BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K16

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230256.1|  PREDICTED: auxin-repressed 12.5 kDa protein        108   2e-26   Solanum lycopersicum
ref|NP_001275423.1|  auxin-repressed 12.5 kDa protein-like              106   1e-25   Solanum tuberosum [potatoes]
ref|XP_002512449.1|  conserved hypothetical protein                     103   3e-24   
ref|XP_007144957.1|  hypothetical protein PHAVU_007G197700g             101   8e-24   Phaseolus vulgaris [French bean]
ref|XP_009611305.1|  PREDICTED: auxin-repressed 12.5 kDa protein        101   1e-23   Nicotiana tomentosiformis
ref|XP_009760621.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...    101   1e-23   Nicotiana sylvestris
gb|AGV54698.1|  hypothetical protein                                    100   2e-23   Phaseolus vulgaris [French bean]
gb|AGV54550.1|  dormancy/auxin associated protein Drm3                  100   3e-23   Phaseolus vulgaris [French bean]
ref|XP_010105309.1|  hypothetical protein L484_001569                   103   5e-23   
ref|XP_011092092.1|  PREDICTED: uncharacterized protein LOC105172...  99.0    9e-23   Sesamum indicum [beniseed]
ref|XP_002283180.1|  PREDICTED: uncharacterized protein LOC100245909  97.1    4e-22   Vitis vinifera
gb|EYU42188.1|  hypothetical protein MIMGU_mgv1a016078mg              97.1    6e-22   Erythranthe guttata [common monkey flower]
ref|XP_003521684.1|  PREDICTED: uncharacterized protein LOC100805...  95.1    3e-21   Glycine max [soybeans]
ref|XP_007031019.1|  Drm3-like protein isoform 1                      94.7    4e-21   
ref|XP_006577224.1|  PREDICTED: uncharacterized protein LOC100805...  94.7    4e-21   Glycine max [soybeans]
gb|KJB78439.1|  hypothetical protein B456_013G205900                  94.4    5e-21   Gossypium raimondii
gb|KJB45318.1|  hypothetical protein B456_007G300900                  94.4    6e-21   Gossypium raimondii
gb|KJB78437.1|  hypothetical protein B456_013G205900                  94.4    6e-21   Gossypium raimondii
ref|XP_007031021.1|  Dormancy/auxin associated family protein iso...  93.6    6e-21   
gb|KHG14651.1|  Auxin-repressed 12.5 kDa                              94.0    7e-21   Gossypium arboreum [tree cotton]
gb|KJB78438.1|  hypothetical protein B456_013G205900                  93.2    1e-20   Gossypium raimondii
gb|KHG05150.1|  Auxin-repressed 12.5 kDa                              93.2    2e-20   Gossypium arboreum [tree cotton]
ref|XP_006604803.1|  PREDICTED: uncharacterized protein LOC100814...  94.7    2e-20   Glycine max [soybeans]
ref|XP_006604804.1|  PREDICTED: uncharacterized protein LOC100814...  94.7    2e-20   Glycine max [soybeans]
gb|EYU42186.1|  hypothetical protein MIMGU_mgv1a016078mg              92.0    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_011087434.1|  PREDICTED: uncharacterized protein LOC105168...  92.8    2e-20   Sesamum indicum [beniseed]
ref|XP_007031022.1|  Dormancy/auxin associated family protein iso...  92.8    2e-20   
gb|KHN43309.1|  hypothetical protein glysoja_001892                   94.7    3e-20   Glycine soja [wild soybean]
ref|XP_010480218.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  92.0    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010414955.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  92.0    5e-20   Camelina sativa [gold-of-pleasure]
gb|EYU42187.1|  hypothetical protein MIMGU_mgv1a016078mg              92.0    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_010511246.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  92.0    6e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010511245.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  91.7    7e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010414954.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  91.3    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010549655.1|  PREDICTED: uncharacterized protein LOC104820...  90.9    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_010549640.1|  PREDICTED: uncharacterized protein LOC104820...  91.3    1e-19   Tarenaya hassleriana [spider flower]
ref|XP_010549646.1|  PREDICTED: uncharacterized protein LOC104820...  90.9    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_006396488.1|  hypothetical protein EUTSA_v10029065mg           90.5    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_007031020.1|  Dormancy/auxin associated family protein iso...  89.7    3e-19   
ref|XP_011092093.1|  PREDICTED: uncharacterized protein LOC105172...  89.4    3e-19   Sesamum indicum [beniseed]
ref|XP_010528902.1|  PREDICTED: uncharacterized protein LOC104805...  89.7    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_010269574.1|  PREDICTED: uncharacterized protein LOC104606...  89.0    6e-19   Nelumbo nucifera [Indian lotus]
ref|XP_009134413.1|  PREDICTED: uncharacterized protein LOC103858...  88.2    6e-19   
emb|CDP17198.1|  unnamed protein product                              88.6    7e-19   Coffea canephora [robusta coffee]
ref|XP_006302769.1|  hypothetical protein CARUB_v10020890mg           90.9    8e-19   
emb|CDX91313.1|  BnaC02g27240D                                        88.2    1e-18   
emb|CDY66288.1|  BnaA03g57280D                                        87.4    1e-18   Brassica napus [oilseed rape]
ref|XP_009134411.1|  PREDICTED: uncharacterized protein LOC103858...  87.8    2e-18   Brassica rapa
ref|XP_010528900.1|  PREDICTED: uncharacterized protein LOC104805...  87.8    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_009134409.1|  PREDICTED: uncharacterized protein LOC103858...  87.8    2e-18   
ref|NP_001077728.1|  dormancy/auxin associated protein                87.0    2e-18   
ref|XP_010528901.1|  PREDICTED: uncharacterized protein LOC104805...  87.4    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_006302768.1|  hypothetical protein CARUB_v10020890mg           89.4    2e-18   
gb|KHN16098.1|  hypothetical protein glysoja_012074                   87.4    2e-18   Glycine soja [wild soybean]
emb|CDY21913.1|  BnaC09g00190D                                        87.4    3e-18   Brassica napus [oilseed rape]
ref|NP_849819.1|  dormancy/auxin associated protein                   86.7    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147009.1|  hypothetical protein PHAVU_006G089000g           87.4    4e-18   Phaseolus vulgaris [French bean]
ref|XP_010259525.1|  PREDICTED: uncharacterized protein LOC104598926  86.7    4e-18   Nelumbo nucifera [Indian lotus]
ref|NP_564714.1|  dormancy/auxin associated protein                   87.0    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849820.1|  dormancy/auxin associated protein                   87.0    5e-18   
ref|XP_009134414.1|  PREDICTED: uncharacterized protein LOC103858...  85.5    5e-18   
emb|CDY10536.1|  BnaC03g70780D                                        86.3    5e-18   Brassica napus [oilseed rape]
ref|XP_009782454.1|  PREDICTED: uncharacterized protein LOC104231...  86.3    5e-18   Nicotiana sylvestris
ref|XP_010025248.1|  PREDICTED: uncharacterized protein LOC104415...  86.7    6e-18   Eucalyptus grandis [rose gum]
gb|ABK96622.1|  unknown                                               86.3    6e-18   Populus trichocarpa x Populus deltoides
emb|CDY18000.1|  BnaC03g30720D                                        86.3    6e-18   Brassica napus [oilseed rape]
gb|AAN72002.1|  expressed protein                                     86.7    7e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDX97284.1|  BnaA02g20750D                                        85.9    7e-18   
ref|XP_010025247.1|  PREDICTED: uncharacterized protein LOC104415...  86.3    8e-18   Eucalyptus grandis [rose gum]
gb|KHN20250.1|  hypothetical protein glysoja_023813                   85.5    1e-17   Glycine soja [wild soybean]
ref|XP_009134412.1|  PREDICTED: uncharacterized protein LOC103858...  85.1    1e-17   Brassica rapa
ref|XP_009134410.1|  PREDICTED: uncharacterized protein LOC103858...  85.1    2e-17   
ref|XP_009144547.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  85.1    2e-17   Brassica rapa
ref|XP_011023705.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  84.3    2e-17   Populus euphratica
ref|XP_002891943.1|  hypothetical protein ARALYDRAFT_474784           84.7    2e-17   
gb|KFK35518.1|  hypothetical protein AALP_AA4G001500                  84.3    3e-17   Arabis alpina [alpine rockcress]
gb|KFK35519.1|  hypothetical protein AALP_AA4G001500                  84.3    3e-17   Arabis alpina [alpine rockcress]
ref|XP_011023703.1|  PREDICTED: uncharacterized protein LOC105125...  84.7    3e-17   Populus euphratica
gb|AAM62421.1|AF515795_1  Drm3                                        84.0    4e-17   Pisum sativum [garden pea]
ref|XP_003626227.1|  Drm3                                             83.6    5e-17   Medicago truncatula
ref|XP_003626228.1|  Drm3                                             84.0    5e-17   Medicago truncatula
gb|KGN60960.1|  hypothetical protein Csa_2G031190                     83.6    5e-17   Cucumis sativus [cucumbers]
ref|XP_003626229.1|  Drm3                                             83.2    5e-17   
ref|XP_011023704.1|  PREDICTED: uncharacterized protein LOC105125...  84.0    6e-17   Populus euphratica
ref|XP_011023702.1|  PREDICTED: uncharacterized protein LOC105125...  84.0    6e-17   Populus euphratica
ref|XP_004144777.1|  PREDICTED: uncharacterized protein LOC101210613  83.2    9e-17   Cucumis sativus [cucumbers]
ref|XP_006375740.1|  hypothetical protein POPTR_0013s01640g           83.2    9e-17   Populus trichocarpa [western balsam poplar]
ref|XP_003591159.1|  Auxin-repressed 12.5 kDa protein                 83.2    9e-17   Medicago truncatula
ref|XP_006375741.1|  hypothetical protein POPTR_0013s01640g           83.2    1e-16   
ref|XP_003591161.1|  Auxin-repressed 12.5 kDa protein                 82.4    1e-16   
ref|XP_009111260.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  82.4    1e-16   Brassica rapa
gb|AAM62422.1|AF515796_1  Drm4                                        82.8    1e-16   Pisum sativum [garden pea]
ref|XP_008454082.1|  PREDICTED: uncharacterized protein LOC103494...  82.4    1e-16   Cucumis melo [Oriental melon]
ref|XP_003591160.1|  Auxin-repressed 12.5 kDa protein                 82.4    2e-16   Medicago truncatula
ref|XP_002319507.1|  dormancy/auxin associated family protein         82.4    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006375739.1|  hypothetical protein POPTR_0013s01640g           82.4    2e-16   Populus trichocarpa [western balsam poplar]
gb|AGM20674.1|  dormancy/auxin associated protein                     84.3    2e-16   Populus tomentosa [Chinese white poplar]
ref|XP_008454074.1|  PREDICTED: uncharacterized protein LOC103494...  81.6    3e-16   Cucumis melo [Oriental melon]
gb|KCW61860.1|  hypothetical protein EUGRSUZ_H04545                   82.0    3e-16   Eucalyptus grandis [rose gum]
emb|CDY22075.1|  BnaA09g01040D                                        80.9    6e-16   Brassica napus [oilseed rape]
gb|EPS59282.1|  drm3-like protein                                     79.7    1e-15   Genlisea aurea
ref|XP_004494583.1|  PREDICTED: uncharacterized protein LOC101493...  79.3    2e-15   
ref|XP_004494582.1|  PREDICTED: uncharacterized protein LOC101493...  79.3    2e-15   Cicer arietinum [garbanzo]
ref|XP_009411670.1|  PREDICTED: uncharacterized protein LOC103993...  79.7    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006433430.1|  hypothetical protein CICLE_v10002843mg           78.6    2e-15   
ref|XP_006382465.1|  hypothetical protein POPTR_0005s02410g           79.0    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_004494581.1|  PREDICTED: uncharacterized protein LOC101493...  78.6    4e-15   Cicer arietinum [garbanzo]
gb|KJB45967.1|  hypothetical protein B456_007G341000                  78.6    4e-15   Gossypium raimondii
ref|XP_006382464.1|  dormancy/auxin associated family protein         78.6    4e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006433432.1|  hypothetical protein CICLE_v10002843mg           78.6    4e-15   Citrus clementina [clementine]
gb|KDO56183.1|  hypothetical protein CISIN_1g033116mg                 78.6    4e-15   Citrus sinensis [apfelsine]
ref|XP_006433431.1|  hypothetical protein CICLE_v10002843mg           78.2    5e-15   
ref|XP_010043047.1|  PREDICTED: uncharacterized protein LOC104432...  78.2    5e-15   Eucalyptus grandis [rose gum]
ref|XP_010674069.1|  PREDICTED: uncharacterized protein LOC104890...  78.2    5e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO56182.1|  hypothetical protein CISIN_1g033116mg                 78.2    6e-15   Citrus sinensis [apfelsine]
ref|XP_004494580.1|  PREDICTED: uncharacterized protein LOC101493...  78.6    6e-15   
ref|XP_008246439.1|  PREDICTED: uncharacterized protein LOC103344...  78.2    6e-15   Prunus mume [ume]
ref|XP_011036884.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  78.2    7e-15   Populus euphratica
ref|XP_011036882.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  78.2    7e-15   Populus euphratica
ref|XP_008246440.1|  PREDICTED: uncharacterized protein LOC103344...  78.2    7e-15   Prunus mume [ume]
ref|XP_011036883.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  77.8    7e-15   Populus euphratica
ref|XP_011036880.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  78.2    8e-15   Populus euphratica
ref|XP_010043046.1|  PREDICTED: uncharacterized protein LOC104432...  77.8    9e-15   Eucalyptus grandis [rose gum]
ref|XP_010674068.1|  PREDICTED: uncharacterized protein LOC104890...  77.8    9e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW85067.1|  hypothetical protein EUGRSUZ_B01910                   77.0    1e-14   Eucalyptus grandis [rose gum]
ref|XP_009618231.1|  PREDICTED: uncharacterized protein LOC104110...  76.3    2e-14   Nicotiana tomentosiformis
gb|KHG12160.1|  Auxin-repressed 12.5 kDa                              76.3    2e-14   Gossypium arboreum [tree cotton]
ref|XP_009782455.1|  PREDICTED: uncharacterized protein LOC104231...  75.5    4e-14   Nicotiana sylvestris
ref|XP_009338244.1|  PREDICTED: uncharacterized protein LOC103930...  75.1    1e-13   Pyrus x bretschneideri [bai li]
ref|NP_001287926.1|  uncharacterized protein LOC101493302             74.7    1e-13   Cicer arietinum [garbanzo]
ref|XP_009338245.1|  PREDICTED: uncharacterized protein LOC103930...  74.7    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_009411671.1|  PREDICTED: uncharacterized protein LOC103993...  74.3    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008363969.1|  PREDICTED: uncharacterized protein LOC103427...  74.3    2e-13   
ref|XP_008363970.1|  PREDICTED: uncharacterized protein LOC103427...  74.3    2e-13   Malus domestica [apple tree]
ref|XP_007206134.1|  hypothetical protein PRUPE_ppa013236mg           73.6    3e-13   Prunus persica
ref|XP_007206135.1|  hypothetical protein PRUPE_ppa013236mg           73.6    3e-13   Prunus persica
ref|XP_010921658.1|  PREDICTED: uncharacterized protein LOC105045183  73.6    3e-13   Elaeis guineensis
ref|NP_001237812.1|  uncharacterized protein LOC100306373             73.6    3e-13   
ref|XP_008388528.1|  PREDICTED: uncharacterized protein LOC103450...  72.4    1e-12   
ref|XP_008789854.1|  PREDICTED: uncharacterized protein LOC103707231  72.0    1e-12   Phoenix dactylifera
ref|XP_010938382.1|  PREDICTED: uncharacterized protein LOC105057465  71.6    1e-12   Elaeis guineensis
ref|XP_008388526.1|  PREDICTED: uncharacterized protein LOC103450...  72.0    1e-12   
ref|XP_009382530.1|  PREDICTED: uncharacterized protein LOC103970...  70.9    3e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784751.1|  PREDICTED: uncharacterized protein LOC103703620  70.9    3e-12   Phoenix dactylifera
ref|XP_010100964.1|  hypothetical protein L484_004927                 69.7    5e-12   
ref|XP_011036881.1|  PREDICTED: uncharacterized protein LOC105134...  69.3    1e-11   Populus euphratica
gb|ABB72822.1|  Drm3-like protein-like protein                        65.9    6e-11   Solanum tuberosum [potatoes]
ref|XP_004302272.1|  PREDICTED: uncharacterized protein LOC101299...  67.0    6e-11   Fragaria vesca subsp. vesca
ref|XP_011466170.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  66.6    8e-11   Fragaria vesca subsp. vesca
ref|XP_009401626.1|  PREDICTED: uncharacterized protein LOC103985603  65.5    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004241920.1|  PREDICTED: auxin-repressed 12.5 kDa protein      64.3    5e-10   
ref|XP_009382529.1|  PREDICTED: uncharacterized protein LOC103970...  64.3    6e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008450631.1|  PREDICTED: uncharacterized protein LOC103492161  63.9    7e-10   Cucumis melo [Oriental melon]
ref|XP_009385017.1|  PREDICTED: uncharacterized protein LOC103972408  63.9    7e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006357424.1|  PREDICTED: uncharacterized protein LOC102600721  62.0    3e-09   Solanum tuberosum [potatoes]
ref|XP_009618232.1|  PREDICTED: uncharacterized protein LOC104110...  60.8    6e-09   Nicotiana tomentosiformis
ref|XP_010914472.1|  PREDICTED: uncharacterized protein LOC105039...  59.7    2e-08   Elaeis guineensis
ref|XP_010914470.1|  PREDICTED: uncharacterized protein LOC105039...  59.3    3e-08   Elaeis guineensis
ref|XP_011467460.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  58.9    3e-08   Fragaria vesca subsp. vesca
ref|XP_004303724.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  58.9    3e-08   Fragaria vesca subsp. vesca
ref|XP_009605489.1|  PREDICTED: putative protein TPRXL                59.3    3e-08   Nicotiana tomentosiformis
ref|XP_004303723.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  58.5    5e-08   Fragaria vesca subsp. vesca
ref|XP_006840584.1|  hypothetical protein AMTR_s00045p00231900        58.2    7e-08   Amborella trichopoda
ref|XP_010654395.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  57.8    8e-08   Vitis vinifera
ref|XP_003632757.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  57.8    1e-07   Vitis vinifera
ref|XP_010654394.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  57.4    1e-07   Vitis vinifera
gb|EMT26445.1|  hypothetical protein F775_29139                       57.8    1e-07   
ref|XP_006843845.1|  hypothetical protein AMTR_s00007p00261640        57.0    1e-07   Amborella trichopoda
dbj|BAK01749.1|  predicted protein                                    57.0    2e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24785.1|  unknown                                               57.0    2e-07   Picea sitchensis
ref|XP_011087435.1|  PREDICTED: uncharacterized protein LOC105168...  56.2    2e-07   
gb|AFK38489.1|  unknown                                               56.6    2e-07   Medicago truncatula
ref|XP_006829426.1|  hypothetical protein AMTR_s00128p00106650        55.5    3e-07   
gb|ABK21467.1|  unknown                                               56.6    3e-07   Picea sitchensis
ref|XP_009794757.1|  PREDICTED: uncharacterized protein LOC104241514  55.8    4e-07   Nicotiana sylvestris
gb|AFK45827.1|  unknown                                               55.1    8e-07   Medicago truncatula
gb|ACJ85880.1|  unknown                                               55.1    9e-07   Medicago truncatula
ref|XP_004135608.1|  PREDICTED: uncharacterized protein LOC101205077  55.1    9e-07   Cucumis sativus [cucumbers]
emb|CDO97812.1|  unnamed protein product                              54.7    1e-06   Coffea canephora [robusta coffee]
ref|NP_001050075.2|  Os03g0342900                                     54.3    2e-06   
ref|XP_010104602.1|  hypothetical protein L484_005033                 54.7    2e-06   Morus notabilis
ref|XP_006829287.1|  hypothetical protein AMTR_s00001p00272960        53.9    2e-06   Amborella trichopoda
gb|KJB34913.1|  hypothetical protein B456_006G090200                  53.9    2e-06   Gossypium raimondii
dbj|BAJ85165.1|  predicted protein                                    53.9    2e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008228143.1|  PREDICTED: uncharacterized protein LOC103327...  53.5    2e-06   Prunus mume [ume]
ref|XP_008228142.1|  PREDICTED: uncharacterized protein LOC103327...  53.5    2e-06   Prunus mume [ume]
gb|ABK23998.1|  unknown                                               54.3    2e-06   Picea sitchensis
gb|ADP94920.1|  dormancy/auxin associated-like protein                54.3    2e-06   Picea sitchensis
gb|ACN41230.1|  unknown                                               54.3    2e-06   Picea sitchensis
gb|KHN37683.1|  hypothetical protein glysoja_007386                   53.1    2e-06   Glycine soja [wild soybean]
gb|ADP94916.1|  dormancy/auxin associated-like protein                54.3    3e-06   Picea sitchensis
ref|XP_007024723.1|  Dormancy/auxin associated family protein, pu...  54.7    3e-06   
ref|XP_008228141.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  53.5    3e-06   Prunus mume [ume]
gb|ADP94910.1|  dormancy/auxin associated-like protein                54.3    3e-06   Picea sitchensis
ref|XP_003528660.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  53.1    3e-06   Glycine max [soybeans]
ref|XP_007135404.1|  hypothetical protein PHAVU_010G126600g           53.1    3e-06   Phaseolus vulgaris [French bean]
ref|XP_003528661.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  53.1    3e-06   Glycine max [soybeans]
ref|XP_010260275.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  53.1    3e-06   Nelumbo nucifera [Indian lotus]
ref|XP_007135403.1|  hypothetical protein PHAVU_010G126600g           53.1    4e-06   Phaseolus vulgaris [French bean]
gb|KHN39595.1|  hypothetical protein glysoja_020673                   52.8    4e-06   Glycine soja [wild soybean]
ref|XP_002465296.1|  hypothetical protein SORBIDRAFT_01g035780        53.1    4e-06   Sorghum bicolor [broomcorn]
ref|XP_011036510.1|  PREDICTED: uncharacterized protein LOC105133...  53.1    4e-06   Populus euphratica
ref|XP_011036509.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  53.1    4e-06   Populus euphratica
ref|XP_010272386.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  52.8    4e-06   Nelumbo nucifera [Indian lotus]
ref|XP_007217191.1|  hypothetical protein PRUPE_ppa013609mg           52.8    5e-06   Prunus persica
gb|ABK23285.1|  unknown                                               53.5    5e-06   Picea sitchensis
ref|XP_011036508.1|  PREDICTED: uncharacterized protein LOC105133...  53.1    5e-06   Populus euphratica
ref|XP_002304241.1|  dormancy/auxin associated family protein         52.8    5e-06   Populus trichocarpa [western balsam poplar]
gb|ABF95871.1|  Dormancy/auxin associated protein, expressed          52.8    5e-06   Oryza sativa Japonica Group [Japonica rice]
gb|ABK26844.1|  unknown                                               53.1    5e-06   Picea sitchensis
gb|ADP94917.1|  dormancy/auxin associated-like protein                53.5    6e-06   Picea sitchensis
tpg|DAA61631.1|  TPA: hypothetical protein ZEAMMB73_530962            52.8    6e-06   
gb|ABF95870.1|  Dormancy/auxin associated protein, expressed          52.8    6e-06   Oryza sativa Japonica Group [Japonica rice]
gb|ADP94909.1|  dormancy/auxin associated-like protein                53.1    6e-06   Picea sitchensis
gb|ADP94925.1|  dormancy/auxin associated-like protein                53.1    6e-06   Picea sitchensis
gb|ADP94914.1|  dormancy/auxin associated-like protein                53.1    6e-06   Picea sitchensis
gb|ADP94908.1|  dormancy/auxin associated-like protein                53.1    6e-06   Picea sitchensis
ref|XP_010685256.1|  PREDICTED: auxin-repressed 12.5 kDa protein      52.8    6e-06   Beta vulgaris subsp. vulgaris [field beet]
gb|ADP94927.1|  dormancy/auxin associated-like protein                53.1    6e-06   Picea sitchensis
tpg|DAA45292.1|  TPA: hypothetical protein ZEAMMB73_352048            52.8    7e-06   
ref|XP_009408653.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  52.4    7e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008383701.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  52.0    8e-06   Malus domestica [apple tree]
tpg|DAA61632.1|  TPA: hypothetical protein ZEAMMB73_530962            52.8    8e-06   
tpg|DAA48815.1|  TPA: hypothetical protein ZEAMMB73_036539            52.0    8e-06   
gb|ABK96319.1|  unknown                                               52.0    9e-06   Populus trichocarpa x Populus deltoides
ref|NP_001141193.1|  hypothetical protein                             52.4    9e-06   Zea mays [maize]
ref|NP_001130689.1|  uncharacterized protein LOC100191792             52.4    9e-06   Zea mays [maize]
gb|KHN01447.1|  hypothetical protein glysoja_009653                   52.0    9e-06   Glycine soja [wild soybean]
gb|EEE59040.1|  hypothetical protein OsJ_10798                        52.4    9e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AFW88431.1|  hypothetical protein ZEAMMB73_546966                  52.4    1e-05   
ref|XP_011048592.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  52.0    1e-05   Populus euphratica
ref|XP_002529178.1|  conserved hypothetical protein                   51.2    1e-05   
gb|KDP40658.1|  hypothetical protein JCGZ_24657                       52.0    1e-05   Jatropha curcas
ref|XP_009408652.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  52.4    1e-05   
ref|NP_001237397.1|  uncharacterized protein LOC100500140             52.4    1e-05   
gb|KEH18503.1|  dormancy/auxin associated protein                     51.6    1e-05   Medicago truncatula
ref|XP_003578165.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  51.6    1e-05   Brachypodium distachyon [annual false brome]
ref|XP_008380766.1|  PREDICTED: auxin-repressed 12.5 kDa protein      51.6    1e-05   Malus domestica [apple tree]
ref|XP_011048588.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  51.6    1e-05   Populus euphratica
ref|XP_009401533.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  51.6    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003627373.1|  hypothetical protein MTR_8g022300                51.6    1e-05   Medicago truncatula
ref|XP_008670216.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  52.0    1e-05   Zea mays [maize]
gb|KEH18504.1|  dormancy/auxin associated protein                     51.2    2e-05   Medicago truncatula
ref|XP_004510547.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  51.2    2e-05   Cicer arietinum [garbanzo]
ref|XP_008670217.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  51.6    2e-05   
ref|XP_008353686.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  50.8    2e-05   
ref|XP_004984433.1|  PREDICTED: uncharacterized protein LOC101781340  51.2    2e-05   Setaria italica
ref|XP_010261733.1|  PREDICTED: auxin-repressed 12.5 kDa protein      51.2    2e-05   Nelumbo nucifera [Indian lotus]
gb|ABK23718.1|  unknown                                               51.2    2e-05   Picea sitchensis
ref|XP_002279836.1|  PREDICTED: auxin-repressed 12.5 kDa protein      50.8    2e-05   Vitis vinifera
ref|XP_004510546.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  50.8    3e-05   Cicer arietinum [garbanzo]
gb|EPS58918.1|  hypothetical protein M569_15895                       50.4    3e-05   Genlisea aurea
ref|XP_008353685.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  50.8    3e-05   
dbj|BAJ97316.1|  predicted protein                                    50.8    3e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006369106.1|  hypothetical protein POPTR_0001s16520g           52.4    3e-05   
ref|XP_003557946.1|  PREDICTED: leucine-rich repeat extensin-like...  50.4    4e-05   Brachypodium distachyon [annual false brome]
ref|XP_004141722.1|  PREDICTED: uncharacterized protein LOC101208956  50.1    4e-05   
gb|EMT14589.1|  hypothetical protein F775_43866                       50.4    4e-05   
ref|XP_006660656.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  50.4    4e-05   
gb|ABK23662.1|  unknown                                               50.8    4e-05   Picea sitchensis
ref|XP_009336720.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  50.1    4e-05   Pyrus x bretschneideri [bai li]
gb|EMT18134.1|  hypothetical protein F775_05685                       50.4    5e-05   
ref|XP_011086050.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  50.1    5e-05   Sesamum indicum [beniseed]
ref|NP_001150581.1|  auxin-repressed protein                          50.1    5e-05   
ref|NP_001063265.1|  Os09g0437500                                     50.4    5e-05   
gb|AAG33924.1|  auxin-repressed protein                               49.7    5e-05   Robinia pseudoacacia [black locust]
ref|XP_006426755.1|  hypothetical protein CICLE_v10026754mg           50.1    5e-05   Citrus clementina [clementine]
ref|XP_004510545.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  50.4    6e-05   
ref|NP_001241246.1|  uncharacterized protein LOC100799417             49.7    6e-05   Glycine max [soybeans]
gb|KHN24763.1|  Auxin-repressed 12.5 kDa protein                      49.7    6e-05   Glycine soja [wild soybean]
ref|XP_002460264.1|  hypothetical protein SORBIDRAFT_02g025640        50.1    7e-05   
gb|KHN08503.1|  Auxin-repressed 12.5 kDa protein                      49.7    7e-05   Glycine soja [wild soybean]
ref|XP_009357914.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  49.7    7e-05   Pyrus x bretschneideri [bai li]
ref|XP_006858256.1|  hypothetical protein AMTR_s00062p00206330        49.7    7e-05   Amborella trichopoda
ref|XP_011027792.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  49.7    7e-05   Populus euphratica
ref|XP_007148140.1|  hypothetical protein PHAVU_006G183600g           49.3    8e-05   Phaseolus vulgaris [French bean]
ref|XP_003574579.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  49.7    8e-05   Brachypodium distachyon [annual false brome]
ref|XP_009147551.1|  PREDICTED: uncharacterized protein LOC103871078  49.7    8e-05   Brassica rapa
ref|XP_004973605.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  49.7    8e-05   Setaria italica
ref|NP_001236920.1|  uncharacterized protein LOC100305548             49.3    8e-05   
ref|XP_010111197.1|  hypothetical protein L484_015082                 49.3    8e-05   
emb|CDY51404.1|  BnaA06g01350D                                        49.3    8e-05   
gb|ABK95255.1|  unknown                                               49.3    9e-05   
ref|XP_007148141.1|  hypothetical protein PHAVU_006G183600g           50.1    9e-05   
ref|XP_006384041.1|  hypothetical protein POPTR_0004s04670g           49.7    9e-05   
gb|AAK25768.1|AF336307_1  auxin-repressed protein like-protein        49.3    9e-05   
ref|XP_004973604.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  50.1    9e-05   
ref|XP_006392723.1|  hypothetical protein EUTSA_v10011865mg           49.3    9e-05   
emb|CDY26147.1|  BnaC06g10490D                                        49.3    9e-05   
ref|XP_011027793.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  49.3    9e-05   
ref|XP_009107063.1|  PREDICTED: uncharacterized protein LOC103832747  49.3    1e-04   
ref|XP_009352885.1|  PREDICTED: auxin-repressed 12.5 kDa protein ...  48.9    1e-04   
ref|XP_006465835.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  49.3    1e-04   
gb|KHG18201.1|  Auxin-repressed 12.5 kDa                              49.3    1e-04   
ref|XP_002305123.2|  hypothetical protein POPTR_0004s04670g           48.9    1e-04   
gb|KJB56983.1|  hypothetical protein B456_009G144700                  49.3    1e-04   
ref|XP_004956901.1|  PREDICTED: CREB-regulated transcription coac...  50.8    1e-04   
ref|XP_004956902.1|  PREDICTED: CREB-regulated transcription coac...  50.8    1e-04   
ref|XP_010057377.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  48.9    1e-04   
ref|XP_004956903.1|  PREDICTED: CREB-regulated transcription coac...  50.8    1e-04   
ref|XP_006465834.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  49.3    1e-04   
ref|XP_009397192.1|  PREDICTED: auxin-repressed 12.5 kDa protein      48.9    1e-04   
ref|NP_175809.1|  Dormancy/auxin associated family protein            48.9    1e-04   
gb|KCW61879.1|  hypothetical protein EUGRSUZ_H04561                   47.8    1e-04   
ref|XP_008807304.1|  PREDICTED: uncharacterized protein LOC103719715  48.9    1e-04   
gb|KJB56984.1|  hypothetical protein B456_009G144700                  49.3    1e-04   
gb|KCW74546.1|  hypothetical protein EUGRSUZ_E03257                   49.7    2e-04   
ref|XP_010917413.1|  PREDICTED: auxin-repressed 12.5 kDa protein      48.9    2e-04   
ref|XP_010932358.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  48.5    2e-04   
ref|XP_002891786.1|  predicted protein                                48.5    2e-04   
gb|KDO77646.1|  hypothetical protein CISIN_1g032874mg                 47.8    2e-04   
ref|XP_010943947.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  48.5    2e-04   
gb|AAD25779.1|AC006577_15  Contains similarity to gb|U93273 putat...  48.9    2e-04   
gb|EEE68798.1|  hypothetical protein OsJ_27543                        48.5    2e-04   
gb|ACG37064.1|  auxin-repressed protein                               48.5    2e-04   
ref|XP_010052292.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  48.1    2e-04   
dbj|BAI52956.1|  auxin-repressed protein                              48.1    2e-04   
ref|NP_001150341.1|  LOC100283971                                     48.5    2e-04   
gb|EEC83671.1|  hypothetical protein OsI_29449                        48.5    2e-04   
gb|KJB66373.1|  hypothetical protein B456_010G155600                  48.1    3e-04   
gb|KJB66368.1|  hypothetical protein B456_010G155600                  47.8    3e-04   
gb|KJB66374.1|  hypothetical protein B456_010G155600                  47.8    3e-04   
gb|EYU45908.1|  hypothetical protein MIMGU_mgv1a016024mg              48.1    3e-04   
gb|KHG06543.1|  Auxin-repressed 12.5 kDa                              47.8    3e-04   
gb|KDO77637.1|  hypothetical protein CISIN_1g032874mg                 47.4    3e-04   
ref|XP_007025570.1|  Dormancy-associated protein-like 1 isoform 2     48.9    3e-04   
gb|KJB66371.1|  hypothetical protein B456_010G155600                  47.4    3e-04   
ref|NP_001131194.1|  hypothetical protein                             47.8    3e-04   
ref|XP_010463473.1|  PREDICTED: uncharacterized protein LOC104744158  46.6    3e-04   
ref|NP_001061955.1|  Os08g0453200                                     47.4    4e-04   
gb|KJB66369.1|  hypothetical protein B456_010G155600                  47.8    4e-04   
ref|XP_008776254.1|  PREDICTED: auxin-repressed 12.5 kDa protein      47.4    4e-04   
ref|XP_006303415.1|  hypothetical protein CARUB_v10010620mg           47.8    4e-04   
gb|AAS76635.1|  auxin-repressed protein                               47.4    5e-04   
gb|KFK35663.1|  hypothetical protein AALP_AA4G021000                  47.4    5e-04   
gb|EYU45909.1|  hypothetical protein MIMGU_mgv1a016024mg              47.8    5e-04   
ref|XP_003593621.1|  Auxin-repressed protein                          47.0    5e-04   
gb|AAS75891.1|  auxin-repressed protein                               47.4    5e-04   
gb|AAZ20292.1|  auxin-repressed protein                               47.4    5e-04   
ref|XP_006650062.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  47.4    5e-04   
ref|XP_008789762.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  47.0    5e-04   
ref|XP_010537705.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  47.0    6e-04   
gb|KCW76224.1|  hypothetical protein EUGRSUZ_D00606                   48.5    6e-04   
ref|XP_011079431.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  47.0    6e-04   
gb|ABW74471.1|  auxin-repressed protein                               47.0    6e-04   
ref|XP_008439831.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  47.0    6e-04   
ref|XP_010537695.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  47.0    6e-04   
ref|XP_009788085.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  47.0    6e-04   
ref|XP_008225127.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  47.0    6e-04   
ref|XP_006303414.1|  hypothetical protein CARUB_v10010620mg           47.0    6e-04   
ref|XP_007212248.1|  hypothetical protein PRUPE_ppa013510mg           47.0    6e-04   
ref|XP_010540456.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  47.4    6e-04   
ref|XP_009417538.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  47.0    7e-04   
ref|XP_006467757.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  47.0    7e-04   
gb|AFK37440.1|  unknown                                               46.6    7e-04   
ref|XP_007025569.1|  Dormancy-associated protein-like 1 isoform 1     48.1    7e-04   
gb|ACG26908.1|  hypothetical protein                                  45.8    8e-04   
gb|AHA92828.1|  DRM1 protein                                          46.6    8e-04   
gb|ABQ44282.1|  auxin-repressed protein                               46.6    8e-04   
ref|XP_006467758.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  46.6    9e-04   
ref|XP_006449377.1|  hypothetical protein CICLE_v10017162mg           47.0    9e-04   
gb|KDO77647.1|  hypothetical protein CISIN_1g032874mg                 46.2    0.001   
ref|XP_002509446.1|  Auxin-repressed 12.5 kDa protein, putative       46.6    0.001   
emb|CDO99512.1|  unnamed protein product                              46.6    0.001   
ref|XP_010540457.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  46.6    0.001   
ref|XP_010929057.1|  PREDICTED: auxin-repressed 12.5 kDa protein-...  46.6    0.001   



>ref|XP_004230256.1| PREDICTED: auxin-repressed 12.5 kDa protein [Solanum lycopersicum]
Length=128

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 110/136 (81%), Gaps = 8/136 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL++LWDDTVAGP P++GLGKLRK+STF+ R NSGKESE   P    RS T + S+DA
Sbjct  1    MSLLDKLWDDTVAGPRPDSGLGKLRKYSTFSQRSNSGKESEVSTP----RSFTEEASEDA  56

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
            +KVTRSIMI+K   +QN+D    SP  SPAG+TPPVSPFSG+ GREA+RFRRRSASFAYE
Sbjct  57   VKVTRSIMIVKPSGSQNRD----SPPVSPAGTTPPVSPFSGSSGREAFRFRRRSASFAYE  112

Query  441  NARGIGPRNAPPPYDV  488
            NA G+GPR+  PPYD+
Sbjct  113  NASGVGPRSPRPPYDL  128



>ref|NP_001275423.1| auxin-repressed 12.5 kDa protein-like [Solanum tuberosum]
 gb|ABA40468.1| Drm3-like protein [Solanum tuberosum]
Length=128

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 109/136 (80%), Gaps = 8/136 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL++LWDDTVAGP P++GLGKLRK+STF+ R NSGKESE   P    RS T + S+DA
Sbjct  1    MSLLDKLWDDTVAGPLPDSGLGKLRKYSTFSPRSNSGKESEVSTP----RSFTEEASEDA  56

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
            +KVTRSIMI+K   +QN+D    SP  SPAG+TPPVSPF+G+ GREA+RFRRRS SFAYE
Sbjct  57   VKVTRSIMIVKPSGSQNRD----SPPVSPAGTTPPVSPFAGSAGREAFRFRRRSVSFAYE  112

Query  441  NARGIGPRNAPPPYDV  488
            NA G+GPR+  PPYD+
Sbjct  113  NASGVGPRSPRPPYDL  128



>ref|XP_002512449.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49901.1| conserved hypothetical protein [Ricinus communis]
Length=125

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 101/136 (74%), Gaps = 11/136 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGPPP+NGLGKLRK STFNFR  +GKES+GQ    N RSL  D S++ 
Sbjct  1    MGLLDQLWDDTVAGPPPDNGLGKLRKHSTFNFRSTTGKESDGQ----NGRSLGDDASEEV  56

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             KVTRSIMI+K P  Q       SP  SPAGSTPPVSPFSG  GRE++RFRRRS S AYE
Sbjct  57   TKVTRSIMIVKPPGYQ-----FGSPPVSPAGSTPPVSPFSG--GRESFRFRRRSTSDAYE  109

Query  441  NARGIGPRNAPPPYDV  488
             A  +GPR+  PPYDV
Sbjct  110  KASEVGPRSPAPPYDV  125



>ref|XP_007144957.1| hypothetical protein PHAVU_007G197700g [Phaseolus vulgaris]
 gb|ESW16951.1| hypothetical protein PHAVU_007G197700g [Phaseolus vulgaris]
Length=127

 Score =   101 bits (252),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 61/78 (78%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGPPPENGLGKLRK  TF FRPNSGKES+G     + +S   D+++DA
Sbjct  1    MGLLDHLWDDTVAGPPPENGLGKLRKHHTFAFRPNSGKESDGG----SLKSYGEDSAEDA  56

Query  261  IKVTRSIMILKSPRNQNK  314
            ++VTRSIMI+K P  Q++
Sbjct  57   MRVTRSIMIVKPPGYQSQ  74



>ref|XP_009611305.1| PREDICTED: auxin-repressed 12.5 kDa protein [Nicotiana tomentosiformis]
Length=127

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 11/137 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVD-TSDD  257
            MSLL++LWDDTVAGP P++GLGKLRK+STF+ R NSGKESE   P    RS + + +S+D
Sbjct  1    MSLLDKLWDDTVAGPRPDSGLGKLRKYSTFSARSNSGKESEVSTP----RSFSEEASSED  56

Query  258  AIKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfay  437
            A++VTRSIMI+K P +QN+D    SP  SPAG+TPPVSPF+G        +  R  SFAY
Sbjct  57   AVRVTRSIMIVKPPGSQNRD----SPPVSPAGTTPPVSPFAG--AGGREAYWSRRRSFAY  110

Query  438  eNARGIGPRNAPPPYDV  488
            ENA G+GPR+  PPYD+
Sbjct  111  ENASGVGPRSPRPPYDL  127



>ref|XP_009760621.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Nicotiana sylvestris]
Length=127

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 11/137 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVD-TSDD  257
            MSLL++LWDDTVAGP P++GLGKLRK+STF+ R NSGKESE   P    RS + + +S+D
Sbjct  1    MSLLDKLWDDTVAGPRPDSGLGKLRKYSTFSPRSNSGKESEVSTP----RSFSEEASSED  56

Query  258  AIKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfay  437
            A++VTRSIMI+K P +QNKD    SP  SPAG+TPPVSPF+G        +  R  SFAY
Sbjct  57   AVRVTRSIMIVKPPGSQNKD----SPPVSPAGTTPPVSPFAG--AGGREAYWSRRRSFAY  110

Query  438  eNARGIGPRNAPPPYDV  488
            ENA G+GPR+  PPYD+
Sbjct  111  ENASGVGPRSPRPPYDL  127



>gb|AGV54698.1| hypothetical protein [Phaseolus vulgaris]
Length=127

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L+ LWDDTVAGPPPENGLGKLRK  TF FRPNSGKES+G     + +S   D+++DA
Sbjct  1    MGFLDHLWDDTVAGPPPENGLGKLRKHHTFAFRPNSGKESDGG----SLKSYGEDSAEDA  56

Query  261  IKVTRSIMILKSPRNQNK  314
            ++VTRSIMI+K P  Q++
Sbjct  57   MRVTRSIMIVKPPGYQSQ  74



>gb|AGV54550.1| dormancy/auxin associated protein Drm3 [Phaseolus vulgaris]
Length=131

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 60/78 (77%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L+ LWDDTVAGPPPENGLGKLRK  TF FRPNSGKES+G     + +S   D+++DA
Sbjct  1    MGFLDHLWDDTVAGPPPENGLGKLRKHHTFAFRPNSGKESDGG----SLKSYGEDSAEDA  56

Query  261  IKVTRSIMILKSPRNQNK  314
            ++VTRSIMI+K P  Q++
Sbjct  57   MRVTRSIMIVKPPGYQSQ  74



>ref|XP_010105309.1| hypothetical protein L484_001569 [Morus notabilis]
 gb|EXC04306.1| hypothetical protein L484_001569 [Morus notabilis]
Length=303

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PENGLGKLRK+S+F+FRPNSGK S+G N N + RS   +  ++A
Sbjct  1    MGLLDQLWDDTVAGPRPENGLGKLRKYSSFSFRPNSGKGSDGGNGNVSVRSYGEEPPEEA  60

Query  261  IKVTRSIMILKSP  299
            ++VTRSIMI+K P
Sbjct  61   VRVTRSIMIVKPP  73



>ref|XP_011092092.1| PREDICTED: uncharacterized protein LOC105172392 isoform X1 [Sesamum 
indicum]
Length=129

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 108/136 (79%), Gaps = 7/136 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P++GLGKLRK STF+FR NSGKESE  +   N +S     +++A
Sbjct  1    MGLLDQLWDDTVAGPRPDSGLGKLRKHSTFSFRSNSGKESEVAD---NRKSFAEAAAEEA  57

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
            ++VTRSIMI+K P+   KD    SP  SPAGSTPPVSPF+GAGGREA+RFRRRSASFAYE
Sbjct  58   VRVTRSIMIVKPPQAAAKD----SPPASPAGSTPPVSPFAGAGGREAFRFRRRSASFAYE  113

Query  441  NARGIGPRNAPPPYDV  488
             A G+GPR+ PPPYD+
Sbjct  114  KASGVGPRSPPPPYDL  129



>ref|XP_002283180.1| PREDICTED: uncharacterized protein LOC100245909 [Vitis vinifera]
 emb|CBI39550.3| unnamed protein product [Vitis vinifera]
Length=126

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 93/136 (68%), Gaps = 10/136 (7%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P++GLGKLRK+STFN RP SGK +       N RS + D+S++A
Sbjct  1    MGLLDQLWDDTVAGPQPDHGLGKLRKYSTFNSRPTSGKAASDGG---NGRSYSDDSSEEA  57

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
            ++VTRSIMI+K P  QN      SP  SPAGSTPPVSPFSG      +R R  S ++   
Sbjct  58   MRVTRSIMIIKPPGFQN-----GSPPVSPAGSTPPVSPFSGGKESFRFRRRSTSDAYEKG  112

Query  441  NARGIGPRNAPPPYDV  488
            N  G+GPR+  PPYDV
Sbjct  113  N--GVGPRSPRPPYDV  126



>gb|EYU42188.1| hypothetical protein MIMGU_mgv1a016078mg [Erythranthe guttata]
Length=130

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 107/138 (78%), Gaps = 10/138 (7%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVD-TSDD  257
            M LL+QLWDDT+AGPPP+ GLGKLRK+ TF+FR NSGKE+E  +   N RS   +  ++D
Sbjct  1    MGLLDQLWDDTLAGPPPDTGLGKLRKYGTFSFRSNSGKETEAVD---NRRSFGEEAAAED  57

Query  258  AIKVTRSIMILKSPRNQN-KDsppaspspspagstppvspFSGaggreayrfrrrsasfa  434
            A++VTRSIMI+K P   N KD    SP  SPAGSTPP SPF+G GGREA+RFRRRSASFA
Sbjct  58   AVRVTRSIMIVKPPPQLNLKD----SPPDSPAGSTPPASPFAG-GGREAFRFRRRSASFA  112

Query  435  yeNARGIGPRNAPPPYDV  488
            YE A G+GPR+ PPPYD+
Sbjct  113  YERANGVGPRSPPPPYDM  130



>ref|XP_003521684.1| PREDICTED: uncharacterized protein LOC100805572 isoformX1 [Glycine 
max]
 gb|KHN03965.1| hypothetical protein glysoja_022651 [Glycine soja]
Length=124

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF FRP+SGKE+EG     + RS   ++S++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFTFRPSSGKEAEGG----SVRSYGDESSEEA  56

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  Q+
Sbjct  57   TRVTRSIMIVKPPGYQS  73



>ref|XP_007031019.1| Drm3-like protein isoform 1 [Theobroma cacao]
 gb|EOY11521.1| Drm3-like protein isoform 1 [Theobroma cacao]
Length=125

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 100/136 (74%), Gaps = 11/136 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+NGLGKLRK STF FRP+S KES+G     + RS   +TS++ 
Sbjct  1    MGLLDQLWDDTVAGPRPDNGLGKLRKHSTFTFRPSSAKESDGG----SVRSYGDETSEEP  56

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             +VTRSIMI+K P  QN      SP  SPAGSTPPVSPFSG  GRE++RFRR+S S AYE
Sbjct  57   TRVTRSIMIVKPPGYQN-----GSPPISPAGSTPPVSPFSG--GRESFRFRRKSTSDAYE  109

Query  441  NARGIGPRNAPPPYDV  488
             A  +GPR+  PPYDV
Sbjct  110  KASEVGPRSPHPPYDV  125



>ref|XP_006577224.1| PREDICTED: uncharacterized protein LOC100805572 isoform X2 [Glycine 
max]
Length=132

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF FRP+SGKE+EG     + RS   ++S++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFTFRPSSGKEAEGG----SVRSYGDESSEEA  56

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  Q+
Sbjct  57   TRVTRSIMIVKPPGYQS  73



>gb|KJB78439.1| hypothetical protein B456_013G205900 [Gossypium raimondii]
Length=123

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+NGLGKLRK STF FR NS KES+G     + RS   +T ++ 
Sbjct  1    MGLLDQLWDDTVAGPRPDNGLGKLRKHSTFTFRSNSSKESDGG----SVRSYNDETPEET  56

Query  261  IKVTRSIMILKSPRNQN  311
             KVTR+IMI+KSPR Q+
Sbjct  57   TKVTRTIMIVKSPRYQS  73



>gb|KJB45318.1| hypothetical protein B456_007G300900 [Gossypium raimondii]
Length=125

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 90/136 (66%), Gaps = 11/136 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+NGLGKLRK STF FRPNS KES+G     + RS   +  ++A
Sbjct  1    MGLLDQLWDDTVAGPRPDNGLGKLRKHSTFTFRPNSAKESDGG----SLRSYGDEAPEEA  56

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             +VTRSIMI+K P  Q+      SP  SPAGSTPPVSPFSG      +R R  S ++   
Sbjct  57   TRVTRSIMIVKPPGYQS-----GSPPVSPAGSTPPVSPFSGGRESYRFRRRSTSDAYEKA  111

Query  441  NARGIGPRNAPPPYDV  488
            N   +GPR+  PPYDV
Sbjct  112  NE--VGPRSPCPPYDV  125



>gb|KJB78437.1| hypothetical protein B456_013G205900 [Gossypium raimondii]
Length=126

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+NGLGKLRK STF FR NS KES+G     + RS   +T ++ 
Sbjct  1    MGLLDQLWDDTVAGPRPDNGLGKLRKHSTFTFRSNSSKESDGG----SVRSYNDETPEET  56

Query  261  IKVTRSIMILKSPRNQN  311
             KVTR+IMI+KSPR Q+
Sbjct  57   TKVTRTIMIVKSPRYQS  73



>ref|XP_007031021.1| Dormancy/auxin associated family protein isoform 3 [Theobroma 
cacao]
 gb|EOY11523.1| Dormancy/auxin associated family protein isoform 3 [Theobroma 
cacao]
Length=107

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+NGLGKLRK STF FRP+S KES+G     + RS   +TS++ 
Sbjct  1    MGLLDQLWDDTVAGPRPDNGLGKLRKHSTFTFRPSSAKESDGG----SVRSYGDETSEEP  56

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  QN
Sbjct  57   TRVTRSIMIVKPPGYQN  73



>gb|KHG14651.1| Auxin-repressed 12.5 kDa [Gossypium arboreum]
Length=125

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 90/136 (66%), Gaps = 11/136 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+NGLGKLRK STF FRPNS KES+G     + RS   +  ++A
Sbjct  1    MGLLDQLWDDTVAGPRPDNGLGKLRKHSTFTFRPNSAKESDGG----SVRSYGDEAPEEA  56

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             +VTRSIMI+K P  Q+      SP  SPAGSTPPVSPFSG      +R R  S +F   
Sbjct  57   TRVTRSIMIVKPPGYQS-----GSPPVSPAGSTPPVSPFSGGRESYRFRRRSTSDAFEKA  111

Query  441  NARGIGPRNAPPPYDV  488
            N   +GPR+  PPYDV
Sbjct  112  NE--VGPRSPRPPYDV  125



>gb|KJB78438.1| hypothetical protein B456_013G205900 [Gossypium raimondii]
Length=111

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+NGLGKLRK STF FR NS KES+G     + RS   +T ++ 
Sbjct  1    MGLLDQLWDDTVAGPRPDNGLGKLRKHSTFTFRSNSSKESDGG----SVRSYNDETPEET  56

Query  261  IKVTRSIMILKSPRNQN  311
             KVTR+IMI+KSPR Q+
Sbjct  57   TKVTRTIMIVKSPRYQS  73



>gb|KHG05150.1| Auxin-repressed 12.5 kDa [Gossypium arboreum]
Length=126

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+NGLGKLRK STF FR NS KE++G     + RS   +T ++ 
Sbjct  1    MGLLDQLWDDTVAGPRPDNGLGKLRKHSTFTFRSNSSKETDGG----SVRSYNDETPEET  56

Query  261  IKVTRSIMILKSPRNQN  311
             KVTR+IMI+KSPR Q+
Sbjct  57   TKVTRTIMIVKSPRCQS  73



>ref|XP_006604803.1| PREDICTED: uncharacterized protein LOC100814324 isoform X1 [Glycine 
max]
Length=211

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF FRP+SGKE+EG     + RS   ++S++A
Sbjct  84   MGLLDHLWDDTVAGPRPENGLGKLRKHHTFTFRPSSGKETEGG----SVRSYGDESSEEA  139

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  Q+
Sbjct  140  TRVTRSIMIVKPPGYQS  156



>ref|XP_006604804.1| PREDICTED: uncharacterized protein LOC100814324 isoform X2 [Glycine 
max]
Length=207

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF FRP+SGKE+EG     + RS   ++S++A
Sbjct  84   MGLLDHLWDDTVAGPRPENGLGKLRKHHTFTFRPSSGKETEGG----SVRSYGDESSEEA  139

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  Q+
Sbjct  140  TRVTRSIMIVKPPGYQS  156



>gb|EYU42186.1| hypothetical protein MIMGU_mgv1a016078mg [Erythranthe guttata]
Length=98

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVD-TSDD  257
            M LL+QLWDDT+AGPPP+ GLGKLRK+ TF+FR NSGKE+E  +   N RS   +  ++D
Sbjct  1    MGLLDQLWDDTLAGPPPDTGLGKLRKYGTFSFRSNSGKETEAVD---NRRSFGEEAAAED  57

Query  258  AIKVTRSIMILKSPRNQN  311
            A++VTRSIMI+K P   N
Sbjct  58   AVRVTRSIMIVKPPPQLN  75



>ref|XP_011087434.1| PREDICTED: uncharacterized protein LOC105168923 isoform X1 [Sesamum 
indicum]
Length=129

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 103/136 (76%), Gaps = 7/136 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDT+AGP P++GLGKLRK +TF+FR NSGKESE  N   + RS      +  
Sbjct  1    MGLLDQLWDDTLAGPLPDSGLGKLRKHATFSFRTNSGKESEVAN---SRRSFDEAPEEAT  57

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             +VTRSIMI+K P+   KD    SP  SPAGSTPPVSPF+G GGREA+RFRRRSASFAYE
Sbjct  58   NRVTRSIMIIKPPQANQKD----SPPVSPAGSTPPVSPFAGGGGREAFRFRRRSASFAYE  113

Query  441  NARGIGPRNAPPPYDV  488
             A G+GP++ PPPYD+
Sbjct  114  KASGVGPKSPPPPYDL  129



>ref|XP_007031022.1| Dormancy/auxin associated family protein isoform 4 [Theobroma 
cacao]
 gb|EOY11524.1| Dormancy/auxin associated family protein isoform 4 [Theobroma 
cacao]
Length=134

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+NGLGKLRK STF FRP+S KES+G     + RS   +TS++ 
Sbjct  1    MGLLDQLWDDTVAGPRPDNGLGKLRKHSTFTFRPSSAKESDGG----SVRSYGDETSEEP  56

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  QN
Sbjct  57   TRVTRSIMIVKPPGYQN  73



>gb|KHN43309.1| hypothetical protein glysoja_001892 [Glycine soja]
Length=220

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF FRP+SGKE+EG     + RS   ++S++A
Sbjct  84   MGLLDHLWDDTVAGPRPENGLGKLRKHHTFTFRPSSGKETEGG----SVRSYGDESSEEA  139

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  Q+
Sbjct  140  TRVTRSIMIVKPPGYQS  156



>ref|XP_010480218.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Camelina 
sativa]
Length=138

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEGGSARSYGEDSPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIIKPPGYQG  74



>ref|XP_010414955.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Camelina 
sativa]
Length=138

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEGGSARSYGEDSPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIIKPPGYQG  74



>gb|EYU42187.1| hypothetical protein MIMGU_mgv1a016078mg [Erythranthe guttata]
Length=135

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVD-TSDD  257
            M LL+QLWDDT+AGPPP+ GLGKLRK+ TF+FR NSGKE+E  +   N RS   +  ++D
Sbjct  1    MGLLDQLWDDTLAGPPPDTGLGKLRKYGTFSFRSNSGKETEAVD---NRRSFGEEAAAED  57

Query  258  AIKVTRSIMILKSPRNQN  311
            A++VTRSIMI+K P   N
Sbjct  58   AVRVTRSIMIVKPPPQLN  75



>ref|XP_010511246.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Camelina 
sativa]
Length=137

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEGGSARSYGEDSPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIIKPPGYQG  74



>ref|XP_010511245.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Camelina 
sativa]
Length=143

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEGGSARSYGEDSPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIIKPPGYQG  74



>ref|XP_010414954.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Camelina 
sativa]
 ref|XP_010480217.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Camelina 
sativa]
Length=144

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEGGSARSYGEDSPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIIKPPGYQG  74



>ref|XP_010549655.1| PREDICTED: uncharacterized protein LOC104820752 isoform X3 [Tarenaya 
hassleriana]
Length=129

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSG-KESEGQNPNPNTRSLTVDTSDD  257
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG  +SEG     + RS   D+ ++
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGNDQSEGG----SVRSYGEDSPEE  56

Query  258  AIKVTRSIMILKSPRNQN  311
            A+KVTRSIMI+K P  Q 
Sbjct  57   AVKVTRSIMIVKPPGYQG  74



>ref|XP_010549640.1| PREDICTED: uncharacterized protein LOC104820752 isoform X1 [Tarenaya 
hassleriana]
Length=139

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEGGSVRSYGEDSPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIVKPPGYQG  74



>ref|XP_010549646.1| PREDICTED: uncharacterized protein LOC104820752 isoform X2 [Tarenaya 
hassleriana]
Length=135

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEGGSVRSYGEDSPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIVKPPGYQG  74



>ref|XP_006396488.1| hypothetical protein EUTSA_v10029065mg [Eutrema salsugineum]
 gb|ESQ37941.1| hypothetical protein EUTSA_v10029065mg [Eutrema salsugineum]
Length=128

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSDGGSVRSYGEDSPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIVKPPGYQG  74



>ref|XP_007031020.1| Dormancy/auxin associated family protein isoform 2 [Theobroma 
cacao]
 gb|EOY11522.1| Dormancy/auxin associated family protein isoform 2 [Theobroma 
cacao]
Length=124

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 97/136 (71%), Gaps = 12/136 (9%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+NGLGKLRK STF FRP+S K   G     + RS   +TS++ 
Sbjct  1    MGLLDQLWDDTVAGPRPDNGLGKLRKHSTFTFRPSSAKADGG-----SVRSYGDETSEEP  55

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             +VTRSIMI+K P  QN      SP  SPAGSTPPVSPFSG  GRE++RFRR+S S AYE
Sbjct  56   TRVTRSIMIVKPPGYQN-----GSPPISPAGSTPPVSPFSG--GRESFRFRRKSTSDAYE  108

Query  441  NARGIGPRNAPPPYDV  488
             A  +GPR+  PPYDV
Sbjct  109  KASEVGPRSPHPPYDV  124



>ref|XP_011092093.1| PREDICTED: uncharacterized protein LOC105172392 isoform X2 [Sesamum 
indicum]
Length=109

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 60/79 (76%), Gaps = 3/79 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P++GLGKLRK STF+FR NSGKESE  +   N +S     +++A
Sbjct  1    MGLLDQLWDDTVAGPRPDSGLGKLRKHSTFSFRSNSGKESEVAD---NRKSFAEAAAEEA  57

Query  261  IKVTRSIMILKSPRNQNKD  317
            ++VTRSIMI+K P+   KD
Sbjct  58   VRVTRSIMIVKPPQAAAKD  76



>ref|XP_010528902.1| PREDICTED: uncharacterized protein LOC104805892 isoform X3 [Tarenaya 
hassleriana]
Length=127

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 92/137 (67%), Gaps = 11/137 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSG-KESEGQNPNPNTRSLTVDTSDD  257
            M LL+ LWDDTVAGP P+NGLGKLRK  TF+FRP+SG  +SEG          +V+++D+
Sbjct  1    MGLLDHLWDDTVAGPRPDNGLGKLRKHQTFSFRPSSGNDQSEGG---------SVESTDE  51

Query  258  AIKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfay  437
            A+KVTRSIMI+K P  Q   S P S   SPAGSTPPVSPFSG G       RR S   A+
Sbjct  52   AVKVTRSIMIVKPPGYQG-GSAPVSAPVSPAGSTPPVSPFSGGGKESFRFRRRSSTVEAF  110

Query  438  eNARGIGPRNAPPPYDV  488
            + A   GPR++PPPY +
Sbjct  111  DKASEAGPRSSPPPYGL  127



>ref|XP_010269574.1| PREDICTED: uncharacterized protein LOC104606184 isoform X1 [Nelumbo 
nucifera]
Length=124

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL++LWDDT+AGP P+NGLGKLRK STF+FRPN GKE++G     N RS   +++D+A
Sbjct  1    MGLLDKLWDDTLAGPLPDNGLGKLRKNSTFSFRPNLGKEADGG----NGRSYGDESTDEA  56

Query  261  IKVTRSIMILKSPRN  305
            ++VTRSI I+K P N
Sbjct  57   MRVTRSITIIKPPGN  71



>ref|XP_009134413.1| PREDICTED: uncharacterized protein LOC103858746 isoform X5 [Brassica 
rapa]
Length=93

 Score = 88.2 bits (217),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLR+  TF+FRP+SG +   Q+   + RS   ++ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRRHHTFSFRPSSGND---QSDGGSVRSYGEESPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIIKPPGYQG  74



>emb|CDP17198.1| unnamed protein product [Coffea canephora]
Length=113

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL +LWDDTVAGP P++GLGKLRK  TFN RPN+GKES   +P   +       ++DA
Sbjct  1    MSLLEKLWDDTVAGPRPDSGLGKLRKHPTFNLRPNAGKESVVGSPRSYSNGAGGAAAEDA  60

Query  261  IKVTRSIMILKSPRNQNKD  317
            ++VTRSIMI++ P    KD
Sbjct  61   VRVTRSIMIVRPPPVDFKD  79



>ref|XP_006302769.1| hypothetical protein CARUB_v10020890mg [Capsella rubella]
 gb|EOA35667.1| hypothetical protein CARUB_v10020890mg [Capsella rubella]
Length=231

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +3

Query  57   CAVSLNCAMSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSL  236
             ++S    M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS 
Sbjct  84   LSISTFLLMGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEAGSARSY  140

Query  237  TVDTSDDAIKVTRSIMILKSPRNQN  311
              D+ ++ +KVTRSIMI+K P  Q+
Sbjct  141  GEDSPEETVKVTRSIMIIKPPGYQS  165



>emb|CDX91313.1| BnaC02g27240D [Brassica napus]
Length=127

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 80/136 (59%), Gaps = 9/136 (7%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+S       N   + RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPLPENGLGKLRKHHTFSFRPSS------ANDQSDVRSYGGDSPEEA  54

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
            +KVTRSIMI+K P  Q      A  SP+ + +    SPFSG      +R R  S +F   
Sbjct  55   VKVTRSIMIIKPPGYQG---GSAPVSPAGSTTPVSPSPFSGGKEPFRFRRRSASDAFDKA  111

Query  441  NARGIGPRNAPPPYDV  488
               G GPRN+PP Y V
Sbjct  112  AGSGNGPRNSPPTYGV  127



>emb|CDY66288.1| BnaA03g57280D [Brassica napus]
Length=110

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLR+  TF+FRP+SG +   Q+   + RS   ++ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRRHHTFSFRPSSGND---QSDGGSVRSYGEESPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIIKPPGYQG  74



>ref|XP_009134411.1| PREDICTED: uncharacterized protein LOC103858746 isoform X3 [Brassica 
rapa]
Length=128

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLR+  TF+FRP+SG +   Q+   + RS   ++ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRRHHTFSFRPSSGND---QSDGGSVRSYGEESPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIIKPPGYQG  74



>ref|XP_010528900.1| PREDICTED: uncharacterized protein LOC104805892 isoform X1 [Tarenaya 
hassleriana]
Length=134

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 10/78 (13%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSG-KESEGQNPNPNTRSLTVDTSDD  257
            M LL+ LWDDTVAGP P+NGLGKLRK  TF+FRP+SG  +SEG          +V+++D+
Sbjct  1    MGLLDHLWDDTVAGPRPDNGLGKLRKHQTFSFRPSSGNDQSEGG---------SVESTDE  51

Query  258  AIKVTRSIMILKSPRNQN  311
            A+KVTRSIMI+K P  Q 
Sbjct  52   AVKVTRSIMIVKPPGYQG  69



>ref|XP_009134409.1| PREDICTED: uncharacterized protein LOC103858746 isoform X1 [Brassica 
rapa]
Length=131

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLR+  TF+FRP+SG +   Q+   + RS   ++ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRRHHTFSFRPSSGND---QSDGGSVRSYGEESPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIIKPPGYQG  74



>ref|NP_001077728.1| dormancy/auxin associated protein [Arabidopsis thaliana]
 gb|AEE33364.1| dormancy/auxin associated protein [Arabidopsis thaliana]
Length=109

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDT-SDD  257
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+  ++
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEAGSARSYGEDSLPEE  57

Query  258  AIKVTRSIMILKSPRNQN  311
            A+KVTRSIMI+K P  Q 
Sbjct  58   AVKVTRSIMIIKPPGYQG  75



>ref|XP_010528901.1| PREDICTED: uncharacterized protein LOC104805892 isoform X2 [Tarenaya 
hassleriana]
Length=130

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 10/78 (13%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSG-KESEGQNPNPNTRSLTVDTSDD  257
            M LL+ LWDDTVAGP P+NGLGKLRK  TF+FRP+SG  +SEG          +V+++D+
Sbjct  1    MGLLDHLWDDTVAGPRPDNGLGKLRKHQTFSFRPSSGNDQSEGG---------SVESTDE  51

Query  258  AIKVTRSIMILKSPRNQN  311
            A+KVTRSIMI+K P  Q 
Sbjct  52   AVKVTRSIMIVKPPGYQG  69



>ref|XP_006302768.1| hypothetical protein CARUB_v10020890mg [Capsella rubella]
 gb|EOA35666.1| hypothetical protein CARUB_v10020890mg [Capsella rubella]
Length=229

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 5/85 (6%)
 Frame = +3

Query  57   CAVSLNCAMSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSL  236
             ++S    M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+S +   G     + RS 
Sbjct  84   LSISTFLLMGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSDQSEAG-----SARSY  138

Query  237  TVDTSDDAIKVTRSIMILKSPRNQN  311
              D+ ++ +KVTRSIMI+K P  Q+
Sbjct  139  GEDSPEETVKVTRSIMIIKPPGYQS  163



>gb|KHN16098.1| hypothetical protein glysoja_012074 [Glycine soja]
Length=127

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF FR  SGKES+      + +S   D  +DA
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFAFRSASGKESDSG----SVKSYGEDLPEDA  56

Query  261  IKVTRSIMILKSP  299
            ++VTRSIMI+K P
Sbjct  57   VRVTRSIMIVKPP  69



>emb|CDY21913.1| BnaC09g00190D [Brassica napus]
Length=128

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M +L+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   N  S   D+ D+ 
Sbjct  1    MGILDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSDGGNVGSYGEDSLDEG  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   LKVTRSIMIIKPPGYQG  74



>ref|NP_849819.1| dormancy/auxin associated protein [Arabidopsis thaliana]
 gb|AEE33362.1| dormancy/auxin associated protein [Arabidopsis thaliana]
Length=112

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDT-SDD  257
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+  ++
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEAGSARSYGEDSLPEE  57

Query  258  AIKVTRSIMILKSPRNQN  311
            A+KVTRSIMI+K P  Q 
Sbjct  58   AVKVTRSIMIIKPPGYQG  75



>ref|XP_007147009.1| hypothetical protein PHAVU_006G089000g [Phaseolus vulgaris]
 gb|ESW19003.1| hypothetical protein PHAVU_006G089000g [Phaseolus vulgaris]
Length=156

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSD-D  257
            M LL+ LWDDTVAGP PENGL KLRK  TFNFRP+SGKE+EG     + RS   ++S  +
Sbjct  32   MGLLDHLWDDTVAGPRPENGLSKLRKHHTFNFRPSSGKEAEGG----SVRSYGDESSSGE  87

Query  258  AIKVTRSIMILKSPRNQN  311
              +VTRSIMI+K P  Q+
Sbjct  88   TTRVTRSIMIVKPPGYQS  105



>ref|XP_010259525.1| PREDICTED: uncharacterized protein LOC104598926 [Nelumbo nucifera]
Length=128

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 6/80 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESE-GQNPNPNTRSLTVDTSDD  257
            M LL++LWDDT+AGP P+NGLGKLRK S F+FR NSGK+S+ G+      RS   D++D+
Sbjct  1    MGLLDKLWDDTLAGPLPDNGLGKLRKPSAFSFRSNSGKDSDVGRG-----RSYGDDSTDE  55

Query  258  AIKVTRSIMILKSPRNQNKD  317
            AI+VTRSIMI+K P N   D
Sbjct  56   AIRVTRSIMIIKPPGNLTVD  75



>ref|NP_564714.1| dormancy/auxin associated protein [Arabidopsis thaliana]
 gb|AAM64319.1| putative auxin-repressed protein [Arabidopsis thaliana]
 dbj|BAH20086.1| AT1G56220 [Arabidopsis thaliana]
 gb|AEE33361.1| dormancy/auxin associated protein [Arabidopsis thaliana]
Length=137

 Score = 87.0 bits (214),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDT-SDD  257
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+  ++
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEAGSARSYGEDSLPEE  57

Query  258  AIKVTRSIMILKSPRNQN  311
            A+KVTRSIMI+K P  Q 
Sbjct  58   AVKVTRSIMIIKPPGYQG  75



>ref|NP_849820.1| dormancy/auxin associated protein [Arabidopsis thaliana]
 gb|AAG50916.1|AC069159_17 unknown protein [Arabidopsis thaliana]
 gb|AEE33363.1| dormancy/auxin associated protein [Arabidopsis thaliana]
Length=140

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDT-SDD  257
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+  ++
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEAGSARSYGEDSLPEE  57

Query  258  AIKVTRSIMILKSPRNQN  311
            A+KVTRSIMI+K P  Q 
Sbjct  58   AVKVTRSIMIIKPPGYQG  75



>ref|XP_009134414.1| PREDICTED: uncharacterized protein LOC103858746 isoform X6 [Brassica 
rapa]
Length=91

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 5/77 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLR+  TF+FRP+S +   G     + RS   ++ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRRHHTFSFRPSSDQSDGG-----SVRSYGEESPEEA  55

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  56   VKVTRSIMIIKPPGYQG  72



>emb|CDY10536.1| BnaC03g70780D [Brassica napus]
Length=121

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M +L+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q    N  S   D+ D+ 
Sbjct  1    MGILDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QLDGGNVGSYGGDSPDEG  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   LKVTRSIMIIKPPGYQG  74



>ref|XP_009782454.1| PREDICTED: uncharacterized protein LOC104231201 isoform X1 [Nicotiana 
sylvestris]
Length=120

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 99/136 (73%), Gaps = 16/136 (12%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MS+L++LWDDTVAGP P++GLGKLRK STFN   +SGKE+EG              S + 
Sbjct  1    MSILDKLWDDTVAGPRPDSGLGKLRKSSTFNLGSSSGKETEG--------------SQEV  46

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             +VT+ IMI+K P   +KD      SP+ AGSTPPVSPF+GAGG+EA+RFRRRS SFAYE
Sbjct  47   ARVTKRIMIVKPPGYVSKD--SPPVSPASAGSTPPVSPFAGAGGKEAFRFRRRSGSFAYE  104

Query  441  NARGIGPRNAPPPYDV  488
            NA GIGPR+ PPPYD+
Sbjct  105  NASGIGPRSPPPPYDL  120



>ref|XP_010025248.1| PREDICTED: uncharacterized protein LOC104415611 isoform X2 [Eucalyptus 
grandis]
 gb|KCW61861.1| hypothetical protein EUGRSUZ_H04545 [Eucalyptus grandis]
Length=134

 Score = 86.7 bits (213),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 57/82 (70%), Gaps = 8/82 (10%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEG-----QNPNPNTRSLTVD  245
            M LL+QLWDDTVAGP PE+GLGKLRKFSTF+ R NSGKESEG        +P+    T  
Sbjct  1    MGLLDQLWDDTVAGPRPESGLGKLRKFSTFSSRSNSGKESEGGGRMKAYGDPDA---TPS  57

Query  246  TSDDAIKVTRSIMILKSPRNQN  311
                AI+VTRSI I+K P NQ+
Sbjct  58   EEAAAIRVTRSITIVKPPGNQS  79



>gb|ABK96622.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96692.1| unknown [Populus trichocarpa x Populus deltoides]
Length=133

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP PENGLGKLRK  ++  RPNSGKES+G   +         T+++ 
Sbjct  1    MSLLDHLWDDTVAGPLPENGLGKLRKKPSYGLRPNSGKESDGSGGSVMRSYGGEATTEET  60

Query  261  IKVTRSIMILKSPRNQN  311
             KVTRSIMI++ P  QN
Sbjct  61   KKVTRSIMIVRPPGYQN  77



>emb|CDY18000.1| BnaC03g30720D [Brassica napus]
Length=131

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 55/77 (71%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLR+  TF+FR +SG +   Q+   + RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRRHHTFSFRASSGND---QSDGGSVRSYGGDSPEEA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  58   VKVTRSIMIIKPPGYQG  74



>gb|AAN72002.1| expressed protein [Arabidopsis thaliana]
 gb|AAP21336.1| At1g56220 [Arabidopsis thaliana]
Length=143

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDT-SDD  257
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+   + RS   D+  ++
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSEAGSARSYGEDSLPEE  57

Query  258  AIKVTRSIMILKSPRNQN  311
            A+KVTRSIMI+K P  Q 
Sbjct  58   AVKVTRSIMIIKPPGYQG  75



>emb|CDX97284.1| BnaA02g20750D [Brassica napus]
Length=126

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 6/77 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+S  +          RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPLPENGLGKLRKHHTFSFRPSSANDQS------EVRSYGGDSPEEA  54

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q+
Sbjct  55   VKVTRSIMIIKPPGYQS  71



>ref|XP_010025247.1| PREDICTED: uncharacterized protein LOC104415611 isoform X1 [Eucalyptus 
grandis]
 gb|KCW61859.1| hypothetical protein EUGRSUZ_H04545 [Eucalyptus grandis]
Length=146

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDD-  257
            M LL+QLWDDTVAGP PE+GLGKLRKFSTF+ R NSGKESEG              S++ 
Sbjct  1    MGLLDQLWDDTVAGPRPESGLGKLRKFSTFSSRSNSGKESEGGGRMKAYGDPDATPSEEA  60

Query  258  -AIKVTRSIMILKSPRNQN  311
             AI+VTRSI I+K P NQ+
Sbjct  61   AAIRVTRSITIVKPPGNQS  79



>gb|KHN20250.1| hypothetical protein glysoja_023813 [Glycine soja]
Length=126

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  +F FR  S KES+      + +S   D+  +A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHSFAFRSASAKESDSG----SVKSYGEDSPKNA  56

Query  261  IKVTRSIMILKSPRNQN  311
            ++VTRSIMI+K P NQ+
Sbjct  57   VRVTRSIMIVKPPGNQS  73



>ref|XP_009134412.1| PREDICTED: uncharacterized protein LOC103858746 isoform X4 [Brassica 
rapa]
Length=126

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 5/77 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLR+  TF+FRP+S +   G     + RS   ++ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRRHHTFSFRPSSDQSDGG-----SVRSYGEESPEEA  55

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  56   VKVTRSIMIIKPPGYQG  72



>ref|XP_009134410.1| PREDICTED: uncharacterized protein LOC103858746 isoform X2 [Brassica 
rapa]
Length=129

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 5/77 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLR+  TF+FRP+S +   G     + RS   ++ ++A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRRHHTFSFRPSSDQSDGG-----SVRSYGEESPEEA  55

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  56   VKVTRSIMIIKPPGYQG  72



>ref|XP_009144547.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Brassica rapa]
Length=127

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 6/77 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKL+K  TF+FRP+S  +        + RS   D+ ++A
Sbjct  1    MGLLDHLWDDTVAGPLPENGLGKLQKHHTFSFRPSSANDQS------DVRSYGGDSPEEA  54

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q+
Sbjct  55   VKVTRSIMIIKPPGYQS  71



>ref|XP_011023705.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X4 [Populus 
euphratica]
Length=115

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP P+NGLGKLRK  ++  RPNSGKES+G   +         T+++ 
Sbjct  1    MSLLDHLWDDTVAGPLPDNGLGKLRKKPSYGLRPNSGKESDGSGGSVMRSYGGEATTEET  60

Query  261  IKVTRSIMILKSPRNQN  311
             KVTRSIMI++ P  QN
Sbjct  61   KKVTRSIMIVRPPGYQN  77



>ref|XP_002891943.1| hypothetical protein ARALYDRAFT_474784 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68202.1| hypothetical protein ARALYDRAFT_474784 [Arabidopsis lyrata subsp. 
lyrata]
Length=136

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 55/77 (71%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDT-SDD  257
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q    + RS   D+  ++
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QPEAGSARSYGEDSLPEE  57

Query  258  AIKVTRSIMILKSPRNQ  308
            A+KVTRSIMI+K P  Q
Sbjct  58   AVKVTRSIMIVKPPGYQ  74



>gb|KFK35518.1| hypothetical protein AALP_AA4G001500 [Arabis alpina]
Length=125

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 55/77 (71%), Gaps = 9/77 (12%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+ + + R      SD+A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSDSGSVR------SDEA  51

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  52   VKVTRSIMIVKPPEYQG  68



>gb|KFK35519.1| hypothetical protein AALP_AA4G001500 [Arabis alpina]
Length=122

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 55/77 (71%), Gaps = 9/77 (12%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG +   Q+ + + R      SD+A
Sbjct  1    MGLLDHLWDDTVAGPRPENGLGKLRKHHTFSFRPSSGND---QSDSGSVR------SDEA  51

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  52   VKVTRSIMIVKPPEYQG  68



>ref|XP_011023703.1| PREDICTED: uncharacterized protein LOC105125098 isoform X2 [Populus 
euphratica]
Length=133

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP P+NGLGKLRK  ++  RPNSGKES+G   +         T+++ 
Sbjct  1    MSLLDHLWDDTVAGPLPDNGLGKLRKKPSYGLRPNSGKESDGSGGSVMRSYGGEATTEET  60

Query  261  IKVTRSIMILKSPRNQN  311
             KVTRSIMI++ P  QN
Sbjct  61   KKVTRSIMIVRPPGYQN  77



>gb|AAM62421.1|AF515795_1 Drm3 [Pisum sativum]
Length=124

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PENGLGKLRK +TF  R +SGKE E      + RS   + S+ A
Sbjct  1    MGLLDQLWDDTVAGPRPENGLGKLRKHNTFAARSSSGKELEAG----SVRSYGEEPSEPA  56

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  Q+
Sbjct  57   TRVTRSIMIVKPPGYQS  73



>ref|XP_003626227.1| Drm3 [Medicago truncatula]
 gb|AES82445.1| dormancy/auxin associated protein [Medicago truncatula]
Length=124

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PENGL KLRK +TF  R NSGKE+E      + RS   ++S+  
Sbjct  1    MGLLDQLWDDTVAGPRPENGLSKLRKHNTFAARSNSGKETEAG----SVRSYGEESSEQT  56

Query  261  IKVTRSIMILKSP  299
             +VTRSIMI+K P
Sbjct  57   TRVTRSIMIVKPP  69



>ref|XP_003626228.1| Drm3 [Medicago truncatula]
 gb|AES82446.1| dormancy/auxin associated protein [Medicago truncatula]
Length=128

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PENGL KLRK +TF  R NSGKE+E      + RS   ++S+  
Sbjct  1    MGLLDQLWDDTVAGPRPENGLSKLRKHNTFAARSNSGKETEAG----SVRSYGEESSEQT  56

Query  261  IKVTRSIMILKSP  299
             +VTRSIMI+K P
Sbjct  57   TRVTRSIMIVKPP  69



>gb|KGN60960.1| hypothetical protein Csa_2G031190 [Cucumis sativus]
Length=125

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSG-KESEGQNPNPNTRSLTVDTSDD  257
            M LL+QLWDDT+AGP PE+GLGKLRK STF+ RP SG KE +G       RS   D+S+ 
Sbjct  1    MGLLDQLWDDTLAGPRPESGLGKLRKHSTFSGRPTSGNKELDGG----RARSYGEDSSES  56

Query  258  AIKVTRSIMILKSPRNQN  311
             +++TRSIMI++ P  QN
Sbjct  57   PVRITRSIMIVRPPGYQN  74



>ref|XP_003626229.1| Drm3 [Medicago truncatula]
 gb|AES82447.1| dormancy/auxin associated protein [Medicago truncatula]
Length=104

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PENGL KLRK +TF  R NSGKE+E      + RS   ++S+  
Sbjct  1    MGLLDQLWDDTVAGPRPENGLSKLRKHNTFAARSNSGKETEAG----SVRSYGEESSEQT  56

Query  261  IKVTRSIMILKSP  299
             +VTRSIMI+K P
Sbjct  57   TRVTRSIMIVKPP  69



>ref|XP_011023704.1| PREDICTED: uncharacterized protein LOC105125098 isoform X3 [Populus 
euphratica]
Length=133

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP P+NGLGKLRK  ++  RPNSGKES+G   +         T+++ 
Sbjct  1    MSLLDHLWDDTVAGPLPDNGLGKLRKKPSYGLRPNSGKESDGSGGSVMRSYGGEATTEET  60

Query  261  IKVTRSIMILKSPRNQN  311
             KVTRSIMI++ P  QN
Sbjct  61   KKVTRSIMIVRPPGYQN  77



>ref|XP_011023702.1| PREDICTED: uncharacterized protein LOC105125098 isoform X1 [Populus 
euphratica]
Length=134

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP P+NGLGKLRK  ++  RPNSGKES+G   +         T+++ 
Sbjct  1    MSLLDHLWDDTVAGPLPDNGLGKLRKKPSYGLRPNSGKESDGSGGSVMRSYGGEATTEET  60

Query  261  IKVTRSIMILKSPRNQN  311
             KVTRSIMI++ P  QN
Sbjct  61   KKVTRSIMIVRPPGYQN  77



>ref|XP_004144777.1| PREDICTED: uncharacterized protein LOC101210613 [Cucumis sativus]
Length=126

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSG-KESEGQNPNPNTRSLTVDTSDD  257
            M LL+QLWDDT+AGP PE+GLGKLRK STF+ RP SG KE +G       RS   D+S+ 
Sbjct  1    MGLLDQLWDDTLAGPRPESGLGKLRKHSTFSGRPTSGNKELDGG----RARSYGEDSSES  56

Query  258  AIKVTRSIMILKSPRNQN  311
             +++TRSIMI++ P  QN
Sbjct  57   PVRITRSIMIVRPPGYQN  74



>ref|XP_006375740.1| hypothetical protein POPTR_0013s01640g [Populus trichocarpa]
 gb|ERP53537.1| hypothetical protein POPTR_0013s01640g [Populus trichocarpa]
Length=133

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP PENGLGKLRK  ++  R NSGKES+G   +         T+++ 
Sbjct  1    MSLLDHLWDDTVAGPLPENGLGKLRKKPSYGLRSNSGKESDGSGGSVMRSYGGEATTEET  60

Query  261  IKVTRSIMILKSPRNQN  311
             KVTRSIMI++ P  QN
Sbjct  61   KKVTRSIMIVRPPGYQN  77



>ref|XP_003591159.1| Auxin-repressed 12.5 kDa protein [Medicago truncatula]
 gb|AES61410.1| dormancy/auxin associated protein [Medicago truncatula]
 gb|AFK35306.1| unknown [Medicago truncatula]
Length=128

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 5/72 (7%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKES-EGQNPNPNTRSLTVDTSDD  257
            MS+L+ LWDDTVAGP PENGLGKLRK  TF  R  S KES EG     N RS + D+ +D
Sbjct  1    MSILDHLWDDTVAGPRPENGLGKLRKHPTFPTRSISDKESGEGG----NVRSYSGDSPED  56

Query  258  AIKVTRSIMILK  293
            A+KVTRSIMI+K
Sbjct  57   AMKVTRSIMIMK  68



>ref|XP_006375741.1| hypothetical protein POPTR_0013s01640g [Populus trichocarpa]
 gb|ERP53538.1| hypothetical protein POPTR_0013s01640g [Populus trichocarpa]
Length=133

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP PENGLGKLRK  ++  R NSGKES+G   +         T+++ 
Sbjct  1    MSLLDHLWDDTVAGPLPENGLGKLRKKPSYGLRSNSGKESDGSGGSVMRSYGGEATTEET  60

Query  261  IKVTRSIMILKSPRNQN  311
             KVTRSIMI++ P  QN
Sbjct  61   KKVTRSIMIVRPPGYQN  77



>ref|XP_003591161.1| Auxin-repressed 12.5 kDa protein [Medicago truncatula]
 gb|AES61412.1| dormancy/auxin associated protein [Medicago truncatula]
Length=119

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 55/78 (71%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKES-EGQNPNPNTRSLTVDTSDD  257
            MS+L+ LWDDTVAGP PENGLGKLRK  TF  R  S KES EG     N RS + D+ +D
Sbjct  1    MSILDHLWDDTVAGPRPENGLGKLRKHPTFPTRSISDKESGEGG----NVRSYSGDSPED  56

Query  258  AIKVTRSIMILKSPRNQN  311
            A+KVTRSIMI+K    Q+
Sbjct  57   AMKVTRSIMIMKPAGYQS  74



>ref|XP_009111260.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Brassica rapa]
Length=121

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 10/77 (13%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M +L+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG          N +S   D+ ++A
Sbjct  1    MGILDHLWDDTVAGPRPENGLGKLRKQHTFSFRPSSG----------NDQSDGGDSPEEA  50

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q 
Sbjct  51   LKVTRSIMIIKPPGYQG  67



>gb|AAM62422.1|AF515796_1 Drm4 [Pisum sativum]
Length=129

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP PENGLGKLRK  +F  R  S KESEG     N RS   D+ + A
Sbjct  1    MSLLDHLWDDTVAGPLPENGLGKLRKHPSFLSRSISDKESEGG----NVRSYGGDSLEGA  56

Query  261  IKVTRSIMILK  293
            +KVTRSIMI+K
Sbjct  57   VKVTRSIMIVK  67



>ref|XP_008454082.1| PREDICTED: uncharacterized protein LOC103494595 isoform X2 [Cucumis 
melo]
Length=125

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSG-KESEGQNPNPNTRSLTVDTSDD  257
            M LL QLWDDTVAGP PE+GLGKLRK ST + RP+SG KE +G     + RS   D+S+ 
Sbjct  1    MGLLEQLWDDTVAGPRPESGLGKLRKHSTSSGRPSSGSKELDGG----SARSYGEDSSES  56

Query  258  AIKVTRSIMILKSPRNQN  311
             +++TRSIMI++ P  QN
Sbjct  57   PVRITRSIMIVRPPGYQN  74



>ref|XP_003591160.1| Auxin-repressed 12.5 kDa protein [Medicago truncatula]
 gb|ACJ83865.1| unknown [Medicago truncatula]
 gb|AES61411.1| dormancy/auxin associated protein [Medicago truncatula]
 gb|AFK48778.1| unknown [Medicago truncatula]
Length=132

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 5/72 (7%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKES-EGQNPNPNTRSLTVDTSDD  257
            MS+L+ LWDDTVAGP PENGLGKLRK  TF  R  S KES EG     N RS + D+ +D
Sbjct  1    MSILDHLWDDTVAGPRPENGLGKLRKHPTFPTRSISDKESGEGG----NVRSYSGDSPED  56

Query  258  AIKVTRSIMILK  293
            A+KVTRSIMI+K
Sbjct  57   AMKVTRSIMIMK  68



>ref|XP_002319507.1| dormancy/auxin associated family protein [Populus trichocarpa]
 gb|EEE95430.1| dormancy/auxin associated family protein [Populus trichocarpa]
Length=134

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP PENGLGKLRK  ++  R NSGKES+G   +         T+++ 
Sbjct  1    MSLLDHLWDDTVAGPLPENGLGKLRKKPSYGLRSNSGKESDGSGGSVMRSYGGEATTEET  60

Query  261  IKVTRSIMILKSPRNQN  311
             KVTRSIMI++ P  QN
Sbjct  61   KKVTRSIMIVRPPGYQN  77



>ref|XP_006375739.1| hypothetical protein POPTR_0013s01640g [Populus trichocarpa]
 gb|ERP53536.1| hypothetical protein POPTR_0013s01640g [Populus trichocarpa]
Length=133

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP PENGLGKLRK  ++  R NSGKES+G   +         T+++ 
Sbjct  1    MSLLDHLWDDTVAGPLPENGLGKLRKKPSYGLRSNSGKESDGSGGSVMRSYGGEATTEET  60

Query  261  IKVTRSIMILKSPRNQN  311
             KVTRSIMI++ P  QN
Sbjct  61   KKVTRSIMIVRPPGYQN  77



>gb|AGM20674.1| dormancy/auxin associated protein [Populus tomentosa]
Length=299

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP P+NGLGKLRK  ++  RPNSGKES+G   +         T+++ 
Sbjct  1    MSLLDHLWDDTVAGPLPDNGLGKLRKKPSYGLRPNSGKESDGSGGSVMRSYGGEATTEET  60

Query  261  IKVTRSIMILKSPRNQN  311
             KVTRSIMI++ P  QN
Sbjct  61   KKVTRSIMIVRPPGYQN  77



>ref|XP_008454074.1| PREDICTED: uncharacterized protein LOC103494595 isoform X1 [Cucumis 
melo]
Length=126

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSG-KESEGQNPNPNTRSLTVDTSDD  257
            M LL QLWDDTVAGP PE+GLGKLRK ST + RP+SG KE +G     + RS   D+S+ 
Sbjct  1    MGLLEQLWDDTVAGPRPESGLGKLRKHSTSSGRPSSGSKELDGG----SARSYGEDSSES  56

Query  258  AIKVTRSIMILKSPRNQN  311
             +++TRSIMI++ P  QN
Sbjct  57   PVRITRSIMIVRPPGYQN  74



>gb|KCW61860.1| hypothetical protein EUGRSUZ_H04545 [Eucalyptus grandis]
Length=135

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 57/83 (69%), Gaps = 9/83 (11%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGK-ESEG-----QNPNPNTRSLTV  242
            M LL+QLWDDTVAGP PE+GLGKLRKFSTF+ R NSGK ESEG        +P+    T 
Sbjct  1    MGLLDQLWDDTVAGPRPESGLGKLRKFSTFSSRSNSGKAESEGGGRMKAYGDPDA---TP  57

Query  243  DTSDDAIKVTRSIMILKSPRNQN  311
                 AI+VTRSI I+K P NQ+
Sbjct  58   SEEAAAIRVTRSITIVKPPGNQS  80



>emb|CDY22075.1| BnaA09g01040D [Brassica napus]
Length=121

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 10/77 (13%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M +L+ LWDDTVAGP PENGLGKLRK  TF+FRP+SG          N +S   D+ ++A
Sbjct  1    MGILDHLWDDTVAGPRPENGLGKLRKQHTFSFRPSSG----------NDQSDGGDSPEEA  50

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSI+I+K P  Q 
Sbjct  51   LKVTRSIIIIKPPGYQG  67



>gb|EPS59282.1| drm3-like protein [Genlisea aurea]
Length=119

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 7/75 (9%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+ LWDDTVAGP P++GLGKLRK +TF+ R +SGKES         +S   D S+  
Sbjct  1    MSLLDHLWDDTVAGPLPDSGLGKLRKNATFSSRSDSGKES-------IRKSFEEDASETG  53

Query  261  IKVTRSIMILKSPRN  305
            ++VTRSIMI+K P+N
Sbjct  54   VRVTRSIMIVKRPQN  68



>ref|XP_004494583.1| PREDICTED: uncharacterized protein LOC101493722 isoform X4 [Cicer 
arietinum]
Length=128

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PENGLGKLRK +TF  R  SGKE E        RS   ++ +  
Sbjct  1    MGLLDQLWDDTVAGPRPENGLGKLRKHNTFASRSTSGKEME----TGIVRSYGEESLEQV  56

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  Q+
Sbjct  57   TRVTRSIMIVKPPGYQS  73



>ref|XP_004494582.1| PREDICTED: uncharacterized protein LOC101493722 isoform X3 [Cicer 
arietinum]
Length=124

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PENGLGKLRK +TF  R  SGKE E        RS   ++ +  
Sbjct  1    MGLLDQLWDDTVAGPRPENGLGKLRKHNTFASRSTSGKEME----TGIVRSYGEESLEQV  56

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  Q+
Sbjct  57   TRVTRSIMIVKPPGYQS  73



>ref|XP_009411670.1| PREDICTED: uncharacterized protein LOC103993363 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=142

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PE GLG+LRK S+F FRP+SG ++EG   +           D  
Sbjct  1    MGLLDQLWDDTVAGPRPETGLGRLRKHSSFGFRPSSGGKAEGAAAHGGIARSEGGGEDVE  60

Query  261  IKVTRSIMILK  293
            ++VTRSIMI +
Sbjct  61   VRVTRSIMIKR  71



>ref|XP_006433430.1| hypothetical protein CICLE_v10002843mg [Citrus clementina]
 gb|ESR46670.1| hypothetical protein CICLE_v10002843mg [Citrus clementina]
 gb|KDO56186.1| hypothetical protein CISIN_1g033116mg [Citrus sinensis]
Length=96

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PE+GLGKLRK S+F+FR +SGKES+G N     RS   +T  DA
Sbjct  1    MGLLDQLWDDTVAGPRPESGLGKLRKHSSFSFRSSSGKESDGGN---VIRSDVDETPMDA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q+
Sbjct  58   MKVTRSIMIVKPPGYQS  74



>ref|XP_006382465.1| hypothetical protein POPTR_0005s02410g [Populus trichocarpa]
 gb|ABK96665.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP60262.1| hypothetical protein POPTR_0005s02410g [Populus trichocarpa]
Length=130

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 53/78 (68%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVD-TSDD  257
            MSLL+QLWDDTVAGP PE+GLGKLRK  +   RPN GKES G       RS + + T+ D
Sbjct  1    MSLLDQLWDDTVAGPLPESGLGKLRKMPSLGLRPNPGKESGGGG---VMRSHSEEATTVD  57

Query  258  AIKVTRSIMILKSPRNQN  311
              +VTRSIMI++ P   N
Sbjct  58   EKRVTRSIMIVRPPGYTN  75



>ref|XP_004494581.1| PREDICTED: uncharacterized protein LOC101493722 isoform X2 [Cicer 
arietinum]
Length=124

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PENGLGKLRK +TF  R  SGKE E        RS   ++ +  
Sbjct  1    MGLLDQLWDDTVAGPRPENGLGKLRKHNTFASRSTSGKEME----TGIVRSYGEESLEQV  56

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  Q+
Sbjct  57   TRVTRSIMIVKPPGYQS  73



>gb|KJB45967.1| hypothetical protein B456_007G341000 [Gossypium raimondii]
Length=126

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 55/78 (71%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTS-DD  257
            M LL+QLWDDTVAGP P+ GLGKLRK S + F PNS +ES+G     + RS   +TS ++
Sbjct  1    MGLLDQLWDDTVAGPRPDTGLGKLRKQSKYTFWPNSARESDGG----SVRSNGDETSLEE  56

Query  258  AIKVTRSIMILKSPRNQN  311
            A +VTR+IMI+K P  Q 
Sbjct  57   ATRVTRTIMIVKPPGYQT  74



>ref|XP_006382464.1| dormancy/auxin associated family protein [Populus trichocarpa]
 gb|ERP60261.1| dormancy/auxin associated family protein [Populus trichocarpa]
Length=130

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 53/78 (68%), Gaps = 4/78 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVD-TSDD  257
            MSLL+QLWDDTVAGP PE+GLGKLRK  +   RPN GKES G       RS + + T+ D
Sbjct  1    MSLLDQLWDDTVAGPLPESGLGKLRKMPSLGLRPNPGKESGGGG---VMRSHSEEATTVD  57

Query  258  AIKVTRSIMILKSPRNQN  311
              +VTRSIMI++ P   N
Sbjct  58   EKRVTRSIMIVRPPGYTN  75



>ref|XP_006433432.1| hypothetical protein CICLE_v10002843mg [Citrus clementina]
 ref|XP_006472104.1| PREDICTED: uncharacterized protein LOC102616956 [Citrus sinensis]
 gb|ESR46672.1| hypothetical protein CICLE_v10002843mg [Citrus clementina]
 gb|KDO56185.1| hypothetical protein CISIN_1g033116mg [Citrus sinensis]
Length=127

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PE+GLGKLRK S+F+FR +SGKES+G N     RS   +T  DA
Sbjct  1    MGLLDQLWDDTVAGPRPESGLGKLRKHSSFSFRSSSGKESDGGN---VIRSDVDETPMDA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q+
Sbjct  58   MKVTRSIMIVKPPGYQS  74



>gb|KDO56183.1| hypothetical protein CISIN_1g033116mg [Citrus sinensis]
Length=120

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PE+GLGKLRK S+F+FR +SGKES+G N     RS   +T  DA
Sbjct  1    MGLLDQLWDDTVAGPRPESGLGKLRKHSSFSFRSSSGKESDGGN---VIRSDVDETPMDA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q+
Sbjct  58   MKVTRSIMIVKPPGYQS  74



>ref|XP_006433431.1| hypothetical protein CICLE_v10002843mg [Citrus clementina]
 gb|ESR46671.1| hypothetical protein CICLE_v10002843mg [Citrus clementina]
 gb|KDO56184.1| hypothetical protein CISIN_1g033116mg [Citrus sinensis]
Length=123

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PE+GLGKLRK S+F+FR +SGKES+G N     RS   +T  DA
Sbjct  1    MGLLDQLWDDTVAGPRPESGLGKLRKHSSFSFRSSSGKESDGGN---VIRSDVDETPMDA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q+
Sbjct  58   MKVTRSIMIVKPPGYQS  74



>ref|XP_010043047.1| PREDICTED: uncharacterized protein LOC104432281 isoform X2 [Eucalyptus 
grandis]
Length=123

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWD+TVAGP P++GLGKLRK +TF+ R NSGKE+E      N RS     S +A
Sbjct  1    MGLLDHLWDETVAGPTPDSGLGKLRKHNTFSSRSNSGKETEAS----NARSYGDGASQEA  56

Query  261  IK-VTRSIMILKSPRNQN  311
            +K VTRSI I++ P  Q+
Sbjct  57   VKRVTRSITIVRPPGYQS  74



>ref|XP_010674069.1| PREDICTED: uncharacterized protein LOC104890326 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=132

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 51/78 (65%), Gaps = 8/78 (10%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL +LWDDTVAGP P+ GLG+LRKF+TFN RP+  KE EG N   N RS   D    A
Sbjct  1    MGLLEKLWDDTVAGPQPDYGLGRLRKFNTFNVRPSPSKEMEGGN---NGRSYGGDGISGA  57

Query  261  -----IKVTRSIMILKSP  299
                 ++VTR IMI+K P
Sbjct  58   DNQEEMRVTRKIMIVKPP  75



>gb|KDO56182.1| hypothetical protein CISIN_1g033116mg [Citrus sinensis]
Length=127

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PE+GLGKLRK S+F+FR +SGKES+G N     RS   +T  DA
Sbjct  1    MGLLDQLWDDTVAGPRPESGLGKLRKHSSFSFRSSSGKESDGGN---VIRSDVDETPMDA  57

Query  261  IKVTRSIMILKSPRNQN  311
            +KVTRSIMI+K P  Q+
Sbjct  58   MKVTRSIMIVKPPGYQS  74



>ref|XP_004494580.1| PREDICTED: uncharacterized protein LOC101493722 isoform X1 [Cicer 
arietinum]
Length=151

 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PENGLGKLRK +TF  R  SGKE E        RS   ++ +  
Sbjct  1    MGLLDQLWDDTVAGPRPENGLGKLRKHNTFASRSTSGKEME----TGIVRSYGEESLEQV  56

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P  Q+
Sbjct  57   TRVTRSIMIVKPPGYQS  73



>ref|XP_008246439.1| PREDICTED: uncharacterized protein LOC103344606 isoform X1 [Prunus 
mume]
 gb|AAB88876.1| putative auxin-repressed protein [Prunus armeniaca]
Length=133

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+ GLGKLRK  TF+FR +S   + G +   N  S   D++++A
Sbjct  1    MGLLDQLWDDTVAGPRPDIGLGKLRKHKTFSFRSSS---ANGSSDGGNVGSYGEDSTEEA  57

Query  261  IKVTRSIMILKSP  299
             +VTRSIMI+K P
Sbjct  58   TRVTRSIMIVKPP  70



>ref|XP_011036884.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X5 [Populus 
euphratica]
Length=130

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+QLWDDTVAGP PE+GLGKLRK  +   RPN GKES G +   + R     T+ D 
Sbjct  1    MSLLDQLWDDTVAGPLPESGLGKLRKMPSSGLRPNPGKESGGGSVMKSYREEA--TTVDE  58

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI++ P   N
Sbjct  59   KRVTRSIMIVRPPGYTN  75



>ref|XP_011036882.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X3 [Populus 
euphratica]
Length=131

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+QLWDDTVAGP PE+GLGKLRK  +   RPN GKES G +   + R     T+ D 
Sbjct  1    MSLLDQLWDDTVAGPLPESGLGKLRKMPSSGLRPNPGKESGGGSVMKSYREEA--TTVDE  58

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI++ P   N
Sbjct  59   KRVTRSIMIVRPPGYTN  75



>ref|XP_008246440.1| PREDICTED: uncharacterized protein LOC103344606 isoform X2 [Prunus 
mume]
Length=132

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+ GLGKLRK  TF+FR +S   + G +   N  S   D++++A
Sbjct  1    MGLLDQLWDDTVAGPRPDIGLGKLRKHKTFSFRSSS---ANGSSDGGNVGSYGEDSTEEA  57

Query  261  IKVTRSIMILKSP  299
             +VTRSIMI+K P
Sbjct  58   TRVTRSIMIVKPP  70



>ref|XP_011036883.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X4 [Populus 
euphratica]
Length=130

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+QLWDDTVAGP PE+GLGKLRK  +   RPN GKES G +   + R     T+ D 
Sbjct  1    MSLLDQLWDDTVAGPLPESGLGKLRKMPSSGLRPNPGKESGGGSVMKSYREEA--TTVDE  58

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI++ P   N
Sbjct  59   KRVTRSIMIVRPPGYTN  75



>ref|XP_011036880.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Populus 
euphratica]
Length=144

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+QLWDDTVAGP PE+GLGKLRK  +   RPN GKES G +   + R     T+ D 
Sbjct  1    MSLLDQLWDDTVAGPLPESGLGKLRKMPSSGLRPNPGKESGGGSVMKSYREEA--TTVDE  58

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI++ P   N
Sbjct  59   KRVTRSIMIVRPPGYTN  75



>ref|XP_010043046.1| PREDICTED: uncharacterized protein LOC104432281 isoform X1 [Eucalyptus 
grandis]
 gb|KCW85066.1| hypothetical protein EUGRSUZ_B01910 [Eucalyptus grandis]
Length=126

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWD+TVAGP P++GLGKLRK +TF+ R NSGKE+E      N RS     S +A
Sbjct  1    MGLLDHLWDETVAGPTPDSGLGKLRKHNTFSSRSNSGKETEAS----NARSYGDGASQEA  56

Query  261  IK-VTRSIMILKSPRNQN  311
            +K VTRSI I++ P  Q+
Sbjct  57   VKRVTRSITIVRPPGYQS  74



>ref|XP_010674068.1| PREDICTED: uncharacterized protein LOC104890326 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=135

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 51/78 (65%), Gaps = 8/78 (10%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL +LWDDTVAGP P+ GLG+LRKF+TFN RP+  KE EG N   N RS   D    A
Sbjct  1    MGLLEKLWDDTVAGPQPDYGLGRLRKFNTFNVRPSPSKEMEGGN---NGRSYGGDGISGA  57

Query  261  -----IKVTRSIMILKSP  299
                 ++VTR IMI+K P
Sbjct  58   DNQEEMRVTRKIMIVKPP  75



>gb|KCW85067.1| hypothetical protein EUGRSUZ_B01910 [Eucalyptus grandis]
Length=109

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+ LWD+TVAGP P++GLGKLRK +TF+ R NSGKE+E      N RS     S +A
Sbjct  1    MGLLDHLWDETVAGPTPDSGLGKLRKHNTFSSRSNSGKETEAS----NARSYGDGASQEA  56

Query  261  IK-VTRSIMILKSPRNQN  311
            +K VTRSI I++ P  Q+
Sbjct  57   VKRVTRSITIVRPPGYQS  74



>ref|XP_009618231.1| PREDICTED: uncharacterized protein LOC104110436 isoform X1 [Nicotiana 
tomentosiformis]
Length=122

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 96/136 (71%), Gaps = 14/136 (10%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MS+L++LWDDTVAGP P+ GLGKLRK STFN                ++     + S + 
Sbjct  1    MSILDKLWDDTVAGPRPDTGLGKLRKSSTFNLG--------------SSSGKESEGSQEM  46

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             +VT+ IMI+K P N +KDSPP SP+ + AGSTPPVSPF+G GG+EA+RFRRRS  FAYE
Sbjct  47   ARVTKRIMIVKPPGNLSKDSPPVSPASASAGSTPPVSPFAGGGGKEAFRFRRRSGPFAYE  106

Query  441  NARGIGPRNAPPPYDV  488
            NA GIGPR+ PPPYD+
Sbjct  107  NASGIGPRSPPPPYDL  122



>gb|KHG12160.1| Auxin-repressed 12.5 kDa [Gossypium arboreum]
Length=123

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTS-DD  257
            M LL+QLWDD+VAGP P+ GL KLRK S F F PNS KES+G     + RS   +TS ++
Sbjct  1    MGLLDQLWDDSVAGPRPDTGLSKLRKQSKFTFWPNSAKESDGG----SVRSNGDETSLEE  56

Query  258  AIKVTRSIMILKSPRNQN  311
            A +VTR+IMI+K P  Q 
Sbjct  57   ATRVTRTIMIVKPPGYQT  74



>ref|XP_009782455.1| PREDICTED: uncharacterized protein LOC104231201 isoform X2 [Nicotiana 
sylvestris]
Length=117

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 14/79 (18%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MS+L++LWDDTVAGP P++GLGKLRK STFN   +SGKE+EG              S + 
Sbjct  1    MSILDKLWDDTVAGPRPDSGLGKLRKSSTFNLGSSSGKETEG--------------SQEV  46

Query  261  IKVTRSIMILKSPRNQNKD  317
             +VT+ IMI+K P   +KD
Sbjct  47   ARVTKRIMIVKPPGYVSKD  65



>ref|XP_009338244.1| PREDICTED: uncharacterized protein LOC103930608 isoform X1 [Pyrus 
x bretschneideri]
 gb|AGG19166.1| auxin-repressed protein [Pyrus pyrifolia]
Length=139

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 4/73 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDT+AGP P++GLGKLRK  TF+FR +S   + G +   N RS   ++ ++A
Sbjct  1    MGLLDQLWDDTLAGPQPDSGLGKLRKHKTFSFRSSS---ATGSSDGGNVRSFGGNSPEEA  57

Query  261  IKVTRSIMILKSP  299
             KVTRSIMI+K P
Sbjct  58   -KVTRSIMIVKPP  69



>ref|NP_001287926.1| uncharacterized protein LOC101493302 [Cicer arietinum]
 gb|AGP25718.1| hypothetical protein [Cicer arietinum]
Length=129

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 5/79 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPN-SGKESEGQNPNPNTRSLTVDTSDD  257
            M LL+ LWDDTVAGP PENGL KLRK  TF   P+ S KE+EG     N RS    T+++
Sbjct  1    MDLLDHLWDDTVAGPRPENGLVKLRKHPTFPNSPSISAKEAEGG----NVRSYGGGTAEE  56

Query  258  AIKVTRSIMILKSPRNQNK  314
             ++VTRSIMI+K    Q++
Sbjct  57   GMRVTRSIMIVKPAGYQSQ  75



>ref|XP_009338245.1| PREDICTED: uncharacterized protein LOC103930608 isoform X2 [Pyrus 
x bretschneideri]
Length=139

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 4/73 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDT+AGP P++GLGKLRK  TF+FR +S   + G +   N RS   ++ ++A
Sbjct  1    MGLLDQLWDDTLAGPQPDSGLGKLRKHKTFSFRSSS---ATGSSDGGNVRSFGGNSPEEA  57

Query  261  IKVTRSIMILKSP  299
             KVTRSIMI+K P
Sbjct  58   -KVTRSIMIVKPP  69



>ref|XP_009411671.1| PREDICTED: uncharacterized protein LOC103993363 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=141

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PE GLG+LRK S+F FRP+SG + EG   +           D  
Sbjct  1    MGLLDQLWDDTVAGPRPETGLGRLRKHSSFGFRPSSGGK-EGAAAHGGIARSEGGGEDVE  59

Query  261  IKVTRSIMILK  293
            ++VTRSIMI +
Sbjct  60   VRVTRSIMIKR  70



>ref|XP_008363969.1| PREDICTED: uncharacterized protein LOC103427679 isoform X1 [Malus 
domestica]
Length=139

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDT+AGP P++GLGKLRK  TF+FR +S   + G +   + RSL  ++ ++A
Sbjct  1    MGLLDQLWDDTLAGPQPDSGLGKLRKHKTFSFRSSS---ATGSSDGGSVRSLGGNSPEEA  57

Query  261  IKVTRSIMILKSP  299
             K+TRSIMI+K P
Sbjct  58   -KITRSIMIVKPP  69



>ref|XP_008363970.1| PREDICTED: uncharacterized protein LOC103427679 isoform X2 [Malus 
domestica]
Length=139

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (74%), Gaps = 4/73 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDT+AGP P++GLGKLRK  TF+FR +S   + G +   + RSL  ++ ++A
Sbjct  1    MGLLDQLWDDTLAGPQPDSGLGKLRKHKTFSFRSSS---ATGSSDGGSVRSLGGNSPEEA  57

Query  261  IKVTRSIMILKSP  299
             K+TRSIMI+K P
Sbjct  58   -KITRSIMIVKPP  69



>ref|XP_007206134.1| hypothetical protein PRUPE_ppa013236mg [Prunus persica]
 gb|EMJ07333.1| hypothetical protein PRUPE_ppa013236mg [Prunus persica]
Length=132

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+ GLGKLRK  TF+FR +S K S       +  S   D++++A
Sbjct  1    MGLLDQLWDDTVAGPRPDIGLGKLRKHKTFSFRSSSAKGSSDGG---SVGSYGEDSTEEA  57

Query  261  IKVTRSIMILKSP  299
             +VTRSIMI+K P
Sbjct  58   TRVTRSIMIVKPP  70



>ref|XP_007206135.1| hypothetical protein PRUPE_ppa013236mg [Prunus persica]
 gb|EMJ07334.1| hypothetical protein PRUPE_ppa013236mg [Prunus persica]
Length=133

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 51/73 (70%), Gaps = 3/73 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+ GLGKLRK  TF+FR +S K S       +  S   D++++A
Sbjct  1    MGLLDQLWDDTVAGPRPDIGLGKLRKHKTFSFRSSSAKGSSDGG---SVGSYGEDSTEEA  57

Query  261  IKVTRSIMILKSP  299
             +VTRSIMI+K P
Sbjct  58   TRVTRSIMIVKPP  70



>ref|XP_010921658.1| PREDICTED: uncharacterized protein LOC105045183 [Elaeis guineensis]
 gb|AGE46024.1| putative dormancy/auxin associated protein [Elaeis guineensis]
Length=130

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 73/138 (53%), Gaps = 10/138 (7%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKES--EGQNPNPNTRSLTVDTSD  254
            M LL++LWDDTVAGP PE GLGKLRK+S+F FRP+SGKE   +G    P         ++
Sbjct  1    MGLLDKLWDDTVAGPRPETGLGKLRKYSSFTFRPSSGKEEAMDGGIAKPA-------GTE  53

Query  255  DAIKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfa  434
            +  KVTR+IMI K P           PS     + P      G      +R +  S +F 
Sbjct  54   EEPKVTRTIMI-KRPTGCPSPGNGTPPSSPAGSTPPVSPFSGGGREWNRFRRKSASDAFE  112

Query  435  yeNARGIGPRNAPPPYDV  488
                 G+GPRN  PPY+V
Sbjct  113  KGGMGGVGPRNPAPPYEV  130



>ref|NP_001237812.1| uncharacterized protein LOC100306373 [Glycine max]
 gb|ACU14512.1| unknown [Glycine max]
Length=132

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 79/134 (59%), Gaps = 9/134 (7%)
 Frame = -2

Query  502  GLIAHTS*GGGAFLGPIPLAFS*ANDADLLLNRYASLPPAPEKgdtggvdpagdgdgdag  323
            GLI HTS  G   LG     FS A+D DLL  R  SL  APEKGDTGGV+PAG+   D  
Sbjct  7    GLICHTS-KGEEELGLFWPVFSYASDVDLLRKRKDSL--APEKGDTGGVEPAGEAGADPL  63

Query  322  GESLF*LRGDFSIMILLVTLIASSLVSTVSDLVFGFGF*PSDSLPELGRKLKVENFLSFP  143
               L+   G F+IMIL VTL ASS  S+  D         SDSLPE  RK KV  F S P
Sbjct  64   --GLWLPPGGFTIMILRVTLTASSGKSSPYDFTLPL----SDSLPEADRKAKVWCFRSLP  117

Query  142  RPFSGGGPATVSSQ  101
            RPFSG GPATVSS 
Sbjct  118  RPFSGRGPATVSSH  131



>ref|XP_008388528.1| PREDICTED: uncharacterized protein LOC103450899 isoform X2 [Malus 
domestica]
Length=145

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 4/74 (5%)
 Frame = +3

Query  78   AMSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDD  257
             + LL+QLWDDTVAGP P++GLGKLRK  TF+FR +S   + G +   N R    ++ ++
Sbjct  2    GLRLLDQLWDDTVAGPQPDSGLGKLRKHKTFSFRSSS---ATGSSDGGNVRXYGXNSPEE  58

Query  258  AIKVTRSIMILKSP  299
            A KVTRSIMI+K P
Sbjct  59   A-KVTRSIMIIKPP  71



>ref|XP_008789854.1| PREDICTED: uncharacterized protein LOC103707231 [Phoenix dactylifera]
Length=129

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 67/136 (49%), Gaps = 7/136 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL++LWDDTVAGP PE GL KLRK STF FRP+ GKE   +              D+A
Sbjct  1    MGLLDKLWDDTVAGPRPETGLSKLRKHSTFAFRPSPGKEEAKEG------GSGKFEGDEA  54

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             +VTRSIMI K P           P      + P      G      +R +  S ++   
Sbjct  55   PRVTRSIMI-KRPTGCPSPGNATPPLSPSGSTPPVSPFSGGGREWNRFRRKSSSDAYERG  113

Query  441  NARGIGPRNAPPPYDV  488
               G+GPRN  PPY+V
Sbjct  114  GMAGVGPRNPAPPYEV  129



>ref|XP_010938382.1| PREDICTED: uncharacterized protein LOC105057465 [Elaeis guineensis]
Length=130

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 68/136 (50%), Gaps = 6/136 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL++LWDDTVAGP PE GL KLRK STF +RP+SGKE   +     T  L     ++A
Sbjct  1    MGLLDKLWDDTVAGPRPETGLSKLRKHSTFAYRPSSGKEEAKEA---GTGKL---EGEEA  54

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             +VTRSIMI +     +  +    PSP  +          G       R     A     
Sbjct  55   PRVTRSIMIKRPTGCPSPGNGTPPPSPGVSTPPLSPFSGGGREWNRFRRKSSSDAYENRG  114

Query  441  NARGIGPRNAPPPYDV  488
               G+GPRN  PPY+V
Sbjct  115  GMAGVGPRNPAPPYEV  130



>ref|XP_008388526.1| PREDICTED: uncharacterized protein LOC103450899 isoform X1 [Malus 
domestica]
Length=159

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 52/74 (70%), Gaps = 4/74 (5%)
 Frame = +3

Query  78   AMSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDD  257
             + LL+QLWDDTVAGP P++GLGKLRK  TF+FR +S   + G +   N R    ++ ++
Sbjct  2    GLRLLDQLWDDTVAGPQPDSGLGKLRKHKTFSFRSSS---ATGSSDGGNVRXYGXNSPEE  58

Query  258  AIKVTRSIMILKSP  299
            A KVTRSIMI+K P
Sbjct  59   A-KVTRSIMIIKPP  71



>ref|XP_009382530.1| PREDICTED: uncharacterized protein LOC103970471 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=140

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL++LWDDT+AGP PE GLG+LRK S+F FR NSG +           S T    + A
Sbjct  1    MGLLDKLWDDTLAGPRPETGLGRLRKHSSFGFRSNSGGKEGAAAGRGIAGSDTGGGDEVA  60

Query  261  IKVTRSIMILK  293
            ++VTRSIMI +
Sbjct  61   VRVTRSIMIKR  71



>ref|XP_008784751.1| PREDICTED: uncharacterized protein LOC103703620 [Phoenix dactylifera]
Length=130

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 71/136 (52%), Gaps = 6/136 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL++LWDDTVAGP PE GLGKLRK S+F FRP++GKE        +  S     +++ 
Sbjct  1    MGLLDKLWDDTVAGPRPETGLGKLRKHSSFTFRPSTGKEEAM-----DRGSAKSGGAEEE  55

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             +VTR+IMI K P           PS     + P      G      +R +  S +F   
Sbjct  56   PRVTRTIMI-KRPTGCPSPGNGTPPSSPLGSTPPVSPFSGGGREWNRFRRKSSSDAFERG  114

Query  441  NARGIGPRNAPPPYDV  488
               G+GPRN  PPY+V
Sbjct  115  GMGGVGPRNPAPPYEV  130



>ref|XP_010100964.1| hypothetical protein L484_004927 [Morus notabilis]
 gb|EXB86429.1| hypothetical protein L484_004927 [Morus notabilis]
Length=119

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEG  206
            M LL+QLWDDTVAGP PEN  GKLRK+S+F+FRPNSGK S+G
Sbjct  1    MGLLDQLWDDTVAGPRPENERGKLRKYSSFSFRPNSGKGSDG  42



>ref|XP_011036881.1| PREDICTED: uncharacterized protein LOC105134240 isoform X2 [Populus 
euphratica]
Length=142

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 50/77 (65%), Gaps = 4/77 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL+QLWDDTVAGP PE+GLGKLRK  +   RPN   ES G +   + R     T+ D 
Sbjct  1    MSLLDQLWDDTVAGPLPESGLGKLRKMPSSGLRPN--PESGGGSVMKSYREEA--TTVDE  56

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI++ P   N
Sbjct  57   KRVTRSIMIVRPPGYTN  73



>gb|ABB72822.1| Drm3-like protein-like protein [Solanum tuberosum]
Length=74

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQN  212
            MSLL++LWDDTVAGP P++GLGKLRK+STF+ R NSGK S G+ 
Sbjct  1    MSLLDKLWDDTVAGPLPDSGLGKLRKYSTFSPRSNSGKGSAGRE  44



>ref|XP_004302272.1| PREDICTED: uncharacterized protein LOC101299014 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=126

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 6/73 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+ GLGKLRK      R NSGK  +G     + RS    ++++ 
Sbjct  1    MGLLDQLWDDTVAGPRPDIGLGKLRKNQP--LRSNSGKGVDGG----SARSYVEGSTEET  54

Query  261  IKVTRSIMILKSP  299
             +VTRSIMI+K P
Sbjct  55   TRVTRSIMIVKPP  67



>ref|XP_011466170.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X1 [Fragaria 
vesca subsp. vesca]
Length=127

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 48/73 (66%), Gaps = 6/73 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP P+ GLGKLRK      R NSGK  +G     + RS    ++++ 
Sbjct  1    MGLLDQLWDDTVAGPRPDIGLGKLRKNQP--LRSNSGKGVDGG----SARSYVEGSTEET  54

Query  261  IKVTRSIMILKSP  299
             +VTRSIMI+K P
Sbjct  55   TRVTRSIMIVKPP  67



>ref|XP_009401626.1| PREDICTED: uncharacterized protein LOC103985603 [Musa acuminata 
subsp. malaccensis]
Length=133

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDTVAGP PE GLG+LRK S+F FR N  KE    +             +  
Sbjct  1    MGLLDQLWDDTVAGPRPETGLGRLRKHSSFGFRSNPSKEGPTAD-GGGIGRSEGGGEEVK  59

Query  261  IKVTRSIMILK  293
            ++VTRSIMI +
Sbjct  60   VRVTRSIMIKR  70



>ref|XP_004241920.1| PREDICTED: auxin-repressed 12.5 kDa protein [Solanum lycopersicum]
Length=137

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 8/75 (11%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVD---TS  251
            M  L++LWDDT+AGP PE+GLGKLRK+++F     +G+ +    P+P    L       S
Sbjct  1    MGFLHKLWDDTLAGPAPESGLGKLRKYNSF-----AGRSTCSAPPSPTKLGLHHHGGGAS  55

Query  252  DDAIKVTRSIMILKS  296
            DD + V+RSI IL+S
Sbjct  56   DDLMPVSRSITILRS  70



>ref|XP_009382529.1| PREDICTED: uncharacterized protein LOC103970471 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=141

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDD-  257
            M LL++LWDDT+AGP PE GLG+LRK S+F FR NSG ++EG               D+ 
Sbjct  1    MGLLDKLWDDTLAGPRPETGLGRLRKHSSFGFRSNSGGKAEGAAAGRGIAGSDTGGGDEV  60

Query  258  AIKVTRSIMI  287
            A++VTRSIMI
Sbjct  61   AVRVTRSIMI  70



>ref|XP_008450631.1| PREDICTED: uncharacterized protein LOC103492161 [Cucumis melo]
Length=137

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSL-----TVD  245
            M LL+QLWDDT+AGP P++GLGKLRK  +F  R  + KES           L        
Sbjct  1    MGLLDQLWDDTLAGPTPDSGLGKLRKHPSFTSRSAAAKESNNGKRYEEGIMLSSSSSAAA  60

Query  246  TSDDAIKVTRSIMILKSP  299
             ++D +KV+R IMI+K P
Sbjct  61   AAEDGVKVSRRIMIVKPP  78



>ref|XP_009385017.1| PREDICTED: uncharacterized protein LOC103972408 [Musa acuminata 
subsp. malaccensis]
Length=139

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 47/77 (61%), Gaps = 8/77 (10%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKE-SEGQNPNPNTRSLTVDTSDD  257
            M LL++LWDDT+AGP PE+GLG+LRK+S+F FRP+S    +        T  L     D+
Sbjct  1    MGLLDKLWDDTLAGPRPESGLGRLRKYSSFAFRPSSSSPLTAADKDEAATGGLGRPYGDE  60

Query  258  -------AIKVTRSIMI  287
                   A +VTRSIMI
Sbjct  61   GSAEAAAAPRVTRSIMI  77



>ref|XP_006357424.1| PREDICTED: uncharacterized protein LOC102600721 [Solanum tuberosum]
Length=139

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 47/77 (61%), Gaps = 10/77 (13%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPN-----TRSLTVD  245
            M  L++LWDDT+AGP PE+GLGKLRK+++F     +G+ +    P+P             
Sbjct  1    MGFLHKLWDDTLAGPAPESGLGKLRKYNSF-----AGRSTCSAPPSPTKLGLHHHGGGGG  55

Query  246  TSDDAIKVTRSIMILKS  296
             SDD + V+RSI IL+S
Sbjct  56   ASDDLMPVSRSITILRS  72



>ref|XP_009618232.1| PREDICTED: uncharacterized protein LOC104110436 isoform X2 [Nicotiana 
tomentosiformis]
Length=119

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 14/79 (18%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MS+L++LWDDTVAGP P+ GLGKLRK STFN                ++     + S + 
Sbjct  1    MSILDKLWDDTVAGPRPDTGLGKLRKSSTFNLG--------------SSSGKESEGSQEM  46

Query  261  IKVTRSIMILKSPRNQNKD  317
             +VT+ IMI+K P N +KD
Sbjct  47   ARVTKRIMIVKPPGNLSKD  65



>ref|XP_010914472.1| PREDICTED: uncharacterized protein LOC105039857 isoform X2 [Elaeis 
guineensis]
Length=133

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 6/71 (8%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL++LWDDTVAGP P+ GLG+LRK S+ + RP S ++          RS      ++ 
Sbjct  1    MSLLDKLWDDTVAGPQPDAGLGRLRKPSSLSLRPPSARDEAAAG---EGRSC---GEEEE  54

Query  261  IKVTRSIMILK  293
             +VTR+IMI +
Sbjct  55   PRVTRAIMIKR  65



>ref|XP_010914470.1| PREDICTED: uncharacterized protein LOC105039857 isoform X1 [Elaeis 
guineensis]
Length=136

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            MSLL++LWDDTVAGP P+ GLG+LRK S+ + RP S +    +      RS      ++ 
Sbjct  1    MSLLDKLWDDTVAGPQPDAGLGRLRKPSSLSLRPPSARVVTDEAAAGEGRSC---GEEEE  57

Query  261  IKVTRSIMILK  293
             +VTR+IMI +
Sbjct  58   PRVTRAIMIKR  68



>ref|XP_011467460.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X2 [Fragaria 
vesca subsp. vesca]
Length=115

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 16/72 (22%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE+GLGKLRKF TF+                N  S  +  +D+A
Sbjct  1    MGFLHKLWDETLAGPAPESGLGKLRKFDTFS----------------NPPSAPMVAADEA  44

Query  261  IKVTRSIMILKS  296
              VTRSI IL++
Sbjct  45   PVVTRSITILRT  56



>ref|XP_004303724.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X3 [Fragaria 
vesca subsp. vesca]
Length=112

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 16/72 (22%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE+GLGKLRKF TF+                N  S  +  +D+A
Sbjct  1    MGFLHKLWDETLAGPAPESGLGKLRKFDTFS----------------NPPSAPMVAADEA  44

Query  261  IKVTRSIMILKS  296
              VTRSI IL++
Sbjct  45   PVVTRSITILRT  56



>ref|XP_009605489.1| PREDICTED: putative protein TPRXL [Nicotiana tomentosiformis]
Length=137

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWDDT+AGP P++GL KLRKF+TF+ R  S   S     + +  ++  D SD+ 
Sbjct  1    MGFLHKLWDDTLAGPAPDSGLSKLRKFNTFSGRIASSAPSSPTKFS-HHNAVAAD-SDNP  58

Query  261  IKVTRSIMILKS  296
            I ++RSI IL+S
Sbjct  59   IPISRSITILRS  70



>ref|XP_004303723.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X1 [Fragaria 
vesca subsp. vesca]
Length=125

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 16/72 (22%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE+GLGKLRKF TF+                N  S  +  +D+A
Sbjct  1    MGFLHKLWDETLAGPAPESGLGKLRKFDTFS----------------NPPSAPMVAADEA  44

Query  261  IKVTRSIMILKS  296
              VTRSI IL++
Sbjct  45   PVVTRSITILRT  56



>ref|XP_006840584.1| hypothetical protein AMTR_s00045p00231900 [Amborella trichopoda]
 gb|ERN02259.1| hypothetical protein AMTR_s00045p00231900 [Amborella trichopoda]
Length=132

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 17/77 (22%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M+ L++LWDDT+AGP PENGL KLRK  +   RP+  K  E               S++A
Sbjct  1    MAFLDKLWDDTLAGPQPENGLSKLRKPVS---RPSPAKVDE--------------FSNEA  43

Query  261  IKVTRSIMILKSPRNQN  311
             +VTRSIMI+K P ++N
Sbjct  44   NRVTRSIMIVKPPSDKN  60



>ref|XP_010654395.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X3 [Vitis 
vinifera]
Length=112

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 17/72 (24%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+TVAGPPPE GLGKLRK+ +     ++ +     NP             D 
Sbjct  1    MGFLDKLWDETVAGPPPETGLGKLRKYKSL----SAARSPPIINP-------------DE  43

Query  261  IKVTRSIMILKS  296
            ++VTRSI ILK+
Sbjct  44   VQVTRSITILKT  55



>ref|XP_003632757.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X2 [Vitis 
vinifera]
 emb|CBI35822.3| unnamed protein product [Vitis vinifera]
Length=126

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 17/72 (24%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+TVAGPPPE GLGKLRK+ +     ++ +     NP             D 
Sbjct  1    MGFLDKLWDETVAGPPPETGLGKLRKYKSL----SAARSPPIINP-------------DE  43

Query  261  IKVTRSIMILKS  296
            ++VTRSI ILK+
Sbjct  44   VQVTRSITILKT  55



>ref|XP_010654394.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X1 [Vitis 
vinifera]
Length=133

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 17/72 (24%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+TVAGPPPE GLGKLRK+ +     ++ +     NP             D 
Sbjct  1    MGFLDKLWDETVAGPPPETGLGKLRKYKSL----SAARSPPIINP-------------DE  43

Query  261  IKVTRSIMILKS  296
            ++VTRSI ILK+
Sbjct  44   VQVTRSITILKT  55



>gb|EMT26445.1| hypothetical protein F775_29139 [Aegilops tauschii]
Length=157

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 19/73 (26%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWD+TVAGP P++GLG+LRK+S+F               +P+T + T    D A
Sbjct  1    MGLLDQLWDETVAGPRPDHGLGRLRKYSSF---------------SPSTAAAT----DVA  41

Query  261  IKVTRSIMILKSP  299
              VTRSI I + P
Sbjct  42   PAVTRSITIARPP  54



>ref|XP_006843845.1| hypothetical protein AMTR_s00007p00261640 [Amborella trichopoda]
 gb|ERN05520.1| hypothetical protein AMTR_s00007p00261640 [Amborella trichopoda]
Length=121

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQN  212
            M LL++LWDDT+AGP P+NGL KLRK+S+F  R +S ++   +N
Sbjct  1    MGLLDKLWDDTLAGPQPDNGLSKLRKYSSFTARSSSDEDHHHRN  44



>dbj|BAK01749.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04998.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=130

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 19/73 (26%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWD+TVAGP P++GLG+LR++S+F+  P+                 T   +D A
Sbjct  1    MGLLDQLWDETVAGPRPDHGLGRLRRYSSFS--PS-----------------TAVAADVA  41

Query  261  IKVTRSIMILKSP  299
             KVTRSI I + P
Sbjct  42   PKVTRSITIARPP  54



>gb|ABK24785.1| unknown [Picea sitchensis]
Length=152

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNS---GKESEGQNPNPNTRSLTVD  245
            M LL++LWDD++AGP PE+GLGKLRK +  N    P S    +E+ G+       +    
Sbjct  7    MGLLDKLWDDSLAGPCPESGLGKLRKITITNSSVAPASTPVAEEALGRLRKCRASAECQR  66

Query  246  TSDDAIKVTRSIMILKSP  299
            ++D+A +VT+SI I+K P
Sbjct  67   SNDEARQVTQSITIVKPP  84



>ref|XP_011087435.1| PREDICTED: uncharacterized protein LOC105168923 isoform X2 [Sesamum 
indicum]
Length=112

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 88/136 (65%), Gaps = 24/136 (18%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDT+AGP P++GL                 ESE  N   + RS      +  
Sbjct  1    MGLLDQLWDDTLAGPLPDSGL-----------------ESEVAN---SRRSFDEAPEEAT  40

Query  261  IKVTRSIMILKSPRNQNKDsppaspspspagstppvspFSGaggreayrfrrrsasfaye  440
             +VTRSIMI+K P+   KD    SP  SPAGSTPPVSPF+G GGREA+RFRRRSASFAYE
Sbjct  41   NRVTRSIMIIKPPQANQKD----SPPVSPAGSTPPVSPFAGGGGREAFRFRRRSASFAYE  96

Query  441  NARGIGPRNAPPPYDV  488
             A G+GP++ PPPYD+
Sbjct  97   KASGVGPKSPPPPYDL  112



>gb|AFK38489.1| unknown [Medicago truncatula]
Length=137

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 65/143 (45%), Gaps = 30/143 (21%)
 Frame = -2

Query  499  LIAHTS*G--GGAFLGPIPLAFS*ANDADLLLNRYASLPPAPEKgdtggvdpagdgdgda  326
            LI+HTS G  G     P    FS A+DADL  NR  SL P                    
Sbjct  4    LISHTSKGEEGPDLFWPF---FSYASDADLRRNRKESLVPE--------------NGDTG  46

Query  325  gGESLF*LRGD-------FSIMILLVTLIASSLVSTVSDLVFGFGF*PSDSLPELGRKLK  167
              E     RGD       F+IM+L VTL+  S  S+  DL        S SLPEL R  K
Sbjct  47   VVEPAGEARGDPLSYPGGFTIMMLRVTLVVCSDDSSPYDLTLP----ASVSLPELDRAAK  102

Query  166  VENFLSFPRPFSGGGPATVSSQS  98
            V  F S  RPFSG GPATVSS +
Sbjct  103  VLCFRSLLRPFSGRGPATVSSHN  125



>ref|XP_006829426.1| hypothetical protein AMTR_s00128p00106650 [Amborella trichopoda]
 gb|ERM96842.1| hypothetical protein AMTR_s00128p00106650 [Amborella trichopoda]
Length=74

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 17/77 (22%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M+LL++LWDDT+AG  PENGL KL+K  ++              P+P       + S++A
Sbjct  1    MALLDKLWDDTLAGSQPENGLSKLKKLVSW--------------PSPTK---VHEFSNEA  43

Query  261  IKVTRSIMILKSPRNQN  311
             +VT+SIMI+K P N N
Sbjct  44   KRVTQSIMIVKPPLNNN  60



>gb|ABK21467.1| unknown [Picea sitchensis]
Length=154

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTS---  251
            M LL++LWDD++AGP P++GLGKLRK +  N    +    EG+      R          
Sbjct  1    MGLLDKLWDDSLAGPCPDSGLGKLRKTTITNSAMATASAPEGKVSLRRLRERRASVQFQR  60

Query  252  --DDAIKVTRSIMILKSP  299
              D+AI+VT+SI I+K P
Sbjct  61   LNDEAIQVTQSITIIKRP  78



>ref|XP_009794757.1| PREDICTED: uncharacterized protein LOC104241514 [Nicotiana sylvestris]
 gb|AAO21304.1| auxin-repressed protein-like protein [Nicotiana tabacum]
Length=137

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 8/75 (11%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNT-RSLTVDTSD-  254
            M  L++LWDDT+AGP P++GL KLRKF+TF     SG+ +     +P   R L    +  
Sbjct  1    MGFLHKLWDDTLAGPAPDSGLSKLRKFNTF-----SGRTASSAPSSPTKFRHLNAAAAAA  55

Query  255  -DAIKVTRSIMILKS  296
             D I ++RSI IL+S
Sbjct  56   VDPIPISRSITILRS  70



>gb|AFK45827.1| unknown [Medicago truncatula]
Length=137

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 64/142 (45%), Gaps = 30/142 (21%)
 Frame = -2

Query  496  IAHTS*G--GGAFLGPIPLAFS*ANDADLLLNRYASLPPAPEKgdtggvdpagdgdgdag  323
            I+HTS G  G     P    FS A+DADL  NR  SL P                     
Sbjct  5    ISHTSKGEEGPDLFWPF---FSYASDADLRRNRKESLVPE--------------NGDTGV  47

Query  322  GESLF*LRGD-------FSIMILLVTLIASSLVSTVSDLVFGFGF*PSDSLPELGRKLKV  164
             E     RGD       F+IM+L VTL+  S  S+  DL        S SLPEL R  KV
Sbjct  48   VEPAGEARGDPLSYPGGFTIMMLRVTLVVCSDDSSPYDLTLP----ASVSLPELDRAAKV  103

Query  163  ENFLSFPRPFSGGGPATVSSQS  98
              F S  RPFSG GPATVSS +
Sbjct  104  LCFRSLLRPFSGRGPATVSSHN  125



>gb|ACJ85880.1| unknown [Medicago truncatula]
Length=137

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 74/143 (52%), Gaps = 30/143 (21%)
 Frame = -2

Query  499  LIAHTS*G--GGAFLGPIPLAFS*ANDADLLLNRYASLPPAPEKgdtggvdpagdgdgda  326
            LI+HTS G  G     P    FS  +DADL  NR  SL   PE GDTG V+PAG+     
Sbjct  4    LISHTSKGEEGPDLFWPF---FSYVSDADLRRNRKESL--VPENGDTGVVEPAGEA----  54

Query  325  gGESLF*LRGD-------FSIMILLVTLIASSLVSTVSDLVFGFGF*PSDSLPELGRKLK  167
                    RGD       F+IM+L VTL+  S  S+  DL        S SLPEL R  K
Sbjct  55   --------RGDPLSYPGGFTIMMLRVTLVVCSDDSSPYDLTLP----ASVSLPELDRAAK  102

Query  166  VENFLSFPRPFSGGGPATVSSQS  98
            V  F S  RPFSG GPATVSS +
Sbjct  103  VLCFRSLLRPFSGRGPATVSSHN  125



>ref|XP_004135608.1| PREDICTED: uncharacterized protein LOC101205077 [Cucumis sativus]
 ref|XP_004165705.1| PREDICTED: uncharacterized LOC101205077 [Cucumis sativus]
 gb|KGN66063.1| hypothetical protein Csa_1G569400 [Cucumis sativus]
Length=131

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL+QLWDDT+AGP P++GLGKLRK  +   R  + KES           ++  +S+D+
Sbjct  1    MGLLDQLWDDTLAGPTPDSGLGKLRKHPSLTSRSAAVKESSNGKRYEEGVVMSSSSSEDS  60

Query  261  IKVTRSIMILKSP  299
            +KV+R IMI+K P
Sbjct  61   VKVSRRIMIVKPP  73



>emb|CDO97812.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 7/71 (10%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE+GLGKLRK+++F     SG               +VD  D  
Sbjct  1    MGFLHKLWDETLAGPTPESGLGKLRKYNSF-----SGARPSAPAAPATMMMGSVD--DHL  53

Query  261  IKVTRSIMILK  293
            I V+RSI IL+
Sbjct  54   IPVSRSITILR  64



>ref|NP_001050075.2| Os03g0342900 [Oryza sativa Japonica Group]
 dbj|BAF11989.2| Os03g0342900 [Oryza sativa Japonica Group]
Length=122

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 10/69 (14%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL++LWDDTVAGP P+ GLG+LRK +    RP + K         N  +      +  
Sbjct  1    MGLLDKLWDDTVAGPRPDTGLGRLRKHAA--ARPAAVKI--------NGPTTPAGAEEAP  50

Query  261  IKVTRSIMI  287
            +KVTRSIMI
Sbjct  51   VKVTRSIMI  59



>ref|XP_010104602.1| hypothetical protein L484_005033 [Morus notabilis]
 gb|EXC01333.1| hypothetical protein L484_005033 [Morus notabilis]
Length=149

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 11/77 (14%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTR----SLTVDT  248
            M  L++LWD+T+AGP P+ GL KLRK+++F     SG   +  +P P T     ++T D 
Sbjct  1    MGFLHKLWDETLAGPMPDTGLSKLRKYNSF-----SGTR-QAPSPAPATDPPQIAVTADC  54

Query  249  -SDDAIKVTRSIMILKS  296
              D  ++VTRSI IL++
Sbjct  55   GHDHQVQVTRSITILRT  71



>ref|XP_006829287.1| hypothetical protein AMTR_s00001p00272960 [Amborella trichopoda]
 gb|ERM96703.1| hypothetical protein AMTR_s00001p00272960 [Amborella trichopoda]
Length=110

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 17/77 (22%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M+LL++LWDDT+AGP  ENGL KLRK  +   RP+  K  E               SD+A
Sbjct  1    MALLDKLWDDTLAGPQLENGLSKLRKPVS---RPSLTKVDE--------------FSDEA  43

Query  261  IKVTRSIMILKSPRNQN  311
             +VT+SIMI K P N N
Sbjct  44   NRVTQSIMITKPPPNNN  60



>gb|KJB34913.1| hypothetical protein B456_006G090200 [Gossypium raimondii]
Length=116

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 13/77 (17%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L +LWD+T+AGP PE+GLGKLRK+ +F+ + +S        P+P+      D  ++ 
Sbjct  1    MGFLQKLWDETLAGPMPESGLGKLRKYDSFSVKRSS--------PSPDHYHDDYDYENNN  52

Query  261  -----IKVTRSIMILKS  296
                 + +TRSI IL+S
Sbjct  53   NNNGKMMITRSITILRS  69



>dbj|BAJ85165.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98950.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=134

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 11/74 (15%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTS---  251
            M LL++LWDDTVAGP P+ GLG+LRK +    RP + K ++     P+  ++   T+   
Sbjct  1    MGLLDKLWDDTVAGPQPDTGLGRLRKLAA---RPAAVKINDVA---PDAATVIPPTTPAS  54

Query  252  --DDAIKVTRSIMI  287
              D  +KVTRSIMI
Sbjct  55   GGDAPMKVTRSIMI  68



>ref|XP_008228143.1| PREDICTED: uncharacterized protein LOC103327587 isoform X3 [Prunus 
mume]
Length=110

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 18/72 (25%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE GLGKLRKF + +              +P + S+      D 
Sbjct  1    MGFLHKLWDETLAGPAPETGLGKLRKFDSLS--------------SPASPSMVC----DE  42

Query  261  IKVTRSIMILKS  296
            + VTRSI IL++
Sbjct  43   VPVTRSITILRT  54



>ref|XP_008228142.1| PREDICTED: uncharacterized protein LOC103327587 isoform X2 [Prunus 
mume]
Length=113

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 18/72 (25%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE GLGKLRKF + +              +P + S+      D 
Sbjct  1    MGFLHKLWDETLAGPAPETGLGKLRKFDSLS--------------SPASPSMVC----DE  42

Query  261  IKVTRSIMILKS  296
            + VTRSI IL++
Sbjct  43   VPVTRSITILRT  54



>gb|ABK23998.1| unknown [Picea sitchensis]
Length=155

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  1    MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  60

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT+SI I+K P
Sbjct  61   LNDEAKQVTQSITIMKPP  78



>gb|ADP94920.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94921.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94936.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94937.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
Length=166

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  13   MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  72

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT+SI I+K P
Sbjct  73   LNDEAKQVTQSITIMKPP  90



>gb|ACN41230.1| unknown [Picea sitchensis]
Length=155

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  1    MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  60

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT+SI I+K P
Sbjct  61   LNDEAKQVTQSITIMKPP  78



>gb|KHN37683.1| hypothetical protein glysoja_007386 [Glycine soja]
Length=86

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 17/72 (24%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE GLGKLRK+++F     SG  S         RS    T  +A
Sbjct  1    MGFLHKLWDETLAGPAPETGLGKLRKYNSF-----SGGIS--------VRS----TVAEA  43

Query  261  IKVTRSIMILKS  296
            + ++RSI I++S
Sbjct  44   VPISRSITIVRS  55



>gb|ADP94916.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94918.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94922.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94938.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
Length=166

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  13   MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  72

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT+SI I+K P
Sbjct  73   LNDEAKQVTQSITIMKPP  90



>ref|XP_007024723.1| Dormancy/auxin associated family protein, putative [Theobroma 
cacao]
 gb|EOY27345.1| Dormancy/auxin associated family protein, putative [Theobroma 
cacao]
Length=181

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 14/72 (19%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE GLGKLRK+ +F+        S   +P P      V   ++ 
Sbjct  1    MGFLHKLWDETLAGPMPETGLGKLRKYDSFS--------STRSSPAP------VVDGNNK  46

Query  261  IKVTRSIMILKS  296
            + +TRSI ILKS
Sbjct  47   MMITRSITILKS  58



>ref|XP_008228141.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X1 [Prunus 
mume]
Length=123

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 18/72 (25%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE GLGKLRKF + +              +P + S+      D 
Sbjct  1    MGFLHKLWDETLAGPAPETGLGKLRKFDSLS--------------SPASPSMVC----DE  42

Query  261  IKVTRSIMILKS  296
            + VTRSI IL++
Sbjct  43   VPVTRSITILRT  54



>gb|ADP94910.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
Length=166

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  13   MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  72

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT+SI I+K P
Sbjct  73   LNDEAKQVTQSITIMKPP  90



>ref|XP_003528660.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform 1 [Glycine 
max]
Length=107

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE GLGKLRK+++F+    S   S      P +RS+T+  S   
Sbjct  3    MGFLHKLWDETLAGPAPETGLGKLRKYNSFS--GGSSVRSTVAEHVPISRSITIVRSQSG  60

Query  261  I  263
             
Sbjct  61   F  61



>ref|XP_007135404.1| hypothetical protein PHAVU_010G126600g [Phaseolus vulgaris]
 gb|ESW07398.1| hypothetical protein PHAVU_010G126600g [Phaseolus vulgaris]
Length=110

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 17/72 (24%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE GLGKLRKF+TF         S G   +P        T  + 
Sbjct  2    MGFLHKLWDETLAGPAPETGLGKLRKFNTF---------SAGTAFHP--------TVPED  44

Query  261  IKVTRSIMILKS  296
            + ++RSI I+++
Sbjct  45   VPISRSITIVRT  56



>ref|XP_003528661.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform 2 [Glycine 
max]
Length=122

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTV  242
            M  L++LWD+T+AGP PE GLGKLRK+++F+    S   S      P +RS+T+
Sbjct  3    MGFLHKLWDETLAGPAPETGLGKLRKYNSFS--GGSSVRSTVAEHVPISRSITI  54



>ref|XP_010260275.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Nelumbo nucifera]
Length=120

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTS  251
            M LL +LWDD VAGP P+ GLG+LRK ST   +P + K+ EG+  +   RS+++  S
Sbjct  1    MVLLEKLWDDVVAGPQPDRGLGRLRKLST---KPLNIKDVEGEGSSKYQRSMSMPAS  54



>ref|XP_007135403.1| hypothetical protein PHAVU_010G126600g [Phaseolus vulgaris]
 gb|ESW07397.1| hypothetical protein PHAVU_010G126600g [Phaseolus vulgaris]
Length=125

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 10/58 (17%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN----FRPNSGKESEGQNPNPNTRSLTV  242
            M  L++LWD+T+AGP PE GLGKLRKF+TF+    F P   ++       P +RS+T+
Sbjct  2    MGFLHKLWDETLAGPAPETGLGKLRKFNTFSAGTAFHPTVPEDV------PISRSITI  53



>gb|KHN39595.1| hypothetical protein glysoja_020673 [Glycine soja]
Length=108

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 17/72 (24%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE GLGKLRK+++F     SG  S         RS    T  +A
Sbjct  3    MGFLHKLWDETLAGPAPETGLGKLRKYNSF-----SGGIS--------VRS----TVAEA  45

Query  261  IKVTRSIMILKS  296
            + ++RSI I++S
Sbjct  46   VPISRSITIVRS  57



>ref|XP_002465296.1| hypothetical protein SORBIDRAFT_01g035780 [Sorghum bicolor]
 gb|EER92294.1| hypothetical protein SORBIDRAFT_01g035780 [Sorghum bicolor]
Length=133

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 8/73 (11%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRK----FSTFNFRPNSGKESEGQNPNPNTRSLTVDT  248
            M LL++LWDDTVAGP P+ GLG+LRK     +       +G  S    P+P + S    +
Sbjct  1    MGLLDKLWDDTVAGPRPDTGLGRLRKQPARPAAVKINDPAGDASAFVPPSPASGS----S  56

Query  249  SDDAIKVTRSIMI  287
             +  +KVTRSIMI
Sbjct  57   EETPVKVTRSIMI  69



>ref|XP_011036510.1| PREDICTED: uncharacterized protein LOC105133995 isoform X3 [Populus 
euphratica]
Length=122

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 12/72 (17%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP P++GLGKLRK+ +F+ R +   ++   N            S + 
Sbjct  1    MGFLHKLWDETLAGPMPDSGLGKLRKYDSFSVRSSPPVDAAAAN------------SIED  48

Query  261  IKVTRSIMILKS  296
            + +TRSI I+++
Sbjct  49   MNITRSITIVRT  60



>ref|XP_011036509.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Populus 
euphratica]
Length=132

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 12/72 (17%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP P++GLGKLRK+ +F+ R +   ++   N            S + 
Sbjct  1    MGFLHKLWDETLAGPMPDSGLGKLRKYDSFSVRSSPPVDAAAAN------------SIED  48

Query  261  IKVTRSIMILKS  296
            + +TRSI I+++
Sbjct  49   MNITRSITIVRT  60



>ref|XP_010272386.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Nelumbo nucifera]
Length=119

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 3/43 (7%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQ  209
            M LL +LWDD VAGP P+NGLGKLRK +T   RP + K++EG+
Sbjct  1    MVLLEKLWDDVVAGPQPDNGLGKLRKLTT---RPLNLKDAEGE  40



>ref|XP_007217191.1| hypothetical protein PRUPE_ppa013609mg [Prunus persica]
 gb|EMJ18390.1| hypothetical protein PRUPE_ppa013609mg [Prunus persica]
Length=113

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 18/72 (25%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE GLGKLRKF + +              +P + ++      D 
Sbjct  1    MGFLHKLWDETLAGPAPETGLGKLRKFDSLS--------------SPASPTMVC----DE  42

Query  261  IKVTRSIMILKS  296
            + VTRSI IL++
Sbjct  43   VPVTRSITILRT  54



>gb|ABK23285.1| unknown [Picea sitchensis]
Length=153

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVD-----  245
            M LL++LWDDT+AGP PE+GLGKLRK    N    +    E +      R          
Sbjct  1    MGLLDKLWDDTLAGPRPESGLGKLRKTGWTNSAMATPATPEAEEALSRLRERRASAEFQP  60

Query  246  TSDDAIKVTRSIMILKSP  299
            ++D+A +VT+SI I+K P
Sbjct  61   SNDEARQVTQSITIIKPP  78



>ref|XP_011036508.1| PREDICTED: uncharacterized protein LOC105133995 isoform X1 [Populus 
euphratica]
Length=136

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 12/72 (17%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP P++GLGKLRK+ +F+ R +   ++   N            S + 
Sbjct  1    MGFLHKLWDETLAGPMPDSGLGKLRKYDSFSVRSSPPVDAAAAN------------SIED  48

Query  261  IKVTRSIMILKS  296
            + +TRSI I+++
Sbjct  49   MNITRSITIVRT  60



>ref|XP_002304241.1| dormancy/auxin associated family protein [Populus trichocarpa]
 gb|EEE79220.1| dormancy/auxin associated family protein [Populus trichocarpa]
Length=136

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 12/72 (17%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP P++GLGKLRK+ +F+ R +   ++   N            S + 
Sbjct  1    MGFLHKLWDETLAGPMPDSGLGKLRKYDSFSVRSSPPVDAAAAN------------SIED  48

Query  261  IKVTRSIMILKS  296
            + +TRSI I+++
Sbjct  49   MNITRSITIVRT  60



>gb|ABF95871.1| Dormancy/auxin associated protein, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95872.1| Dormancy/auxin associated protein, expressed [Oryza sativa Japonica 
Group]
Length=122

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL++LWDDTVAGP P+ GLG+LRK +    RP + K     +P  +   + V  +  A
Sbjct  1    MGLLDKLWDDTVAGPRPDTGLGRLRKHAA--ARPAAVKI---NDPTGDAAMVAVPPTTPA  55

Query  261  ------IKVTRSIMI  287
                  +KVTRSIMI
Sbjct  56   GAEEAPVKVTRSIMI  70



>gb|ABK26844.1| unknown [Picea sitchensis]
Length=154

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  1    MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  60

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT++I I+K P
Sbjct  61   LNDEAKQVTQTITIMKPP  78



>gb|ADP94917.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94919.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94923.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94939.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
Length=166

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  13   MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  72

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT++I I+K P
Sbjct  73   LNDEAKQVTQTITIMKPP  90



>tpg|DAA61631.1| TPA: hypothetical protein ZEAMMB73_530962 [Zea mays]
Length=135

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKE-SEGQNPNPNTRSLTV  242
            M LL+QLWDDTVAGP P++GLGKLRK ++F+    +    +EG  P   TRS+T+
Sbjct  1    MGLLDQLWDDTVAGPRPDSGLGKLRKHASFSPSSAAPSPTAEGAAPPAVTRSITM  55



>gb|ABF95870.1| Dormancy/auxin associated protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG87654.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96539.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96641.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96921.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97569.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87340.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75235.1| hypothetical protein OsI_11520 [Oryza sativa Indica Group]
Length=133

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL++LWDDTVAGP P+ GLG+LRK +    RP + K     +P  +   + V  +  A
Sbjct  1    MGLLDKLWDDTVAGPRPDTGLGRLRKHAA--ARPAAVKI---NDPTGDAAMVAVPPTTPA  55

Query  261  ------IKVTRSIMI  287
                  +KVTRSIMI
Sbjct  56   GAEEAPVKVTRSIMI  70



>gb|ADP94909.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94911.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
Length=166

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  13   MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  72

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT++I I+K P
Sbjct  73   LNDEAKQVTQTITIMKPP  90



>gb|ADP94925.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
Length=166

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  13   MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  72

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT++I I+K P
Sbjct  73   LNDEAKQVTQTITIMKPP  90



>gb|ADP94914.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94924.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94926.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94932.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94933.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
Length=166

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  13   MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  72

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT++I I+K P
Sbjct  73   LNDEAKQVTQTITIMKPP  90



>gb|ADP94908.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94912.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94913.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94915.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94928.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94929.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94930.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94931.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
Length=166

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  13   MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  72

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT++I I+K P
Sbjct  73   LNDEAKQVTQTITIMKPP  90



>ref|XP_010685256.1| PREDICTED: auxin-repressed 12.5 kDa protein [Beta vulgaris subsp. 
vulgaris]
Length=134

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 11/74 (15%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNP--NTRSLTVDTSD  254
            MS L+ LWD+T+AGP P+NG+G LRK+ +          S  ++PN    T +   D +D
Sbjct  1    MSFLDNLWDETLAGPAPKNGVGSLRKYKSL---------SAVRSPNHPIVTTNYHDDHND  51

Query  255  DAIKVTRSIMILKS  296
              + +TRSI IL++
Sbjct  52   QTVGITRSITILRT  65



>gb|ADP94927.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94934.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
 gb|ADP94935.1| dormancy/auxin associated-like protein, partial [Picea sitchensis]
Length=166

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNSGKESEGQNPNPNTRSLTVD---  245
            M LL++LWD+T+AGP PENGLGKLRK  + N      S  E E        R  + D   
Sbjct  13   MGLLDKLWDETLAGPRPENGLGKLRKTESTNSAMANPSTPELEEALSRLRERRASADFQR  72

Query  246  TSDDAIKVTRSIMILKSP  299
             +D+A +VT++I I+K P
Sbjct  73   LNDEAKQVTQTITIMKPP  90



>tpg|DAA45292.1| TPA: hypothetical protein ZEAMMB73_352048 [Zea mays]
Length=137

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 15/76 (20%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQN-------PNPNTRSLT  239
            M LL++LWDDTVAGP P+ GLG+LRK      RP + K S+          P+P + S  
Sbjct  1    MGLLDKLWDDTVAGPRPDTGLGRLRK---QPVRPAAVKISDPAGDAAAFVPPSPASGS--  55

Query  240  VDTSDDAIKVTRSIMI  287
                +  +KVTRSIMI
Sbjct  56   ---EETPVKVTRSIMI  68



>ref|XP_009408653.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=117

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQ  209
            M LL+++WDD +AGPPPE GLGKLRK ST       G+ S G 
Sbjct  1    MVLLDKMWDDVLAGPPPERGLGKLRKVSTKPLNVKEGESSGGM  43



>ref|XP_008383701.1| PREDICTED: auxin-repressed 12.5 kDa protein isoform X1 [Malus 
domestica]
Length=117

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQN  212
            M LL +LWDD VAGP PE GLG+LRK S    RP + KE EG++
Sbjct  1    MVLLEKLWDDIVAGPQPERGLGRLRKVSP---RPLNAKEGEGES  41



>tpg|DAA61632.1| TPA: hypothetical protein ZEAMMB73_530962 [Zea mays]
Length=157

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKE-SEGQNPNPNTRSLTV  242
            M LL+QLWDDTVAGP P++GLGKLRK ++F+    +    +EG  P   TRS+T+
Sbjct  1    MGLLDQLWDDTVAGPRPDSGLGKLRKHASFSPSSAAPSPTAEGAAPPAVTRSITM  55



>tpg|DAA48815.1| TPA: hypothetical protein ZEAMMB73_036539, partial [Zea mays]
Length=99

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  75   CAMSLLNQLWDDTVAGPPPENGLGKLRKFST  167
              M LL+QLWD+TVAGP P++GLGKLRK+S+
Sbjct  67   AGMGLLDQLWDETVAGPRPDSGLGKLRKYSS  97



>gb|ABK96319.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96394.1| unknown [Populus trichocarpa x Populus deltoides]
Length=108

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 12/72 (17%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP P+ GLGKLRK+++F  R +    +   N            S+  
Sbjct  1    MGFLHKLWDETLAGPMPDTGLGKLRKYNSFPVRSSPPVNASSAN------------SNGE  48

Query  261  IKVTRSIMILKS  296
            + VTRSI I+++
Sbjct  49   MNVTRSITIIRT  60



>ref|NP_001141193.1| hypothetical protein [Zea mays]
 gb|ACF85676.1| unknown [Zea mays]
 gb|AFW88430.1| hypothetical protein ZEAMMB73_546966 [Zea mays]
Length=132

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 15/76 (20%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQN-------PNPNTRSLT  239
            M LL++LWDDTVAGP P+ GLG+LRK      RP + K S+          P+P + S  
Sbjct  1    MGLLDKLWDDTVAGPRPDTGLGRLRKQPA---RPAAVKISDPAGDAAALVPPSPASGS--  55

Query  240  VDTSDDAIKVTRSIMI  287
                +  +KVTRSIMI
Sbjct  56   ---EETPVKVTRSIMI  68



>ref|NP_001130689.1| uncharacterized protein LOC100191792 [Zea mays]
 gb|ACF79005.1| unknown [Zea mays]
 gb|ACG32801.1| auxin-repressed protein [Zea mays]
 tpg|DAA45291.1| TPA: auxin-repressed protein [Zea mays]
Length=132

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 15/76 (20%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQN-------PNPNTRSLT  239
            M LL++LWDDTVAGP P+ GLG+LRK      RP + K S+          P+P + S  
Sbjct  1    MGLLDKLWDDTVAGPRPDTGLGRLRK---QPVRPAAVKISDPAGDAAAFVPPSPASGS--  55

Query  240  VDTSDDAIKVTRSIMI  287
                +  +KVTRSIMI
Sbjct  56   ---EETPVKVTRSIMI  68



>gb|KHN01447.1| hypothetical protein glysoja_009653 [Glycine soja]
Length=128

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE GLGKLRK+++F+    S   S      P +RS+T+  S   
Sbjct  3    MGFLHKLWDETLAGPAPETGLGKLRKYNSFS--GGSSVRSTVAEHVPISRSITIVRSQSG  60

Query  261  I  263
             
Sbjct  61   F  61



>gb|EEE59040.1| hypothetical protein OsJ_10798 [Oryza sativa Japonica Group]
Length=148

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 11/75 (15%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M LL++LWDDTVAGP P+ GLG+LRK +    RP + K     +P  +   + V  +  A
Sbjct  1    MGLLDKLWDDTVAGPRPDTGLGRLRKHAA--ARPAAVKI---NDPTGDAAMVAVPPTTPA  55

Query  261  ------IKVTRSIMI  287
                  +KVTRSIMI
Sbjct  56   GAEEAPVKVTRSIMI  70



>gb|AFW88431.1| hypothetical protein ZEAMMB73_546966 [Zea mays]
Length=149

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 9/73 (12%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRK----FSTFNFRPNSGKESEGQNPNPNTRSLTVDT  248
            M LL++LWDDTVAGP P+ GLG+LRK     +       +G  +    P+P + S     
Sbjct  1    MGLLDKLWDDTVAGPRPDTGLGRLRKQPARPAAVKISDPAGDAAALVPPSPASGS-----  55

Query  249  SDDAIKVTRSIMI  287
             +  +KVTRSIMI
Sbjct  56   EETPVKVTRSIMI  68



>ref|XP_011048592.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Populus 
euphratica]
Length=118

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 12/72 (17%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP P+ GLGKLRK+++F  R +    +   N            S+  
Sbjct  1    MGFLHKLWDETLAGPMPDTGLGKLRKYNSFPVRSSPPVNASSAN------------SNGE  48

Query  261  IKVTRSIMILKS  296
            + VTRSI I+++
Sbjct  49   MNVTRSITIIRT  60



>ref|XP_002529178.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33192.1| conserved hypothetical protein [Ricinus communis]
Length=92

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 40/72 (56%), Gaps = 17/72 (24%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE G+GKLRK+ +F         S  ++  P    + +      
Sbjct  1    MEFLHKLWDETLAGPAPETGVGKLRKYDSF---------SASRSSPPVVEEMPI------  45

Query  261  IKVTRSIMILKS  296
              +TRSI ILKS
Sbjct  46   --ITRSITILKS  55



>gb|KDP40658.1| hypothetical protein JCGZ_24657 [Jatropha curcas]
Length=126

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 9/72 (13%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE+GLGKLRK+ +F+    + + S    P P          ++ 
Sbjct  1    MGFLHKLWDETLAGPMPESGLGKLRKYDSFSGATGAPRSS----PEP-----VFPHHNED  51

Query  261  IKVTRSIMILKS  296
            + +TRSI IL++
Sbjct  52   LPITRSITILRT  63



>ref|XP_009408652.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=150

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 3/41 (7%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESE  203
            M LL+++WDD +AGPPPE GLGKLRK ST   +P + KE E
Sbjct  1    MVLLDKMWDDVLAGPPPERGLGKLRKVST---KPLNVKEGE  38



>ref|NP_001237397.1| uncharacterized protein LOC100500140 [Glycine max]
 gb|ACU15064.1| unknown [Glycine max]
Length=156

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 76/139 (55%), Gaps = 10/139 (7%)
 Frame = -2

Query  517  GRLPAGLIAHTS*GGGAFLGPIPLAFS*ANDADLLLNRYASLPPAPEKgdtggvdpagdg  338
            G +   LI+HTS G        P+ FS A+D DLL  R  SL  APE GDTGGV+PAG+ 
Sbjct  27   GYIVVRLISHTSKGEEELDLFWPV-FSYASDVDLLRKRKDSL--APENGDTGGVEPAGEA  83

Query  337  dgdagGESLF*LRGDFSIMILLVTLIASSLVSTVSDLVFGFGF*PSDSLPELGRKLKVEN  158
              D     L+ L G F+I+IL VTL A    S+  D         SDSL E  RK K   
Sbjct  84   GADPL--GLW-LPGGFTIIILRVTLTAFLGESSPYDFTLPL----SDSLAEADRKTKEWC  136

Query  157  FLSFPRPFSGGGPATVSSQ  101
            F S PRPFSG GPA VSS 
Sbjct  137  FRSLPRPFSGRGPARVSSH  155



>gb|KEH18503.1| dormancy/auxin associated protein [Medicago truncatula]
Length=108

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 39/71 (55%), Gaps = 13/71 (18%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L +LWD+T+AGP PE GLGKLRK+++F+        S G    P           D 
Sbjct  1    MGFLEKLWDETLAGPTPETGLGKLRKYNSFS------AASSGVRLPPV-------KDHDV  47

Query  261  IKVTRSIMILK  293
              VTRSIMI++
Sbjct  48   PVVTRSIMIIR  58



>ref|XP_003578165.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Brachypodium 
distachyon]
Length=134

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKF  161
            M LL+QLWDDTVAGP PE+GLGKLRK+
Sbjct  1    MGLLDQLWDDTVAGPRPESGLGKLRKY  27



>ref|XP_008380766.1| PREDICTED: auxin-repressed 12.5 kDa protein [Malus domestica]
Length=124

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTV  242
            M  L++LWD+T+AGP PE+GLGKLRK+ + +  P+S       N  P TRS+T+
Sbjct  1    MGFLHKLWDETLAGPAPESGLGKLRKYDSMSI-PSS--LPMAANEVPVTRSITI  51



>ref|XP_011048588.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Populus 
euphratica]
 ref|XP_011048589.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Populus 
euphratica]
 ref|XP_011048590.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Populus 
euphratica]
 ref|XP_011048591.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Populus 
euphratica]
Length=132

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 12/72 (17%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP P+ GLGKLRK+++F  R +    +   N            S+  
Sbjct  1    MGFLHKLWDETLAGPMPDTGLGKLRKYNSFPVRSSPPVNASSAN------------SNGE  48

Query  261  IKVTRSIMILKS  296
            + VTRSI I+++
Sbjct  49   MNVTRSITIIRT  60



>ref|XP_009401533.1| PREDICTED: auxin-repressed 12.5 kDa protein-like [Musa acuminata 
subsp. malaccensis]
Length=132

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRK  158
            MSLL+ LWDDTVAGPPP+ GLGKLRK
Sbjct  1    MSLLHHLWDDTVAGPPPDTGLGKLRK  26



>ref|XP_003627373.1| hypothetical protein MTR_8g022300 [Medicago truncatula]
 gb|AET01849.1| dormancy/auxin associated protein [Medicago truncatula]
Length=123

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 39/71 (55%), Gaps = 13/71 (18%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L +LWD+T+AGP PE GLGKLRK+++F+        S G    P           D 
Sbjct  1    MGFLEKLWDETLAGPTPETGLGKLRKYNSFS------AASSGVRLPPV-------KDHDV  47

Query  261  IKVTRSIMILK  293
              VTRSIMI++
Sbjct  48   PVVTRSIMIIR  58



>ref|XP_008670216.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X1 [Zea 
mays]
Length=147

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKF  161
            M LLNQLWDDTVAGP P++GLGKLRK+
Sbjct  1    MGLLNQLWDDTVAGPRPDSGLGKLRKY  27



>gb|KEH18504.1| dormancy/auxin associated protein [Medicago truncatula]
Length=122

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 39/71 (55%), Gaps = 13/71 (18%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L +LWD+T+AGP PE GLGKLRK+++F+        S G    P           D 
Sbjct  1    MGFLEKLWDETLAGPTPETGLGKLRKYNSFS------AASSGVRLPPV-------KDHDV  47

Query  261  IKVTRSIMILK  293
              VTRSIMI++
Sbjct  48   PVVTRSIMIIR  58



>ref|XP_004510547.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X3 [Cicer 
arietinum]
Length=109

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 19/78 (24%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE GLGKLRK+++F+                  RS  V    + 
Sbjct  1    MGFLDKLWDETLAGPTPETGLGKLRKYNSFS----------------AVRSAPV---KED  41

Query  261  IKVTRSIMILKSPRNQNK  314
            ++++RSI I+++  N  +
Sbjct  42   VQISRSITIIRAHSNYGR  59



>ref|XP_008670217.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Zea 
mays]
 tpg|DAA40140.1| TPA: auxin-repressed protein [Zea mays]
Length=145

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKF  161
            M LLNQLWDDTVAGP P++GLGKLRK+
Sbjct  1    MGLLNQLWDDTVAGPRPDSGLGKLRKY  27



>ref|XP_008353686.1| PREDICTED: auxin-repressed 12.5 kDa protein-like isoform X2 [Malus 
domestica]
Length=111

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 18/72 (25%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWD+T+AGP PE+GLGKLRK+ + +               P++  +      D 
Sbjct  1    MGFLHKLWDETLAGPAPESGLGKLRKYDSMSI--------------PSSPPMAA----DE  42

Query  261  IKVTRSIMILKS  296
            + VTRSI IL++
Sbjct  43   VPVTRSITILRT  54



>ref|XP_004984433.1| PREDICTED: uncharacterized protein LOC101781340 [Setaria italica]
Length=132

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 42/73 (58%), Gaps = 9/73 (12%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRK----FSTFNFRPNSGKESEGQNPNPNTRSLTVDT  248
            M LL++LWDDTVAGP P+ GLG+LRK     +       +G  +    P+P + S     
Sbjct  1    MGLLDKLWDDTVAGPRPDTGLGRLRKQPARPAAVKINDPAGDATAFVPPSPASGS-----  55

Query  249  SDDAIKVTRSIMI  287
             +  +KVTRSIMI
Sbjct  56   EETPVKVTRSIMI  68



>ref|XP_010261733.1| PREDICTED: auxin-repressed 12.5 kDa protein [Nelumbo nucifera]
Length=125

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 38/72 (53%), Gaps = 18/72 (25%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQNPNPNTRSLTVDTSDDA  260
            M  L++LWDD VAGP PE GLGKLRK+ +F+             P P           D 
Sbjct  1    MGFLDKLWDDIVAGPKPETGLGKLRKYDSFS----------ASRPPPLI--------TDD  42

Query  261  IKVTRSIMILKS  296
            I ++RSI I+K+
Sbjct  43   IPISRSITIIKT  54



>gb|ABK23718.1| unknown [Picea sitchensis]
Length=146

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFN--FRPNS---GKESEGQNPNPNTRSLTVD  245
            M LL++LWDD++AGP P++GL KLRK +  N    P S    +E+ G+       +    
Sbjct  1    MGLLDKLWDDSLAGPCPDSGLAKLRKITITNSSMPPESTLVAEEALGRLRKCRVSAECQR  60

Query  246  TSDDAIKVTRSIMILKSP  299
            ++D+A  VT+ I I+K P
Sbjct  61   SNDEARHVTQIITIIKPP  78



>ref|XP_002279836.1| PREDICTED: auxin-repressed 12.5 kDa protein [Vitis vinifera]
 emb|CAN59795.1| hypothetical protein VITISV_001903 [Vitis vinifera]
 emb|CBI30595.3| unnamed protein product [Vitis vinifera]
Length=121

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = +3

Query  81   MSLLNQLWDDTVAGPPPENGLGKLRKFSTFNFRPNSGKESEGQN  212
            M LL +LWDD VAGP P+ GLGKLRK +T   +P S K  EG++
Sbjct  1    MVLLEKLWDDVVAGPQPDRGLGKLRKLTT---KPLSVKTDEGES  41



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840