPENL+WYVQAELVN RWAMLGVAGMLLPEVFT+IGI
Sbjct  61   SSPSYLDGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVAGMLLPEVFTKIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>ref|XP_007037388.1| Light-harvesting chlorophyll-protein complex I subunit A4 [Theobroma 
cacao]
 gb|EOY21889.1| Light-harvesting chlorophyll-protein complex I subunit A4 [Theobroma 
cacao]
Length=252

 Score =   313 bits (802),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 162/172 (94%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATV-TQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATV TQ SAAVFRP ASKTRFLTGSS KLNR+V F+ + S++  SFK+EAKKGEWLPGL
Sbjct  1    MATVSTQASAAVFRPRASKTRFLTGSSSKLNRKVCFKPTASTTPSSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSLPGDNGFDPLGLAEDPENL+WYVQAELVN RWAMLGVAGMLLPEVFT+IGI
Sbjct  61   PSPAYLNGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVAGMLLPEVFTKIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>gb|KJB50940.1| hypothetical protein B456_008G194000 [Gossypium raimondii]
Length=252

 Score =   313 bits (801),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +1

Query  46   ATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPS  225
            A  TQ SAAVFRPC SKTRFLTG+SGKLNREV F++ +SSS  SFK+EAKKGEWLPGLPS
Sbjct  3    AVTTQASAAVFRPCMSKTRFLTGNSGKLNREVCFKSMSSSSISSFKVEAKKGEWLPGLPS  62

Query  226  PAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIIN  405
            PAYL GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT+IG+IN
Sbjct  63   PAYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGLIN  122

Query  406  APKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AP+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  123  APQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>ref|XP_003523016.2| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Glycine max]
Length=291

 Score =   313 bits (802),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPC SK+RFLTGSSGKLNREV+ R      + SFK+EAKKGEWLPGL
Sbjct  40   MATVTTQASAAIFRPCTSKSRFLTGSSGKLNREVTMRPMGCPPSASFKVEAKKGEWLPGL  99

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+G+LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+ GI
Sbjct  100  ASPTYLNGTLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKFGI  159

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  160  INAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  211



>gb|KHG01496.1| Chlorophyll a-b binding P4, chloroplastic [Gossypium arboreum]
Length=252

 Score =   311 bits (797),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  46   ATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPS  225
            A  TQ SAAVFRPC SKTRFLTG+SGKLNR+V F+  +SSS  SFK+EAKKGEWLPGLPS
Sbjct  3    AVTTQASAAVFRPCTSKTRFLTGNSGKLNRQVCFKPMSSSSISSFKVEAKKGEWLPGLPS  62

Query  226  PAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIIN  405
            PAYL GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT+IG+IN
Sbjct  63   PAYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGLIN  122

Query  406  APKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AP+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  123  APQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>ref|XP_003527087.2| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Glycine max]
Length=292

 Score =   313 bits (801),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPCASK+RFLTGSSGKLNREV+ R      + SFK+EAKKGEWLPGL
Sbjct  41   MATVTTQASAAIFRPCASKSRFLTGSSGKLNREVTMRPMGCPPSASFKVEAKKGEWLPGL  100

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+G+LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  101  ASPTYLNGTLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGI  160

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  161  INAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  212



>gb|KHN26254.1| Chlorophyll a-b binding protein P4, chloroplastic [Glycine soja]
Length=252

 Score =   311 bits (797),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPCASK+RFLTGSSGKLNREV+ R      + SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAIFRPCASKSRFLTGSSGKLNREVTMRPMGCPPSASFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+G+LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  61   ASPTYLNGTLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>gb|KHN01874.1| Chlorophyll a-b binding protein P4, chloroplastic [Glycine soja]
Length=252

 Score =   311 bits (796),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPC SK+RFLTGSSGKLNREV+ R      + SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAIFRPCTSKSRFLTGSSGKLNREVTMRPMGCPPSASFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+G+LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+ GI
Sbjct  61   ASPTYLNGTLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKFGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  121  INAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>ref|XP_007138174.1| hypothetical protein PHAVU_009G186500g [Phaseolus vulgaris]
 gb|AGV54430.1| chlorophyll A/B binding protein [Phaseolus vulgaris]
 gb|ESW10168.1| hypothetical protein PHAVU_009G186500g [Phaseolus vulgaris]
Length=252

 Score =   310 bits (795),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPCASK+RFLTGSSGKLNREVS R      + SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAIFRPCASKSRFLTGSSGKLNREVSMRPMGCPPSASFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT++GI
Sbjct  61   ASPTYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKLGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>ref|XP_010093602.1| Chlorophyll a-b binding protein P4 [Morus notabilis]
 gb|EXB54330.1| Chlorophyll a-b binding protein P4 [Morus notabilis]
Length=250

 Score =   310 bits (795),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 163/172 (95%), Gaps = 3/172 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MAT+T Q +AAVFRPCA+K+RF TGSSGKLNREVS R  T+SS+ +FK+EAKKGEWLPGL
Sbjct  1    MATITMQATAAVFRPCAAKSRFPTGSSGKLNREVSVR--TASSSGAFKVEAKKGEWLPGL  58

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  59   PSPAYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGI  118

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +NAPKWYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  119  LNAPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  170



>gb|AGV54882.1| chlorophyll A/B binding protein P4 chloroplastic-like protein 
[Phaseolus vulgaris]
Length=252

 Score =   310 bits (794),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPCASK+RFLTGSSGKLNREVS R      + SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAIFRPCASKSRFLTGSSGKLNREVSMRPMGCPPSASFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT++GI
Sbjct  61   ASPTYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKLGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>gb|AGZ15388.1| PSI light-harvesting antenna chlorophyll a/b-binding protein 
[Phaseolus vulgaris]
Length=252

 Score =   310 bits (794),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 159/172 (92%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPCASK+RFLTGSSGKLNREVS R      + SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAIFRPCASKSRFLTGSSGKLNREVSMRPMGCPPSASFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT++GI
Sbjct  61   ASPTYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKLGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>gb|ACB05669.1| chloroplast chlorophyll a/b binding protein [Capsicum annuum]
Length=250

 Score =   308 bits (790),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 154/161 (96%), Gaps = 2/161 (1%)
 Frame = +1

Query  73   VFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLP  252
            +FRPCA++TRFLTGSSGKLNREVSFR STS  N SFK+EAKKGEWLPGL SPAYLDGSLP
Sbjct  12   IFRPCATRTRFLTGSSGKLNREVSFRPSTS--NNSFKVEAKKGEWLPGLASPAYLDGSLP  69

Query  253  GDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGK  432
            GDNGFDPLGLAEDPENL+WY+QAELVNGRWAMLGVAGMLLPEVFT IGI+N PKWYDAGK
Sbjct  70   GDNGFDPLGLAEDPENLKWYIQAELVNGRWAMLGVAGMLLPEVFTSIGILNVPKWYDAGK  129

Query  433  SEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  130  AEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  170



>ref|XP_002514741.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47847.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=251

 Score =   308 bits (790),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 160/172 (93%), Gaps = 2/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCASK+RFL+GS  KLNREV+F+   SSS  SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASKSRFLSGSPSKLNREVAFKP-MSSSPASFKVEAKKGEWLPGL  59

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSLPGDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  60   PSPAYLNGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGI  119

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IN PKWYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  120  INVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  171



>emb|CBI15210.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   308 bits (789),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 160/172 (93%), Gaps = 4/172 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCASK+RFLTGSSGKL REVS +  TSSS   FK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASKSRFLTGSSGKLGREVSVKPMTSSS---FKVEAKKGEWLPGL  57

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP+YLDGSLPGDNGFDPLGLAEDPENL+WYVQAELVN RWAMLGVAGMLLPEVFT+IGI
Sbjct  58   SSPSYLDGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVAGMLLPEVFTKIGI  117

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  118  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  169



>ref|XP_010030046.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Eucalyptus 
grandis]
 gb|KCW83631.1| hypothetical protein EUGRSUZ_B00523 [Eucalyptus grandis]
Length=294

 Score =   309 bits (791),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 161/175 (92%), Gaps = 2/175 (1%)
 Frame = +1

Query  37   ENMATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRA-STSSSNVSFKIEAKKGEWL  210
            + MATVT Q SAAVFRPC+SKTRFLTGSSGKLNREVS +A  ++SS  S K+EAKKGEWL
Sbjct  40   KKMATVTTQASAAVFRPCSSKTRFLTGSSGKLNREVSIKALPSTSSPASLKVEAKKGEWL  99

Query  211  PGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQ  390
            PGL SP YL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT+
Sbjct  100  PGLASPGYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTK  159

Query  391  IGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IGIIN P WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  160  IGIINVPAWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  214



>ref|XP_006374461.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
 gb|ERP52258.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
Length=213

 Score =   305 bits (782),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 2/172 (1%)
 Frame = +1

Query  43   MATV-TQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATV TQ SAAVFRPCA K+RFL G+  KLNRE+S +   SSS  SFK+EAKKGEWLPGL
Sbjct  1    MATVSTQASAAVFRPCAYKSRFLAGAPSKLNRELSIKPMASSS-PSFKVEAKKGEWLPGL  59

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSP+YL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  60   PSPSYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGI  119

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  120  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  171



>ref|XP_006477466.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Citrus sinensis]
Length=250

 Score =   306 bits (785),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 3/172 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCASK+RFLTGSSGKLNREV+ +  +SS+  SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASKSRFLTGSSGKLNREVALKPVSSSA--SFKVEAKKGEWLPGL  58

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+GSLPGDNGFDPLGLAEDPENL+WYVQAELVN RWAMLGV GMLLPEVFT+IGI
Sbjct  59   ASPTYLNGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGI  118

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  119  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  170



>ref|XP_011047180.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Populus euphratica]
Length=251

 Score =   306 bits (784),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 2/172 (1%)
 Frame = +1

Query  43   MATV-TQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATV TQ SAAVFRPCA K+RFL G+  KLNRE+S +   SSS  SFK+EAKKGEWLPGL
Sbjct  1    MATVSTQASAAVFRPCAYKSRFLAGAPSKLNRELSIKPMASSS-PSFKVEAKKGEWLPGL  59

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSP+YL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  60   PSPSYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGI  119

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  120  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  171



>ref|XP_006374462.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
 gb|ERP52259.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
Length=213

 Score =   305 bits (780),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 2/172 (1%)
 Frame = +1

Query  43   MATV-TQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATV TQ SAAVFRPCA K+RFL G+  KLNRE+S +   SSS  SFK+EAKKGEWLPGL
Sbjct  1    MATVSTQASAAVFRPCAYKSRFLAGAPSKLNRELSIKPMASSS-PSFKVEAKKGEWLPGL  59

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSP+YL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  60   PSPSYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGI  119

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  120  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  171



>ref|XP_006374463.1| Chlorophyll a-b binding protein 4 [Populus trichocarpa]
 gb|ABK96327.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP52260.1| Chlorophyll a-b binding protein 4 [Populus trichocarpa]
Length=251

 Score =   306 bits (783),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 2/172 (1%)
 Frame = +1

Query  43   MATV-TQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATV TQ SAAVFRPCA K+RFL G+  KLNRE+S +   SSS  SFK+EAKKGEWLPGL
Sbjct  1    MATVSTQASAAVFRPCAYKSRFLAGAPSKLNRELSIKPMASSS-PSFKVEAKKGEWLPGL  59

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSP+YL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  60   PSPSYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGI  119

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  120  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  171



>ref|XP_006374464.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
 gb|ERP52261.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa]
Length=252

 Score =   306 bits (783),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 2/172 (1%)
 Frame = +1

Query  43   MATV-TQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATV TQ SAAVFRPCA K+RFL G+  KLNRE+S +   SSS  SFK+EAKKGEWLPGL
Sbjct  1    MATVSTQASAAVFRPCAYKSRFLAGAPSKLNRELSIKPMASSS-PSFKVEAKKGEWLPGL  59

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSP+YL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  60   PSPSYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGI  119

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  120  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  171



>ref|XP_008453211.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Cucumis melo]
Length=252

 Score =   306 bits (783),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 165/172 (96%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCA+++RFL+GSSGKL+R +S +  ++SS+ SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPCAARSRFLSGSSGKLHRVLSVKPVSASSSSSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  61   PSPAYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTKIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>ref|XP_010258312.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Nelumbo 
nucifera]
Length=251

 Score =   305 bits (782),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +1

Query  43   MATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLP  222
            MATVT  ++AVFRPC S++RFLTGSSGKL RE+S + + SSS  SFKIEAKKGEWLPGL 
Sbjct  1    MATVTTQASAVFRPCTSRSRFLTGSSGKLAREISVKTAASSSPGSFKIEAKKGEWLPGLA  60

Query  223  SPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGII  402
            SP YL+GSLPGDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPE+FT+IGII
Sbjct  61   SPGYLNGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEIFTKIGII  120

Query  403  NAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            N P WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  NVPAWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  171



>ref|XP_004138171.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004154963.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cucumis sativus]
 gb|KGN63677.1| hypothetical protein Csa_1G009810 [Cucumis sativus]
Length=252

 Score =   305 bits (781),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 163/172 (95%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCA+++RFL+GSSGKL R +S +  ++SS+ SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPCAARSRFLSGSSGKLQRVLSVKPVSASSSSSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSP YL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  61   PSPMYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>ref|XP_008783815.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Phoenix dactylifera]
Length=252

 Score =   304 bits (779),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRP ASK RFLTGSSGKL R+ + + + S +  S K+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPQASKARFLTGSSGKLARDFATKTARSKTTTSLKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSLPGDNGFDPLGLAEDPENL+WYVQAELVN RWAMLGV GMLLPEVFT+IGI
Sbjct  61   PSPAYLNGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IN PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  121  INVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>ref|XP_006354774.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=250

 Score =   304 bits (779),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 160/172 (93%), Gaps = 2/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRP A+KTRFL+GSSGKLNR+VSF++ST S N SFKIEAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPSATKTRFLSGSSGKLNRDVSFKSSTLSYN-SFKIEAKKGEWLPGL  59

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+GSL GDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT IG+
Sbjct  60   TSPTYLNGSLAGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGL  119

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +N PKW+DAGKS+YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  120  LNVPKWFDAGKSDYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  171



>gb|ACJ85068.1| unknown [Medicago truncatula]
 gb|AFK42004.1| unknown [Medicago truncatula]
 gb|KEH33313.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=253

 Score =   304 bits (778),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPC  K+RFLTGSSGKLNREV+ R    S + SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAIFRPCGLKSRFLTGSSGKLNREVAIRPMGCSPSASFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL GSLPGDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT IGI
Sbjct  61   ASPGYLTGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTNIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IN PKWYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>ref|XP_004513901.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cicer arietinum]
Length=252

 Score =   303 bits (775),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            M TVT Q SAA+FRPCASK+RFLTGSSGKLNREV+ R    S + SFK+EAKKGEWLPGL
Sbjct  1    MTTVTTQASAAIFRPCASKSRFLTGSSGKLNREVAIRPIGFSPSASFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL GSLPGDNGFDPL LAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT IGI
Sbjct  61   SSPGYLTGSLPGDNGFDPLALAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTNIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IN PKWYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>ref|XP_004137413.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004168449.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Cucumis sativus]
 gb|KGN64012.1| hypothetical protein Csa_1G033310 [Cucumis sativus]
Length=250

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATV-TQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATV TQ SA VFRPCAS++RFL+GSSGK NR +S + +TSS   +FK+EAKKGEWLPGL
Sbjct  1    MATVITQASATVFRPCASRSRFLSGSSGKFNRALSVKPTTSSIPNAFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSP YLDGSLPGDNGFDPLGLAEDPENLRWY QAELVNGRWAMLGVAGM+LPEV T  GI
Sbjct  61   PSPTYLDGSLPGDNGFDPLGLAEDPENLRWYTQAELVNGRWAMLGVAGMVLPEVLTNYGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IN PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>ref|XP_009587071.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=251

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRP ASK+RFL+G+SGKLNREV F+ STSSS  SFK+EAKKGEWLPGL
Sbjct  1    MATVTSQASAAVFRPTASKSRFLSGASGKLNREVFFKPSTSSSYNSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YLDG L GDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEV T  G+
Sbjct  61   TSPTYLDGRLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSAGL  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +N PKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  LNVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>gb|KDO55547.1| hypothetical protein CISIN_1g025674mg [Citrus sinensis]
Length=215

 Score =   300 bits (768),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 159/172 (92%), Gaps = 4/172 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCASK+RFLTGSSGKLNREV+ +  +SS+  SFK+EAK GEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASKSRFLTGSSGKLNREVALKPVSSSA--SFKVEAK-GEWLPGL  57

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+GSLPGDNGFDPLGLAEDPENL+WYVQAELVN RWAMLGV GMLLPEVFT+IGI
Sbjct  58   ASPTYLNGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGI  117

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  118  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  169



>ref|XP_009369279.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Pyrus x bretschneideri]
 gb|AHM26641.1| a-b binding protein [Pyrus x bretschneideri]
Length=253

 Score =   301 bits (770),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 154/173 (89%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCA-SKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MATVT Q SAAVFRPC  SK+RFL+GSS KLNREV+FR   S    SFK+EAKKGEWLPG
Sbjct  1    MATVTTQASAAVFRPCVNSKSRFLSGSSSKLNREVAFRPMASPPAASFKVEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            LPSP YL GSLPGDNGFDPL LAEDPENLRWYVQAELVNGRWAMLGV GMLLPEVFT IG
Sbjct  61   LPSPDYLTGSLPGDNGFDPLALAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVFTSIG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            I+N PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  ILNVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>ref|XP_009804068.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Nicotiana sylvestris]
Length=249

 Score =   300 bits (769),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = +1

Query  43   MATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLP  222
            MATVT  ++AVFRP ASKTRFL+G+SGKLNREV F+ STSS N SFK+EAKKGEWLPGL 
Sbjct  1    MATVTSQASAVFRPTASKTRFLSGASGKLNREVFFKPSTSSCN-SFKVEAKKGEWLPGLT  59

Query  223  SPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGII  402
            SP YLDG L GDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEV T  G++
Sbjct  60   SPTYLDGRLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSAGLL  119

Query  403  NAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            N PKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  120  NVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  170



>ref|XP_006404376.1| hypothetical protein EUTSA_v10010659mg [Eutrema salsugineum]
 dbj|BAJ33651.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45829.1| hypothetical protein EUTSA_v10010659mg [Eutrema salsugineum]
Length=251

 Score =   300 bits (769),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRA-STSSSNVSFKIEAKKGEWLPG  216
            MATVT Q SA++FRPC SK RFLTGSSG+LNRE+SF++  +SS   SFK+EAKKGEWLPG
Sbjct  1    MATVTTQASASIFRPCTSKPRFLTGSSGRLNRELSFKSIGSSSKTASFKVEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SP YL+GSL GDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT+IG
Sbjct  61   LASPGYLNGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IIN P+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  IINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>ref|XP_011087238.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Sesamum 
indicum]
Length=249

 Score =   300 bits (769),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 153/167 (92%), Gaps = 2/167 (1%)
 Frame = +1

Query  58   QPSAAVFRP-CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAY  234
            Q S A FRP CAS+TRFLTGSSGKLNREVS R + SS N SFK+EAKKGEWLPGL SP Y
Sbjct  5    QASVAGFRPACASRTRFLTGSSGKLNREVSVRQAVSSYN-SFKVEAKKGEWLPGLASPTY  63

Query  235  LDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPK  414
            LDGSLPGDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT IGIIN PK
Sbjct  64   LDGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPK  123

Query  415  WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  124  WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  170



>emb|CDP12284.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  46   ATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPS  225
            A  TQ S AVFRPCASKTRFLTGSSGKLNR VS R STSSS  SFK+EAKKGEWLPGL S
Sbjct  3    AVTTQASIAVFRPCASKTRFLTGSSGKLNRGVSIRPSTSSSTTSFKVEAKKGEWLPGLAS  62

Query  226  PAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIIN  405
            P YLDGSLPGDNGFDPLGLAEDPENLRW +QAELVN RWAMLGV GM+LPEV T+IGIIN
Sbjct  63   PPYLDGSLPGDNGFDPLGLAEDPENLRWMIQAELVNSRWAMLGVVGMILPEVLTKIGIIN  122

Query  406  APKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AP WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  123  APNWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>gb|KDO55546.1| hypothetical protein CISIN_1g025674mg [Citrus sinensis]
Length=249

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 159/172 (92%), Gaps = 4/172 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCASK+RFLTGSSGKLNREV+ +  +SS+  SFK+EAK GEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASKSRFLTGSSGKLNREVALKPVSSSA--SFKVEAK-GEWLPGL  57

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+GSLPGDNGFDPLGLAEDPENL+WYVQAELVN RWAMLGV GMLLPEVFT+IGI
Sbjct  58   ASPTYLNGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGI  117

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  118  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  169



>ref|XP_010547822.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Tarenaya 
hassleriana]
Length=252

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFR-ASTSSSNVSFKIEAKKGEWLPG  216
            MATVT Q SAAVFRPCAS+ RFLTGSSGKLNR++  +   +S+   SFK+EAKKGEWLPG
Sbjct  1    MATVTTQASAAVFRPCASRPRFLTGSSGKLNRDLLVKPIGSSTRTASFKVEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SPAYL+GSLPGDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT+IG
Sbjct  61   LASPAYLNGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IIN P+WYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  IINVPEWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>gb|AFK37078.1| unknown [Lotus japonicus]
Length=252

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+FRPCAS++RFLTGSSGKLNREV+FR      + SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAIFRPCASRSRFLTGSSGKLNREVAFRPMGCPPSTSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+GSLPGDNGFDPL LAEDPENL+W+VQAELVNGRWA LGVAGMLLPEV T IG+
Sbjct  61   ASPNYLNGSLPGDNGFDPLALAEDPENLKWFVQAELVNGRWATLGVAGMLLPEVLTNIGL  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IN PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>ref|XP_004299348.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=251

 Score =   300 bits (767),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 154/172 (90%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVTQPSAAVFRP-CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT  ++AV+RP   SK+RFLTGSSGKL REV+FR  TS S  SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAVYRPQITSKSRFLTGSSGKLTREVAFRPVTSPSASSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSP YL GSLPGDNGFDPL LAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEV T IGI
Sbjct  61   PSPGYLTGSLPGDNGFDPLALAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IN PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>ref|XP_008374556.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Malus domestica]
Length=253

 Score =   300 bits (767),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 154/173 (89%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCA-SKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MATVT Q SAA+FRPC  SK+RFL+GSS KLNREV+FR   S    SFK+EAKKGEWLPG
Sbjct  1    MATVTTQASAAIFRPCVNSKSRFLSGSSSKLNREVAFRPMASPPASSFKVEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            LPSP YL GSLPGDNGFDPL LAEDPENLRWY+QAELVNGRWAMLGV GMLLPEVFT IG
Sbjct  61   LPSPDYLTGSLPGDNGFDPLALAEDPENLRWYIQAELVNGRWAMLGVVGMLLPEVFTSIG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            I+N PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  ILNVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>ref|XP_010322569.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Solanum lycopersicum]
Length=250

 Score =   299 bits (765),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 157/172 (91%), Gaps = 2/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVF P A+KTRFL GSSGKLNR+ SF++ST S N SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFPPSATKTRFLNGSSGKLNRDFSFKSSTLSYN-SFKVEAKKGEWLPGL  59

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+GSL GDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT IG+
Sbjct  60   TSPTYLNGSLAGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGL  119

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +N PKWYDAGKS+YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  120  LNVPKWYDAGKSDYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  171



>ref|XP_010546068.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Tarenaya hassleriana]
Length=252

 Score =   299 bits (765),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFR-ASTSSSNVSFKIEAKKGEWLPG  216
            MATVT Q SAAVFRPC SK RFLTGSSGKLNRE+  +   +S+   S+K+EAKKGEWLPG
Sbjct  1    MATVTTQASAAVFRPCGSKPRFLTGSSGKLNRELLVKPVGSSTRTASYKVEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SPAYL+GSL GDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT+IG
Sbjct  61   LASPAYLNGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IINAP+WYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  IINAPEWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>ref|XP_006440616.1| hypothetical protein CICLE_v10021861mg [Citrus clementina]
 gb|ESR53856.1| hypothetical protein CICLE_v10021861mg [Citrus clementina]
Length=249

 Score =   298 bits (764),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 158/172 (92%), Gaps = 4/172 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCASK+RFLTGSSGKLNREV+ +  +SS+  SFK+EAK GEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASKSRFLTGSSGKLNREVALKPVSSSA--SFKVEAK-GEWLPGL  57

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+GSLPGDNGFDPLGLAEDPENL+WYVQAELVN RWAMLGV GMLLPEVFT+IGI
Sbjct  58   ASPTYLNGSLPGDNGFDPLGLAEDPENLKWYVQAELVNSRWAMLGVVGMLLPEVFTKIGI  117

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IN P+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  118  INVPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  169



>gb|KFK34045.1| hypothetical protein AALP_AA5G094700 [Arabis alpina]
Length=252

 Score =   298 bits (763),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRA-STSSSNVSFKIEAKKGEWLPG  216
            MATVT Q SA++FRPCASK RFLTGSSG+LNR++SF++  +SS   SFK++AKKGEWLPG
Sbjct  1    MATVTTQASASIFRPCASKPRFLTGSSGRLNRDLSFKSIGSSSKTASFKVQAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SP YL GSL GDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT+IG
Sbjct  61   LASPGYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IIN P+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  IINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>ref|XP_010678492.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 emb|CAE30280.1| chlorophyll a /b binding protein [Beta vulgaris]
Length=252

 Score =   298 bits (763),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  46   ATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPS  225
            A  TQ S A FRPCASK+RFLTG+ GKLN+E   R  ++SS  S K+EAKKGEWLPGL S
Sbjct  3    AVTTQASIAGFRPCASKSRFLTGAPGKLNKECGVRLPSTSSTNSLKVEAKKGEWLPGLAS  62

Query  226  PAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIIN  405
            PAYL+GSLPGDNGFDPL LAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFTQIGIIN
Sbjct  63   PAYLNGSLPGDNGFDPLALAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTQIGIIN  122

Query  406  APKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             PKWYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  123  VPKWYDAGKQEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>ref|XP_009339094.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Pyrus x bretschneideri]
Length=253

 Score =   298 bits (763),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 154/173 (89%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCA-SKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MATVT Q SAAVFRPC  SK+RFL+GSS KLNREV+FR   S S  SFK+EAKKGEWLPG
Sbjct  1    MATVTTQASAAVFRPCVNSKSRFLSGSSSKLNREVAFRPMASPSASSFKVEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SP YL GSLPGDNGFDPL LAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT +G
Sbjct  61   LASPDYLTGSLPGDNGFDPLALAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSLG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            I+N PKWYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  ILNVPKWYDAGKGEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>ref|XP_007209497.1| hypothetical protein PRUPE_ppa010291mg [Prunus persica]
 gb|EMJ10696.1| hypothetical protein PRUPE_ppa010291mg [Prunus persica]
Length=255

 Score =   296 bits (757),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 155/175 (89%), Gaps = 4/175 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCA-SKTRFLTGSSG-KLNREVSF-RASTSSSNVSFKIEAKKGEWL  210
            MATVT Q SAAVFRPC  SK+RFLTGSS  KLNREVSF R   S S  SFK+EAKKGEWL
Sbjct  1    MATVTTQASAAVFRPCINSKSRFLTGSSSTKLNREVSFIRPMASPSATSFKVEAKKGEWL  60

Query  211  PGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQ  390
            PGL SP YL GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEVFT 
Sbjct  61   PGLASPGYLTGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVFTS  120

Query  391  IGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IGI+N PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  IGILNVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  175



>ref|XP_008393169.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Malus domestica]
 ref|XP_008351850.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Malus domestica]
Length=253

 Score =   295 bits (756),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 153/173 (88%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCA-SKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MATVT Q SAAVFRPC  SK+RFL+GSS KLNREV+FR   S S  SFK+EAKKGEWLPG
Sbjct  1    MATVTTQASAAVFRPCVNSKSRFLSGSSSKLNREVAFRPMASPSASSFKVEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SP YL GSLPGDNGFDPL LAEDPENLRW+VQAELVN RWAMLGVAGMLLPEVFT +G
Sbjct  61   LASPDYLTGSLPGDNGFDPLALAEDPENLRWFVQAELVNSRWAMLGVAGMLLPEVFTXLG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            I+N PKWYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  ILNVPKWYDAGKGEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>ref|XP_010939818.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Elaeis guineensis]
Length=251

 Score =   294 bits (753),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q S AV RP ASK+RFLTGSSGKL RE + + + S++  SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASIAVLRPQASKSRFLTGSSGKLTREFAAKTARSNTLNSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPA+L+GSL GDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT+ GI
Sbjct  61   PSPAHLNGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKTGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IN PKWYDAGK+EYFASSSTLFVIEFILFHYVE+RRWQDIKNPG VNQDPIF
Sbjct  121  INVPKWYDAGKAEYFASSSTLFVIEFILFHYVEMRRWQDIKNPGSVNQDPIF  172



>ref|XP_010937179.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Elaeis guineensis]
Length=251

 Score =   294 bits (752),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  46   ATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPS  225
            A  TQ   AVFRP ASK RFLTGSSGKL R  + + + S++  SFK+EAKKGEWLPGLPS
Sbjct  3    AVSTQAPVAVFRPQASKPRFLTGSSGKLARGFATKTTRSNTTTSFKVEAKKGEWLPGLPS  62

Query  226  PAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIIN  405
            P+YL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVN RWAMLGV GMLLPEVFT+IGIIN
Sbjct  63   PSYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNSRWAMLGVVGMLLPEVFTKIGIIN  122

Query  406  APKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            APKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  123  APKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  172



>ref|NP_190331.3| chlorophyll a-b binding protein 4 [Arabidopsis thaliana]
 sp|P27521.1|CA4_ARATH RecName: Full=Chlorophyll a-b binding protein 4, chloroplastic; 
AltName: Full=LHCI type III CAB-4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA32760.1| light-harvesting chlorophyll a/b binding protein [Arabidopsis 
thaliana]
 emb|CAB61973.1| CHLOROPHYLL A-B BINDING PROTEIN 4 PRECURSOR homolog [Arabidopsis 
thaliana]
 gb|AAM13079.1| chlorophyll A-B binding protein 4 precursor homolog [Arabidopsis 
thaliana]
 gb|AAM63472.1| chlorophyll a-b binding protein 4 precursor homolog [Arabidopsis 
thaliana]
 gb|AAN15412.1| chlorophyll A-B binding protein 4 precursor homolog [Arabidopsis 
thaliana]
 gb|AEE78285.1| chlorophyll a-b binding protein 4 [Arabidopsis thaliana]
Length=251

 Score =   293 bits (751),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 155/173 (90%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVS-FKIEAKKGEWLPG  216
            MATVT   SA++FRPC SK RFLTGSSG+LNR++SF +  SS+  S FK+EAKKGEWLPG
Sbjct  1    MATVTTHASASIFRPCTSKPRFLTGSSGRLNRDLSFTSIGSSAKTSSFKVEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SP YL GSL GDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT+IG
Sbjct  61   LASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IIN P+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  IINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>pdb|2WSC|4 Chain 4, Improved Model Of Plant Photosystem I
 pdb|2WSE|4 Chain 4, Improved Model Of Plant Photosystem I
 pdb|2WSF|4 Chain 4, Improved Model Of Plant Photosystem I
Length=251

 Score =   293 bits (749),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+F PC  K+RFL GSSGKLNR V+FR    S + SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAIFGPCGLKSRFLGGSSGKLNRGVAFRPVGCSPSASFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT IGI
Sbjct  61   ASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IN PKWY AGK EYFASSSTLFVIEFIL HYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIF  172



>sp|Q9SQL2.1|CB24_PEA RecName: Full=Chlorophyll a-b binding protein P4, chloroplastic; 
AltName: Full=LHCI type III CAB-P4; Flags: Precursor [Pisum 
sativum]
 gb|AAF13731.1| PSI light-harvesting antenna chlorophyll a/b-binding protein 
[Pisum sativum]
Length=252

 Score =   293 bits (749),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 150/172 (87%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAA+F PC  K+RFL GSSGKLNR V+FR    S + SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAIFGPCGLKSRFLGGSSGKLNRGVAFRPVGCSPSASFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT IGI
Sbjct  61   ASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IN PKWY AGK EYFASSSTLFVIEFIL HYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  INVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIF  172



>gb|KFK27969.1| hypothetical protein AALP_AA8G455000 [Arabis alpina]
Length=251

 Score =   292 bits (748),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 155/173 (90%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNV-SFKIEAKKGEWLPG  216
            MATVT Q  AAVFR C S+TRFLTGSSG+LNR++S +   SS+N  SFKIEAKKGEWLPG
Sbjct  1    MATVTVQAPAAVFRSCGSRTRFLTGSSGRLNRDLSVKPIGSSTNTASFKIEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SP YL GSL GDNGFDPL LAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT++G
Sbjct  61   LASPGYLTGSLAGDNGFDPLALAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKLG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +INAP+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  VINAPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>ref|XP_008239927.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic 
[Prunus mume]
Length=256

 Score =   292 bits (747),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 154/175 (88%), Gaps = 4/175 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCA-SKTRFLTGSSG-KLNREVSF-RASTSSSNVSFKIEAKKGEWL  210
            MATVT Q SAAVFRPC  SK+RFL+GSS  KLNREVS  R   S S  SFK+EAKKGEWL
Sbjct  1    MATVTTQASAAVFRPCINSKSRFLSGSSSTKLNREVSIIRPMASPSATSFKVEAKKGEWL  60

Query  211  PGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQ  390
            PGL SP YL GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEVFT 
Sbjct  61   PGLASPGYLTGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVFTN  120

Query  391  IGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IGI+N PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  IGILNVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  175



>ref|XP_010550595.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=252

 Score =   291 bits (746),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 155/173 (90%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFR-ASTSSSNVSFKIEAKKGEWLPG  216
            MATVT Q SAAVF PCASK RF TGSSGKLNR +  + A +S+ + SFK+EAKKGEWLPG
Sbjct  1    MATVTTQASAAVFPPCASKPRFRTGSSGKLNRALLVKPAGSSTKSASFKVEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L +PAYL+GSLPGDNGFDPL LAEDPEN RW+VQAELVNGRWAMLGVAGMLLPEVFT+IG
Sbjct  61   LATPAYLNGSLPGDNGFDPLALAEDPENFRWFVQAELVNGRWAMLGVAGMLLPEVFTKIG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            II+ P+WYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  IISVPEWYDAGKGEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>ref|XP_009388762.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=251

 Score =   291 bits (744),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = +1

Query  43   MATV-TQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATV TQ S A  RPC+S++RF+TGSSGKL RE + R+S SSS  S K+EAKKGEWLPGL
Sbjct  1    MATVATQASVAALRPCSSRSRFMTGSSGKLAREFAARSSPSSSYRSLKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  61   ASPTYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIK PG VNQDPIF
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKYPGSVNQDPIF  172



>gb|EYU24360.1| hypothetical protein MIMGU_mgv1a012416mg [Erythranthe guttata]
Length=251

 Score =   290 bits (743),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 150/171 (88%), Gaps = 2/171 (1%)
 Frame = +1

Query  46   ATVTQPSAAVFRPCASKTRFLTGSS-GKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLP  222
            A  TQ S  VFRPCA+KT+FL GSS GKLNREV  R + S+   SFK+EAKKGEWLPGL 
Sbjct  3    AVTTQASVTVFRPCATKTQFLAGSSFGKLNREVFVRQAASNYK-SFKVEAKKGEWLPGLA  61

Query  223  SPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGII  402
            SP YL GSLPGDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEV T IG+I
Sbjct  62   SPNYLAGSLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSIGLI  121

Query  403  NAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            N PKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  122  NVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  172



>ref|XP_008802578.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Phoenix dactylifera]
Length=247

 Score =   290 bits (741),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 154/174 (89%), Gaps = 9/174 (5%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNV--SFKIEAKKGEWLP  213
            MATVT   S AVFRP ASK RFLTGSSGKL       A T+ SN   SFK+EAKKG+WLP
Sbjct  1    MATVTAHASVAVFRPQASKPRFLTGSSGKLT------AKTARSNTLNSFKVEAKKGQWLP  54

Query  214  GLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQI  393
            GLPSPAYL+GSLPGDNGFDPLGLAEDPENL+WYVQAELVNGRWAMLGVAGMLLPEVFT+I
Sbjct  55   GLPSPAYLNGSLPGDNGFDPLGLAEDPENLKWYVQAELVNGRWAMLGVAGMLLPEVFTKI  114

Query  394  GIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GIIN P+WY+AGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  115  GIINVPEWYEAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  168



>ref|XP_010515052.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Camelina sativa]
Length=253

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 154/174 (89%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCA-SKTRFLTGSSGKLNREVSFRASTSSSNVS-FKIEAKKGEWLP  213
            MATVT   SA++FRPC  SK RFL GSSGKLNR++SF+   SSS  S FK+EAKKGEWLP
Sbjct  1    MATVTTHASASIFRPCTTSKPRFLIGSSGKLNRDLSFKTIGSSSKTSSFKVEAKKGEWLP  60

Query  214  GLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQI  393
            GL SP YL GSL GDNGFDPLGLAEDPENL+W++QAELVNGRWAMLGVAGMLLPEVFT+I
Sbjct  61   GLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFIQAELVNGRWAMLGVAGMLLPEVFTKI  120

Query  394  GIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GIIN P+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  GIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  174



>ref|XP_010426187.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Camelina sativa]
Length=253

 Score =   289 bits (740),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 155/174 (89%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCA-SKTRFLTGSSGKLNREVSFRASTSSSNVS-FKIEAKKGEWLP  213
            MATVT   SA++FRPC  SK RFLTGSSGKLNR++SF++  S S  S FK+EAKKGEWLP
Sbjct  1    MATVTTHASASIFRPCTTSKPRFLTGSSGKLNRDLSFKSIGSPSKTSSFKVEAKKGEWLP  60

Query  214  GLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQI  393
            GL SP YL GSL GDNGFDPLGLAEDPENL+W++QAELVNGRWAMLGVAGMLLPEVFT+I
Sbjct  61   GLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFIQAELVNGRWAMLGVAGMLLPEVFTKI  120

Query  394  GIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GIIN P+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  GIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  174



>ref|XP_010257811.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Nelumbo nucifera]
Length=250

 Score =   287 bits (734),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +1

Query  43   MATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLP  222
            MA VT  ++AVFRPC S++RFLTGSSGKL + +S +  TSSS  SFKIEAKKGEWLPGL 
Sbjct  1    MAMVTTQASAVFRPCTSRSRFLTGSSGKLTKVISVKTPTSSSPSSFKIEAKKGEWLPGLA  60

Query  223  SPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGII  402
            SP+YL+GSLPGDNGFDPLGLAEDP+NL+W+VQAEL NGRWAMLGVAGMLLPE+ T+IGII
Sbjct  61   SPSYLNGSLPGDNGFDPLGLAEDPDNLKWFVQAELQNGRWAMLGVAGMLLPEILTKIGII  120

Query  403  NAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            N P WYDAGK EYFASSSTLFV+EFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  NVPAWYDAGKVEYFASSSTLFVVEFILFHYVEIRRWQDIKNPGSVNQDPIF  171



>ref|XP_009149912.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Brassica 
rapa]
 emb|CDY47410.1| BnaCnng15190D [Brassica napus]
 emb|CDX99044.1| BnaA06g17350D [Brassica napus]
Length=252

 Score =   286 bits (733),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSS--SNVSFKIEAKKGEWLP  213
            MATVT Q SA++FRPC SK RFLTGSSG+LNR++SF++  SS     SFK+EAKKGEWLP
Sbjct  1    MATVTTQASASIFRPCTSKPRFLTGSSGRLNRDLSFKSIGSSSSKTASFKVEAKKGEWLP  60

Query  214  GLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQI  393
            GL SP YL+GSL GDNGFDPLGLAEDPENL+W++QAELVNGRWAMLGVAGMLLPEVFT+I
Sbjct  61   GLASPGYLNGSLAGDNGFDPLGLAEDPENLKWFIQAELVNGRWAMLGVAGMLLPEVFTKI  120

Query  394  GIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GIIN P+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  GIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  174



>ref|XP_009398171.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=252

 Score =   286 bits (731),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = +1

Query  43   MATV-TQPS-AAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MATV TQ S AA+ RPC+ +T FLTGSSGKL+RE++ ++  SS+  S K+EAKKGEWLPG
Sbjct  1    MATVSTQASVAALRRPCSLRTGFLTGSSGKLSRELAAKSLPSSAFRSVKVEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SPAYLDGSL GDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT+IG
Sbjct  61   LASPAYLDGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIG  120

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IINAP+WYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIK PG VNQDPIF
Sbjct  121  IINAPEWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKYPGSVNQDPIF  173



>ref|XP_006291725.1| hypothetical protein CARUB_v10017894mg [Capsella rubella]
 ref|XP_010503346.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Camelina 
sativa]
 gb|EOA24623.1| hypothetical protein CARUB_v10017894mg [Capsella rubella]
Length=253

 Score =   284 bits (726),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 156/174 (90%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCA-SKTRFLTGSSGKLNREVSFRASTSSSNVS-FKIEAKKGEWLP  213
            MATVT   SA++FRPC  SK RFLTGSSGKLNR++SF++  SSS  S FK+EAKKGEWLP
Sbjct  1    MATVTTHASASIFRPCTTSKPRFLTGSSGKLNRDLSFKSIGSSSKTSSFKVEAKKGEWLP  60

Query  214  GLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQI  393
            GL SP YL GSL GDNGFDPLGLAEDPENL+W++QAELVNGRWAMLGVAGMLLPEVFT+I
Sbjct  61   GLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFIQAELVNGRWAMLGVAGMLLPEVFTKI  120

Query  394  GIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GIIN P+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  GIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  174



>gb|KJB08270.1| hypothetical protein B456_001G074300 [Gossypium raimondii]
Length=162

 Score =   280 bits (716),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 147/158 (93%), Gaps = 1/158 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MATVT Q SAAVFRPCASKTRFLTGSSGKLNR+VSF+   S+S  SFK+EAKKGEWLPGL
Sbjct  1    MATVTTQASAAVFRPCASKTRFLTGSSGKLNRDVSFKPVASTSTSSFKVEAKKGEWLPGL  60

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+IGI
Sbjct  61   PSPAYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGI  120

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQ  513
            INAP+WYDAGK+EYFASSSTLFVIEFILFHY + + W 
Sbjct  121  INAPQWYDAGKAEYFASSSTLFVIEFILFHYGDWQCWH  158



>ref|XP_002877563.1| chlorophyll a/b-binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53822.1| chlorophyll a/b-binding protein [Arabidopsis lyrata subsp. lyrata]
Length=252

 Score =   279 bits (714),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 3/174 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCA-SKTRFLTGSSGKLNREVSFRASTSSSNVS-FKIEAKKGEWLP  213
            MATVT   SA++FRPC  SK RFLT SSG+LNR+++F++  SSS  S FK+EAKKGEWLP
Sbjct  1    MATVTTHASASIFRPCTTSKPRFLTSSSGRLNRDLTFKSIGSSSKTSSFKVEAKKGEWLP  60

Query  214  GLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQI  393
            GL SP YL GSL GDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT++
Sbjct  61   GLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKL  120

Query  394  GIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GIIN P+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  121  GIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  174



>ref|XP_010550593.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=278

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 155/199 (78%), Gaps = 28/199 (14%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFR-ASTSSSNVSFKIEAKKGEWLPG  216
            MATVT Q SAAVF PCASK RF TGSSGKLNR +  + A +S+ + SFK+EAKKGEWLPG
Sbjct  1    MATVTTQASAAVFPPCASKPRFRTGSSGKLNRALLVKPAGSSTKSASFKVEAKKGEWLPG  60

Query  217  LPSPAYLDG--------------------------SLPGDNGFDPLGLAEDPENLRWYVQ  318
            L +PAYL+G                          SLPGDNGFDPL LAEDPEN RW+VQ
Sbjct  61   LATPAYLNGRLMIKLSLIIIFFSEGLVRFIKNRLFSLPGDNGFDPLALAEDPENFRWFVQ  120

Query  319  AELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVE  498
            AELVNGRWAMLGVAGMLLPEVFT+IGII+ P+WYDAGK EYFASSSTLFVIEFILFHYVE
Sbjct  121  AELVNGRWAMLGVAGMLLPEVFTKIGIISVPEWYDAGKGEYFASSSTLFVIEFILFHYVE  180

Query  499  IRRWQDIKNPGCVNQDPIF  555
            IRRWQDIKNPG VNQDPIF
Sbjct  181  IRRWQDIKNPGSVNQDPIF  199



>gb|AEZ49173.1| chlorophyll a/b binding protein 4 [Wolffia australiana]
Length=250

 Score =   275 bits (703),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 149/172 (87%), Gaps = 2/172 (1%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MA+VT Q S AV RPC S++RFLTGSS    R VS   S S +  +F++ AKKGEWLPGL
Sbjct  1    MASVTAQTSLAVIRPC-SRSRFLTGSSPAKLRPVSRNPSASRAVPAFRVSAKKGEWLPGL  59

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SP YL+GSLPGDNGFDPLGLAEDPENL+W+VQAEL NGRWAMLGVAGMLLPEVFT+IGI
Sbjct  60   ASPDYLNGSLPGDNGFDPLGLAEDPENLKWFVQAELQNGRWAMLGVAGMLLPEVFTKIGI  119

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  120  INAPQWYDAGKQEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  171



>ref|XP_006827292.1| hypothetical protein AMTR_s00010p00264770 [Amborella trichopoda]
 gb|ERM94529.1| hypothetical protein AMTR_s00010p00264770 [Amborella trichopoda]
Length=252

 Score =   268 bits (686),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 150/174 (86%), Gaps = 4/174 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSS-GKLN-REVSFRASTSSSNVSFKIEAKKGEWLP  213
            MATVT Q S    RP  +K+RFL+GS+  +L  R++S R +++  N SFK+ AKKGEWLP
Sbjct  1    MATVTMQASLGALRPSITKSRFLSGSNPNRLTARDISSRTASAPGN-SFKVVAKKGEWLP  59

Query  214  GLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQI  393
            GL SP YL GSLPGDNGFDPLGLAEDPENL+W++QAELVN RWAMLGVAGM+LPEVFT+I
Sbjct  60   GLASPGYLTGSLPGDNGFDPLGLAEDPENLKWFIQAELVNSRWAMLGVAGMILPEVFTKI  119

Query  394  GIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GIIN P+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  120  GIINVPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>gb|ABV44672.1| photosystem I light-harvesting complex type 4 protein [Bambusa 
oldhamii]
Length=244

 Score =   262 bits (670),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 142/172 (83%), Gaps = 8/172 (5%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MA+VT +   A  RP AS      G S +L R      ++SS+  S ++EAK GEWLPGL
Sbjct  1    MASVTARAPVAALRPSASLKSGFLGHSSRLGR------ASSSTRRSLRVEAK-GEWLPGL  53

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVN RWAMLGVAGMLLPEV T+IGI
Sbjct  54   PSPAYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNARWAMLGVAGMLLPEVLTKIGI  113

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP WYDAGKS YFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  114  INAPLWYDAGKSTYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  165



>gb|AFW62279.1| hypothetical protein ZEAMMB73_290736 [Zea mays]
Length=242

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 143/172 (83%), Gaps = 8/172 (5%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MA+VT +   A  RP +S   FL G S +L R     A+ S +  S K EAK GEWLPGL
Sbjct  1    MASVTARAPVAALRPSSSSA-FL-GHSSRLGRT----ATASPTRRSLKAEAK-GEWLPGL  53

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGML+PEV T+ G+
Sbjct  54   PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLIPEVLTKAGL  113

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  114  INAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  165



>gb|AFW62280.1| hypothetical protein ZEAMMB73_290736 [Zea mays]
Length=224

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 144/172 (84%), Gaps = 8/172 (5%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MA+VT +   A  RP +S + FL G S +L R     A+ S +  S K EAK GEWLPGL
Sbjct  1    MASVTARAPVAALRPSSS-SAFL-GHSSRLGRT----ATASPTRRSLKAEAK-GEWLPGL  53

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGML+PEV T+ G+
Sbjct  54   PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLIPEVLTKAGL  113

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  114  INAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  165



>gb|AFW62278.1| chlorophyll a-b binding protein 4 [Zea mays]
Length=244

 Score =   258 bits (658),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 144/172 (84%), Gaps = 8/172 (5%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MA+VT +   A  RP +S + FL G S +L R     A+ S +  S K EAK GEWLPGL
Sbjct  1    MASVTARAPVAALRPSSS-SAFL-GHSSRLGRT----ATASPTRRSLKAEAK-GEWLPGL  53

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGML+PEV T+ G+
Sbjct  54   PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLIPEVLTKAGL  113

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  114  INAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  165



>gb|EAZ07102.1| hypothetical protein OsI_29351 [Oryza sativa Indica Group]
Length=244

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 145/173 (84%), Gaps = 10/173 (6%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCAS-KTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MA+VT +   A  RP AS K+ FL  SS +L R     A T+  NV  + EAK GEWLPG
Sbjct  1    MASVTARAPVAALRPSASLKSTFLGQSSTRLAR-----APTTRRNV--RAEAK-GEWLPG  52

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            LPSP YL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEV T+IG
Sbjct  53   LPSPTYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVLTKIG  112

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +I+AP+WYDAGK+ YFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  113  LIDAPQWYDAGKATYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  165



>ref|XP_010235157.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Brachypodium distachyon]
Length=244

 Score =   255 bits (652),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 140/172 (81%), Gaps = 8/172 (5%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MA++T +   A  RP AS      G S +L        ++S+S  S ++EAK GEWLPGL
Sbjct  1    MASITARAPVAALRPSASLNSGFLGHSSRLG------LASSTSRRSLRVEAK-GEWLPGL  53

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYLDG LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGML PE+ T+IG+
Sbjct  54   PSPAYLDGKLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLTPELLTKIGL  113

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP+WYDAGKS YFASSSTLFV+EFILFHYVEIRRWQDIK PGCVNQDPIF
Sbjct  114  INAPEWYDAGKSTYFASSSTLFVVEFILFHYVEIRRWQDIKEPGCVNQDPIF  165



>gb|AAR19267.2| chlorophyll a/b binding protein presusor [Oryza sativa Japonica 
Group]
Length=244

 Score =   255 bits (651),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 144/173 (83%), Gaps = 10/173 (6%)
 Frame = +1

Query  43   MATVT--QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MA+VT   P AA+    + K+ FL  SS +L R     A T+  NV  + EAK GEWLPG
Sbjct  1    MASVTARTPVAALRSSASLKSTFLGQSSTRLAR-----APTTRRNV--RAEAK-GEWLPG  52

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            LPSP YL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEV T+IG
Sbjct  53   LPSPTYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVLTKIG  112

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +I+AP+WYDAGK+ YFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  113  LIDAPQWYDAGKATYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  165



>ref|XP_006659431.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Oryza brachyantha]
Length=246

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 145/174 (83%), Gaps = 10/174 (6%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCAS--KTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLP  213
            MA+VT +   A  RP A+  K+ FL   S +L R     ++T+  NV  ++EAK GEWLP
Sbjct  1    MASVTARAPVAALRPSAASLKSSFLGQPSTRLGRA----STTARRNV--RVEAK-GEWLP  53

Query  214  GLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQI  393
            GLPSP YLDGSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEV T+ 
Sbjct  54   GLPSPVYLDGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVLTKA  113

Query  394  GIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GII+AP+WYDAGK+ YFASSSTLFV+EFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  114  GIIDAPQWYDAGKATYFASSSTLFVVEFILFHYVEIRRWQDIKNPGCVNQDPIF  167



>ref|NP_001061884.1| Os08g0435900 [Oryza sativa Japonica Group]
 dbj|BAD10636.1| putative chlorophyll a/b-binding protein precursor [Oryza sativa 
Japonica Group]
 dbj|BAF23798.1| Os08g0435900 [Oryza sativa Japonica Group]
 gb|EAZ42851.1| hypothetical protein OsJ_27444 [Oryza sativa Japonica Group]
 dbj|BAG90554.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96663.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96733.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87372.1| unnamed protein product [Oryza sativa Japonica Group]
Length=244

 Score =   254 bits (649),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 144/173 (83%), Gaps = 10/173 (6%)
 Frame = +1

Query  43   MATVT--QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MA+VT   P AA+    + K+ FL  SS +L R     A T+  NV  + EAK GEWLPG
Sbjct  1    MASVTARTPVAALRSSASLKSTFLGQSSTRLAR-----APTTRRNV--RAEAK-GEWLPG  52

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            LPSP YL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEV T+IG
Sbjct  53   LPSPTYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVLTKIG  112

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +I+AP+WYDAGK+ YFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  113  LIDAPQWYDAGKATYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  165



>ref|XP_004973512.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like 
[Setaria italica]
Length=245

 Score =   254 bits (648),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 142/173 (82%), Gaps = 9/173 (5%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCAS-KTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MA+VT +   A  RP AS ++    G S +L R      + + +  S + EAK GEWLPG
Sbjct  1    MASVTARTPVAALRPSASLRSSAFVGHSSRLGR------AAAPTRRSLRAEAK-GEWLPG  53

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            LPSPAYLDGSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGML+PEV T+ G
Sbjct  54   LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLIPEVLTKAG  113

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +INAP+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  114  LINAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  166



>gb|EAZ07099.1| hypothetical protein OsI_29348 [Oryza sativa Indica Group]
Length=244

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 144/173 (83%), Gaps = 10/173 (6%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCAS-KTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MA+VT +   A  RP AS K+ FL  SS +L R     A T+  NV  + EAK GEWLPG
Sbjct  1    MASVTARAPVAALRPSASLKSTFLGQSSTRLAR-----APTTRRNV--RAEAK-GEWLPG  52

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            LPSP YL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEV T+IG
Sbjct  53   LPSPTYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVLTKIG  112

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +I+AP+WYDAGK+ YFASSSTLFVIEFILFH VEIRRWQDIKNPGCVNQDPIF
Sbjct  113  LIDAPQWYDAGKATYFASSSTLFVIEFILFHSVEIRRWQDIKNPGCVNQDPIF  165



>gb|ACA66262.1| chloroplast chlorophyll a/b binding protein precursor [Phyllostachys 
edulis]
Length=245

 Score =   252 bits (643),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 141/173 (82%), Gaps = 9/173 (5%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MA+VT +   A  RP AS      G S +L R      ++SS+  S ++EAK GEWLPGL
Sbjct  1    MASVTARAPVAALRPSASLKSGFLGHSSRLGR------ASSSTRRSLRVEAK-GEWLPGL  53

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
             SPAYLDGSL GDNGFDPLGLAEDPENLRWYVQAELVN RWAMLGVAG+L+PEV T+IGI
Sbjct  54   ASPAYLDGSLAGDNGFDPLGLAEDPENLRWYVQAELVNARWAMLGVAGVLVPEVLTKIGI  113

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQD-IKNPGCVNQDPIF  555
            INAP+WYDAGKS YFASSSTLFVIEFILFHYVEIRRWQD IKNPGCVNQDPIF
Sbjct  114  INAPQWYDAGKSTYFASSSTLFVIEFILFHYVEIRRWQDIIKNPGCVNQDPIF  166



>gb|AAC67557.1| chlorophyll a/b-binding protein presursor [Oryza sativa Japonica 
Group]
Length=244

 Score =   251 bits (641),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 140/169 (83%), Gaps = 8/169 (5%)
 Frame = +1

Query  49   TVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSP  228
            T   P AA+    + K+ FL  SS +L R     A T+  NV  + EAK GEWLPGLPSP
Sbjct  5    TARTPVAALLSSASLKSTFLGQSSTRLAR-----APTTRRNV--RAEAK-GEWLPGLPSP  56

Query  229  AYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINA  408
             YL+GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEV T+IG+I+A
Sbjct  57   TYLNGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVLTKIGLIDA  116

Query  409  PKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            P+WYDAGK+ YFASS+TLFVIEFILFHYVEIR+WQDIKNPGCVNQDPIF
Sbjct  117  PQWYDAGKATYFASSNTLFVIEFILFHYVEIRQWQDIKNPGCVNQDPIF  165



>gb|ACG30344.1| chlorophyll a-b binding protein 4 [Zea mays]
Length=252

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 141/178 (79%), Gaps = 12/178 (7%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRF------LTGSSGKLNREVSFRASTSSSNVSFKIEAKKG  201
            MA+VT +   A  RP AS            G S +L R     A+ S +  S K EAK G
Sbjct  1    MASVTARAPVAALRPSASLKSSSSSAAAFLGHSSRLGRT----ATASPTRRSLKAEAK-G  55

Query  202  EWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEV  381
            EWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGML+PEV
Sbjct  56   EWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLIPEV  115

Query  382  FTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             T+ G+INAP+WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  116  LTKAGLINAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  173



>emb|CAA78932.1| Lhca4 protein,Type 4 protein of light-harvesting complex of photosystem 
I [Pinus sylvestris]
Length=251

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 142/173 (82%), Gaps = 4/173 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSS-GKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MA+VT Q +  V  P   ++ FLTGSS  +L R V    S  +   SFK+EAK GEWLPG
Sbjct  1    MASVTTQAALGVSCPSVCRSAFLTGSSVSRLARRVR-PGSNPAPARSFKVEAK-GEWLPG  58

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SP+YL+GSLPGDNGFDPLGLAEDPE+L+WYVQAELVNGRWAMLGVAGML+PEV T IG
Sbjct  59   LSSPSYLNGSLPGDNGFDPLGLAEDPESLKWYVQAELVNGRWAMLGVAGMLIPEVLTSIG  118

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +IN PKWYDAGK EYFASSSTLFVIEFILFHYVE+RRWQDIK PG VNQDP+F
Sbjct  119  LINVPKWYDAGKVEYFASSSTLFVIEFILFHYVELRRWQDIKYPGSVNQDPLF  171



>gb|ACF86037.1| unknown [Zea mays]
 gb|ACG28373.1| chlorophyll a-b binding protein 4 [Zea mays]
 tpg|DAA48990.1| TPA: chlorophyll a-b binding protein 4 [Zea mays]
Length=247

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 140/175 (80%), Gaps = 11/175 (6%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRF---LTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWL  210
            MA+VT +   A  RP ++  +      G S +L R      + S +  S K EAK GEWL
Sbjct  1    MASVTARAPVAALRPSSASLKSSSAFLGHSSRLGR------TASPTRRSLKAEAK-GEWL  53

Query  211  PGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQ  390
            PGLPSP+YLDGSL GDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGML+PEV T+
Sbjct  54   PGLPSPSYLDGSLAGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLIPEVLTK  113

Query  391  IGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             G+INAP+WYDAGKSEYFASSSTLFV+EFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  114  AGLINAPQWYDAGKSEYFASSSTLFVVEFILFHYVEIRRWQDIKNPGSVNQDPIF  168



>emb|CCI55399.1| PSI antenna protein Lhca4 [Marchantia polymorpha]
Length=249

 Score =   243 bits (621),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 138/172 (80%), Gaps = 3/172 (2%)
 Frame = +1

Query  43   MATVTQPSAAVFRPCASKTRFLTG-SSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
            MA+V+  + +V      KT FL+G SS + +R V   A+  SS  S K+EAKKGEWLPGL
Sbjct  1    MASVSMQAMSV-SSAVCKTSFLSGTSSTRFSRNVQVAAAPISSQ-SLKVEAKKGEWLPGL  58

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
            PSPAYL+GSL GDNGFDPLGLAEDP  L WYVQAEL NGRWAMLGVAGML+PEV T+IG+
Sbjct  59   PSPAYLNGSLAGDNGFDPLGLAEDPAALNWYVQAELQNGRWAMLGVAGMLVPEVLTKIGL  118

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            INAP WYDAGK EYFA +STLFVIEFILFHYVEIRRWQDIK PG V+QDP F
Sbjct  119  INAPLWYDAGKVEYFAPASTLFVIEFILFHYVEIRRWQDIKYPGSVSQDPFF  170



>emb|CAA78901.1| Lhca4 protein,Type 4 protein of light-harvesting complex of photosystem 
I [Pinus sylvestris]
Length=244

 Score =   242 bits (617),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 134/159 (84%), Gaps = 3/159 (2%)
 Frame = +1

Query  82   PCASKTRFLTGSS-GKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGD  258
            P   ++ FLTGSS  +L R V    S  +   SFK+EAK GEWLPGL SP+YL+GSLPGD
Sbjct  8    PSVCRSGFLTGSSVSRLARRVR-PGSNPAPARSFKVEAK-GEWLPGLSSPSYLNGSLPGD  65

Query  259  NGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSE  438
            NGFDPLGLAEDPE+L+WYVQAELVNGRWAMLGVAGML+PEV T IG+IN PKWYDAGK E
Sbjct  66   NGFDPLGLAEDPESLKWYVQAELVNGRWAMLGVAGMLIPEVLTSIGLINVPKWYDAGKVE  125

Query  439  YFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            YFASSSTLFVIEFILFHYVE+RRWQDIK PG VNQDP+F
Sbjct  126  YFASSSTLFVIEFILFHYVELRRWQDIKYPGSVNQDPLF  164



>ref|XP_002975356.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ23557.1| light-harvesting complex [Selaginella moellendorffii]
Length=248

 Score =   242 bits (617),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 134/170 (79%), Gaps = 4/170 (2%)
 Frame = +1

Query  46   ATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPS  225
            A+  Q S  V  P    + FL+GSS KL R     A+ S +   FK+EAKKGEW PGL S
Sbjct  3    ASTMQASIGVSCP----STFLSGSSSKLQRGSRAVAAPSFATGKFKVEAKKGEWCPGLAS  58

Query  226  PAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIIN  405
            P YL+GSLPGDNGFDPLGLA DP NL+WYVQAEL NGRWAM+GVAGML+PEV T+IG+IN
Sbjct  59   PGYLNGSLPGDNGFDPLGLAGDPANLKWYVQAELQNGRWAMVGVAGMLIPEVLTKIGVIN  118

Query  406  APKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AP WYDAGK EYFA +STLFVIEF++FHYVE+RRWQDIK PG VNQDPIF
Sbjct  119  APLWYDAGKVEYFAPASTLFVIEFLMFHYVEVRRWQDIKYPGSVNQDPIF  168



>ref|NP_001150371.1| LOC100284001 [Zea mays]
 gb|ACG38831.1| chlorophyll a-b binding protein 4 [Zea mays]
Length=247

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 139/175 (79%), Gaps = 11/175 (6%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRF---LTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWL  210
            MA+VT +   A  RP ++  +      G S +L R      + S +  S K EAK GEWL
Sbjct  1    MASVTARAPVAALRPSSASLKSSSAFLGHSSRLGR------TASPTRRSLKAEAK-GEWL  53

Query  211  PGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQ  390
            PGLPSP+YLDGSL GDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGML+PEV T+
Sbjct  54   PGLPSPSYLDGSLAGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLIPEVLTK  113

Query  391  IGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             G+INAP+WYDA KSEYFASSSTLFV+EFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  114  AGLINAPQWYDASKSEYFASSSTLFVVEFILFHYVEIRRWQDIKNPGSVNQDPIF  168



>gb|AGU28447.1| light-harvesting chlorophyll-protein complex I subunit A4, partial 
[Sinapis alba]
Length=206

 Score =   239 bits (610),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  175  SFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLG  354
            SFK+EAKKGE LPGL SP YL+GSL GDNGFDPLGLAEDPENL+W++QAELVNGRWAMLG
Sbjct  2    SFKVEAKKGEGLPGLASPGYLNGSLAGDNGFDPLGLAEDPENLKWFIQAELVNGRWAMLG  61

Query  355  VAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGC  534
            VAGMLLPEVFT+IGIIN P+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPG 
Sbjct  62   VAGMLLPEVFTKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGS  121

Query  535  VNQDPIF  555
            VNQDPIF
Sbjct  122  VNQDPIF  128



>gb|ABK24236.1| unknown [Picea sitchensis]
 gb|ABK25778.1| unknown [Picea sitchensis]
 gb|ACN40523.1| unknown [Picea sitchensis]
Length=251

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 138/173 (80%), Gaps = 4/173 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSS-GKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MA+VT Q +  V      ++ FLTGSS  +L R V    S  +   SFK+EAK GEWLPG
Sbjct  1    MASVTTQATLGVSCRSVCRSGFLTGSSVSRLARRVR-PGSNPAPARSFKVEAK-GEWLPG  58

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SP YL+GSLPGDNGFDPLGLAEDPE+L+WYVQAELVNGRWAMLGVAGML+PEV T  G
Sbjct  59   LSSPTYLNGSLPGDNGFDPLGLAEDPESLKWYVQAELVNGRWAMLGVAGMLIPEVLTSFG  118

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             I+ PKWYDAGK EYFASSSTLFVIEFILFHYVE+RRWQDIK PG VNQDP+F
Sbjct  119  FIDVPKWYDAGKVEYFASSSTLFVIEFILFHYVELRRWQDIKYPGSVNQDPVF  171



>emb|CAC84491.1| putative chlorophyll a/b-binding protein type 4 [Pinus pinaster]
Length=251

 Score =   239 bits (611),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 138/172 (80%), Gaps = 4/172 (2%)
 Frame = +1

Query  43   MATV-TQPSAAVFRPCASKTRFLTGSS-GKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MA+V TQ +  V  P   ++ FLTGSS  +L R V    S  +   SFK+EAK GEWLPG
Sbjct  1    MASVPTQAALGVSCPSVCRSGFLTGSSVSRLARRVR-PGSNPAPARSFKVEAK-GEWLPG  58

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SP+YL+GSLPGDNG DPLGLAEDPE+L+WYVQAELVNGRWAMLGVAGM +PEV T IG
Sbjct  59   LSSPSYLNGSLPGDNGXDPLGLAEDPESLKWYVQAELVNGRWAMLGVAGMXIPEVLTSIG  118

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPI  552
            +IN PKWYDAGK EYFASS TLFVIEFILFHYVE+RRWQDIK PG VNQDPI
Sbjct  119  LINVPKWYDAGKVEYFASSXTLFVIEFILFHYVELRRWQDIKYPGSVNQDPI  170



>gb|ACG35965.1| chlorophyll a-b binding protein 4 [Zea mays]
Length=247

 Score =   239 bits (610),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 139/175 (79%), Gaps = 11/175 (6%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRF---LTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWL  210
            MA+VT +   A  RP ++  +      G S +L R      + S +  S K EAK GEWL
Sbjct  1    MASVTARAPVAALRPSSASLKSSSAFLGHSSRLGR------TASPTRRSXKAEAK-GEWL  53

Query  211  PGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQ  390
            PGLPSP+YLDGSL GDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGML+PEV T+
Sbjct  54   PGLPSPSYLDGSLAGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLIPEVLTK  113

Query  391  IGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             G+INAP+WYDAGKSEYFASSSTLFV+EFILF YVEIRRWQDIKNPG VNQDPIF
Sbjct  114  AGLINAPQWYDAGKSEYFASSSTLFVVEFILFXYVEIRRWQDIKNPGSVNQDPIF  168



>gb|EPS72553.1| chlorophyll a /b binding protein, partial [Genlisea aurea]
Length=208

 Score =   238 bits (606),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  178  FKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV  357
            FK+EAKKGEWLPGL SP YL+G LPGDNGFDPLGL EDPENL+W+VQAEL NGRWAMLGV
Sbjct  3    FKVEAKKGEWLPGLASPGYLNGRLPGDNGFDPLGLGEDPENLKWFVQAELQNGRWAMLGV  62

Query  358  AGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCV  537
            AGMLLPEV T  G+IN PKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG V
Sbjct  63   AGMLLPEVLTSAGLINVPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSV  122

Query  538  NQDPIF  555
            NQDPIF
Sbjct  123  NQDPIF  128



>ref|XP_002964438.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ34771.1| light-harvesting complex [Selaginella moellendorffii]
Length=248

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 133/170 (78%), Gaps = 4/170 (2%)
 Frame = +1

Query  46   ATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPS  225
            A+  Q S  V  P    + FL+ SS KL R     A+ S +   FK+EAKKGEW PGL S
Sbjct  3    ASTMQASIGVSCP----STFLSRSSSKLQRGSRAVAAPSFATGKFKVEAKKGEWCPGLAS  58

Query  226  PAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIIN  405
            P YL+GSLPGDNGFDPLGLA DP NL+WYVQAEL NGRWAM+GVAGML+PEV T+IG+IN
Sbjct  59   PGYLNGSLPGDNGFDPLGLAGDPANLKWYVQAELQNGRWAMVGVAGMLIPEVLTKIGVIN  118

Query  406  APKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AP WYDAGK EYFA +STLFVIEF++FHYVE+RRWQDIK PG VNQDPIF
Sbjct  119  APLWYDAGKVEYFAPASTLFVIEFLMFHYVEVRRWQDIKYPGSVNQDPIF  168



>gb|ACN40598.1| unknown [Picea sitchensis]
Length=251

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 138/173 (80%), Gaps = 4/173 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSS-GKLNREVSFRASTSSSNVSFKIEAKKGEWLPG  216
            MA+VT Q +  V      ++ FLTGSS  +L R V    S  +   SFK+EAK GEWLPG
Sbjct  1    MASVTTQATLGVSCRSVCRSGFLTGSSVSRLARRVR-PGSNPAPARSFKVEAK-GEWLPG  58

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SP YL+GSLPGDNGFDPLGLAEDP++L+WYVQAELVNGRWAMLGVAGML+PEV T  G
Sbjct  59   LSSPTYLNGSLPGDNGFDPLGLAEDPDSLKWYVQAELVNGRWAMLGVAGMLIPEVLTSFG  118

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             I+ PKWYDAGK EYFASSSTLFVIEFILFHYVE+RRWQDIK PG VNQDP+F
Sbjct  119  FIDVPKWYDAGKVEYFASSSTLFVIEFILFHYVELRRWQDIKYPGSVNQDPVF  171



>pdb|4RKU|4 Chain 4, Crystal Structure Of Plant Photosystem I At 3 Angstrom 
Resolution
Length=196

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  196  KGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLP  375
            KGEWLPGL SP YL GSLPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLP
Sbjct  1    KGEWLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLP  60

Query  376  EVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            EVFT IGIIN PKWYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  61   EVFTSIGIINVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  120



>gb|EMS64136.1| Chlorophyll a-b binding protein 1B-20, chloroplastic [Triticum 
urartu]
Length=245

 Score =   236 bits (601),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 132/164 (80%), Gaps = 11/164 (7%)
 Frame = +1

Query  70   AVFRPCASKT--RFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDG  243
            A  RP AS +  RFL G SG++    S R   +       ++AK G WLPGLPSPAYLDG
Sbjct  11   AALRPAASASSPRFL-GDSGRVGLAKSTRRDVA-------VQAK-GSWLPGLPSPAYLDG  61

Query  244  SLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYD  423
            SL GDNGFDPL LAEDPE+LRW+VQAELVNGRWAMLGVAGML+PEV T+ G++NAP+WYD
Sbjct  62   SLAGDNGFDPLALAEDPEDLRWFVQAELVNGRWAMLGVAGMLIPEVLTKAGLLNAPEWYD  121

Query  424  AGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AGK  YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  122  AGKETYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  165



>dbj|BAJ89800.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85392.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=245

 Score =   233 bits (593),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 131/164 (80%), Gaps = 11/164 (7%)
 Frame = +1

Query  70   AVFRPCASKT--RFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDG  243
            A  RP AS +  RFL G SG++    S R   +       ++AK G WLPGL SPAYLDG
Sbjct  11   AALRPAASASSPRFL-GDSGRVGLAKSTRRDVA-------VQAK-GSWLPGLQSPAYLDG  61

Query  244  SLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYD  423
            SL GDNGFDPL LAEDPE+LRW+VQAELVNGRWAMLGVAGML+PEV T+ G++NAP+WYD
Sbjct  62   SLAGDNGFDPLALAEDPEDLRWFVQAELVNGRWAMLGVAGMLIPEVLTKAGLLNAPEWYD  121

Query  424  AGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AGK  YFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  122  AGKETYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  165



>gb|AAF90200.1|AF287276_2 chlorophyll a/b-binding protein precursor [Hordeum vulgare]
Length=228

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 127/157 (81%), Gaps = 9/157 (6%)
 Frame = +1

Query  85   CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNG  264
             AS  RFL G SG++    S R   +       ++AK G WLPGL SPAYLDGSL GDNG
Sbjct  1    SASSPRFL-GDSGRVGLAKSTRRDVA-------VQAK-GSWLPGLQSPAYLDGSLAGDNG  51

Query  265  FDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYF  444
            FDPL LAEDPE+LRW+VQAELVNGRWAMLGVAGML+PEV T+ G++NAP+WYDAGK  YF
Sbjct  52   FDPLALAEDPEDLRWFVQAELVNGRWAMLGVAGMLIPEVLTKAGLLNAPEWYDAGKETYF  111

Query  445  ASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            ASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  112  ASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  148



>ref|XP_003578105.1| PREDICTED: chlorophyll a-b binding protein 1B-20, chloroplastic-like 
[Brachypodium distachyon]
Length=246

 Score =   228 bits (580),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 131/164 (80%), Gaps = 9/164 (5%)
 Frame = +1

Query  70   AVFRPCASKT--RFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDG  243
            A  RP AS    RFL G SG   R++    S +  +V+ +    KG+WLPGL SPAYLDG
Sbjct  11   AALRPSASSPSPRFL-GDSG---RQLGLAKSLARRDVAVQ---AKGQWLPGLASPAYLDG  63

Query  244  SLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYD  423
            SL GDNGFDPL LAEDP +LRW+VQAELVNGRWAMLGVAGML+PE+ T+ G+++AP+WYD
Sbjct  64   SLAGDNGFDPLALAEDPADLRWFVQAELVNGRWAMLGVAGMLIPELLTKAGLLSAPEWYD  123

Query  424  AGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AGK  YFASSSTLFV+EFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  124  AGKETYFASSSTLFVVEFILFHYVEIRRWQDIKNPGSVNQDPIF  167



>emb|CAA57877.1| light-harvesting chlorophyll a /b binding protein [Nicotiana 
tabacum]
Length=200

 Score =   226 bits (576),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/121 (88%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = +1

Query  193  KKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLL  372
            KKG+WLPGL SP YLDGSLPGD GF PLGLAEDPENL+W+VQAELVN RWAMLGVAGMLL
Sbjct  1    KKGQWLPGLASPTYLDGSLPGDXGFAPLGLAEDPENLKWFVQAELVNVRWAMLGVAGMLL  60

Query  373  PEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPI  552
            PEVFT IGI+N PKWYDAGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQ PI
Sbjct  61   PEVFTNIGILNVPKWYDAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQXPI  120

Query  553  F  555
            F
Sbjct  121  F  121



>gb|EMT16884.1| hypothetical protein F775_43922 [Aegilops tauschii]
Length=329

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 126/152 (83%), Gaps = 9/152 (6%)
 Frame = +1

Query  100  RFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLG  279
            RFL G SG++    S R   +       ++AK G WLPGLPSPAYLDGSL GDNGFDPL 
Sbjct  23   RFL-GDSGRVGLAKSTRRDVA-------VQAK-GSWLPGLPSPAYLDGSLAGDNGFDPLA  73

Query  280  LAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSST  459
            LAEDPE+LRW+VQAELVNGRWAMLGVAGML+PEV T+ G++NAP+WYDAGK  YFASSST
Sbjct  74   LAEDPEDLRWFVQAELVNGRWAMLGVAGMLIPEVLTKAGLLNAPEWYDAGKETYFASSST  133

Query  460  LFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            LFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  134  LFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  165



>gb|ACO87363.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
formosana]
Length=148

 Score =   221 bits (564),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/111 (94%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  223  SPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGII  402
            SP YL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGII
Sbjct  1    SPNYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTTIGII  60

Query  403  NAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            N PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   NVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  111



>gb|ACO87356.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87357.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87358.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87359.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87360.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87361.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
formosana]
 gb|ACO87362.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
formosana]
 gb|ACO87364.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
formosana]
 gb|ACO87365.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
formosana]
 gb|ACO87366.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACO87367.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACO87369.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACO87370.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACO87371.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACO87372.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACO87373.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACO87374.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACO87376.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
formosana]
 gb|ACO87377.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
formosana]
 gb|ACO87378.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
formosana]
 gb|ACO87379.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
formosana]
 gb|ACO87380.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87381.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87382.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87383.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87384.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87385.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87386.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87387.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87388.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
chinensis]
 gb|ACO87389.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
acalycina]
 gb|ACO87390.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
acalycina]
 gb|ACO87391.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
acalycina]
 gb|ACO87392.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
acalycina]
 gb|ACO87393.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
acalycina]
Length=148

 Score =   221 bits (564),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/111 (94%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  223  SPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGII  402
            SP YL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGII
Sbjct  1    SPNYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGII  60

Query  403  NAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            N PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   NVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  111



>gb|ACO87375.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=148

 Score =   219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/111 (93%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  223  SPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGII  402
            SP YL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGII
Sbjct  1    SPNYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGII  60

Query  403  NAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            N PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPI 
Sbjct  61   NVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIL  111



>gb|ACO87368.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=148

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/111 (93%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  223  SPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGII  402
            SP YL+GSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGII
Sbjct  1    SPNYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGII  60

Query  403  NAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            N PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQ PIF
Sbjct  61   NVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQGPIF  111



>ref|WP_039310946.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 gb|KHL91182.1| hypothetical protein QW71_36155 [Paenibacillus sp. IHB B 3415]
Length=193

 Score =   218 bits (556),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            +PSP YL+GSLPGDNGFDPLGLAEDPENL+WY+QAELVN RWAMLGV GMLLPEVF+ IG
Sbjct  1    MPSPDYLNGSLPGDNGFDPLGLAEDPENLKWYIQAELVNSRWAMLGVTGMLLPEVFSTIG  60

Query  397  IINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            IIN PKWYDAGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  61   IINVPKWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  113



>gb|KJB08274.1| hypothetical protein B456_001G074300 [Gossypium raimondii]
Length=192

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/104 (97%), Positives = 104/104 (100%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  SLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYD  423
            SLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+IGIINAP+WYD
Sbjct  9    SLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGIINAPQWYD  68

Query  424  AGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AGK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  69   AGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  112



>ref|XP_006394395.1| hypothetical protein EUTSA_v10005046mg [Eutrema salsugineum]
 gb|ESQ31681.1| hypothetical protein EUTSA_v10005046mg [Eutrema salsugineum]
Length=162

 Score =   211 bits (537),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 114/129 (88%), Gaps = 2/129 (2%)
 Frame = +1

Query  43   MATVT-QPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNV-SFKIEAKKGEWLPG  216
            MATVT Q  AAVFRPCAS+ RFLTGSSG+LNR++S +   SS+N  SFKIEAKKGEWLPG
Sbjct  1    MATVTTQAPAAVFRPCASRMRFLTGSSGRLNRDLSVKPIGSSTNTASFKIEAKKGEWLPG  60

Query  217  LPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIG  396
            L SP YL GSL GDNGFDPL LAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT+IG
Sbjct  61   LASPGYLTGSLAGDNGFDPLALAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIG  120

Query  397  IINAPKWYD  423
            IINAP+WYD
Sbjct  121  IINAPEWYD  129



>gb|ACI25416.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   210 bits (534),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25388.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
styraciflua]
 gb|ACI25390.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
styraciflua]
 gb|ACI25391.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
styraciflua]
 gb|ACI25392.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
styraciflua]
 gb|ACI25393.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
styraciflua]
Length=138

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEVFT IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVFTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK EYFASS+TLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKVEYFASSTTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|KJB08272.1| hypothetical protein B456_001G074300 [Gossypium raimondii]
Length=183

 Score =   211 bits (537),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            + GDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFT+IGIINAP+WYDA
Sbjct  1    MAGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGIINAPQWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25414.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25385.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
obovata]
 gb|ACI25386.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
formosana]
 gb|ACI25387.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
formosana]
 gb|ACI25394.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
obovata]
 gb|ACI25395.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
obovata]
 gb|ACI25396.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
obovata]
 gb|ACI25397.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
obovata]
 gb|ACI25398.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
obovata]
 gb|ACI25399.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
obovata]
 gb|ACI25400.1| chloroplast chlorophyll a-b binding protein 4, partial [Altingia 
obovata]
 gb|ACI25402.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACI25404.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACI25405.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACI25409.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACI25411.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACI25412.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACI25415.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACI25417.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACI25419.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACI25422.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACI25423.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
 gb|ACI25426.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25407.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   209 bits (532),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEF+LFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFVLFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25424.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   208 bits (530),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTGIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25389.1| chloroplast chlorophyll a-b binding protein 4, partial [Liquidambar 
styraciflua]
Length=138

 Score =   208 bits (530),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/103 (95%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKVEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25410.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   208 bits (530),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN P+WYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGIINVPRWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25406.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   208 bits (529),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPE  T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEALTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25420.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   208 bits (529),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQA+LVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAKLVNGRWAMLGVVGMLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25401.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   208 bits (529),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+E+FASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEHFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25418.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   208 bits (529),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEF LFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFTLFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25413.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   207 bits (528),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV G+LLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGVLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25421.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   207 bits (528),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV G LLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGTLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|ACI25403.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   207 bits (527),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIE ILFHYVE+RRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIELILFHYVEVRRWQDIKNPGCVNQDPIF  103



>gb|ACI25408.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   207 bits (526),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EY ASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYSASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|KEH33314.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=192

 Score =   208 bits (530),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/104 (94%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  244  SLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYD  423
            SLPGDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEVFT IGIIN PKWYD
Sbjct  8    SLPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTNIGIINVPKWYD  67

Query  424  AGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AGK EYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  68   AGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  111



>gb|ACI25425.1| chloroplast chlorophyll a-b binding protein 4, partial [Semiliquidambar 
cathayensis]
Length=138

 Score =   206 bits (525),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDP NLRWYVQAELVNGRWAMLGV GMLLPEV T IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPGNLRWYVQAELVNGRWAMLGVVGMLLPEVLTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GK+EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF
Sbjct  61   GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  103



>gb|EYU24361.1| hypothetical protein MIMGU_mgv1a012416mg [Erythranthe guttata]
Length=186

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENL+W+VQAELVNGRWAMLGVAGMLLPEV T IG+IN PKWYDA
Sbjct  5    LPGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVLTSIGLINVPKWYDA  64

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPG VNQDPIF
Sbjct  65   GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIF  107



>ref|WP_033581582.1| hypothetical protein, partial [Dickeya zeae]
Length=94

 Score =   190 bits (483),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +1

Query  247  LPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDA  426
            LPGDNGFDPLGLAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT IGIIN PKWYDA
Sbjct  1    LPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYDA  60

Query  427  GKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNP  528
            GK EYFASSSTLFVIEFILFHYVEIRRWQDIKNP
Sbjct  61   GKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNP  94



>sp|Q36718.1|CB120_HORVU RecName: Full=Chlorophyll a-b binding protein 1B-20, chloroplastic; 
AltName: Full=LHCI type I CAB-1B-20; AltName: Full=Light-harvesting 
complex I 20 kDa protein; Flags: Precursor, partial 
[Hordeum vulgare]
 gb|AAB29486.1| light-harvesting complex I, partial (chloroplast) [Hordeum vulgare]
Length=231

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = +1

Query  154  STSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVN  333
            S  S+     ++AK G WLPGL SPAYLDGSL GDNGFDPL LAEDPE+LRW+VQA++VN
Sbjct  20   SPRSTRRDVAVQAK-GSWLPGLQSPAYLDGSLEGDNGFDPLALAEDPEDLRWFVQADVVN  78

Query  334  GRWAMLGVAGMLLPEVFTQIGIINAPKWYD-AGKSEYFASSSTLFVIEFILFHYVEIRRW  510
            GRWAMLGVAGML+PEV T+ G++NAP+W    GK  YFASSST   +  +   YVEIRRW
Sbjct  79   GRWAMLGVAGMLIPEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVH-MSSTYVEIRRW  137

Query  511  QDIKNPGCVNQDPIF  555
            QDIKNPG VNQDPIF
Sbjct  138  QDIKNPGSVNQDPIF  152



>pdb|3LW5|4 Chain 4, Improved Model Of Plant Photosystem I
Length=166

 Score =   179 bits (453),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/92 (92%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  280  LAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSST  459
            LAEDPENLRW+VQAELVNGRWAMLGVAGMLLPEVFT IGIIN PKWY AGK EYFASSST
Sbjct  1    LAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSST  60

Query  460  LFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            LFVIEFIL HYVEIRRWQDIKNPG VNQDPIF
Sbjct  61   LFVIEFILSHYVEIRRWQDIKNPGSVNQDPIF  92



>ref|NP_001060090.1| Os07g0577600 [Oryza sativa Japonica Group]
 dbj|BAC83072.1| putative photosystem I antenna protein [Oryza sativa Japonica 
Group]
 dbj|BAF22004.1| Os07g0577600 [Oryza sativa Japonica Group]
 gb|EAZ04452.1| hypothetical protein OsI_26600 [Oryza sativa Indica Group]
 gb|EAZ40410.1| hypothetical protein OsJ_24861 [Oryza sativa Japonica Group]
 dbj|BAG96345.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96438.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96478.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87660.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96569.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96828.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96864.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=263

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 111/167 (66%), Gaps = 3/167 (2%)
 Frame = +1

Query  64   SAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE---WLPGLPSPAY  234
            +A    P A++     G +G+  R +  +A +SS+  SF + A   +   W PG   P +
Sbjct  11   TAVAALPGAARASSFLGGAGRSGRLLLRQAESSSARASFAVRAAAPDRPIWFPGSTPPPW  70

Query  235  LDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPK  414
            LDGSLPGD GFDPLGL  DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P 
Sbjct  71   LDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPS  130

Query  415  WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            WY AG+ +YF  ++TLF+IE IL  + E RRW DI  PGCVN DPIF
Sbjct  131  WYTAGEQQYFTDTTTLFIIELILIGWAEGRRWADIIKPGCVNTDPIF  177



>ref|XP_002514914.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47468.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=270

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 103/156 (66%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL+G    + +  S   ++ S  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   ATKASFLSGKRLTVRKHTSPVVASRSVTVCAVADPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WYDAGK EYF 
Sbjct  89   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYDAGKLEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF+IE I   + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFIIELIFIGWAEGRRWADILKPGCVNTDPIF  184



>ref|XP_004510609.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=268

 Score =   179 bits (454),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 103/153 (67%), Gaps = 0/153 (0%)
 Frame = +1

Query  97   TRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPL  276
            T+   G   K+N   S R  ++++      E  +  W PG   PA+LDGSLPGD GFDPL
Sbjct  30   TKAFLGRKLKVNNNTSVRVRSAATTKCAVAEPDRPIWFPGSTPPAWLDGSLPGDFGFDPL  89

Query  277  GLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSS  456
            GL  DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF  ++
Sbjct  90   GLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTT  149

Query  457  TLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            TLF+IE +   + E RRW DI NPGCVN DPIF
Sbjct  150  TLFIIELLFIGWAEGRRWADIINPGCVNTDPIF  182



>ref|XP_004510608.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=273

 Score =   179 bits (453),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 103/153 (67%), Gaps = 0/153 (0%)
 Frame = +1

Query  97   TRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPL  276
            T+   G   K+N   S R  ++++      E  +  W PG   PA+LDGSLPGD GFDPL
Sbjct  30   TKAFLGRKLKVNNNTSVRVRSAATTKCAVAEPDRPIWFPGSTPPAWLDGSLPGDFGFDPL  89

Query  277  GLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSS  456
            GL  DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF  ++
Sbjct  90   GLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTT  149

Query  457  TLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            TLF+IE +   + E RRW DI NPGCVN DPIF
Sbjct  150  TLFIIELLFIGWAEGRRWADIINPGCVNTDPIF  182



>gb|KDP26804.1| hypothetical protein JCGZ_17962 [Jatropha curcas]
Length=270

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 102/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL+G   +L    S    + S  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   ATKASFLSGKKLRLRSNTSSPVVSRSVTVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WYDAGK EYF 
Sbjct  89   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYDAGKLEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF+IE IL  + E RRW DI  PG VN DPIF
Sbjct  149  DTTTLFIIELILIGWAEGRRWADILKPGSVNTDPIF  184



>ref|XP_006352516.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Solanum tuberosum]
Length=270

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 107/156 (69%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL G   ++++  +  A+ S++ V    E  +  W PG   P +LDGSLPGD GF
Sbjct  29   ATKASFLGGRRLRVSKYSTTPAARSATTVCVAAEPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE+LRW  QAE+V+ RWAMLG AG+ +PE+ T+IGI+N P WY AG+ EYF 
Sbjct  89   DPLGLGSDPESLRWNQQAEIVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E +L  + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIF  184



>ref|XP_003548018.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform 1 [Glycine max]
 gb|ACU23352.1| unknown [Glycine max]
Length=270

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 105/156 (67%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            ++K  FL+G   K+N   +   + SS+ V    E  +  W PG   P +LDGSLPGD GF
Sbjct  29   STKASFLSGRKLKVNNFTAPVGARSSTTVCAVAEPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGLA DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  89   DPLGLASDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E     + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFIVELFFIGWAEGRRWADIIKPGCVNTDPIF  184



>gb|AAB65793.1| photosystem I antenna protein [Oryza sativa Indica Group]
Length=265

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 111/168 (66%), Gaps = 4/168 (2%)
 Frame = +1

Query  64   SAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE---WLPGLPSPAY  234
            +A    P A +     G +G+  R +  +A +SS+  SF + A   +   W PG   P +
Sbjct  12   TAVAALPGAPRASSFLGGAGRSGRLLLRQAESSSARASFAVRAAAPDRPIWFPGSTPPPW  71

Query  235  LDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPK  414
            LDGSLPGD GFDPLGL  DPE+LRW VQA+LV+ RWAMLG AG+ +PE  T+IGI+N P 
Sbjct  72   LDGSLPGDFGFDPLGLGSDPESLRWNVQADLVHCRWAMLGAAGIFIPEFLTKIGILNTPS  131

Query  415  WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQD-IKNPGCVNQDPIF  555
            WY AG+ +YF  ++TLF+IE IL  + E RRW D I NPGCVN DPIF
Sbjct  132  WYTAGEHQYFTDTTTLFIIELILIGWAEGRRWADIIINPGCVNTDPIF  179



>ref|XP_010669087.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=270

 Score =   177 bits (448),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 107/159 (67%), Gaps = 6/159 (4%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE---WLPGLPSPAYLDGSLPGD  258
            A+K  FL    GK  R+  ++A T+S ++S    A + E   W PG   P +LDGSLPGD
Sbjct  29   ATKASFL---GGKKLRDTKYKAPTASKSLSVSAAAAEPERPIWFPGSTPPPWLDGSLPGD  85

Query  259  NGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSE  438
             GFDPLG   DPE L+W VQ+ELV+ RWAMLG AG+ +PE  T++GI+N P WY AG+ E
Sbjct  86   FGFDPLGFGSDPETLKWMVQSELVHCRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGELE  145

Query  439  YFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            YF  ++TLF+IE IL  + E RRW DI  PGCVN DPIF
Sbjct  146  YFTDTTTLFIIEMILIGWAEGRRWADILKPGCVNTDPIF  184



>ref|XP_004248339.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Solanum 
lycopersicum]
 sp|P10708.1|CB12_SOLLC RecName: Full=Chlorophyll a-b binding protein 7, chloroplastic; 
AltName: Full=LHCI type II CAB-7; Flags: Precursor [Solanum 
lycopersicum]
 emb|CAA32197.1| chlorophyll a/b-binding protein [Solanum lycopersicum]
 gb|AAA34159.1| chlorophyll a/b-binding protein [Solanum lycopersicum]
 prf||1601518A chlorophyll a/b binding protein II
Length=270

 Score =   176 bits (447),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = +1

Query  91   SKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFD  270
            +K  FL G   ++++  +   + S++ V    +  +  W PG   P +LDGSLPGD GFD
Sbjct  30   TKASFLGGRRLRVSKYSTTPTARSATTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFD  89

Query  271  PLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFAS  450
            PLGLA DPE+LRW  QAELV+ RWAMLG AG+ +PE+ T+IGI+N P WY AG+ EYF  
Sbjct  90   PLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTD  149

Query  451  SSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            ++TLF++E +L  + E RRW DI  PGCVN DPIF
Sbjct  150  TTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIF  184



>ref|XP_003528751.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform 1 [Glycine max]
 gb|KHN01491.1| Chlorophyll a-b binding protein 7, chloroplastic [Glycine soja]
Length=270

 Score =   176 bits (446),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 104/156 (67%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            ++K  FL+G   K+N   +   + SS+ V    E  +  W PG   P +LDGSLPGD GF
Sbjct  29   STKASFLSGRKLKVNSFTAPVGARSSTTVCAVAEPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  89   DPLGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLFV+E     + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFVVELFFIGWAEGRRWADIIKPGCVNTDPIF  184



>ref|XP_009787153.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009773771.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana 
sylvestris]
Length=270

 Score =   176 bits (445),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL G   ++++ V+   S S +  +   +  +  W PG   P +LDGSLPGD GF
Sbjct  29   ATKASFLGGKRLRVSKHVAPAGSRSVAVSAVAADPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGLA DPE+L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  89   DPLGLASDPESLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLFVIE +L  + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIF  184



>gb|AFK45885.1| unknown [Lotus japonicus]
Length=269

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 108/172 (63%), Gaps = 0/172 (0%)
 Frame = +1

Query  40   NMATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGL  219
             +A  T  S     P  +   FL+G   K+N   +   + S++ V    E  +  W PG 
Sbjct  12   TLAISTPSSQKNGSPLGTTKAFLSGRKLKVNTFTAPVGARSTTTVCAAAEPDRPLWFPGS  71

Query  220  PSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGI  399
              P +LDGSLPGD GFDPLGL+ DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IGI
Sbjct  72   TPPPWLDGSLPGDFGFDPLGLSSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGI  131

Query  400  INAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +N P WY AG+ EYF  ++TLF++E I   + E RRW DI  PG VN DPIF
Sbjct  132  LNTPSWYTAGEQEYFTDTTTLFIVELIFIGWAEGRRWADILKPGSVNTDPIF  183



>ref|XP_009587026.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nicotiana 
tomentosiformis]
Length=269

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL G   ++++ V+   S S +  +   +  +  W PG   P +LDGSLPGD GF
Sbjct  29   ATKASFLGGKRLRVSKYVAPAGSRSVAVSAVAADPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGLA DPE+L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  89   DPLGLASDPESLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLFVIE +L  + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIF  184



>pdb|2O01|4 Chain 4, The Structure Of A Plant Photosystem I Supercomplex 
At 3.4 Angstrom Resolution
Length=165

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +1

Query  292  PENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVI  471
            PENLRW+VQAELVNGRWAMLGVAGMLLPEVFT IGIIN PKWY AGK EYFASSSTLFVI
Sbjct  1    PENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVI  60

Query  472  EFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            EFIL HYVEIRRWQDIKNPG VNQDPIF
Sbjct  61   EFILSHYVEIRRWQDIKNPGSVNQDPIF  88



>ref|XP_002299309.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa]
 gb|EEE84114.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa]
Length=272

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 106/164 (65%), Gaps = 8/164 (5%)
 Frame = +1

Query  88   ASKTRFLTGS------SGKLNREVSFRASTSSSNVSFKIEAKKGE--WLPGLPSPAYLDG  243
            + KT FL GS      SGK  R   + A T++ +V+  + A      W PG   P +LDG
Sbjct  23   SQKTGFLVGSTKASFLSGKKLRLKKYTAPTAARSVTVCVAADPDRPLWFPGSTPPPWLDG  82

Query  244  SLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYD  423
            SLPGD GFDPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY 
Sbjct  83   SLPGDFGFDPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYT  142

Query  424  AGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AG+ EYF  ++TLF++E     + E RRW DI  PGCVN DPIF
Sbjct  143  AGELEYFTDTTTLFIVELFFIGWAEGRRWADILKPGCVNTDPIF  186



>gb|ABK95596.1| unknown [Populus trichocarpa]
Length=269

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 105/162 (65%), Gaps = 8/162 (5%)
 Frame = +1

Query  94   KTRFLTGS------SGKLNREVSFRASTSSSNVSFKIEAKKGE--WLPGLPSPAYLDGSL  249
            KT FL GS      SGK  R   + A T++ +V+  + A      W PG   P +LDGSL
Sbjct  22   KTGFLVGSTKASFLSGKKLRLKKYTAPTAARSVTVCVAADPDRPLWFPGSTPPPWLDGSL  81

Query  250  PGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAG  429
            PGD GFDPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG
Sbjct  82   PGDFGFDPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAG  141

Query  430  KSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            + EYF  ++TLF++E     + E RRW DI  PGCVN DPIF
Sbjct  142  ELEYFTDTTTLFIVELFFIGWAEGRRWADILKPGCVNTDPIF  183



>gb|KDO81901.1| hypothetical protein CISIN_1g024422mg [Citrus sinensis]
 gb|KDO81902.1| hypothetical protein CISIN_1g024422mg [Citrus sinensis]
Length=265

 Score =   173 bits (439),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 103/156 (66%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL G   KL +  +   + S S  +   +  +  W PG   P +LDGSLPGD GF
Sbjct  27   ATKASFLGGKKLKLRKNGATAGTRSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGF  86

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQ+E+V+ RWAMLG AG+ +PE+ T++GI+N P WY AG+ EYF 
Sbjct  87   DPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFT  146

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  147  DTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIF  182



>ref|XP_006484100.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Citrus sinensis]
 gb|KDO81900.1| hypothetical protein CISIN_1g024422mg [Citrus sinensis]
Length=268

 Score =   173 bits (439),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 103/156 (66%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL G   KL +  +   + S S  +   +  +  W PG   P +LDGSLPGD GF
Sbjct  27   ATKASFLGGKKLKLRKNGATAGTRSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGF  86

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQ+E+V+ RWAMLG AG+ +PE+ T++GI+N P WY AG+ EYF 
Sbjct  87   DPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFT  146

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  147  DTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIF  182



>gb|KJB15537.1| hypothetical protein B456_002G183400 [Gossypium raimondii]
Length=270

 Score =   173 bits (439),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
             +K  FLTG   +  R+ +  A+  +  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   TTKASFLTGKKLRSVRKYTKPAAGPTFPVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG  EYF 
Sbjct  89   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGTEEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  184



>gb|KJB15539.1| hypothetical protein B456_002G183400 [Gossypium raimondii]
Length=274

 Score =   173 bits (439),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
             +K  FLTG   +  R+ +  A+  +  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   TTKASFLTGKKLRSVRKYTKPAAGPTFPVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG  EYF 
Sbjct  89   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGTEEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  184



>gb|KJB15538.1| hypothetical protein B456_002G183400 [Gossypium raimondii]
Length=269

 Score =   173 bits (439),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
             +K  FLTG   +  R+ +  A+  +  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  28   TTKASFLTGKKLRSVRKYTKPAAGPTFPVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGF  87

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG  EYF 
Sbjct  88   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGTEEYFT  147

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  148  DTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  183



>emb|CAA57492.1| Type II chlorophyll a/b binding protein from photosystem I [Pisum 
sativum]
Length=269

 Score =   173 bits (439),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 108/166 (65%), Gaps = 8/166 (5%)
 Frame = +1

Query  82   PCASKTRFLTGSSGK-LNREVSFRAST-------SSSNVSFKIEAKKGEWLPGLPSPAYL  237
            P + K    +G+S   L R++   +ST       S+S V    E  +  W PG   P +L
Sbjct  18   PSSQKNGSPSGTSKAFLGRKLKVNSSTASPSRVRSTSTVCTVAEPDRPLWFPGSTPPPWL  77

Query  238  DGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKW  417
            DGSLPGD GFDPLGL  DPE+LRW VQAELV+ RWAMLG AG+ +PE  T++GI+N P W
Sbjct  78   DGSLPGDFGFDPLGLGSDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSW  137

Query  418  YDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            Y AG+ EYF  ++TLF++E +   + E RRW DI NPGCVN DPIF
Sbjct  138  YTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIF  183



>pdb|2WSC|2 Chain 2, Improved Model Of Plant Photosystem I
 pdb|2WSE|2 Chain 2, Improved Model Of Plant Photosystem I
 pdb|2WSF|2 Chain 2, Improved Model Of Plant Photosystem I
Length=269

 Score =   173 bits (439),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 108/166 (65%), Gaps = 8/166 (5%)
 Frame = +1

Query  82   PCASKTRFLTGSSGK-LNREVSFRAST-------SSSNVSFKIEAKKGEWLPGLPSPAYL  237
            P + K    +G+S   L R++   +ST       S+S V    E  +  W PG   P +L
Sbjct  18   PSSQKNGSPSGTSKAFLGRKLKVNSSTASPSRVRSTSTVCTVAEPDRPLWFPGSTPPPWL  77

Query  238  DGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKW  417
            DGSLPGD GFDPLGL  DPE+LRW VQAELV+ RWAMLG AG+ +PE  T++GI+N P W
Sbjct  78   DGSLPGDFGFDPLGLGSDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSW  137

Query  418  YDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            Y AG+ EYF  ++TLF++E +   + E RRW DI NPGCVN DPIF
Sbjct  138  YTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIF  183



>sp|P13869.1|CB12_PETHY RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCI type II CAB; Flags: Precursor [Petunia x 
hybrida]
 gb|AAA33711.1| chlorophyll binding protein precursor [Petunia x hybrida]
 prf||1503272A chlorophyll binding protein
Length=270

 Score =   173 bits (439),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 105/156 (67%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL G   ++++ ++   S S +  +   +  +  W PG   P +LDGSLPGD GF
Sbjct  29   ATKASFLGGKRLRVSKFIAPVGSRSVAVSAVAADPDRPLWFPGSTPPEWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE+L+W  QAELV+ RWAMLG AG+ +PE  T+IG++N P WY AG+ EYF 
Sbjct  89   DPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLFVIE +L  + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIF  184



>ref|XP_007139044.1| hypothetical protein PHAVU_009G260200g [Phaseolus vulgaris]
 gb|ESW11038.1| hypothetical protein PHAVU_009G260200g [Phaseolus vulgaris]
Length=267

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 101/154 (66%), Gaps = 0/154 (0%)
 Frame = +1

Query  94   KTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDP  273
            K  FL G   ++N+  +     SS+ V    E  +  W PG   P +LDG+LPGD GFDP
Sbjct  31   KASFLGGRKLRVNKYTAAVGGRSSTTVCAVAEPDRPLWFPGSTPPPWLDGTLPGDFGFDP  90

Query  274  LGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASS  453
            LGL  DPE+LRW VQAE+V+ RWAMLG AG+ +PE  T+IG++N P WY AG+ EYF  +
Sbjct  91   LGLGSDPESLRWNVQAEIVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYSAGEQEYFTDT  150

Query  454  STLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +TLF++E     + E RRW DI  PGCVN DPIF
Sbjct  151  TTLFIVELFFIGWAEGRRWADIIKPGCVNTDPIF  184



>ref|XP_007139043.1| hypothetical protein PHAVU_009G260200g [Phaseolus vulgaris]
 gb|ESW11037.1| hypothetical protein PHAVU_009G260200g [Phaseolus vulgaris]
Length=270

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 101/154 (66%), Gaps = 0/154 (0%)
 Frame = +1

Query  94   KTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDP  273
            K  FL G   ++N+  +     SS+ V    E  +  W PG   P +LDG+LPGD GFDP
Sbjct  31   KASFLGGRKLRVNKYTAAVGGRSSTTVCAVAEPDRPLWFPGSTPPPWLDGTLPGDFGFDP  90

Query  274  LGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASS  453
            LGL  DPE+LRW VQAE+V+ RWAMLG AG+ +PE  T+IG++N P WY AG+ EYF  +
Sbjct  91   LGLGSDPESLRWNVQAEIVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYSAGEQEYFTDT  150

Query  454  STLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +TLF++E     + E RRW DI  PGCVN DPIF
Sbjct  151  TTLFIVELFFIGWAEGRRWADIIKPGCVNTDPIF  184



>gb|KJB15540.1| hypothetical protein B456_002G183400 [Gossypium raimondii]
Length=292

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
             +K  FLTG   +  R+ +  A+  +  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   TTKASFLTGKKLRSVRKYTKPAAGPTFPVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG  EYF 
Sbjct  89   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGTEEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  184



>ref|XP_011036086.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Populus euphratica]
Length=269

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 1/156 (1%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            ++K  FL+G   +L R  +  A+ S + V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   STKASFLSGKKLRLKRYTTPTAARSVT-VCVAADPDRPLWFPGSTPPPWLDGSLPGDFGF  87

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  88   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFT  147

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E     + E RRW DI  PGCVN DPIF
Sbjct  148  DTTTLFIVELFFIGWAEGRRWADILKPGCVNTDPIF  183



>emb|CAA41406.1| Type II chlorophyll a /b-binding protein [Pinus sylvestris]
Length=278

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 112/181 (62%), Gaps = 6/181 (3%)
 Frame = +1

Query  31   SSENMATVTQPSAAVFRPC------ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEA  192
            SS   A V  PS++  +        A+K  FL G +  L +  +     ++  VS  ++ 
Sbjct  12   SSVTAAVVVAPSSSSQKTILANNVGAAKASFLVGRAVSLRQTKAAMPRRAAVTVSQAVQT  71

Query  193  KKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLL  372
            ++  W PG   P +LDGSLPGD GFDPLGL  DPE L+W VQAELV+ RWAMLG AG+ +
Sbjct  72   ERPLWFPGNTPPPWLDGSLPGDFGFDPLGLGSDPETLKWMVQAELVHCRWAMLGAAGIFI  131

Query  373  PEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPI  552
            PE+ T++GI+N P WY AG+ EYF   +TLFV+E I   + E RRW DI  PG VN DPI
Sbjct  132  PELCTKLGILNTPSWYTAGELEYFTDKTTLFVVEMIFLGWAEGRRWADILEPGSVNTDPI  191

Query  553  F  555
            F
Sbjct  192  F  192



>gb|KJB50346.1| hypothetical protein B456_008G165200 [Gossypium raimondii]
Length=270

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
             +K  FLTG   +  ++ +  A+  +  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   TTKASFLTGKKLRSVKKYTKPAAARTVPVCAVADPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG  EYF 
Sbjct  89   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGTEEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  184



>ref|XP_003637339.1| Chlorophyll a-b binding protein [Medicago truncatula]
 gb|KEH18534.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=268

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = +1

Query  82   PCASKTRFLTGSSGKLNREVSFRAST-SSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGD  258
            P  +   FL G   K+N  ++      S++ V    E  +  W PG   P +LDGSLPGD
Sbjct  25   PMGTSKAFL-GRKLKVNSNIAAPVRVRSTTTVCAAAEPDRPLWFPGSTPPPWLDGSLPGD  83

Query  259  NGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSE  438
             GFDPLGL+ DPE+L+W VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ E
Sbjct  84   FGFDPLGLSSDPESLKWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQE  143

Query  439  YFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            YF  ++TLF++E I   + E RRW DI NPGCVN DPIF
Sbjct  144  YFTDTTTLFIVELIFIGWAEGRRWADILNPGCVNTDPIF  182



>emb|CAA59049.1| LHCI-680, photosystem I antenna protein [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ85253.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 106/160 (66%), Gaps = 14/160 (9%)
 Frame = +1

Query  85   CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE---WLPGLPSPAYLDGSLPG  255
              ++T FL G++GK           ++S  SF + A   E   W PG   P +LDGSLPG
Sbjct  21   AGARTSFL-GAAGK----------AAASRTSFAVRAAAPERPIWFPGSTPPPWLDGSLPG  69

Query  256  DNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKS  435
            D GFDP GL  DPE+LRW VQAELV+ RWAMLG AG+ +PE+ T+IGI+N P WY AG+ 
Sbjct  70   DFGFDPWGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQ  129

Query  436  EYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            EYF  ++TLF++E IL  + E RRW DI  PGCVN DPIF
Sbjct  130  EYFTDTTTLFIVELILIGWAEGRRWADIIKPGCVNTDPIF  169



>ref|XP_011002123.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Populus 
euphratica]
Length=269

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 1/156 (1%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            ++K  FL+G   +L R  +  A+ S + V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   STKASFLSGKKLRLKRYTTPTAARSVT-VCVAADPDRPLWFPGSTPPPWLDGSLPGDFGF  87

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  88   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFT  147

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E     + E RRW DI  PGCVN DPIF
Sbjct  148  DTTTLFIVELFFIGWAEGRRWADILKPGCVNTDPIF  183



>ref|XP_008801837.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Phoenix dactylifera]
Length=262

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 106/156 (68%), Gaps = 1/156 (1%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A K  FL G+  +  +  +  A  + S VS +  +++  W PG   P +LDGSLPGD GF
Sbjct  23   AMKASFLGGTKLRQKKSTAPTARRALS-VSAEATSERPLWFPGSTPPPWLDGSLPGDFGF  81

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE+LRW  QAELV+ RWAMLG AG+ +PE+ T+IGI+N P WY AG+ EYF 
Sbjct  82   DPLGLGSDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGELEYFT  141

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLFVIE IL  + E RRW DI  PGCVN DP+F
Sbjct  142  DTTTLFVIELILIGWAEGRRWADIIKPGCVNTDPVF  177



>ref|XP_011020754.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Populus euphratica]
Length=269

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 102/156 (65%), Gaps = 1/156 (1%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            ++K  FL G   +L    S  A+ S + V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   STKASFLRGKKLRLKTYTSPTAARSVT-VCVAADPDRPLWFPGSTPPPWLDGSLPGDFGF  87

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  88   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFT  147

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  148  DTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  183



>gb|KHG11922.1| Chlorophyll a-b binding 7, chloroplastic [Gossypium arboreum]
Length=270

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
             +K  FL+G   +  R+ +  A+  +  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   TTKASFLSGKKLRSVRKYTKPAAGPTFPVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG  EYF 
Sbjct  89   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGTEEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  184



>ref|XP_008805305.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Phoenix dactylifera]
Length=267

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEA--KKGEWLPGLPSPAYLDGSLPGDN  261
            A+K  FL G   KL ++  + A T+   +S   EA  ++  W PG   P +LDGSLPGD 
Sbjct  26   ATKASFLGGM--KLRQKKCWIAPTARRALSVSAEATTERPLWFPGSTPPPWLDGSLPGDF  83

Query  262  GFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEY  441
            GFDPLGL  DPE+LRW  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EY
Sbjct  84   GFDPLGLGSDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEY  143

Query  442  FASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            F  ++TLFVIE I   + E RRW DI  PGCVN DPIF
Sbjct  144  FTDTTTLFVIELIFIGWAEGRRWADIIKPGCVNTDPIF  181



>emb|CDP13340.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 3/178 (2%)
 Frame = +1

Query  25   NFSSENMATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNV-SFKIEAKKG  201
            N SS   A   Q + ++    A+K  FL+G   ++++  S  A   S  + +   + ++ 
Sbjct  26   NVSSTLYAYSPQKNGSILG--ATKASFLSGRKLRVSQYTSPPAGARSLTICAAAADLERP  83

Query  202  EWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEV  381
             W PG   P +LDGSLPGD GFDPLGL  DPE LRW VQ+E+V+ RWAMLG AG+ +PE 
Sbjct  84   IWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPEF  143

Query  382  FTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             T+IGI+N P WY AG+ EYF  ++TLFV+E IL  + E RRW DI  PGCVN DPIF
Sbjct  144  LTKIGILNTPSWYSAGELEYFTDTTTLFVVEMILIGWAEGRRWADIIKPGCVNTDPIF  201



>ref|XP_010531194.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=269

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 104/156 (67%), Gaps = 1/156 (1%)
 Frame = +1

Query  91   SKTRFLTGSSGKLNREVSFR-ASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            ++  FL G   ++ +  +   A+  S+ V+  ++  +  W PG   P +LDGSLPGD GF
Sbjct  28   TRAGFLGGKKLRVKKNAAAEVAAGRSATVAAAVDPDRPLWFPGSTPPPWLDGSLPGDFGF  87

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE+LRW  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  88   DPLGLGSDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFT  147

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  148  DTTTLFIVELIFIGWAEGRRWADIIKPGCVNTDPIF  183



>gb|AFK35880.1| unknown [Medicago truncatula]
Length=268

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = +1

Query  160  SSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGR  339
            S++ V    E  +  W PG   P +LDGSLPGD GFDPLGL+ DPE+L+W VQAELV+ R
Sbjct  51   STTTVCAAAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLSSDPESLKWNVQAELVHCR  110

Query  340  WAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDI  519
            WAMLG AG+ +PE  T+IGI+N P WY AG+ EYF  ++TLF++E I   + E RRW DI
Sbjct  111  WAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELIFIGWAEGRRWADI  170

Query  520  KNPGCVNQDPIF  555
             NPGCVN DPIF
Sbjct  171  LNPGCVNTDPIF  182



>ref|XP_010905185.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Elaeis guineensis]
Length=266

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 107/158 (68%), Gaps = 5/158 (3%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEA--KKGEWLPGLPSPAYLDGSLPGDN  261
            A+K  FL G+  KL R+  + A T+   +S   EA  ++  W PG   P +LDGSLPGD 
Sbjct  26   ATKASFLGGT--KL-RQKKWTAPTARRALSVSAEAISERPLWFPGSTPPPWLDGSLPGDF  82

Query  262  GFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEY  441
            GFDPLGL  DPE+LRW  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EY
Sbjct  83   GFDPLGLGSDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEY  142

Query  442  FASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            F  ++TLFVIE I   + E RRW DI  PGCVN DPIF
Sbjct  143  FTDTTTLFVIELIFIGWAEGRRWADIIKPGCVNTDPIF  180



>gb|KJB50347.1| hypothetical protein B456_008G165200 [Gossypium raimondii]
Length=313

 Score =   172 bits (436),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 101/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
             +K  FLTG   +  ++ +  A+  +  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   TTKASFLTGKKLRSVKKYTKPAAARTVPVCAVADPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG  EYF 
Sbjct  89   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGTEEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  184



>ref|XP_006438030.1| hypothetical protein CICLE_v10031886mg [Citrus clementina]
 gb|ESR51270.1| hypothetical protein CICLE_v10031886mg [Citrus clementina]
Length=367

 Score =   173 bits (439),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 103/156 (66%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL G   KL +  +   + S S  +   +  +  W PG   P +LDGSLPGD GF
Sbjct  126  ATKASFLGGKKLKLRKNGATAGTRSVSVSAAAADPNRPLWFPGSTPPEWLDGSLPGDFGF  185

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQ+E+V+ RWAMLG AG+ +PE+ T++GI+N P WY AG+ EYF 
Sbjct  186  DPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFT  245

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  246  DTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIF  281



>ref|XP_010531186.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=270

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 104/156 (67%), Gaps = 1/156 (1%)
 Frame = +1

Query  91   SKTRFLTGSSGKLNREVSFR-ASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            ++  FL G   ++ +  +   A+  S+ V+  ++  +  W PG   P +LDGSLPGD GF
Sbjct  29   TRAGFLGGKKLRVKKNAAAEVAAGRSATVAAAVDPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE+LRW  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  89   DPLGLGSDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFT  148

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  149  DTTTLFIVELIFIGWAEGRRWADIIKPGCVNTDPIF  184



>gb|ABK95601.1| unknown [Populus trichocarpa]
Length=269

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 1/156 (1%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            ++K  FL G   +L    S  A+ S + V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   STKASFLRGKKLRLRTYTSPTAARSVT-VCVAADPDRPLWFPGSTPPPWLDGSLPGDFGF  87

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  88   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGEVEYFT  147

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E     + E RRW DI  PGCVN DPIF
Sbjct  148  DTTTLFIVELFFIGWAEGRRWADILKPGCVNTDPIF  183



>gb|AGV54278.1| light-harvesting complex I protein Lhca2 [Phaseolus vulgaris]
Length=269

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 104/156 (67%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
             +K  FL+G   K+N   +   + SS+ V    +  +  W PG   P +LDGSLPGD GF
Sbjct  28   TAKASFLSGRKLKVNSFTAPVGARSSTTVCAVADPDRPLWFPGSTPPPWLDGSLPGDFGF  87

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL+ DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IG++N P WY AG+ EYF+
Sbjct  88   DPLGLSSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGELEYFS  147

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLFV+E     + E RRW DI  PG VN DPIF
Sbjct  148  DTTTLFVVELFFIGWAEGRRWADIIKPGSVNTDPIF  183



>gb|EMT28434.1| hypothetical protein F775_43774 [Aegilops tauschii]
Length=255

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 100/151 (66%), Gaps = 3/151 (2%)
 Frame = +1

Query  112  GSSGKLNREVSFRASTSSSNVSFKIEAKKGE---WLPGLPSPAYLDGSLPGDNGFDPLGL  282
            G +G  +  +      + S  SF + A   E   W PG   P +LDGSLPGD GFDP GL
Sbjct  19   GLAGARSSFLGAAGKAAGSRASFAVRAAAPERPIWFPGSTPPPWLDGSLPGDFGFDPWGL  78

Query  283  AEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTL  462
              DPE+LRW VQAELV+ RWAMLG AG+ +PE+ T+IGI+N P WY AG+ EYF  ++TL
Sbjct  79   GSDPESLRWNVQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTL  138

Query  463  FVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            F++E IL  + E RRW DI  PGCVN DPIF
Sbjct  139  FIVELILIGWAEGRRWADIIKPGCVNTDPIF  169



>ref|XP_010917526.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Elaeis guineensis]
Length=266

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 106/156 (68%), Gaps = 1/156 (1%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL G   +  + ++  A+  + +VS +   ++  W PG   P +LDGSLPGD GF
Sbjct  26   ATKATFLGGIKLRQKKWIA-PAARRALSVSAEATTERPLWFPGSTPPPWLDGSLPGDFGF  84

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE+LRW  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ +YF 
Sbjct  85   DPLGLGSDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELQYFT  144

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLFVIE IL  + E RRW DI  PGCVN DPIF
Sbjct  145  DTTTLFVIELILIGWAEGRRWADIIKPGCVNTDPIF  180



>ref|XP_007135346.1| hypothetical protein PHAVU_010G121400g, partial [Phaseolus vulgaris]
 gb|ESW07340.1| hypothetical protein PHAVU_010G121400g, partial [Phaseolus vulgaris]
Length=264

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 103/156 (66%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
             +K  FL+G   K+N   +   + SS+ V    +  +  W PG   P +LDGSLPGD GF
Sbjct  28   TAKASFLSGRKLKVNSLTAPVGARSSTTVCAVADPDRPLWFPGSTPPPWLDGSLPGDFGF  87

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL+ DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IG++N P WY AG+ EYF 
Sbjct  88   DPLGLSSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGELEYFT  147

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLFV+E     + E RRW DI  PG VN DPIF
Sbjct  148  DTTTLFVVELFFIGWAEGRRWADIIKPGSVNTDPIF  183



>ref|XP_006848348.1| hypothetical protein AMTR_s00013p00180670 [Amborella trichopoda]
 gb|ERN09929.1| hypothetical protein AMTR_s00013p00180670 [Amborella trichopoda]
Length=264

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 105/157 (67%), Gaps = 7/157 (4%)
 Frame = +1

Query  94   KTRFLTGSS---GKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNG  264
            K  FL G S   GK+   VS R+ T    VS  + +++  W PG   P +LDGSLPGD G
Sbjct  26   KASFLGGRSLRQGKVWVPVSRRSLT----VSAAVASERPLWFPGSTPPEWLDGSLPGDFG  81

Query  265  FDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYF  444
            FDPLGL  DPE+LRW  QAELV+ RWAMLG AG+ +PE  T++GI+N P WY AG+ EYF
Sbjct  82   FDPLGLGSDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYF  141

Query  445  ASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
              ++TLFV+E I   + E RRW DI  PGCVN DPIF
Sbjct  142  TDTTTLFVVELIFIGWAEGRRWADIIKPGCVNTDPIF  178



>gb|AGV54335.1| chlorophyll A/B binding protein 7 chloroplastic-like protein 
[Phaseolus vulgaris]
Length=269

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 103/156 (66%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
             +K  FL+G   K+N   +   + SS+ V    +  +  W PG   P +LDGSLPGD GF
Sbjct  28   TAKASFLSGRKLKVNSFTAPVGARSSTTVCAVADPDRPLWFPGSTPPPWLDGSLPGDFGF  87

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL+ DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IG++N P WY AG+ EYF 
Sbjct  88   DPLGLSSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGELEYFT  147

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLFV+E     + E RRW DI  PG VN DPIF
Sbjct  148  DTTTLFVVELFFIGWAEGRRWADIIKPGSVNTDPIF  183



>ref|XP_002303791.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa]
 gb|EEE78770.1| chlorophyll a/b-binding protein type II precursor [Populus trichocarpa]
Length=269

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 1/156 (1%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            ++K  FL G   +L    S  A+ S + V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   STKASFLRGEKLRLRTYTSPTAARSVT-VCVAADPDRPLWFPGSTPPPWLDGSLPGDFGF  87

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  88   DPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGEVEYFT  147

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E     + E RRW DI  PGCVN DPIF
Sbjct  148  DTTTLFIVELFFIGWAEGRRWADILKPGCVNTDPIF  183



>ref|XP_006657881.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Oryza brachyantha]
Length=266

 Score =   169 bits (429),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 97/136 (71%), Gaps = 3/136 (2%)
 Frame = +1

Query  157  TSSSNVSFKIEAKKGE---WLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAEL  327
            +S+ + SF + A   +   W PG   P +LDGSLPGD GFDPLGL  DPE+LRW VQAEL
Sbjct  45   SSARSASFAVRAAAPDRPIWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAEL  104

Query  328  VNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRR  507
            V+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ +YF  ++TLF+IE IL  + E RR
Sbjct  105  VHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQQYFTDTTTLFIIELILIGWAEGRR  164

Query  508  WQDIKNPGCVNQDPIF  555
            W DI  PGCVN DPIF
Sbjct  165  WADIIKPGCVNTDPIF  180



>ref|XP_009405484.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=311

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 103/157 (66%), Gaps = 0/157 (0%)
 Frame = +1

Query  85   CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNG  264
             A+K  FL G       + + + +  + +VS     ++  W PG   P +LDGSLPGD G
Sbjct  69   AATKASFLGGGRKVRQGKWATKTARRAFSVSAAAVPERPLWFPGSTPPPWLDGSLPGDFG  128

Query  265  FDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYF  444
            FDPLGL  DPE+LRW  QAE+V+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF
Sbjct  129  FDPLGLGSDPESLRWNQQAEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGQLEYF  188

Query  445  ASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
              ++TLFVIE IL  + E RRW DI  PGCVN DPIF
Sbjct  189  TDTTTLFVIELILIGWAEGRRWADIIKPGCVNTDPIF  225



>ref|XP_010655886.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Vitis 
vinifera]
 emb|CBI27656.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 101/157 (64%), Gaps = 1/157 (1%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKI-EAKKGEWLPGLPSPAYLDGSLPGDNG  264
            A+K  FL G    L +  +  A T S  VS    +  +  W PG   P +LDGSLPGD G
Sbjct  29   ATKASFLGGKRLSLKKFTAPAAGTRSFTVSAAAADPNRPLWFPGSTPPPWLDGSLPGDFG  88

Query  265  FDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYF  444
            FDPLGL  DPE L+W VQ+E+V+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF
Sbjct  89   FDPLGLGSDPETLKWMVQSEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYF  148

Query  445  ASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
               +TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  149  TDKTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDPIF  185



>gb|KHN15861.1| Chlorophyll a-b binding protein 7, chloroplastic [Glycine soja]
Length=249

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = +1

Query  124  KLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENL  303
            ++N   +   + SS+ V    E  +  W PG   P +LDGSLPGD GFDPLGLA DPE+L
Sbjct  20   QVNNFTAPVGARSSTTVCAVAEPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESL  79

Query  304  RWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFIL  483
            RW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF  ++TLF++E   
Sbjct  80   RWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFTDTTTLFIVELFF  139

Query  484  FHYVEIRRWQDIKNPGCVNQDPIF  555
              + E RRW DI  PGCVN DPIF
Sbjct  140  IGWAEGRRWADIIKPGCVNTDPIF  163



>ref|XP_010100230.1| Chlorophyll a-b binding protein [Morus notabilis]
 gb|EXB81985.1| Chlorophyll a-b binding protein [Morus notabilis]
Length=283

 Score =   169 bits (429),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 103/159 (65%), Gaps = 4/159 (3%)
 Frame = +1

Query  88   ASKTRFLTGSSGKL---NREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGD  258
            A+K  FL GS  KL   N     R+S S S V    +  +  W PG   P +LDGSLPGD
Sbjct  40   ATKGSFLGGSK-KLRVRNYTAPIRSSRSFSTVCAAADPNRPLWFPGSTPPDWLDGSLPGD  98

Query  259  NGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSE  438
             GFDPLGL  DPE LRW VQ+E+V+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ E
Sbjct  99   FGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGEQE  158

Query  439  YFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            YF  ++TLF++E I   + E RRW DI  PG VN DPIF
Sbjct  159  YFTDTTTLFIVEMIFIGWAEGRRWADILKPGSVNTDPIF  197



>ref|XP_007044017.1| Chlorophyll a-b binding protein 7, chloroplastic [Theobroma cacao]
 gb|EOX99848.1| Chlorophyll a-b binding protein 7, chloroplastic [Theobroma cacao]
Length=271

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 99/157 (63%), Gaps = 1/157 (1%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFR-ASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNG  264
            A+K  FL+G   +  R+ S   A      V    +  +  W PG   P +LDGSLPGD G
Sbjct  29   ATKASFLSGKKLRSARKYSAAPAGARPVAVCAAADPNRPLWFPGSTPPPWLDGSLPGDFG  88

Query  265  FDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYF  444
            FDPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG  EYF
Sbjct  89   FDPLGLGSDPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGTEEYF  148

Query  445  ASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
               +TLF++E +   + E RRW DI  PGCVN DPIF
Sbjct  149  TDPTTLFIVELLFIGWAEGRRWADILKPGCVNTDPIF  185



>ref|XP_011086789.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Sesamum 
indicum]
Length=271

 Score =   169 bits (427),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 103/156 (66%), Gaps = 1/156 (1%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  F  G   ++++  +  + T S  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  31   ATKASFFGGRKLRVSKFAA-PSGTRSVTVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGF  89

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE+L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  90   DPLGLGSDPESLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFT  149

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF+IE IL  + E RRW DI  PGCVN DPIF
Sbjct  150  DTTTLFIIELILIGWAEGRRWADIIKPGCVNTDPIF  185



>gb|AHM26636.1| a-b binding protein [Pyrus x bretschneideri]
Length=189

 Score =   166 bits (420),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 105/162 (65%), Gaps = 9/162 (6%)
 Frame = +1

Query  85   CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE-----WLPGLPSPAYLDGSL  249
             A+K  F     G+  R  SF A T SS+ SF + A   +     W PG   P +LDGSL
Sbjct  28   AATKASFF---GGRKLRVRSFTAPTGSSS-SFTVRAAAADPDRPLWFPGSTPPPWLDGSL  83

Query  250  PGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAG  429
            PGD GFDPLGL+ DP++L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG
Sbjct  84   PGDFGFDPLGLSSDPDSLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAG  143

Query  430  KSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            + EYF  ++TLFV+E +L  + E RRW DI  PG VN DPI 
Sbjct  144  EQEYFTDTTTLFVVELVLIGWAEGRRWADILKPGSVNTDPIL  185



>pdb|4RKU|2 Chain 2, Crystal Structure Of Plant Photosystem I At 3 Angstrom 
Resolution
Length=199

 Score =   166 bits (420),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +1

Query  187  EAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGM  366
            E  +  W PG   P +LDGSLPGD GFDPLGL  DPE+LRW VQAELV+ RWAMLG AG+
Sbjct  3    EPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHSRWAMLGAAGI  62

Query  367  LLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQD  546
             +PE  T++GI+N P WY AG+ EYF  ++TLF++E +   + E RRW DI NPGCVN D
Sbjct  63   FIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTD  122

Query  547  PIF  555
            PIF
Sbjct  123  PIF  125



>gb|AHM26638.1| a-b binding protein [Pyrus x bretschneideri]
Length=271

 Score =   168 bits (426),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 107/162 (66%), Gaps = 9/162 (6%)
 Frame = +1

Query  85   CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE-----WLPGLPSPAYLDGSL  249
             A+K  F     G+  R  SF A+T SS+ SF + A   +     W PG   P +LDGSL
Sbjct  28   AATKASFF---GGRKLRVRSFTAATGSSS-SFTVRAAAADPDRPLWFPGSTPPPWLDGSL  83

Query  250  PGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAG  429
            PGD GFDPLGL+ DP++L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG
Sbjct  84   PGDFGFDPLGLSSDPDSLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAG  143

Query  430  KSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            + EYF  ++TLFV+E +L  + E RRW DI  PG VN DPIF
Sbjct  144  EQEYFTDTTTLFVVELVLIGWAEGRRWADILKPGSVNTDPIF  185



>gb|ABY63668.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=262

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 103/157 (66%), Gaps = 5/157 (3%)
 Frame = +1

Query  85   CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNG  264
              ++T FL     KL RE + R S + S  +      +  W PG   P +LDGSLPGD G
Sbjct  25   AGARTSFLGAGRTKL-REAAARPSFAVSAAA----PDRPIWFPGSVPPPWLDGSLPGDFG  79

Query  265  FDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYF  444
            FDP GL  DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IGI++ P WY AG+ +YF
Sbjct  80   FDPFGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILSTPSWYTAGEQQYF  139

Query  445  ASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
              ++TLF+IE IL  + E RRW DI  PGCVN DPIF
Sbjct  140  TDTTTLFIIELILIGWAEGRRWADIIKPGCVNTDPIF  176



>gb|ABK21282.1| unknown [Picea sitchensis]
 gb|ABK22450.1| unknown [Picea sitchensis]
 gb|ABK23211.1| unknown [Picea sitchensis]
 gb|ABK24121.1| unknown [Picea sitchensis]
 gb|ABK26112.1| unknown [Picea sitchensis]
 gb|ABK26188.1| unknown [Picea sitchensis]
 gb|ABK26376.1| unknown [Picea sitchensis]
 gb|ABR17439.1| unknown [Picea sitchensis]
 gb|ACN39904.1| unknown [Picea sitchensis]
 gb|ACN39960.1| unknown [Picea sitchensis]
 gb|ACN40062.1| unknown [Picea sitchensis]
 gb|ACN40101.1| unknown [Picea sitchensis]
 gb|ACN40463.1| unknown [Picea sitchensis]
Length=278

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 102/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL G +  L +  +     ++  VS  ++ ++  W PG   P +LDGSLP D GF
Sbjct  37   AAKASFLVGRAVSLRQSKAAMPRRAAVIVSEAVQTERPLWFPGTTPPPWLDGSLPADFGF  96

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE L+W VQ+ELV+ RWAMLG AG+ +PE+ T++GI+N P WY AG+ EYF 
Sbjct  97   DPLGLGSDPETLKWNVQSELVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGEQEYFT  156

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
              +TLFV+E I   + E RRW DI  PG VN DPIF
Sbjct  157  DKTTLFVVEMIFLGWAEGRRWADIIKPGSVNTDPIF  192



>gb|KJB50348.1| hypothetical protein B456_008G165200 [Gossypium raimondii]
Length=268

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
             +K  FLTG   +  ++ +  A+  +  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  29   TTKASFLTGKKLRSVKKYTKPAAARTVPVCAVADPDRPLWFPGSTPPPWLDGSLPGDFGF  88

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG  EYF 
Sbjct  89   DPLGL--DPETLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGTEEYFT  146

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  147  DTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  182



>ref|XP_009372280.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Pyrus 
x bretschneideri]
Length=271

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = +1

Query  85   CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE-----WLPGLPSPAYLDGSL  249
             A+K  F     G+  R  SF A T SS+ SF + A   +     W PG   P +LDGSL
Sbjct  28   AATKASFF---GGRKLRVRSFTAPTGSSS-SFTVRAAAADPDRPLWFPGSTPPPWLDGSL  83

Query  250  PGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAG  429
            PGD GFDPLGL+ DP++L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG
Sbjct  84   PGDFGFDPLGLSSDPDSLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAG  143

Query  430  KSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            + EYF  ++TLFV+E +L  + E RRW DI  PG VN DPIF
Sbjct  144  EQEYFTDTTTLFVVELVLIGWAEGRRWADILKPGSVNTDPIF  185



>ref|XP_001778557.1| predicted protein [Physcomitrella patens]
 gb|EDQ56587.1| predicted protein [Physcomitrella patens]
Length=273

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 109/178 (61%), Gaps = 3/178 (2%)
 Frame = +1

Query  31   SSENMATVTQPSAA--VFRPCASKTRFLTGSSGKLNR-EVSFRASTSSSNVSFKIEAKKG  201
            +S N+A V  PS +  V     ++T  L G   ++ R   S +A              + 
Sbjct  7    ASSNVAVVAGPSTSKVVNSAGPARTSLLAGRVRRVTRIAASPQAEAPVPAQPSLPNNDRP  66

Query  202  EWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEV  381
             W PG   P +LDGSLPGD GFDPLGL  DPE L+W+VQAELV+ RWAMLG AG+ +PE 
Sbjct  67   LWFPGSQPPEWLDGSLPGDFGFDPLGLGSDPELLKWFVQAELVHCRWAMLGAAGIFIPEA  126

Query  382  FTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             T+ GI+N P W  AG  +YF  ++TLFVIE ILF + E RRW DI NPGCVN DP+F
Sbjct  127  LTKAGILNTPSWTVAGDQQYFTDATTLFVIEIILFAWAEGRRWADIINPGCVNVDPVF  184



>ref|XP_008446036.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic isoform 
X2 [Cucumis melo]
Length=269

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 101/154 (66%), Gaps = 1/154 (1%)
 Frame = +1

Query  97   TRFLTGSSGKL-NREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDP  273
            + FL G   +L N   +   +  S+ V    +  +  W PG   P +LDGSLPGD GFDP
Sbjct  30   SNFLAGKKLRLRNLNAAAVVAPRSAPVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGFDP  89

Query  274  LGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASS  453
            LGLA DPE+LRW  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF  +
Sbjct  90   LGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGELEYFTDT  149

Query  454  STLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  150  TTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  183



>ref|NP_001239987.1| uncharacterized protein LOC100794944 [Glycine max]
 gb|ACU18230.1| unknown [Glycine max]
Length=267

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 100/152 (66%), Gaps = 1/152 (1%)
 Frame = +1

Query  103  FLTGSSGKLNRE-VSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLG  279
            FL+G   ++ +E  +    +  + V    E  +  W PG   P +LDG+LPGD GFDPLG
Sbjct  30   FLSGRKLRVKKERAAIGGRSMGTTVCAVAEPDRPLWFPGSTPPPWLDGTLPGDFGFDPLG  89

Query  280  LAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSST  459
            L  DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IG++N P WY AG+ EYF  ++T
Sbjct  90   LGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYSAGELEYFTDTTT  149

Query  460  LFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            LF++E     + E RRW DI  PGCVN DPIF
Sbjct  150  LFIVELFFIGWAEGRRWADIIKPGCVNTDPIF  181



>emb|CCI55397.1| PSI antenna protein Lhca2 [Marchantia polymorpha]
Length=267

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 110/179 (61%), Gaps = 11/179 (6%)
 Frame = +1

Query  46   ATVTQPSAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVS------FKIEAKKGE-  204
            A  T    A   P  S T+ +  SSG   +   F  +  S+ VS      F + A+  E 
Sbjct  4    AVCTTSRIASIAPSTSATKAV--SSGSAVKAAFFGKTLRSAKVSAVSKASFSVRAQATER  61

Query  205  --WLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPE  378
              W PG  +P +LDGSLPGD GFDPLGL  +PE L+W+VQAE+V+ RWAMLG AG+ +PE
Sbjct  62   PLWFPGSTAPEWLDGSLPGDFGFDPLGLGSEPELLKWFVQAEIVHCRWAMLGAAGIFIPE  121

Query  379  VFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            + T+IGI+N P WY AG+  YFA  +TLF++E +   + E RRW DI  PG VN DP+F
Sbjct  122  LLTKIGILNTPSWYTAGEQTYFADQTTLFIVELLFMGWAEGRRWADILKPGSVNTDPVF  180



>gb|EEC82322.1| hypothetical protein OsI_26601 [Oryza sativa Indica Group]
Length=432

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 106/162 (65%), Gaps = 3/162 (2%)
 Frame = +1

Query  64   SAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE---WLPGLPSPAY  234
            +A    P A++     G +G+  R +  +A +SS+  SF + A   +   W PG   P +
Sbjct  11   TAVAALPGAARASSFLGGAGRSGRLLLRQAESSSARASFAVRAAAPDRPIWFPGSTPPPW  70

Query  235  LDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPK  414
            LDGSLPGD GFDPLGL  DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IGI+N P 
Sbjct  71   LDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPS  130

Query  415  WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVN  540
            WY AG+ +YF  ++TLF+IE IL  + E RRW DI  PGCV 
Sbjct  131  WYTAGEQQYFTDTTTLFIIELILIGWAEGRRWADIIKPGCVG  172



>ref|XP_003562834.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Brachypodium 
distachyon]
Length=258

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 93/130 (72%), Gaps = 3/130 (2%)
 Frame = +1

Query  175  SFKIEAKKGE---WLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWA  345
            SF + A   E   W PG   P +LDGSLPGD GFDP GL  DPE+LRW VQAELV+ RWA
Sbjct  43   SFAVRAAAPERPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAELVHCRWA  102

Query  346  MLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKN  525
            MLG AG+ +PE+ T+IGI+N P WY AG+  YFA ++TLF++E IL  + E RRW DI  
Sbjct  103  MLGAAGIFIPELLTKIGILNTPSWYTAGEQTYFADTTTLFIVELILIGWAEGRRWADIIK  162

Query  526  PGCVNQDPIF  555
            PGCVN DPIF
Sbjct  163  PGCVNTDPIF  172



>emb|CAC81065.1| putative chlorophyll A-B binding protein of LHCI type II precursor 
[Picea abies]
Length=278

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 102/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            A+K  FL G +  L +  +     ++  VS  ++ ++  W PG   P +LDGSLP D GF
Sbjct  37   AAKASFLVGRAVSLRQSKAAMPRRAAVIVSEAVQTERPLWFPGTTPPPWLDGSLPADFGF  96

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGL  DPE L+W VQ+ELV+ RWAMLG AG+ +PE+ T++GI+N P WY AG+ EYF 
Sbjct  97   DPLGLGSDPETLKWNVQSELVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFT  156

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
              +TLFV+E I   + E RRW DI  PG VN DPIF
Sbjct  157  DKTTLFVVEMIFLGWAEGRRWADIIKPGSVNTDPIF  192



>ref|XP_007222715.1| hypothetical protein PRUPE_ppa009903mg [Prunus persica]
 gb|EMJ23914.1| hypothetical protein PRUPE_ppa009903mg [Prunus persica]
Length=272

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 106/164 (65%), Gaps = 13/164 (8%)
 Frame = +1

Query  85   CASKTRFLTGSSGKLNREVSFR--ASTSSSNVSFKIEAKKGE-----WLPGLPSPAYLDG  243
             A+K  F  G      R++  R   ++S S+ SF + A   +     W PG   P +LDG
Sbjct  29   AATKASFFGG------RKLRVRNLTASSGSSTSFTVRAAAADPDRPLWFPGSTPPPWLDG  82

Query  244  SLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYD  423
            SLPGD GFDPLGL+ DP++LRW  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY 
Sbjct  83   SLPGDFGFDPLGLSSDPDSLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYT  142

Query  424  AGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            AG+ EYF  ++TLFV+E +L  + E RRW DI  PG VN DPIF
Sbjct  143  AGEQEYFTDTTTLFVVELVLIGWAEGRRWADILKPGSVNTDPIF  186



>ref|XP_008446035.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic isoform 
X1 [Cucumis melo]
Length=281

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 101/154 (66%), Gaps = 1/154 (1%)
 Frame = +1

Query  97   TRFLTGSSGKL-NREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDP  273
            + FL G   +L N   +   +  S+ V    +  +  W PG   P +LDGSLPGD GFDP
Sbjct  30   SNFLAGKKLRLRNLNAAAVVAPRSAPVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGFDP  89

Query  274  LGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASS  453
            LGLA DPE+LRW  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF  +
Sbjct  90   LGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAGELEYFTDT  149

Query  454  STLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  150  TTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  183



>ref|XP_004135326.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004171576.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Cucumis sativus]
 gb|KGN51671.1| hypothetical protein Csa_5G589390 [Cucumis sativus]
Length=271

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 101/156 (65%), Gaps = 3/156 (2%)
 Frame = +1

Query  97   TRFLTGSSGKL---NREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            + FLTG   +L   N   +   +  +  V    +  +  W PG   P +LDGSLPGD GF
Sbjct  30   SNFLTGKKLRLRNLNAAATAVVAPRTVPVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGF  89

Query  268  DPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFA  447
            DPLGLA DPE+LRW  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF 
Sbjct  90   DPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFT  149

Query  448  SSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++TLF++E I   + E RRW DI  PGCVN DPIF
Sbjct  150  DTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIF  185



>gb|ACF23028.1| ST49-6 [Eutrema halophilum]
Length=215

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 102/153 (67%), Gaps = 2/153 (1%)
 Frame = +1

Query  103  FLTGSSGKLNREVSFRASTSSSNVSFKIEA--KKGEWLPGLPSPAYLDGSLPGDNGFDPL  276
            FL G   +L  + S  A + S+ +   + A  ++  W PG   P +LDGSLPGD GFDPL
Sbjct  24   FLGGKKLRLKNKASVPAVSRSAALVRAVAADPERPIWFPGSTPPEWLDGSLPGDFGFDPL  83

Query  277  GLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSS  456
            GL+ DP++L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF   +
Sbjct  84   GLSSDPDSLKWNAQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  143

Query  457  TLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            TLFV+E IL  + E RRW DI  PG VN DPIF
Sbjct  144  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIF  176



>ref|XP_008340223.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Malus 
domestica]
Length=271

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 102/150 (68%), Gaps = 6/150 (4%)
 Frame = +1

Query  121  GKLNREVSFRASTSSSNVSFKIEAKKGE-----WLPGLPSPAYLDGSLPGDNGFDPLGLA  285
            G+  R  SF A T SS+ SF + A   +     W PG   P +LDGSLPGD GFDPLGL+
Sbjct  37   GRKLRVRSFTAPTGSSS-SFTVRAAAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLS  95

Query  286  EDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLF  465
             DP++L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF  ++TLF
Sbjct  96   SDPDSLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDTTTLF  155

Query  466  VIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            V+E +L  + E RRW DI  PG VN DPIF
Sbjct  156  VVELVLIGWAEGRRWADILKPGSVNTDPIF  185



>ref|XP_001786080.1| predicted protein [Physcomitrella patens]
 gb|EDQ49108.1| predicted protein [Physcomitrella patens]
Length=278

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGF  267
            ++K  F +G + ++ +  ++     + +     + ++  W PG  +P +LDGSLPGD GF
Sbjct  28   STKASFFSGRALRMTKVAAYTNGDMTISAVAAPQNERPLWFPGSQAPEWLDGSLPGDFGF  87

Query  268  DPLGL------AEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAG  429
            DPLGL        DPE L+W+VQAELV+ RWAMLG AG+ +PE  T++GI+N P W  AG
Sbjct  88   DPLGLVLRTCAGSDPETLKWFVQAELVHCRWAMLGAAGIFIPEALTKMGILNTPSWTVAG  147

Query  430  KSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             ++YF   +TLFVIE ILF + E RRW DI NPGCVN DP+F
Sbjct  148  DADYFTDKTTLFVIELILFAWAEGRRWADIVNPGCVNVDPVF  189



>ref|NP_001147224.1| chlorophyll a-b binding protein [Zea mays]
 gb|ACG26188.1| chlorophyll a-b binding protein [Zea mays]
 emb|CDY43936.1| BnaC04g21740D [Brassica napus]
Length=256

 Score =   166 bits (420),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 105/153 (69%), Gaps = 2/153 (1%)
 Frame = +1

Query  103  FLTGSSGKLNREVSFRASTSSSNVSFKI--EAKKGEWLPGLPSPAYLDGSLPGDNGFDPL  276
            FL G   +LN+++S  A + S+     +  + ++  W PG   P +LDGSLPGD GFDPL
Sbjct  18   FLAGKKLRLNKKLSVPAVSKSAASVRAVAADPERPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  277  GLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSS  456
            GL+ DPE+L+W VQAE+V+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF   +
Sbjct  78   GLSSDPESLKWNVQAEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  457  TLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            TLFV+E IL  + E RRW DI  PG VN DPIF
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIF  170



>emb|CAA55864.1| type II LHCI [Lolium temulentum]
Length=253

 Score =   165 bits (418),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 100/151 (66%), Gaps = 4/151 (3%)
 Frame = +1

Query  115  SSGKLNREVSF----RASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGL  282
            S+G      SF    +A+T SS        ++  W PG   P +LDGSLPGD GFDP GL
Sbjct  17   SNGLAGARTSFLGTGKAATRSSFTVRTAAPERPIWFPGSTPPPWLDGSLPGDFGFDPWGL  76

Query  283  AEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTL  462
              DPE+LRW VQAELV+ RWAMLG AG+ +PE+ T+IGI+N P WY AG+ EYF  ++TL
Sbjct  77   GSDPESLRWNVQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTL  136

Query  463  FVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            FV+E IL  + E RRW DI  PG VN DPIF
Sbjct  137  FVVELILIGWAEGRRWADIIKPGSVNTDPIF  167



>ref|XP_009104311.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Brassica 
rapa]
Length=256

 Score =   165 bits (418),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 101/153 (66%), Gaps = 2/153 (1%)
 Frame = +1

Query  103  FLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE--WLPGLPSPAYLDGSLPGDNGFDPL  276
            FL G   +LN++++  A + S      + A      W PG   P +LDGSLPGD GFDPL
Sbjct  18   FLGGKKLRLNKKLNVPAVSRSGTSVRAVAADPDRPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  277  GLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSS  456
            GL+ DP++L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF   +
Sbjct  78   GLSSDPDSLKWNAQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  457  TLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            TLFV+E IL  + E RRW DI  PG VN DPIF
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIF  170



>ref|XP_001782439.1| predicted protein [Physcomitrella patens]
 gb|EDQ52774.1| predicted protein, partial [Physcomitrella patens]
Length=210

 Score =   164 bits (414),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  205  WLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVF  384
            W PG  +P +LDGSLPGD GFDPLGL  DPE L+W+VQAELV+ RWAMLG AG+ +PE  
Sbjct  5    WFPGSKAPEWLDGSLPGDFGFDPLGLGSDPELLKWFVQAELVHCRWAMLGAAGIFIPEAL  64

Query  385  TQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            T+ GI+N P W  AG  +YFA  +TLFVIE ILF + E RRW DI NPGCVN DP+F
Sbjct  65   TKAGILNTPSWNVAGDQQYFADPTTLFVIELILFAWAEGRRWADIVNPGCVNVDPVF  121



>ref|XP_004310079.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=269

 Score =   165 bits (418),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 105/162 (65%), Gaps = 8/162 (5%)
 Frame = +1

Query  85   CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE-----WLPGLPSPAYLDGSL  249
             A+K  F     G+  R  +  A + SS+ SF++ A   +     W PG   P +LDGSL
Sbjct  26   AATKASFF---GGRKLRVRNVAAPSGSSSTSFRVCAAAADPDRPLWFPGSTPPPWLDGSL  82

Query  250  PGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAG  429
            PGD GFDPLGL+ DP++L+W  QAE+V+ RWAMLG AG+ +PE  T+IGI+N P WY AG
Sbjct  83   PGDFGFDPLGLSSDPDSLKWNTQAEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAG  142

Query  430  KSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            + EYF  ++TLF++E I   + E RRW DI  PG VN DPIF
Sbjct  143  EQEYFTDTTTLFIVELIFIGWAEGRRWADILKPGSVNTDPIF  184



>ref|XP_009138769.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Brassica rapa]
 emb|CDX89120.1| BnaA04g00660D [Brassica napus]
Length=256

 Score =   165 bits (417),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 105/153 (69%), Gaps = 2/153 (1%)
 Frame = +1

Query  103  FLTGSSGKLNREVSFRASTSSSNVSFKI--EAKKGEWLPGLPSPAYLDGSLPGDNGFDPL  276
            FL G   +LN+++S  A + S+     +  + ++  W PG   P +LDGSLPGD GFDPL
Sbjct  18   FLCGKKLRLNKKLSVAAVSKSAASVRAVAADPERPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  277  GLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSS  456
            GL+ DP++L+W VQAE+V+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF   +
Sbjct  78   GLSSDPDSLKWNVQAEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  457  TLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            TLFV+E IL  + E RRW DI  PG VN DPIF
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIF  170



>gb|ABO71660.2| LhCa2 protein [Brassica juncea]
Length=256

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 105/153 (69%), Gaps = 2/153 (1%)
 Frame = +1

Query  103  FLTGSSGKLNREVSFRASTSSSNVSFKI--EAKKGEWLPGLPSPAYLDGSLPGDNGFDPL  276
            FL G   +LN+++S  A + S+     +  + ++  W PG   P +LDGSLPGD GFDPL
Sbjct  18   FLCGKKLRLNKKLSVAAVSKSAASVRAVAADPERPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  277  GLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSS  456
            GL+ DP++L+W VQAE+V+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF   +
Sbjct  78   GLSSDPDSLKWNVQAEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  457  TLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            TLFV+E IL  + E RRW DI  PG VN DPIF
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIF  170



>ref|XP_008389866.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Malus domestica]
Length=336

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = +1

Query  85   CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE-----WLPGLPSPAYLDGSL  249
             A+K  F     G+  R  SF A+  SS+ SF + A   +     W PG   P +LDGSL
Sbjct  93   AATKASFF---GGRKLRVRSFTATKGSSS-SFTVRAAAADPDRPLWFPGSTPPPWLDGSL  148

Query  250  PGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAG  429
            PGD GFDPLGL+ DP++L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG
Sbjct  149  PGDFGFDPLGLSSDPDSLKWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAG  208

Query  430  KSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            + EYF  ++TLFV+E +L  + E RRW DI  PG VN DPIF
Sbjct  209  EQEYFTDTTTLFVVELVLIGWAEGRRWADILKPGSVNTDPIF  250



>ref|XP_010044808.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Eucalyptus 
grandis]
 gb|KCW86917.1| hypothetical protein EUGRSUZ_B03494 [Eucalyptus grandis]
Length=264

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 102/154 (66%), Gaps = 1/154 (1%)
 Frame = +1

Query  97   TRFLTGSSGKLNREVSFRASTSS-SNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDP  273
            + FLTG   ++++  +  A+    + V    +  +  W PG   P +LDGSLPGD GFDP
Sbjct  25   SSFLTGKRLRVSKYTAPAAAAGRLATVCAVADPDRPLWFPGSTPPPWLDGSLPGDFGFDP  84

Query  274  LGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASS  453
            LGL  DPE+LRW  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF  +
Sbjct  85   LGLGSDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDT  144

Query  454  STLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +TLF+IE I   + E RRW DI  PGCVN DPIF
Sbjct  145  TTLFIIELIFIGWAEGRRWADIIKPGCVNTDPIF  178



>ref|XP_010250717.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Nelumbo 
nucifera]
Length=273

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 103/162 (64%), Gaps = 9/162 (6%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE------WLPGLPSPAYLDGSL  249
            ++K  FL    G+  R+  F  +T++   S  + A   +      W PG   P +LDGSL
Sbjct  29   STKASFL---GGRKLRQKKFTTATAAGPRSLSVSAAATDANERPLWFPGSTPPPWLDGSL  85

Query  250  PGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAG  429
            PGD GFDPLGL  DPE+LRW  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG
Sbjct  86   PGDFGFDPLGLGSDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYSAG  145

Query  430  KSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            + EYF  ++TLF+IE I   + E RRW DI  PG VN DPIF
Sbjct  146  ELEYFTDTTTLFIIELIFIGWAEGRRWADIIKPGSVNTDPIF  187



>dbj|BAJ34383.1| unnamed protein product [Thellungiella halophila]
Length=256

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 102/153 (67%), Gaps = 2/153 (1%)
 Frame = +1

Query  103  FLTGSSGKLNREVSFRASTSSSNVSFKIEA--KKGEWLPGLPSPAYLDGSLPGDNGFDPL  276
            FL G   +L  + S  A + S+ +   + A  ++  W PG   P +LDGSLPGD GFDPL
Sbjct  18   FLGGKKLRLKNKASVPAVSRSAALVRAVAADPERPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  277  GLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSS  456
            GL+ DP++L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF   +
Sbjct  78   GLSSDPDSLKWNAQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  457  TLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            TLFV+E IL  + E RRW DI  PG VN DPIF
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIF  170



>emb|CDY51572.1| BnaCnng21010D [Brassica napus]
Length=259

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 103/154 (67%), Gaps = 4/154 (3%)
 Frame = +1

Query  103  FLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE---WLPGLPSPAYLDGSLPGDNGFDP  273
            FL G   +LN++++   + S S  S +  A   +   W PG   P +LDGSLPGD GFDP
Sbjct  18   FLGGKKLRLNKKLNV-PTVSRSGTSVRAVAADPDRPIWFPGSTPPEWLDGSLPGDFGFDP  76

Query  274  LGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASS  453
            LGL+ DP++L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF   
Sbjct  77   LGLSSDPDSLKWNAQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDK  136

Query  454  STLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            +TLFV+E IL  + E RRW DI  PG VN DPIF
Sbjct  137  TTLFVVELILIGWAEGRRWADIIKPGSVNTDPIF  170



>ref|XP_009415903.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=269

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +1

Query  169  NVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAM  348
            +VS     ++  W PG   P +LDGSLPGD GFDPLGL  DPE+LRW  QAE+V+ RWAM
Sbjct  55   SVSAAAAPERPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNQQAEIVHCRWAM  114

Query  349  LGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNP  528
            LG AG+ +PE+ T+IGI+N P WY AG+ +YF  ++TLFVIE IL  + E RRW DI  P
Sbjct  115  LGAAGIFIPELLTKIGILNTPSWYTAGQLQYFTDTTTLFVIELILIGWAEGRRWADIIKP  174

Query  529  GCVNQDPIF  555
            GCVN DPIF
Sbjct  175  GCVNTDPIF  183



>ref|XP_006402477.1| hypothetical protein EUTSA_v10006165mg [Eutrema salsugineum]
 gb|ESQ43930.1| hypothetical protein EUTSA_v10006165mg [Eutrema salsugineum]
Length=271

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 102/153 (67%), Gaps = 2/153 (1%)
 Frame = +1

Query  103  FLTGSSGKLNREVSFRASTSSSNVSFKIEA--KKGEWLPGLPSPAYLDGSLPGDNGFDPL  276
            FL G   +L  + S  A + S+ +   + A  ++  W PG   P +LDGSLPGD GFDPL
Sbjct  18   FLGGKKLRLKNKASVPAVSRSAALVRAVAADPERPIWFPGSTPPEWLDGSLPGDFGFDPL  77

Query  277  GLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSS  456
            GL+ DP++L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF   +
Sbjct  78   GLSSDPDSLKWNAQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKT  137

Query  457  TLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            TLFV+E IL  + E RRW DI  PG VN DPIF
Sbjct  138  TLFVVELILIGWAEGRRWADIIKPGSVNTDPIF  170



>gb|EPS71951.1| chlorophyll a-b binding protein 7, chloroplastic, partial [Genlisea 
aurea]
Length=259

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = +1

Query  205  WLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVF  384
            W PG   PA+LDGSLPGD GFDPLGLA DP++L+W  Q+ELV+GRWAMLG AG+ +PE  
Sbjct  57   WFPGSTPPAWLDGSLPGDFGFDPLGLASDPDSLKWNQQSELVHGRWAMLGAAGIFIPEFL  116

Query  385  TQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            T+IGI+N P WY AG+ EYF  ++TLF+IE IL  + E RRW DI  PG VN DPIF
Sbjct  117  TKIGILNTPSWYTAGEQEYFTDTTTLFIIELILIGWAEGRRWADIIKPGSVNTDPIF  173



>gb|EYU25891.1| hypothetical protein MIMGU_mgv1a025195mg, partial [Erythranthe 
guttata]
Length=250

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 105/158 (66%), Gaps = 5/158 (3%)
 Frame = +1

Query  88   ASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE--WLPGLPSPAYLDGSLPGDN  261
            A+K  F  G   ++++   F A +++ +V+  + A      W PG   P +LDGSLPGD 
Sbjct  10   ATKASFFGGRKLRVSK---FAAPSNTRSVAVCVAADPDRPIWFPGSTPPEWLDGSLPGDF  66

Query  262  GFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEY  441
            GFDPLGL  DP++L+W  QAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EY
Sbjct  67   GFDPLGLGSDPDSLKWNAQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEY  126

Query  442  FASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            F  ++TLF++E +L  + E RRW DI  PG VN DPIF
Sbjct  127  FTDTTTLFIVELVLIGWAEGRRWADIIKPGSVNTDPIF  164



>gb|AAL74385.1|AF359117_1 LHC I type II chlorophyll binding protein [Pinus sylvestris]
 gb|AAL74386.1|AF359118_1 LHC I type II chlorophyll binding protein [Pinus sylvestris]
Length=137

 Score =   159 bits (403),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 91/130 (70%), Gaps = 0/130 (0%)
 Frame = +1

Query  160  SSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGR  339
            ++  VS  ++ ++  W PG   P +LDGSLPGD GFDPLGL  DPE L+W VQAELV+ R
Sbjct  8    AAVTVSQAVQTERPLWFPGNTPPPWLDGSLPGDFGFDPLGLGSDPETLKWMVQAELVHCR  67

Query  340  WAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDI  519
            WAMLG AG+ +PE+ T++GI+N P WY AG+ EYF   +TLFV+E I   + E RRW DI
Sbjct  68   WAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDKTTLFVVEMIFLGWAEGRRWADI  127

Query  520  KNPGCVNQDP  549
              PG VN DP
Sbjct  128  LKPGSVNTDP  137



>pdb|2O01|2 Chain 2, The Structure Of A Plant Photosystem I Supercomplex 
At 3.4 Angstrom Resolution
Length=186

 Score =   160 bits (406),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +1

Query  226  PAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIIN  405
            P +LDGSLPGD GFDPLGL+ DPE+LRW VQAELV+ RWAMLG AG+ +PE  T++GI+N
Sbjct  1    PEWLDGSLPGDFGFDPLGLSSDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILN  60

Query  406  APKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
             P WY AG+ EYF  ++TLF++E +   + E RRW DI NPGCVN DPIF
Sbjct  61   TPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIF  110



>ref|XP_001758295.1| predicted protein [Physcomitrella patens]
 gb|EDQ76697.1| predicted protein [Physcomitrella patens]
Length=270

 Score =   163 bits (412),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 104/167 (62%), Gaps = 5/167 (3%)
 Frame = +1

Query  64   SAAVFRPCASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGE---WLPGLPSPAY  234
            S  V    +++T FL G + +  +     A+     VS  +   K +   WLPG  +P +
Sbjct  20   SKVVSNVGSARTSFLAGRALRTTQVCG--AAKGDMTVSATLTGNKTDRPLWLPGSEAPKW  77

Query  235  LDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPK  414
            LDGSLPGD GFDPL LA +P  L W VQAELV+ RWAMLG AG+ +PE+ T+IGI+N P 
Sbjct  78   LDGSLPGDYGFDPLDLAAEPGRLNWMVQAELVHCRWAMLGAAGIFIPELLTKIGILNTPS  137

Query  415  WYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            WY AG + YFA   TLF++E +L  + E RRW DI  PG VN DPIF
Sbjct  138  WYKAGDATYFADQGTLFIVELLLMAWAESRRWADIARPGSVNTDPIF  184



>ref|XP_010469082.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Camelina 
sativa]
Length=255

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = +1

Query  103  FLTGSSGKLNREVSFRASTSSSNV-SFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLG  279
            FL G   +L +      S   ++V +   + ++  W PG   P +LDGSLPGD GFDPLG
Sbjct  18   FLGGKKLRLKKLTVPAVSRPDASVRAVAADPERPIWFPGSTPPEWLDGSLPGDFGFDPLG  77

Query  280  LAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSST  459
            L+ DP++L+W VQAELV+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF   +T
Sbjct  78   LSSDPDSLKWNVQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGEQEYFTDKTT  137

Query  460  LFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            LFV+E IL  + E RRW DI  PG VN DP+F
Sbjct  138  LFVVELILIGWAEGRRWADIIKPGSVNTDPVF  169



>emb|CAN72005.1| hypothetical protein VITISV_033663 [Vitis vinifera]
Length=272

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 97/152 (64%), Gaps = 6/152 (4%)
 Frame = +1

Query  115  SSGKLNREVSFRASTSSSNVSFKIEAKKGE-----WLPGLPSPAYLDGSLPGDNGFDPLG  279
            S G+      F A  + +  SF + A   +     W PG   P +LDGSLPGD GFDPLG
Sbjct  36   SWGEETEPEEFTAPAAGTR-SFTVSAAAADPNRPLWFPGSTPPPWLDGSLPGDFGFDPLG  94

Query  280  LAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSST  459
            L  DPE L+W VQ+E+V+ RWAMLG AG+ +PE  T+IGI+N P WY AG+ EYF   +T
Sbjct  95   LGSDPETLKWMVQSEIVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFTDKTT  154

Query  460  LFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            LF++E I   + E RRW DI  PGCVN DPIF
Sbjct  155  LFIVEMIFIGWAEGRRWADIIKPGCVNTDPIF  186



>gb|KHN16392.1| Chlorophyll a-b binding protein 7, chloroplastic [Glycine soja]
Length=452

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 100/152 (66%), Gaps = 1/152 (1%)
 Frame = +1

Query  103  FLTGSSGKLNRE-VSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLG  279
            FL+G   ++ +E  +    +  + V    E  +  W PG   P +LDG+LPGD GFDPLG
Sbjct  215  FLSGRKLRVKKERAAIGGRSMGTTVCAVAEPDRPLWFPGSTPPPWLDGTLPGDFGFDPLG  274

Query  280  LAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSST  459
            L  DPE+LRW VQAELV+ RWAMLG AG+ +PE  T+IG++N P WY AG+ EYF  ++T
Sbjct  275  LGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGVLNTPSWYSAGELEYFTDTTT  334

Query  460  LFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            LF++E     + E RRW DI  PGCVN DPIF
Sbjct  335  LFIVELFFIGWAEGRRWADIIKPGCVNTDPIF  366



>tpg|DAA41205.1| TPA: hypothetical protein ZEAMMB73_510089 [Zea mays]
 tpg|DAA41206.1| TPA: hypothetical protein ZEAMMB73_510089 [Zea mays]
Length=196

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = +1

Query  148  RASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAEL  327
             A+  S  V    +  +  W PG   P +LDGSLPGD GFDP GL  DPE+LRW VQAEL
Sbjct  39   EAARPSFAVRAAADPNRPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAEL  98

Query  328  VNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRR  507
            V+ RWAMLG AG+ +PE  T+IG++N P WY AG+ +YF  ++TLF+IE IL  + E RR
Sbjct  99   VHCRWAMLGAAGIFIPEFLTKIGVLNTPFWYTAGEQQYFTDTTTLFIIELILIGWAEGRR  158

Query  508  WQDIKNPGCVNQDPIF  555
            W DI  PG VN DPIF
Sbjct  159  WADIIKPGSVNTDPIF  174



>tpg|DAA41204.1| TPA: hypothetical protein ZEAMMB73_510089 [Zea mays]
Length=199

 Score =   159 bits (402),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 92/136 (68%), Gaps = 0/136 (0%)
 Frame = +1

Query  148  RASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAEL  327
             A+  S  V    +  +  W PG   P +LDGSLPGD GFDP GL  DPE+LRW VQAEL
Sbjct  39   EAARPSFAVRAAADPNRPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAEL  98

Query  328  VNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRR  507
            V+ RWAMLG AG+ +PE  T+IG++N P WY AG+ +YF  ++TLF+IE IL  + E RR
Sbjct  99   VHCRWAMLGAAGIFIPEFLTKIGVLNTPFWYTAGEQQYFTDTTTLFIIELILIGWAEGRR  158

Query  508  WQDIKNPGCVNQDPIF  555
            W DI  PG VN DPIF
Sbjct  159  WADIIKPGSVNTDPIF  174



>ref|XP_002984998.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ13873.1| light-harvesting complex [Selaginella moellendorffii]
Length=268

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 105/157 (67%), Gaps = 1/157 (1%)
 Frame = +1

Query  85   CASKTRFLTGSSGKLNREVSFRASTSSSNVSFKIEAKKGEWLPGLPSPAYLDGSLPGDNG  264
             ++KT FL G   + N+    +A+ +  +V+     ++  W PG   PA+LDGSLP D G
Sbjct  27   VSAKTTFLAGRPLR-NKAHVAKAAKAVFSVTAAAATERPLWFPGSTPPAWLDGSLPADFG  85

Query  265  FDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTQIGIINAPKWYDAGKSEYF  444
            FDPLGL  +PE L+W+VQ+E+V+ RWAMLG AG+ +PE  T++GI+N P WY AG+ EYF
Sbjct  86   FDPLGLGSEPELLKWFVQSEIVHSRWAMLGAAGIFIPEALTKLGILNTPFWYTAGEQEYF  145

Query  445  ASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
               +TLF++E IL  + E RRW DI  PG VN DP+F
Sbjct  146  TDQTTLFIVEMILLGWAEGRRWADILKPGSVNTDPVF  182



>ref|XP_002876615.1| Lhca2 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52874.1| Lhca2 protein [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   160 bits (405),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  205  WLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVF  384
            W PG   P +LDGSLPGD GFDPLGL+ DP++L+W VQAELV+ RWAMLG AG+ +PE  
Sbjct  55   WFPGSTPPEWLDGSLPGDFGFDPLGLSSDPDSLKWNVQAELVHCRWAMLGAAGIFIPEFL  114

Query  385  TQIGIINAPKWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIF  555
            T+IGI+N P WY AG+ EYF   +TLFV+E IL  + E RRW DI  PG VN DP+F
Sbjct  115  TKIGILNTPSWYTAGEQEYFTDKTTLFVVELILIGWAEGRRWADIIKPGSVNTDPVF  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800