BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K15

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006341470.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    293   3e-92   Solanum tuberosum [potatoes]
ref|XP_009614005.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    292   6e-92   Nicotiana tomentosiformis
ref|XP_009780577.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    291   2e-91   Nicotiana sylvestris
ref|XP_004235848.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    287   3e-90   Solanum lycopersicum
ref|XP_011073291.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    285   2e-89   Sesamum indicum [beniseed]
emb|CDO98302.1|  unnamed protein product                                285   4e-89   Coffea canephora [robusta coffee]
ref|XP_011082927.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    277   2e-86   
gb|ADR79441.1|  glycyl-tRNA synthetase-like protein                     272   8e-84   Liriodendron tulipifera
gb|ADR79437.1|  glycyl-tRNA synthetase-like protein                     272   9e-84   Liriodendron tulipifera
gb|KDO58150.1|  hypothetical protein CISIN_1g0401421mg                  264   1e-83   Citrus sinensis [apfelsine]
ref|XP_002267943.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    271   2e-83   Vitis vinifera
ref|XP_004250689.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    271   4e-83   Solanum lycopersicum
ref|XP_002297878.2|  Glycyl-tRNA synthetase family protein              270   4e-83   Populus trichocarpa [western balsam poplar]
ref|XP_010249248.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    270   5e-83   Nelumbo nucifera [Indian lotus]
ref|XP_011036186.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    269   1e-82   Populus euphratica
ref|XP_008779920.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    259   1e-82   
ref|XP_002512672.1|  glycyl-tRNA synthetase, putative                   268   2e-82   
gb|KDP23259.1|  hypothetical protein JCGZ_23092                         268   2e-82   Jatropha curcas
ref|XP_006420796.1|  hypothetical protein CICLE_v10004524mg             266   3e-82   
gb|AFW64974.1|  hypothetical protein ZEAMMB73_056745                    256   3e-82   
ref|XP_006420795.1|  hypothetical protein CICLE_v10004524mg             267   3e-82   
ref|XP_009395183.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    268   4e-82   
ref|XP_011020893.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    268   5e-82   Populus euphratica
ref|XP_010250511.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    268   5e-82   Nelumbo nucifera [Indian lotus]
ref|XP_007043777.1|  Glycyl-tRNA synthetase / glycine--tRNA ligase      268   7e-82   
ref|XP_007139132.1|  hypothetical protein PHAVU_008G004200g             268   9e-82   Phaseolus vulgaris [French bean]
ref|XP_009385431.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    267   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006343502.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    267   1e-81   Solanum tuberosum [potatoes]
ref|XP_004170329.1|  PREDICTED: LOW QUALITY PROTEIN: glycine--tRN...    266   2e-81   
ref|XP_002304639.1|  Glycyl-tRNA synthetase family protein              266   2e-81   
ref|XP_004152844.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    266   3e-81   Cucumis sativus [cucumbers]
gb|EPS67446.1|  hypothetical protein M569_07324                         264   3e-81   Genlisea aurea
ref|XP_010663810.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    265   3e-81   Vitis vinifera
ref|XP_010927793.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    266   3e-81   Elaeis guineensis
gb|KHG20733.1|  Glycine--tRNA ligase 1, mitochondrial -like protein     266   4e-81   Gossypium arboreum [tree cotton]
ref|XP_007038160.1|  Glycyl-tRNA synthetase / glycine--tRNA ligase      263   6e-81   Theobroma cacao [chocolate]
ref|XP_009793813.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    265   7e-81   Nicotiana sylvestris
ref|XP_003532335.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    265   9e-81   Glycine max [soybeans]
ref|XP_008351110.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    264   1e-80   
ref|XP_007221906.1|  hypothetical protein PRUPE_ppa001964mg             265   1e-80   Prunus persica
ref|XP_004499600.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    264   1e-80   Cicer arietinum [garbanzo]
emb|CDP18987.1|  unnamed protein product                                264   2e-80   Coffea canephora [robusta coffee]
ref|XP_008450384.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    264   3e-80   Cucumis melo [Oriental melon]
ref|XP_011082905.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    262   3e-80   
gb|KJB77209.1|  hypothetical protein B456_012G125800                    264   4e-80   Gossypium raimondii
gb|EEC77206.1|  hypothetical protein OsI_15722                          261   4e-80   Oryza sativa Indica Group [Indian rice]
ref|XP_009600007.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    263   4e-80   Nicotiana tomentosiformis
ref|XP_011082897.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    262   5e-80   Sesamum indicum [beniseed]
ref|XP_008222253.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    263   5e-80   Prunus mume [ume]
ref|XP_006487557.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    263   6e-80   Citrus sinensis [apfelsine]
gb|KEH21485.1|  glycyl-tRNA synthetase/glycine-tRNA ligase              262   6e-80   Medicago truncatula
ref|XP_009359873.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    262   8e-80   Pyrus x bretschneideri [bai li]
emb|CAH66534.1|  H0209H04.1                                             261   1e-79   Oryza sativa [red rice]
gb|EEE60922.1|  hypothetical protein OsJ_14640                          259   2e-79   Oryza sativa Japonica Group [Japonica rice]
gb|EYU24531.1|  hypothetical protein MIMGU_mgv1a002993mg                259   2e-79   Erythranthe guttata [common monkey flower]
ref|XP_010909743.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    261   2e-79   Elaeis guineensis
ref|XP_009353511.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    261   2e-79   Pyrus x bretschneideri [bai li]
emb|CDX98156.1|  BnaC07g09420D                                          261   2e-79   
ref|XP_006659640.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    259   2e-79   
ref|XP_008369623.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    260   2e-79   Malus domestica [apple tree]
gb|KEH32824.1|  glycyl-tRNA synthetase/glycine-tRNA ligase              259   3e-79   Medicago truncatula
ref|XP_009102802.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    261   3e-79   Brassica rapa
emb|CDY43195.1|  BnaA07g07590D                                          261   4e-79   Brassica napus [oilseed rape]
ref|XP_010530803.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    261   4e-79   Tarenaya hassleriana [spider flower]
gb|EYU21758.1|  hypothetical protein MIMGU_mgv1a002954mg                258   6e-79   Erythranthe guttata [common monkey flower]
emb|CAE05155.2|  OSJNBa0039C07.11                                       258   1e-78   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ53123.1|  JHL07K02.13                                            258   3e-78   Jatropha curcas
ref|XP_009115209.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    258   3e-78   Brassica rapa
ref|NP_001062369.1|  Os08g0538000                                       257   5e-78   
emb|CDX99860.1|  BnaC05g22820D                                          257   5e-78   
gb|AFW64973.1|  hypothetical protein ZEAMMB73_056745                    256   5e-78   
dbj|BAJ98760.1|  predicted protein                                      256   7e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008664405.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    256   9e-78   Zea mays [maize]
ref|NP_001169639.1|  uncharacterized protein LOC100383520               256   9e-78   Zea mays [maize]
gb|KFK44815.1|  hypothetical protein AALP_AA1G306400                    256   1e-77   Arabis alpina [alpine rockcress]
dbj|BAE98387.1|  glycyl-tRNA synthetase                                 252   1e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855551.1|  hypothetical protein AMTR_s00057p00219540          256   1e-77   
ref|XP_004974034.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    256   1e-77   
ref|XP_003574845.2|  PREDICTED: glycine--tRNA ligase 1, mitochond...    256   2e-77   Brachypodium distachyon [annual false brome]
gb|KEH32823.1|  glycyl-tRNA synthetase/glycine-tRNA ligase              258   2e-77   Medicago truncatula
ref|XP_006855617.1|  hypothetical protein AMTR_s00044p00082740          255   2e-77   Amborella trichopoda
emb|CDY26309.1|  BnaA09g26600D                                          255   3e-77   Brassica napus [oilseed rape]
ref|XP_002445793.1|  hypothetical protein SORBIDRAFT_07g025840          254   5e-77   
ref|XP_010066465.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    255   6e-77   Eucalyptus grandis [rose gum]
ref|XP_006306915.1|  hypothetical protein CARUB_v10008480mg             254   6e-77   Capsella rubella
ref|XP_002877358.1|  hypothetical protein ARALYDRAFT_323159             253   9e-77   
gb|KCW64348.1|  hypothetical protein EUGRSUZ_G01975                     255   1e-76   Eucalyptus grandis [rose gum]
gb|KCW64347.1|  hypothetical protein EUGRSUZ_G01975                     255   1e-76   Eucalyptus grandis [rose gum]
gb|ACN40407.1|  unknown                                                 254   1e-76   Picea sitchensis
ref|XP_010100026.1|  Glycine--tRNA ligase 1                             253   1e-76   
ref|XP_010667009.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    254   2e-76   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM64494.1|  glycyl tRNA synthetase, putative                        253   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893587.1|  glycyl-tRNA synthetase                             253   4e-76   
ref|NP_564337.1|  glycyl-tRNA synthetase / glycine--tRNA ligase         253   5e-76   Arabidopsis thaliana [mouse-ear cress]
gb|AAK92832.1|  putative glycyl tRNA synthetase                         253   5e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415539.1|  hypothetical protein EUTSA_v10006931mg             250   4e-75   Eutrema salsugineum [saltwater cress]
ref|XP_002446361.1|  hypothetical protein SORBIDRAFT_06g014710          248   2e-74   
ref|XP_008779554.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    241   2e-74   Phoenix dactylifera
ref|XP_006297101.1|  hypothetical protein CARUB_v10013104mg             247   2e-74   Capsella rubella
ref|XP_004975463.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    246   5e-74   Setaria italica
ref|XP_008669487.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    245   1e-73   
gb|EMS65218.1|  Glycyl-tRNA synthetase 1, mitochondrial                 249   2e-73   Triticum urartu
ref|XP_008779279.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    244   5e-73   
ref|XP_004310250.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    243   4e-72   Fragaria vesca subsp. vesca
gb|KEH32825.1|  glycyl-tRNA synthetase/glycine-tRNA ligase              229   2e-67   Medicago truncatula
emb|CBI29263.3|  unnamed protein product                                225   1e-66   Vitis vinifera
gb|KHN24948.1|  Glycine--tRNA ligase 1, mitochondrial                   223   2e-65   Glycine soja [wild soybean]
gb|EMT31842.1|  Glycyl-tRNA synthetase 1, mitochondrial                 223   2e-65   
ref|XP_010451601.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    211   6e-65   
ref|XP_006653348.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    219   2e-64   Oryza brachyantha
gb|EMS46310.1|  Glycyl-tRNA synthetase 1, mitochondrial                 219   3e-64   Triticum urartu
ref|XP_008390393.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    215   2e-62   
ref|XP_010491514.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    214   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010450296.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    212   7e-62   
ref|XP_010440657.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    212   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010440655.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    212   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010495983.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    211   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_002982576.1|  hypothetical protein SELMODRAFT_268613             201   2e-57   Selaginella moellendorffii
ref|XP_002981102.1|  hypothetical protein SELMODRAFT_268427             201   2e-57   
ref|XP_001781733.1|  predicted protein                                  195   2e-55   
ref|XP_003058222.1|  predicted protein                                  193   3e-54   Micromonas pusilla CCMP1545
emb|CEF98749.1|  S15/NS1, RNA-binding                                   188   1e-52   Ostreococcus tauri
ref|XP_002964282.1|  hypothetical protein SELMODRAFT_230438             187   2e-52   
ref|XP_002499602.1|  predicted protein                                  187   3e-52   Micromonas commoda
ref|XP_010460764.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    187   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010478362.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    186   6e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010499503.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    186   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007513452.1|  glycyl-tRNA synthetase                             183   2e-50   Bathycoccus prasinos
gb|KIY99820.1|  glycyl-tRNA synthetase                                  179   2e-50   Monoraphidium neglectum
ref|XP_001418945.1|  predicted protein                                  181   4e-50   Ostreococcus lucimarinus CCE9901
ref|XP_001702190.1|  hypothetical protein CHLREDRAFT_82920              181   1e-49   Chlamydomonas reinhardtii
ref|XP_002953140.1|  hypothetical protein VOLCADRAFT_75635              180   1e-49   Volvox carteri f. nagariensis
gb|KDD74333.1|  class II core domain (G, H, P, S and T) tRNA synt...    178   2e-49   Helicosporidium sp. ATCC 50920
ref|XP_010437044.1|  PREDICTED: glycine--tRNA ligase 1, mitochond...    177   1e-48   
ref|XP_011402058.1|  Glycine-tRNA ligase 1, mitochondrial               176   3e-48   Auxenochlorella protothecoides
ref|XP_005850566.1|  hypothetical protein CHLNCDRAFT_34068              175   1e-47   Chlorella variabilis
ref|XP_002868880.1|  hypothetical protein ARALYDRAFT_352903             174   1e-47   
ref|XP_010468097.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    170   2e-47   Camelina sativa [gold-of-pleasure]
gb|EFA82757.1|  glycyl-tRNA synthetase                                  173   3e-47   Heterostelium album PN500
ref|XP_003292434.1|  hypothetical protein DICPUDRAFT_157146             173   5e-47   Dictyostelium purpureum
ref|XP_002989527.1|  hypothetical protein SELMODRAFT_269525             167   5e-45   
ref|XP_005644380.1|  glycyl-tRNA synthetase                             166   8e-45   Coccomyxa subellipsoidea C-169
gb|EWM21480.1|  glycyl-trna synthetase                                  167   9e-45   Nannochloropsis gaditana
dbj|GAM27924.1|  hypothetical protein SAMD00019534_111000               165   2e-44   Acytostelium subglobosum LB1
ref|XP_004356903.1|  glycyl-tRNA synthetase                             162   5e-43   Cavenderia fasciculata
ref|XP_005707414.1|  glycyl-tRNA synthetase                             164   5e-43   Galdieria sulphuraria
ref|XP_010765453.1|  PREDICTED: glycine--tRNA ligase-like               155   7e-43   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008295957.1|  PREDICTED: glycine--tRNA ligase-like               157   8e-43   Stegastes partitus
ref|NP_174280.2|  putative glycine--tRNA ligase                         159   1e-42   Arabidopsis thaliana [mouse-ear cress]
gb|AAG10609.1|AC008030_9  Putative glycyl-tRNA synthetase               159   1e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CAF89444.1|  unnamed protein product                                154   2e-42   Tetraodon nigroviridis
ref|XP_001637887.1|  predicted protein                                  160   2e-42   Nematostella vectensis
ref|XP_011487263.1|  PREDICTED: glycine--tRNA ligase                    160   2e-42   Oryzias latipes [Japanese rice fish]
ref|XP_006283325.1|  hypothetical protein CARUB_v10004365mg             158   5e-42   Capsella rubella
gb|EMP29421.1|  Glycyl-tRNA synthetase                                  154   1e-41   Chelonia mydas [green seaturtle]
ref|XP_003585085.2|  PREDICTED: glycine--tRNA ligase-like               147   1e-41   
gb|AJO66533.1|  glycyl-tRNA synthetase                                  151   2e-41   Heliconius melpomene melpomene
ref|XP_009039546.1|  hypothetical protein AURANDRAFT_30354              150   2e-41   Aureococcus anophagefferens
gb|AEB61024.1|  glycyl-tRNA synthetase-like protein                     153   2e-41   Equus caballus [domestic horse]
ref|XP_010751960.1|  PREDICTED: glycine--tRNA ligase-like               157   2e-41   
ref|XP_007066625.1|  PREDICTED: glycine--tRNA ligase                    154   2e-41   
gb|KFV89732.1|  Glycine--tRNA ligase                                    153   3e-41   Fulmarus glacialis
gb|AJO66493.1|  glycyl-tRNA synthetase                                  149   3e-41   Heliconius egeria
gb|AJO66523.1|  glycyl-tRNA synthetase                                  150   4e-41   Heliconius heurippa
gb|ADI80823.1|  glycyl-tRNA synthetase                                  150   4e-41   Heliconius heurippa
ref|XP_009586419.1|  PREDICTED: glycine--tRNA ligase                    154   5e-41   Fulmarus glacialis
gb|AJO66526.1|  glycyl-tRNA synthetase                                  150   5e-41   Heliconius hierax
gb|AJO66484.1|  glycyl-tRNA synthetase                                  149   5e-41   Heliconius cydno weymeri
gb|AJO66525.1|  glycyl-tRNA synthetase                                  150   5e-41   Heliconius hierax
gb|AJO66499.1|  glycyl-tRNA synthetase                                  149   7e-41   Heliconius erato demophoon
ref|XP_010126389.1|  PREDICTED: glycine--tRNA ligase                    155   7e-41   Chlamydotis macqueenii
gb|KFP45624.1|  Glycine--tRNA ligase                                    155   7e-41   Chlamydotis macqueenii
gb|AJO66516.1|  glycyl-tRNA synthetase                                  149   8e-41   Heliconius hecalesia
gb|AJO66480.1|  glycyl-tRNA synthetase                                  149   8e-41   Heliconius cydno alithea
gb|AAH96883.1|  Si:dkey-276i5.1 protein                                 156   8e-41   Danio rerio [leopard danio]
ref|XP_008579391.1|  PREDICTED: glycine--tRNA ligase                    153   8e-41   Galeopterus variegatus [Malayan flying lemur]
gb|AJO66522.1|  glycyl-tRNA synthetase                                  149   9e-41   Heliconius heurippa
gb|AJO66541.1|  glycyl-tRNA synthetase                                  149   9e-41   Heliconius pachinus
ref|XP_009874724.1|  PREDICTED: glycine--tRNA ligase                    154   9e-41   Apaloderma vittatum
ref|XP_007909967.1|  PREDICTED: glycine--tRNA ligase                    155   9e-41   Callorhinchus milii [Australian ghost shark]
gb|KFP79239.1|  Glycine--tRNA ligase                                    154   1e-40   Apaloderma vittatum
ref|XP_009295729.1|  PREDICTED: glycine--tRNA ligase                    156   1e-40   
gb|KFQ47149.1|  Glycine--tRNA ligase                                    155   1e-40   Nestor notabilis
gb|ADI80800.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius melpomene melpomene
gb|AJO66531.1|  glycyl-tRNA synthetase                                  148   1e-40   Heliconius melpomene ecuadorensis
gb|AJO66527.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius himera
gb|AJO66563.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius wallacei
gb|EJW81070.1|  glycyl-tRNA synthetase                                  155   1e-40   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_010010079.1|  PREDICTED: glycine--tRNA ligase                    155   1e-40   Nestor notabilis
gb|AJO66528.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius ismenius
gb|AJO66519.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius hecuba
gb|AJO66471.1|  glycyl-tRNA synthetase                                  149   1e-40   Neruda aoede
gb|AJO66538.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius melpomene rosina
ref|XP_002893585.1|  hypothetical protein ARALYDRAFT_890516             154   1e-40   
ref|XP_007544426.1|  PREDICTED: glycine--tRNA ligase                    155   1e-40   Poecilia formosa
gb|AJO66479.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius congener
gb|AJO66557.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius telesiphe
gb|AJO66485.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius cydno weymeri
ref|XP_002675607.1|  Glycyl-tRNA synthetase                             154   1e-40   Naegleria gruberi strain NEG-M
gb|AJO66568.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius xanthocles
gb|AJO66560.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius timareta timareta
gb|AJO66475.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius charithonia [zebra butterfly]
gb|AJO66567.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius xanthocles mellitus
gb|AJO66552.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius sara
gb|AJO66540.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius numata
gb|AJO66521.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius hermathena
gb|KFP45981.1|  Glycine--tRNA ligase                                    153   1e-40   Cathartes aura
gb|AJO66465.1|  glycyl-tRNA synthetase                                  149   1e-40   Eueides lybia
gb|AJO66564.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius wallacei flavescens
gb|ADI80798.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius melpomene melpomene
ref|XP_008394435.1|  PREDICTED: glycine--tRNA ligase                    155   1e-40   Poecilia reticulata
ref|XP_005797884.1|  PREDICTED: glycine--tRNA ligase-like               155   1e-40   Xiphophorus maculatus
gb|ADI80796.1|  glycyl-tRNA synthetase                                  149   1e-40   Heliconius melpomene melpomene
gb|AJO66473.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius besckei
gb|ADI80801.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius melpomene melpomene
gb|AJO66474.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius burneyi
gb|KFM63062.1|  Glycine--tRNA ligase                                    150   2e-40   Stegodyphus mimosarum
gb|AJO66486.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius demeter
gb|AJO66500.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius erato emma
gb|AJO66470.1|  glycyl-tRNA synthetase                                  149   2e-40   Neruda aoede
gb|AJO66551.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius sapho
gb|AJO66520.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius hecuba
gb|AJO66566.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius xanthocles
gb|AJO66476.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius clysonymus
gb|AJO66495.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius eleuchia
gb|AJO66469.1|  glycyl-tRNA synthetase                                  149   2e-40   Eueides vibilia unifasciatus
gb|AJO66478.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius clysonymus
gb|AJO66464.1|  glycyl-tRNA synthetase                                  149   2e-40   Eueides lybia
gb|AJO66535.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius melpomene meriana
gb|AJO66549.1|  glycyl-tRNA synthetase                                  149   2e-40   Heliconius sapho sapho
gb|AJO66468.1|  glycyl-tRNA synthetase                                  149   2e-40   Eueides vibilia
ref|XP_005722749.1|  PREDICTED: glycine--tRNA ligase-like               155   2e-40   Pundamilia nyererei
gb|AJO66489.1|  glycyl-tRNA synthetase                                  149   2e-40   Laparus doris
gb|AJO66490.1|  glycyl-tRNA synthetase                                  149   2e-40   Laparus doris
gb|KFO06291.1|  Glycine--tRNA ligase                                    152   2e-40   Balearica regulorum gibbericeps
ref|XP_010308438.1|  PREDICTED: glycine--tRNA ligase                    152   2e-40   Balearica regulorum gibbericeps
gb|AJO66466.1|  glycyl-tRNA synthetase                                  148   2e-40   Eueides lybia lybia
gb|KFP30201.1|  Glycine--tRNA ligase                                    154   2e-40   Colius striatus
gb|KFO90361.1|  Glycine--tRNA ligase                                    154   2e-40   Buceros rhinoceros silvestris
ref|XP_010196388.1|  PREDICTED: glycine--tRNA ligase                    154   2e-40   Colius striatus
gb|AJO66487.1|  glycyl-tRNA synthetase                                  148   2e-40   Laparus doris
ref|XP_005150074.1|  PREDICTED: glycine--tRNA ligase                    154   2e-40   Melopsittacus undulatus
ref|XP_005912357.1|  PREDICTED: glycine--tRNA ligase-like               155   2e-40   Haplochromis burtoni
gb|AJO66488.1|  glycyl-tRNA synthetase                                  148   2e-40   Laparus doris
ref|XP_010135464.1|  PREDICTED: glycine--tRNA ligase                    154   2e-40   Buceros rhinoceros silvestris
ref|XP_004546800.1|  PREDICTED: glycine--tRNA ligase-like               155   2e-40   Maylandia zebra
ref|XP_003141464.1|  glycyl-tRNA synthetase                             154   3e-40   Loa loa
ref|XP_006736909.1|  PREDICTED: glycine--tRNA ligase-like               153   3e-40   Leptonychotes weddellii
gb|EGW05197.1|  Glycyl-tRNA synthetase                                  154   3e-40   Cricetulus griseus [Chinese hamsters]
ref|XP_005030460.1|  PREDICTED: glycine--tRNA ligase-like               152   3e-40   
gb|EHB11940.1|  Glycyl-tRNA synthetase                                  154   3e-40   Heterocephalus glaber [naked mole rat]
gb|EAS30746.3|  glycyl-tRNA synthetase                                  154   3e-40   Coccidioides immitis RS
gb|KFQ78051.1|  Glycine--tRNA ligase                                    153   3e-40   Phoenicopterus ruber ruber
ref|XP_005511345.1|  PREDICTED: glycine--tRNA ligase                    154   3e-40   
gb|KFW94477.1|  Glycine--tRNA ligase                                    153   3e-40   Phalacrocorax carbo [common cormorant]
gb|ADI80799.1|  glycyl-tRNA synthetase                                  148   3e-40   Heliconius melpomene melpomene
gb|EFW22960.1|  glycyl-tRNA synthetase                                  154   3e-40   Coccidioides posadasii str. Silveira
gb|ADI80802.1|  glycyl-tRNA synthetase                                  148   3e-40   Heliconius melpomene melpomene
gb|KFV11092.1|  Glycine--tRNA ligase                                    153   3e-40   Tauraco erythrolophus
gb|KFQ69100.1|  Glycine--tRNA ligase                                    154   3e-40   Phaethon lepturus
ref|NP_001026681.1|  glycine--tRNA ligase                               154   3e-40   Gallus gallus [bantam]
gb|EMC81023.1|  Glycyl-tRNA synthetase                                  154   3e-40   
gb|KFQ47876.1|  Glycine--tRNA ligase                                    154   3e-40   Pelecanus crispus
ref|XP_005442452.1|  PREDICTED: glycine--tRNA ligase                    154   3e-40   
ref|XP_005241040.1|  PREDICTED: glycine--tRNA ligase                    154   3e-40   
ref|XP_010294863.1|  PREDICTED: glycine--tRNA ligase                    154   3e-40   Phaethon lepturus
ref|XP_006023007.1|  PREDICTED: glycine--tRNA ligase                    154   3e-40   Alligator sinensis
ref|XP_003069570.1|  glycyl-tRNA synthetase, putative                   154   3e-40   Coccidioides posadasii C735 delta SOWgp
ref|XP_009978085.1|  PREDICTED: glycine--tRNA ligase                    153   3e-40   Tauraco erythrolophus
ref|XP_009858076.1|  PREDICTED: glycine--tRNA ligase isoform X2         154   3e-40   
ref|XP_009482962.1|  PREDICTED: glycine--tRNA ligase                    154   3e-40   Pelecanus crispus
ref|XP_009274249.1|  PREDICTED: glycine--tRNA ligase                    154   3e-40   
gb|KFZ51930.1|  Glycine--tRNA ligase                                    154   3e-40   Podiceps cristatus
gb|KFV57839.1|  Glycine--tRNA ligase                                    154   3e-40   Gavia stellata
gb|KFQ11578.1|  Glycine--tRNA ligase                                    154   3e-40   Haliaeetus albicilla
ref|XP_007443389.1|  PREDICTED: glycine--tRNA ligase-like               154   3e-40   
gb|KGL90430.1|  Glycine--tRNA ligase                                    153   3e-40   Charadrius vociferus
gb|KFQ35280.1|  Glycine--tRNA ligase                                    154   3e-40   Mesitornis unicolor
ref|XP_010182375.1|  PREDICTED: glycine--tRNA ligase                    153   3e-40   Mesitornis unicolor
ref|XP_010157590.1|  PREDICTED: glycine--tRNA ligase                    153   3e-40   
gb|KFR09026.1|  Glycine--tRNA ligase                                    153   3e-40   
gb|KFM05276.1|  Glycine--tRNA ligase                                    153   3e-40   
ref|XP_005191908.1|  PREDICTED: glycine--tRNA ligase-like               154   3e-40   
gb|KFP20292.1|  Glycine--tRNA ligase                                    153   4e-40   
emb|CDQ89943.1|  unnamed protein product                                154   4e-40   
gb|KFZ55503.1|  Glycine--tRNA ligase                                    153   4e-40   
gb|KFR17312.1|  Glycine--tRNA ligase                                    153   4e-40   
ref|XP_003386096.1|  PREDICTED: glycine--tRNA ligase-like               154   4e-40   
gb|KFV66329.1|  Glycine--tRNA ligase                                    153   4e-40   
ref|XP_009926718.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
gb|KFW12414.1|  Glycine--tRNA ligase                                    153   4e-40   
ref|XP_010163370.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
ref|XP_004181369.1|  hypothetical protein TBLA_0F03110                  153   4e-40   
ref|XP_009642382.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
ref|XP_006795190.1|  PREDICTED: glycine--tRNA ligase-like               154   4e-40   
ref|XP_005319221.1|  PREDICTED: glycine--tRNA ligase                    154   4e-40   
ref|XP_009698761.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
gb|AJO66548.1|  glycyl-tRNA synthetase                                  147   4e-40   
ref|XP_005377558.1|  PREDICTED: glycine--tRNA ligase                    154   4e-40   
ref|XP_009815320.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
ref|XP_010559507.1|  PREDICTED: glycine--tRNA ligase isoform X1         153   4e-40   
ref|XP_004898882.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
gb|KFP65173.1|  Glycine--tRNA ligase                                    153   4e-40   
ref|XP_001218064.1|  glycyl-tRNA synthetase 1                           153   4e-40   
ref|XP_010218280.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
ref|XP_008684776.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
ref|XP_002130910.1|  PREDICTED: glycine--tRNA ligase isoform X1         154   4e-40   
gb|KFQ04936.1|  Glycine--tRNA ligase                                    153   4e-40   
sp|Q5I0G4.1|SYG_RAT  RecName: Full=Glycine--tRNA ligase; AltName:...    153   4e-40   
gb|KGL80988.1|  Glycine--tRNA ligase                                    153   4e-40   
ref|XP_009941292.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
gb|AJO66482.1|  glycyl-tRNA synthetase                                  147   4e-40   
gb|ADN07464.1|  glycyl-tRNA synthetase, 5 prime                         152   4e-40   
ref|XP_009509430.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
gb|ADI80806.1|  glycyl-tRNA synthetase                                  148   4e-40   
ref|XP_007130071.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
ref|XP_004626577.1|  PREDICTED: glycine--tRNA ligase                    153   4e-40   
gb|AJO66497.1|  glycyl-tRNA synthetase                                  147   4e-40   
gb|EPQ05694.1|  Glycyl-tRNA synthetase                                  153   4e-40   
ref|XP_006146292.1|  PREDICTED: glycine--tRNA ligase                    153   5e-40   
ref|XP_007090603.1|  PREDICTED: glycine--tRNA ligase                    153   5e-40   
gb|AJO66510.1|  glycyl-tRNA synthetase                                  147   5e-40   
ref|XP_006986984.1|  PREDICTED: glycine--tRNA ligase                    153   5e-40   
gb|AJO66503.1|  glycyl-tRNA synthetase                                  147   5e-40   
ref|XP_008065797.1|  PREDICTED: glycine--tRNA ligase                    153   5e-40   
ref|XP_003407063.1|  PREDICTED: glycine--tRNA ligase                    154   5e-40   
gb|KFV00500.1|  Glycine--tRNA ligase                                    152   5e-40   
ref|XP_006088801.1|  PREDICTED: glycine--tRNA ligase                    153   5e-40   
ref|XP_009959641.1|  PREDICTED: glycine--tRNA ligase                    153   5e-40   
ref|XP_005448918.1|  PREDICTED: glycine--tRNA ligase-like               154   5e-40   
gb|AJO66463.1|  glycyl-tRNA synthetase                                  147   5e-40   
gb|KIV91573.1|  glycine-tRNA ligase                                     153   5e-40   
emb|CAG04248.1|  unnamed protein product                                154   5e-40   
ref|NP_001086647.1|  glycyl-tRNA synthetase                             154   5e-40   
ref|XP_010559528.1|  PREDICTED: glycine--tRNA ligase isoform X3         152   5e-40   
gb|AJO66546.1|  glycyl-tRNA synthetase                                  147   5e-40   
ref|XP_008145809.1|  PREDICTED: glycine--tRNA ligase                    153   5e-40   
ref|XP_638501.1|  glycyl-tRNA synthetase                                153   5e-40   
gb|ADQ64525.1|  hypothetical protein                                    144   5e-40   
ref|XP_010559517.1|  PREDICTED: glycine--tRNA ligase isoform X2         152   5e-40   
ref|XP_009897412.1|  PREDICTED: glycine--tRNA ligase                    152   5e-40   
ref|XP_005863058.1|  PREDICTED: glycine--tRNA ligase                    153   5e-40   
gb|ADI80815.1|  glycyl-tRNA synthetase                                  147   5e-40   
ref|XP_007642652.1|  PREDICTED: glycine--tRNA ligase isoform X1         153   5e-40   
gb|KFP07332.1|  Glycine--tRNA ligase                                    153   5e-40   
ref|XP_006774998.1|  PREDICTED: glycine--tRNA ligase                    153   5e-40   
ref|XP_005981274.1|  PREDICTED: glycine--tRNA ligase                    153   5e-40   
ref|XP_004652820.1|  PREDICTED: glycine--tRNA ligase                    153   5e-40   
gb|ELW67931.1|  Glycyl-tRNA synthetase                                  152   5e-40   
ref|XP_004377560.1|  PREDICTED: glycine--tRNA ligase                    154   5e-40   
ref|XP_004352908.1|  glycine-tRNA ligase                                153   5e-40   
ref|XP_008500454.1|  PREDICTED: glycine--tRNA ligase                    153   6e-40   
ref|XP_006634255.1|  PREDICTED: glycine--tRNA ligase-like               153   6e-40   
ref|XP_001242329.1|  hypothetical protein CIMG_06225                    153   6e-40   
gb|AJO66550.1|  glycyl-tRNA synthetase                                  147   6e-40   
ref|XP_004582459.1|  PREDICTED: glycine--tRNA ligase                    154   6e-40   
gb|AJO66460.1|  glycyl-tRNA synthetase                                  147   6e-40   
gb|AJO66518.1|  glycyl-tRNA synthetase                                  147   6e-40   
ref|XP_009971847.1|  PREDICTED: glycine--tRNA ligase                    152   6e-40   
ref|XP_007943647.1|  PREDICTED: glycine--tRNA ligase                    154   6e-40   
gb|KFO74215.1|  Glycine--tRNA ligase                                    153   6e-40   
ref|XP_003468005.2|  PREDICTED: glycine--tRNA ligase                    153   6e-40   
ref|XP_003982988.2|  PREDICTED: glycine--tRNA ligase                    153   6e-40   
gb|KFV78370.1|  Glycine--tRNA ligase                                    153   6e-40   
ref|XP_004762630.1|  PREDICTED: glycine--tRNA ligase                    153   6e-40   
gb|ERE66022.1|  glycyl-tRNA synthetase                                  153   7e-40   
ref|XP_010079234.1|  PREDICTED: glycine--tRNA ligase                    152   7e-40   
gb|AJO66545.1|  glycyl-tRNA synthetase                                  147   7e-40   
gb|AJO66472.1|  glycyl-tRNA synthetase                                  147   7e-40   
ref|XP_004453261.1|  PREDICTED: glycine--tRNA ligase                    153   7e-40   
ref|XP_003221922.2|  PREDICTED: LOW QUALITY PROTEIN: glycine--tRN...    153   7e-40   
ref|XP_007291641.1|  glycyl-tRNA synthetase                             153   7e-40   
gb|AJO66509.1|  glycyl-tRNA synthetase                                  147   7e-40   
gb|ADI80845.1|  glycyl-tRNA synthetase                                  147   7e-40   
ref|XP_004418923.1|  PREDICTED: glycine--tRNA ligase                    153   7e-40   
gb|AJO66496.1|  glycyl-tRNA synthetase                                  147   7e-40   
ref|XP_009667484.1|  PREDICTED: glycine--tRNA ligase                    153   7e-40   
gb|KIW26690.1|  glycine-tRNA ligase                                     153   7e-40   
ref|XP_009473646.1|  PREDICTED: glycine--tRNA ligase                    153   7e-40   
ref|XP_010626668.1|  PREDICTED: glycine--tRNA ligase                    153   7e-40   
gb|AJO66512.1|  glycyl-tRNA synthetase                                  147   7e-40   
ref|XP_002751476.1|  PREDICTED: glycine--tRNA ligase                    153   7e-40   
dbj|BAE38417.1|  unnamed protein product                                153   7e-40   
ref|XP_004414006.1|  PREDICTED: glycine--tRNA ligase                    153   8e-40   
ref|XP_008521171.1|  PREDICTED: LOW QUALITY PROTEIN: glycine--tRN...    153   8e-40   
gb|KFU89365.1|  Glycine--tRNA ligase                                    152   8e-40   
ref|XP_005360870.1|  PREDICTED: glycine--tRNA ligase                    153   8e-40   
ref|XP_004314437.1|  PREDICTED: LOW QUALITY PROTEIN: glycine--tRN...    153   8e-40   
ref|XP_009879799.1|  PREDICTED: glycine--tRNA ligase                    153   8e-40   
gb|EYE93477.1|  glycyl-tRNA synthetase                                  152   8e-40   
ref|XP_008295958.1|  PREDICTED: glycine--tRNA ligase                    153   8e-40   
gb|AAH21747.1|  Glycyl-tRNA synthetase                                  153   8e-40   
ref|NP_851009.2|  glycine--tRNA ligase                                  153   9e-40   
ref|XP_004839531.1|  PREDICTED: glycine--tRNA ligase                    153   9e-40   
ref|XP_004269991.1|  PREDICTED: glycine--tRNA ligase                    153   9e-40   
gb|EFB30199.1|  hypothetical protein PANDA_007924                       153   9e-40   
ref|XP_009995640.1|  PREDICTED: glycine--tRNA ligase                    152   9e-40   
ref|XP_007175318.1|  PREDICTED: glycine--tRNA ligase                    153   9e-40   
gb|ADI80829.1|  glycyl-tRNA synthetase                                  147   9e-40   
gb|EDK98718.1|  glycyl-tRNA synthetase, isoform CRA_a                   153   9e-40   
gb|AJO66515.1|  glycyl-tRNA synthetase                                  147   9e-40   
gb|EDK98719.1|  glycyl-tRNA synthetase, isoform CRA_b                   153   9e-40   
gb|ELR61161.1|  Glycyl-tRNA synthetase                                  153   9e-40   
ref|XP_008306154.1|  PREDICTED: glycine--tRNA ligase                    153   9e-40   
ref|XP_002919302.1|  PREDICTED: glycine--tRNA ligase                    153   9e-40   
ref|XP_007249113.1|  PREDICTED: glycine--tRNA ligase-like               153   9e-40   
ref|XP_004045310.1|  PREDICTED: glycine--tRNA ligase                    152   9e-40   
ref|XP_005609449.1|  PREDICTED: glycine--tRNA ligase                    154   9e-40   
ref|XP_002739603.2|  PREDICTED: glycine--tRNA ligase-like               153   1e-39   
ref|NP_001258068.1|  glycine--tRNA ligase                               153   1e-39   
ref|XP_004797110.1|  PREDICTED: glycine--tRNA ligase                    153   1e-39   
dbj|BAE27003.1|  unnamed protein product                                153   1e-39   
ref|XP_003788599.1|  PREDICTED: glycine--tRNA ligase                    153   1e-39   
gb|EPY80618.1|  glycyl-tRNA synthetase-like protein                     152   1e-39   
ref|XP_005628738.1|  PREDICTED: glycine--tRNA ligase isoform X2         152   1e-39   
ref|NP_001091035.1|  glycine--tRNA ligase                               153   1e-39   
ref|XP_007466163.1|  PREDICTED: glycine--tRNA ligase                    153   1e-39   
ref|XP_004531613.1|  PREDICTED: glycine--tRNA ligase-like               153   1e-39   
ref|XP_003639538.1|  PREDICTED: glycine--tRNA ligase isoform X1         153   1e-39   
pdb|4KR3|A  Chain A, Glycyl-trna Synthetase Mutant E71g In Comple...    152   1e-39   
gb|KFO31561.1|  Glycyl-tRNA synthetase                                  153   1e-39   
ref|XP_007535460.1|  PREDICTED: glycine--tRNA ligase                    154   1e-39   
ref|XP_005076856.1|  PREDICTED: glycine--tRNA ligase                    152   1e-39   
gb|KFW73678.1|  Glycine--tRNA ligase                                    152   1e-39   
gb|AJO66477.1|  glycyl-tRNA synthetase                                  147   1e-39   
pdb|4KR2|A  Chain A, Glycyl-trna Synthetase In Complex With Trna-gly    152   1e-39   
ref|XP_004007976.1|  PREDICTED: glycine--tRNA ligase                    152   1e-39   
ref|XP_008259821.1|  PREDICTED: glycine--tRNA ligase                    152   1e-39   
emb|CBN81988.1|  Glycyl-tRNA synthetase                                 153   1e-39   
ref|XP_006902857.1|  PREDICTED: glycine--tRNA ligase                    152   1e-39   
ref|XP_003968038.1|  PREDICTED: glycine--tRNA ligase-like               152   1e-39   
ref|XP_010827706.1|  PREDICTED: glycine--tRNA ligase                    152   1e-39   
ref|XP_007635621.1|  PREDICTED: glycine--tRNA ligase isoform X2         153   1e-39   
ref|XP_010751441.1|  PREDICTED: LOW QUALITY PROTEIN: glycine--tRN...    152   1e-39   
gb|EHH52236.1|  Glycyl-tRNA synthetase                                  152   1e-39   
ref|XP_009556631.1|  PREDICTED: glycine--tRNA ligase                    152   1e-39   
ref|XP_005679411.1|  PREDICTED: glycine--tRNA ligase                    153   2e-39   
gb|KGK39072.1|  hypothetical protein JL09_g1756                         152   2e-39   
ref|XP_002047981.1|  GJ13721                                            152   2e-39   
ref|XP_001645114.1|  hypothetical protein Kpol_538p16                   151   2e-39   
gb|AAA86443.1|  glycyl-tRNA synthetase                                  152   2e-39   
ref|XP_001554992.1|  hypothetical protein BC1G_06515                    152   2e-39   
gb|KFP86432.1|  Glycine--tRNA ligase                                    152   2e-39   
ref|XP_004604306.1|  PREDICTED: glycine--tRNA ligase                    152   2e-39   
gb|AAA57001.1|  glycyl-tRNA synthetase                                  152   2e-39   
ref|XP_009078892.1|  PREDICTED: glycine--tRNA ligase                    151   2e-39   
pdb|2Q5H|A  Chain A, Crystal Structure Of Apo-Wildtype Glycyl-Trn...    152   2e-39   
pdb|2Q5I|A  Chain A, Crystal Structure Of Apo S581l Glycyl-Trna S...    152   2e-39   
pdb|4KQE|A  Chain A, Complex Structure Reveals Multiple Conformat...    152   2e-39   
pdb|2PMF|A  Chain A, The Crystal Structure Of A Human Glycyl-trna...    152   2e-39   
ref|NP_001089920.1|  uncharacterized protein LOC734988                  152   2e-39   
ref|XP_006185545.1|  PREDICTED: glycine--tRNA ligase                    152   2e-39   
gb|AJO66467.1|  glycyl-tRNA synthetase                                  146   2e-39   
pdb|2PME|A  Chain A, The Apo Crystal Structure Of The Glycyl-Trna...    152   2e-39   
ref|XP_008825739.1|  PREDICTED: glycine--tRNA ligase                    152   2e-39   
ref|XP_006275918.1|  PREDICTED: glycine--tRNA ligase-like               152   2e-39   
dbj|BAG58412.1|  unnamed protein product                                152   2e-39   
gb|AJO66461.1|  glycyl-tRNA synthetase                                  146   2e-39   
ref|XP_005889209.1|  PREDICTED: glycine--tRNA ligase                    153   2e-39   
ref|NP_001007492.1|  glycine--tRNA ligase                               152   2e-39   
ref|XP_006055715.1|  PREDICTED: glycine--tRNA ligase                    153   2e-39   
dbj|BAE88416.1|  unnamed protein product                                151   2e-39   
gb|KFW80781.1|  Glycine--tRNA ligase                                    151   2e-39   
gb|KFO66166.1|  Glycine--tRNA ligase                                    151   2e-39   
gb|ELK12632.1|  Glycyl-tRNA synthetase                                  152   2e-39   
ref|XP_006832229.1|  PREDICTED: glycine--tRNA ligase                    152   2e-39   
ref|XP_004091026.1|  PREDICTED: glycine--tRNA ligase isoform 2          151   2e-39   
ref|XP_011382913.1|  PREDICTED: glycine--tRNA ligase                    152   2e-39   
ref|XP_006912102.1|  PREDICTED: glycine--tRNA ligase                    152   3e-39   
dbj|BAA06338.1|  glycyl tRNA synthetase                                 152   3e-39   
ref|XP_001086099.1|  PREDICTED: glycyl-tRNA synthetase                  150   3e-39   
ref|XP_005491512.1|  PREDICTED: glycine--tRNA ligase                    151   3e-39   
ref|XP_002621153.1|  glycyl-tRNA synthetase                             151   3e-39   
ref|XP_006120705.1|  PREDICTED: glycine--tRNA ligase-like               152   3e-39   
ref|XP_005527835.1|  PREDICTED: glycine--tRNA ligase                    151   3e-39   
gb|EPZ31009.1|  Glycyl-tRNA synthetase/DNA polymerase subunit gam...    151   3e-39   
ref|XP_002009245.1|  GI13931                                            151   3e-39   
tpe|CBF77921.1|  TPA: glycyl-tRNA synthetase (AFU_orthologue; AFU...    151   3e-39   
gb|EAW93960.1|  glycyl-tRNA synthetase, isoform CRA_a                   152   3e-39   
ref|XP_009331592.1|  PREDICTED: glycine--tRNA ligase                    152   3e-39   
ref|XP_001229782.1|  hypothetical protein CHGG_03266                    151   3e-39   
ref|XP_010986344.1|  PREDICTED: glycine--tRNA ligase                    152   3e-39   
ref|XP_003935230.1|  PREDICTED: glycine--tRNA ligase                    152   3e-39   
ref|XP_003270534.1|  PREDICTED: glycine--tRNA ligase isoform 1          152   3e-39   
ref|XP_005424409.1|  PREDICTED: glycine--tRNA ligase                    151   3e-39   
ref|XP_002772056.1|  glycyl-tRNA synthetase, putative                   150   3e-39   
ref|XP_011200219.1|  PREDICTED: glycine--tRNA ligase isoform X2         151   3e-39   
ref|NP_002038.2|  glycine--tRNA ligase precursor                        151   3e-39   
ref|XP_006715749.1|  PREDICTED: glycine--tRNA ligase isoform X1         150   3e-39   
gb|AIC58967.1|  GARS                                                    152   3e-39   
ref|XP_009084511.1|  PREDICTED: glycine--tRNA ligase                    151   3e-39   
ref|XP_005673337.1|  PREDICTED: glycine--tRNA ligase isoform X2         150   3e-39   
ref|XP_010969616.1|  PREDICTED: glycine--tRNA ligase                    151   3e-39   
ref|XP_007979909.1|  PREDICTED: glycine--tRNA ligase                    151   3e-39   
ref|XP_010393293.1|  PREDICTED: glycine--tRNA ligase                    151   3e-39   
ref|XP_010369463.1|  PREDICTED: glycine--tRNA ligase isoform X2         150   3e-39   
ref|XP_005549936.1|  PREDICTED: glycine--tRNA ligase isoform X2         150   3e-39   
gb|EJK72359.1|  hypothetical protein THAOC_06119                        146   3e-39   
ref|XP_003134854.3|  PREDICTED: glycine--tRNA ligase isoform X1         151   3e-39   
ref|XP_009201426.1|  PREDICTED: glycine--tRNA ligase isoform X2         150   3e-39   



>ref|XP_006341470.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Solanum 
tuberosum]
Length=621

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  91   MDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  270
            MD A+EAQNRE FRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ
Sbjct  1    MDPAQEAQNRETFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  60

Query  271  HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE  450
            HFVLEENMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE
Sbjct  61   HFVLEENMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLE  120

Query  451  RDPNLPADKVAEYRHVLAVLDDLSAEE  531
            RDPNLPA+K AE+RHVLAVLDDLS+EE
Sbjct  121  RDPNLPAEKAAEFRHVLAVLDDLSSEE  147



>ref|XP_009614005.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=621

 Score =   292 bits (747),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 136/147 (93%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  91   MDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  270
            MD A+EAQNREAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVL+FWRQ
Sbjct  1    MDPAQEAQNREAFRQAVINTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLSFWRQ  60

Query  271  HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE  450
            HFVLEENMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE
Sbjct  61   HFVLEENMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLE  120

Query  451  RDPNLPADKVAEYRHVLAVLDDLSAEE  531
            RDPNLPA+K AE+RHVLAVLDDLSAEE
Sbjct  121  RDPNLPAEKAAEFRHVLAVLDDLSAEE  147



>ref|XP_009780577.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=621

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = +1

Query  91   MDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  270
            MD A+EAQNREAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVL+FWRQ
Sbjct  1    MDPAQEAQNREAFRQAVINTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLSFWRQ  60

Query  271  HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE  450
            HFVLEENMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE
Sbjct  61   HFVLEENMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLE  120

Query  451  RDPNLPADKVAEYRHVLAVLDDLSAEE  531
            RDPNLPA+K AE++HVLAVLDDLSAEE
Sbjct  121  RDPNLPAEKAAEFKHVLAVLDDLSAEE  147



>ref|XP_004235848.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial [Solanum lycopersicum]
Length=621

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +1

Query  91   MDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  270
            MD A+EAQNRE FRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA WRQ
Sbjct  1    MDPAQEAQNRETFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLACWRQ  60

Query  271  HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE  450
            HFVLEENMLEVDCPCVTPE VLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE
Sbjct  61   HFVLEENMLEVDCPCVTPEAVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLE  120

Query  451  RDPNLPADKVAEYRHVLAVLDDLSAEE  531
            RDPNLPA+K AE+RHVLAVLDDLS+EE
Sbjct  121  RDPNLPAEKAAEFRHVLAVLDDLSSEE  147



>ref|XP_011073291.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Sesamum 
indicum]
Length=621

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +1

Query  91   MDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  270
            MDAA+EA NREAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ
Sbjct  1    MDAAQEAHNREAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  60

Query  271  HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE  450
            HFVLEENMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C +KLE
Sbjct  61   HFVLEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCKDKLE  120

Query  451  RDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +DPNL A+K AE RHVLAVLDDLSAEE
Sbjct  121  KDPNLSAEKAAELRHVLAVLDDLSAEE  147



>emb|CDO98302.1| unnamed protein product [Coffea canephora]
Length=621

 Score =   285 bits (728),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +1

Query  91   MDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  270
            MDAAREA NREAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK+NVLAFWRQ
Sbjct  1    MDAAREAHNREAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKANVLAFWRQ  60

Query  271  HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE  450
            HFVLEENMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC EKLE
Sbjct  61   HFVLEENMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGNCYRADHLLKDFCKEKLE  120

Query  451  RDPNLPADKVAEYRHVLAVLDDLSAEE  531
            ++PNL  +K AE+RHVLAVLDDLSAEE
Sbjct  121  KEPNLSDEKKAEFRHVLAVLDDLSAEE  147



>ref|XP_011082927.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Sesamum 
indicum]
Length=621

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +1

Query  91   MDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  270
            MDAA+EAQ REAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK+NVLAFWRQ
Sbjct  1    MDAAQEAQKREAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKANVLAFWRQ  60

Query  271  HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE  450
            HFV EE+MLE+DCPCVTPE+VLKASGHVEKFTDLMVKDEKTG CYRADHLLKD+C +KLE
Sbjct  61   HFVREESMLEIDCPCVTPEIVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDYCKDKLE  120

Query  451  RDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +DPNL A+K AE +HVLA+LDDLS EE
Sbjct  121  KDPNLSAEKAAELKHVLAMLDDLSPEE  147



>gb|ADR79441.1| glycyl-tRNA synthetase-like protein [Liriodendron tulipifera]
Length=688

 Score =   272 bits (696),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            + +REAFRQ+V NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE
Sbjct  71   SASREAFRQSVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  130

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC EKLE+D  LP
Sbjct  131  NMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLTLP  190

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
            A+K AE +HVLAVLDDLSAEE
Sbjct  191  AEKAAELKHVLAVLDDLSAEE  211



>gb|ADR79437.1| glycyl-tRNA synthetase-like protein [Liriodendron tulipifera]
Length=688

 Score =   272 bits (696),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            + +REAFRQ+V NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE
Sbjct  71   SASREAFRQSVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  130

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC EKLE+D  LP
Sbjct  131  NMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLTLP  190

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
            A+K AE +HVLAVLDDLSAEE
Sbjct  191  AEKAAELKHVLAVLDDLSAEE  211



>gb|KDO58150.1| hypothetical protein CISIN_1g0401421mg, partial [Citrus sinensis]
Length=405

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQ V NTLERRLF+IPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE+M
Sbjct  118  NREAFRQTVFNTLERRLFFIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEEDM  177

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPE VLKASGHVEKFTDLMVKDEK G CYRADHLLKDF NEKLE+D +L A+
Sbjct  178  LEVDCPCVTPEAVLKASGHVEKFTDLMVKDEKMGTCYRADHLLKDFGNEKLEKDLSLSAE  237

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE RH+LAVLDDLSAEE
Sbjct  238  KAAELRHLLAVLDDLSAEE  256



>ref|XP_002267943.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial [Vitis vinifera]
Length=667

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            A NREAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK+NVLAFWRQHFVLEE
Sbjct  48   AVNREAFRQAVANTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKANVLAFWRQHFVLEE  107

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHL+KDFCNEKL+ D  + 
Sbjct  108  NMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLVKDFCNEKLQNDNTMT  167

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
            ADK AE RH+LAVLDDLSAEE
Sbjct  168  ADKAAELRHMLAVLDDLSAEE  188



>ref|XP_004250689.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Solanum 
lycopersicum]
Length=738

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +1

Query  61   SHFSPAIDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAV  240
            S    A+    D    + +R+AFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGC+V
Sbjct  103  SQLQVALAGAADGGSSSASRDAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCSV  162

Query  241  KSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHL  420
            KSNVL+FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHL
Sbjct  163  KSNVLSFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHL  222

Query  421  LKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            LKDFC EKLE+D +L A+K AE +H+LAVLDDLSAE+
Sbjct  223  LKDFCKEKLEKDFSLSAEKAAELKHILAVLDDLSAEQ  259



>ref|XP_002297878.2| Glycyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE82683.2| Glycyl-tRNA synthetase family protein [Populus trichocarpa]
Length=690

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 140/157 (89%), Gaps = 5/157 (3%)
 Frame = +1

Query  76   AIDSEMDAAREAQ-----NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAV  240
            +I+ ++ AA         N+EAFRQAV NTLERRLF+IPSFKIYRGVAGLYDYGPPGCAV
Sbjct  55   SIEKQLQAAVSGNPDGSVNKEAFRQAVVNTLERRLFFIPSFKIYRGVAGLYDYGPPGCAV  114

Query  241  KSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHL  420
            KSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHL
Sbjct  115  KSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHL  174

Query  421  LKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            LKDFCNEK+++D ++ A+K AE +HVLAVLDDLSAEE
Sbjct  175  LKDFCNEKIQKDLSISAEKAAELKHVLAVLDDLSAEE  211



>ref|XP_010249248.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Nelumbo 
nucifera]
Length=691

 Score =   270 bits (691),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NR+AFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM
Sbjct  74   NRDAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  133

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC EKLE+D ++ AD
Sbjct  134  LEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLSISAD  193

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE +HV+AVLDDLSAEE
Sbjct  194  KAAELKHVIAVLDDLSAEE  212



>ref|XP_011036186.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial [Populus euphratica]
Length=690

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 140/157 (89%), Gaps = 5/157 (3%)
 Frame = +1

Query  76   AIDSEMDAAREAQ-----NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAV  240
            +I+ ++ AA         N+EAFRQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGCAV
Sbjct  55   SIEKQLQAAVSGNPDSSVNKEAFRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCAV  114

Query  241  KSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHL  420
            KSNVL+FWRQHFVLEENMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHL
Sbjct  115  KSNVLSFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHL  174

Query  421  LKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            LKDFCNEK+++D ++ A+K AE +HVLAVLDDLSAEE
Sbjct  175  LKDFCNEKIQKDLSISAEKAAELKHVLAVLDDLSAEE  211



>ref|XP_008779920.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=313

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = +1

Query  79   IDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA  258
            + S + +  +  ++EAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA
Sbjct  61   LQSAVSSNSDGSSKEAFRQAVANTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA  120

Query  259  FWRQ---HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKD  429
            FWRQ   HFVLEENMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKD
Sbjct  121  FWRQSPIHFVLEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKD  180

Query  430  FCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +C  KLE+D  L  DK AE++HV++VLDDLS+EE
Sbjct  181  YCKGKLEKDLTLSPDKAAEFKHVISVLDDLSSEE  214



>ref|XP_002512672.1| glycyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF50124.1| glycyl-tRNA synthetase, putative [Ricinus communis]
Length=686

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +1

Query  94   DAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQH  273
            +AA  + +REAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGC+VKSNVLAFWRQH
Sbjct  68   NAADSSVSREAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCSVKSNVLAFWRQH  127

Query  274  FVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLER  453
            FVLEENMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC EKL++
Sbjct  128  FVLEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCTEKLQK  187

Query  454  DPNLPADKVAEYRHVLAVLDDLSAEE  531
            D  + ++K AE +HVLAVLDDLSAEE
Sbjct  188  DLTITSEKAAELKHVLAVLDDLSAEE  213



>gb|KDP23259.1| hypothetical protein JCGZ_23092 [Jatropha curcas]
Length=691

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            +REAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGC+VKSNVLAFWRQHFVLEENM
Sbjct  74   SREAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCSVKSNVLAFWRQHFVLEENM  133

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPE+VLKASGHV+KFTDLMVKD+KTG CYRADHLLKDFCNEKL++D +L ++
Sbjct  134  LEVDCPCVTPEIVLKASGHVDKFTDLMVKDDKTGTCYRADHLLKDFCNEKLQKDLSLTSE  193

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE RHVLAVLDDLSAEE
Sbjct  194  KAAELRHVLAVLDDLSAEE  212



>ref|XP_006420796.1| hypothetical protein CICLE_v10004524mg [Citrus clementina]
 gb|ESR34036.1| hypothetical protein CICLE_v10004524mg [Citrus clementina]
Length=578

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQ V NTLERRLF+IPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE+M
Sbjct  118  NREAFRQTVFNTLERRLFFIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEEDM  177

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPE VLKASGHVEKFTDLMVKDEK G CYRADHLLKDFCNEKLE+D +L A+
Sbjct  178  LEVDCPCVTPEAVLKASGHVEKFTDLMVKDEKMGTCYRADHLLKDFCNEKLEKDLSLYAE  237

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE RH+LAVLDDLSAEE
Sbjct  238  KAAELRHLLAVLDDLSAEE  256



>gb|AFW64974.1| hypothetical protein ZEAMMB73_056745 [Zea mays]
Length=253

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            RE  RQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGC VK+NVL+FWRQHFVLEENML
Sbjct  75   REELRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCRVKANVLSFWRQHFVLEENML  134

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFC EKLE+D  LP +K
Sbjct  135  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLALPQEK  194

Query  478  VAEYRHVLAVLDDLSAEE  531
              E++ +LA+LDDLSAEE
Sbjct  195  ADEFKRILAILDDLSAEE  212



>ref|XP_006420795.1| hypothetical protein CICLE_v10004524mg [Citrus clementina]
 gb|ESR34035.1| hypothetical protein CICLE_v10004524mg [Citrus clementina]
Length=646

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQ V NTLERRLF+IPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE+M
Sbjct  118  NREAFRQTVFNTLERRLFFIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEEDM  177

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPE VLKASGHVEKFTDLMVKDEK G CYRADHLLKDFCNEKLE+D +L A+
Sbjct  178  LEVDCPCVTPEAVLKASGHVEKFTDLMVKDEKMGTCYRADHLLKDFCNEKLEKDLSLYAE  237

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE RH+LAVLDDLSAEE
Sbjct  238  KAAELRHLLAVLDDLSAEE  256



>ref|XP_009395183.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Musa acuminata 
subsp. malaccensis]
Length=695

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            A +REAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE
Sbjct  75   ASSREAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  134

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFC EKLE+D  L 
Sbjct  135  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLTLS  194

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
             +K AE +HV+ VLDDLSAEE
Sbjct  195  PEKAAELKHVIMVLDDLSAEE  215



>ref|XP_011020893.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Populus 
euphratica]
Length=696

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            N+EAFRQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGCAVKSNVL+FWRQHFVLEENM
Sbjct  79   NKEAFRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLSFWRQHFVLEENM  138

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCNEK+++D ++ A+
Sbjct  139  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNEKIQKDLSISAE  198

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE +HVLA+LDDLSAEE
Sbjct  199  KAAELKHVLAILDDLSAEE  217



>ref|XP_010250511.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Nelumbo 
nucifera]
Length=719

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            A NR+AFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVL FWRQHFVLEE
Sbjct  100  AVNRDAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLGFWRQHFVLEE  159

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC EKLE+D ++ 
Sbjct  160  NMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLSMS  219

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
            A+K AE +H+LA+LDDLSAEE
Sbjct  220  AEKAAELKHILAILDDLSAEE  240



>ref|XP_007043777.1| Glycyl-tRNA synthetase / glycine--tRNA ligase [Theobroma cacao]
 gb|EOX99608.1| Glycyl-tRNA synthetase / glycine--tRNA ligase [Theobroma cacao]
Length=739

 Score =   268 bits (685),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            +REAFRQA  NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM
Sbjct  122  SREAFRQAAANTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  181

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCNEKL++D ++ A+
Sbjct  182  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNEKLQKDLSISAE  241

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE +HVLA LDDLSAEE
Sbjct  242  KAAELKHVLATLDDLSAEE  260



>ref|XP_007139132.1| hypothetical protein PHAVU_008G004200g [Phaseolus vulgaris]
 gb|ESW11126.1| hypothetical protein PHAVU_008G004200g [Phaseolus vulgaris]
Length=724

 Score =   268 bits (684),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            +  REAFRQAV NTLERRLFYIPSFKIYRGVAGL+DYGPPGCAVKSNVL+FWRQHFVLEE
Sbjct  105  SDTREAFRQAVVNTLERRLFYIPSFKIYRGVAGLFDYGPPGCAVKSNVLSFWRQHFVLEE  164

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG C+RADHLLKDFCNEKL+RD  L 
Sbjct  165  NMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCFRADHLLKDFCNEKLQRDLTLS  224

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
            +DKV+E +HVLA+LDD SAEE
Sbjct  225  SDKVSELKHVLAMLDDFSAEE  245



>ref|XP_009385431.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Musa acuminata 
subsp. malaccensis]
Length=728

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            A +REAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE
Sbjct  108  AGSREAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  167

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C EKLE+D  L 
Sbjct  168  NMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCKEKLEKDLTLS  227

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
            A+K AE +H+LAVLDDLSA+E
Sbjct  228  AEKAAELKHILAVLDDLSADE  248



>ref|XP_006343502.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Solanum 
tuberosum]
Length=738

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            R+AFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGC+VKSNVLAFWRQHFVLEENML
Sbjct  122  RDAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCSVKSNVLAFWRQHFVLEENML  181

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFC EKLE+D +L A+K
Sbjct  182  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDFSLSAEK  241

Query  478  VAEYRHVLAVLDDLSAEE  531
             AE +H+LAVLDDLSAE+
Sbjct  242  AAELKHILAVLDDLSAEQ  259



>ref|XP_004170329.1| PREDICTED: LOW QUALITY PROTEIN: glycine--tRNA ligase 1, mitochondrial-like 
[Cucumis sativus]
Length=729

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NRE+FRQ V+NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM
Sbjct  112  NRESFRQTVSNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  171

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCNEKL++D ++ ++
Sbjct  172  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNEKLQKDLSISSE  231

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE +H+LAVLDDLSA++
Sbjct  232  KAAELKHILAVLDDLSADQ  250



>ref|XP_002304639.1| Glycyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE79618.1| Glycyl-tRNA synthetase family protein [Populus trichocarpa]
Length=691

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            N+EAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVL+FWRQHFVLEENM
Sbjct  74   NKEAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLSFWRQHFVLEENM  133

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG C RADHLLKDFCNEK+++D ++ A+
Sbjct  134  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCCRADHLLKDFCNEKIQKDLSISAE  193

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE +HVLA+LDDLSAEE
Sbjct  194  KAAELKHVLAILDDLSAEE  212



>ref|XP_004152844.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN61223.1| hypothetical protein Csa_2G070890 [Cucumis sativus]
Length=729

 Score =   266 bits (681),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NRE+FRQ V+NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM
Sbjct  112  NRESFRQTVSNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  171

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCNEKL++D ++ ++
Sbjct  172  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNEKLQKDLSISSE  231

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE +H+LAVLDDLSA++
Sbjct  232  KAAELKHILAVLDDLSADQ  250



>gb|EPS67446.1| hypothetical protein M569_07324, partial [Genlisea aurea]
Length=615

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            A NREAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCA+KSNVL+FWRQHFVLEE
Sbjct  1    ALNREAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAIKSNVLSFWRQHFVLEE  60

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C +KLE+DP L 
Sbjct  61   NMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCKDKLEKDPKLS  120

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
             +  AE + VLAVLDDLS+EE
Sbjct  121  PENAAELKRVLAVLDDLSSEE  141



>ref|XP_010663810.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial [Vitis vinifera]
 emb|CBI15763.3| unnamed protein product [Vitis vinifera]
Length=687

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 137/157 (87%), Gaps = 5/157 (3%)
 Frame = +1

Query  76   AIDSEMDAAREAQN-----REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAV  240
            +I+ ++ AA    N     R+AFRQA+ NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAV
Sbjct  52   SIEKQLQAALTNGNDNALSRDAFRQALVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAV  111

Query  241  KSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHL  420
            KSNVLAFWRQHFVLEENMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHL
Sbjct  112  KSNVLAFWRQHFVLEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHL  171

Query  421  LKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            LKDFC EKLE+D  +  +K AE +H+LAVLDDLSAEE
Sbjct  172  LKDFCKEKLEKDLTISGEKAAELKHILAVLDDLSAEE  208



>ref|XP_010927793.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Elaeis 
guineensis]
Length=733

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  79   IDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA  258
            + S + +  +  ++EAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA
Sbjct  103  LQSAVSSNGDGSSKEAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA  162

Query  259  FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCN  438
            FWRQHFVLEENMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C 
Sbjct  163  FWRQHFVLEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCK  222

Query  439  EKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
             KLE+D  L  DK AE++HV+AVLDDLSAEE
Sbjct  223  GKLEKDLTLSPDKAAEFKHVVAVLDDLSAEE  253



>gb|KHG20733.1| Glycine--tRNA ligase 1, mitochondrial -like protein [Gossypium 
arboreum]
Length=737

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            A +REAFRQA  NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE
Sbjct  118  ALSREAFRQAAVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  177

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCNEKL++D  + 
Sbjct  178  NMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNEKLQKDLTIS  237

Query  469  ADKVAEYRHVLAVLDDLSAE  528
            A+K AE +HVLA LDDLSAE
Sbjct  238  AEKAAELKHVLATLDDLSAE  257



>ref|XP_007038160.1| Glycyl-tRNA synthetase / glycine--tRNA ligase [Theobroma cacao]
 gb|EOY22661.1| Glycyl-tRNA synthetase / glycine--tRNA ligase [Theobroma cacao]
Length=627

 Score =   263 bits (673),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NR+AFRQAV NTLERRLFY+PSFKIY GVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM
Sbjct  11   NRDAFRQAVVNTLERRLFYVPSFKIYGGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  70

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG C+RADHLLKDFC ++LE+D N+ AD
Sbjct  71   LEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCFRADHLLKDFCKDQLEKDINVTAD  130

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE +HVLAVLDDLSAEE
Sbjct  131  KAAELKHVLAVLDDLSAEE  149



>ref|XP_009793813.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=728

 Score =   265 bits (678),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 138/155 (89%), Gaps = 3/155 (2%)
 Frame = +1

Query  76   AIDSEMDAA---REAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKS  246
            +I+S++  A     + +R+AFRQ V NTLERRLFYIPSFKIYRGVAGLYDYGPPGC+VKS
Sbjct  95   SIESQLQTAAGGSSSASRDAFRQNVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCSVKS  154

Query  247  NVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLK  426
            NVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLK
Sbjct  155  NVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLK  214

Query  427  DFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            D+C EKLE+D +L + K AE +H+LAVLDDLSAE+
Sbjct  215  DYCKEKLEKDFSLSSGKAAELKHILAVLDDLSAEQ  249



>ref|XP_003532335.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Glycine 
max]
Length=725

 Score =   265 bits (677),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            + +REAFRQ+V NTLERRLFYIPSFKIYRGVAGL+DYGPPGC+VKSNVL+FWRQHFVLEE
Sbjct  106  SDSREAFRQSVVNTLERRLFYIPSFKIYRGVAGLFDYGPPGCSVKSNVLSFWRQHFVLEE  165

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCN+KL+RD  L 
Sbjct  166  NMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNDKLQRDLALS  225

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
            +DKVAE +HVLA+LDD SAEE
Sbjct  226  SDKVAELKHVLAMLDDFSAEE  246



>ref|XP_008351110.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Malus 
domestica]
Length=671

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 144/176 (82%), Gaps = 4/176 (2%)
 Frame = +1

Query  4    FHYRIGIFYPHYTLSSRRRSHFSPAIDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSF  183
            F +R+G         + RR+     + + + ++  + NREAFRQAV+NTLERRLFYI SF
Sbjct  21   FRFRLGT----ERAQAGRRASIEKDLQATLSSSEGSGNREAFRQAVSNTLERRLFYIKSF  76

Query  184  KIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKF  363
             IY GVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHV+KF
Sbjct  77   NIYGGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVDKF  136

Query  364  TDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            TDLMVKDEKTG CYRADHLLKDFCN+KL++D N+ A+K  E +H+LAVLDDLS E+
Sbjct  137  TDLMVKDEKTGTCYRADHLLKDFCNDKLQKDLNITAEKAKELKHILAVLDDLSPED  192



>ref|XP_007221906.1| hypothetical protein PRUPE_ppa001964mg [Prunus persica]
 gb|EMJ23105.1| hypothetical protein PRUPE_ppa001964mg [Prunus persica]
Length=735

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  79   IDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA  258
            + + + +A  + NREAFRQAV+NTLERRLFYI SF IY GVAGLYDYGPPGCAVKSNVLA
Sbjct  106  LQATLSSADGSLNREAFRQAVSNTLERRLFYIKSFNIYGGVAGLYDYGPPGCAVKSNVLA  165

Query  259  FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCN  438
            FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFCN
Sbjct  166  FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCN  225

Query  439  EKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +KL++D N+ A+K  E +HVLA+LDD SAEE
Sbjct  226  DKLQKDLNITAEKAKELKHVLAMLDDFSAEE  256



>ref|XP_004499600.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Cicer 
arietinum]
Length=720

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            + +REAFRQ+V NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVL+FWRQHFVLEE
Sbjct  101  SDSREAFRQSVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLSFWRQHFVLEE  160

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+CNEKL++D  L 
Sbjct  161  NMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCNEKLQKDLTLS  220

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
            +DK AE +HVLA+LDD S++E
Sbjct  221  SDKAAEIKHVLAMLDDFSSQE  241



>emb|CDP18987.1| unnamed protein product [Coffea canephora]
Length=735

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NR+AFRQA+ NTLERRLFY+PSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM
Sbjct  117  NRDAFRQALVNTLERRLFYMPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  176

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPE+VLKASGHVEKFTDLMVKDEKTG CYRADHLLKD+C +KLE+D  + A+
Sbjct  177  LEVDCPCVTPEIVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDYCKDKLEKDLTITAE  236

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE +HVLA+LDDLSAEE
Sbjct  237  KAAELKHVLALLDDLSAEE  255



>ref|XP_008450384.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial [Cucumis melo]
Length=729

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NRE+FRQ V+NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM
Sbjct  112  NRESFRQTVSNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  171

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCNEKL++D ++ ++
Sbjct  172  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNEKLQKDLSISSE  231

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE + +LAVLDDLSA++
Sbjct  232  KAAELKQILAVLDDLSADQ  250



>ref|XP_011082905.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like isoform 
X2 [Sesamum indicum]
Length=643

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  97   AAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHF  276
            +  E+Q +EAFRQAV NTLERRLFYIPS+KIY G+AGLYDYGPPGCA+K+NVLAFWRQHF
Sbjct  39   SVTESQKKEAFRQAVLNTLERRLFYIPSYKIYGGIAGLYDYGPPGCAIKANVLAFWRQHF  98

Query  277  VLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERD  456
            VLEENMLEVDCPCVTPE+VLKASGHV+KFTDLMV DEK+G CYRADHLLKD+C +KL++D
Sbjct  99   VLEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVNDEKSGTCYRADHLLKDYCTDKLQKD  158

Query  457  PNLPADKVAEYRHVLAVLDDLSAEE  531
            PNL A+K A  RHVLAVLDDLS EE
Sbjct  159  PNLSAEKAANLRHVLAVLDDLSVEE  183



>gb|KJB77209.1| hypothetical protein B456_012G125800 [Gossypium raimondii]
 gb|KJB77210.1| hypothetical protein B456_012G125800 [Gossypium raimondii]
Length=737

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            A +REAFRQA  NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE
Sbjct  118  ALSREAFRQAAVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  177

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCNE L++D  + 
Sbjct  178  NMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNEMLQKDLTIS  237

Query  469  ADKVAEYRHVLAVLDDLSAE  528
            A+K AE +HVLA LDDLSAE
Sbjct  238  AEKAAELKHVLATLDDLSAE  257



>gb|EEC77206.1| hypothetical protein OsI_15722 [Oryza sativa Indica Group]
Length=637

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFR AVTNTLERRLFY+PSFKIY GVAGLYDYGPPGCAVK+NVLAFWRQHFVLEE M
Sbjct  14   NREAFRVAVTNTLERRLFYVPSFKIYGGVAGLYDYGPPGCAVKANVLAFWRQHFVLEEGM  73

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  LP +
Sbjct  74   LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLEKDNTLPPE  133

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE+ HVLAVLDDLSAE+
Sbjct  134  KTAEFNHVLAVLDDLSAEQ  152



>ref|XP_009600007.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial [Nicotiana tomentosiformis]
Length=728

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            R+AFRQ V NTLERRLFYIPSFKIYRGVAGLYDYGPPGC+VKSNVLAFWRQHFVLEENML
Sbjct  112  RDAFRQNVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCSVKSNVLAFWRQHFVLEENML  171

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKD+C EKLE+D +L ++K
Sbjct  172  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDYCKEKLEKDFSLSSEK  231

Query  478  VAEYRHVLAVLDDLSAEE  531
             AE +H+LAVLDDLSAE+
Sbjct  232  AAELKHILAVLDDLSAEQ  249



>ref|XP_011082897.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like isoform 
X1 [Sesamum indicum]
Length=664

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  106  EAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLE  285
            E+Q +EAFRQAV NTLERRLFYIPS+KIY G+AGLYDYGPPGCA+K+NVLAFWRQHFVLE
Sbjct  42   ESQKKEAFRQAVLNTLERRLFYIPSYKIYGGIAGLYDYGPPGCAIKANVLAFWRQHFVLE  101

Query  286  ENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNL  465
            ENMLEVDCPCVTPE+VLKASGHV+KFTDLMV DEK+G CYRADHLLKD+C +KL++DPNL
Sbjct  102  ENMLEVDCPCVTPEIVLKASGHVDKFTDLMVNDEKSGTCYRADHLLKDYCTDKLQKDPNL  161

Query  466  PADKVAEYRHVLAVLDDLSAEE  531
             A+K A  RHVLAVLDDLS EE
Sbjct  162  SAEKAANLRHVLAVLDDLSVEE  183



>ref|XP_008222253.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial [Prunus mume]
Length=735

 Score =   263 bits (672),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  79   IDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA  258
            + + + +A  + NREAFRQAV+NTLERRLFYI SF IY GVAGLYDYGPPGCAVKSNVLA
Sbjct  106  LQATLSSADGSVNREAFRQAVSNTLERRLFYIKSFNIYGGVAGLYDYGPPGCAVKSNVLA  165

Query  259  FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCN  438
            FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDE+TG CYRADHLLKDFCN
Sbjct  166  FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEETGTCYRADHLLKDFCN  225

Query  439  EKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +KL++D N+ A+K  E +HVLA+LDD SAEE
Sbjct  226  DKLQKDLNIAAEKAKELKHVLAMLDDFSAEE  256



>ref|XP_006487557.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Citrus 
sinensis]
Length=735

 Score =   263 bits (672),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQ V NTLERRLF+IPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE+M
Sbjct  118  NREAFRQTVFNTLERRLFFIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEEDM  177

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPE VLKASGHVEKFTDLMVKDEK G CYRADHLLKDF NEKLE+D +L A+
Sbjct  178  LEVDCPCVTPEAVLKASGHVEKFTDLMVKDEKMGTCYRADHLLKDFGNEKLEKDLSLSAE  237

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE RH+LAVLDDLSAEE
Sbjct  238  KAAELRHLLAVLDDLSAEE  256



>gb|KEH21485.1| glycyl-tRNA synthetase/glycine-tRNA ligase [Medicago truncatula]
Length=686

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            + +REAFRQ+V NTLERRLFYIPSFKIYRGVAG YDYGPPGCAVKSNVLAFWRQHFVLEE
Sbjct  67   SDSREAFRQSVNNTLERRLFYIPSFKIYRGVAGFYDYGPPGCAVKSNVLAFWRQHFVLEE  126

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCP VTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKD+CNEKL++D  L 
Sbjct  127  NMLEVDCPSVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDYCNEKLQKDLTLS  186

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
            +DK AE +HVLA+LDD S++E
Sbjct  187  SDKAAELKHVLAMLDDFSSQE  207



>ref|XP_009359873.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=689

 Score =   262 bits (669),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  79   IDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA  258
            + + + +   + N+EAFRQAV+NTLERRLFYI SF IY GVAGLYDYGPPGCAVKSNVLA
Sbjct  60   LQATLSSGEGSGNKEAFRQAVSNTLERRLFYIKSFNIYGGVAGLYDYGPPGCAVKSNVLA  119

Query  259  FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCN  438
            FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFCN
Sbjct  120  FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCN  179

Query  439  EKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +KL++D N+ A+K  E +H+LAVLDDLS E+
Sbjct  180  DKLQKDLNITAEKAKELKHILAVLDDLSPED  210



>emb|CAH66534.1| H0209H04.1 [Oryza sativa Indica Group]
Length=679

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFR AVTNTLERRLFY+PSFKIY GVAGLYDYGPPGCAVK+NVLAFWRQHFVLEE M
Sbjct  56   NREAFRVAVTNTLERRLFYVPSFKIYGGVAGLYDYGPPGCAVKANVLAFWRQHFVLEEGM  115

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  LP +
Sbjct  116  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLEKDNTLPPE  175

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE+ HVLAVLDDLSAE+
Sbjct  176  KTAEFNHVLAVLDDLSAEQ  194



>gb|EEE60922.1| hypothetical protein OsJ_14640 [Oryza sativa Japonica Group]
Length=591

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFR AVTNTLERRLFY+PSFKIY GVAGLYDYGPPGCAVK+NVLAFWRQHFVLEE M
Sbjct  14   NREAFRVAVTNTLERRLFYVPSFKIYGGVAGLYDYGPPGCAVKANVLAFWRQHFVLEEGM  73

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  L  +
Sbjct  74   LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLEKDNTLSPE  133

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE+ HVLAVLDDLSAE+
Sbjct  134  KTAEFNHVLAVLDDLSAEQ  152



>gb|EYU24531.1| hypothetical protein MIMGU_mgv1a002993mg [Erythranthe guttata]
Length=618

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 3/147 (2%)
 Frame = +1

Query  91   MDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  270
            MDA  +   REAFRQAV NTLERRLFYIPSFKIY GVAGLYDYGPPGCAVK+NVLAFWRQ
Sbjct  1    MDAVLK---REAFRQAVVNTLERRLFYIPSFKIYGGVAGLYDYGPPGCAVKANVLAFWRQ  57

Query  271  HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE  450
            HFV EENMLEVDCPCVTPE VLKASGHV+KFTDLMVKDEKTG C+RADHL+KDFC EKLE
Sbjct  58   HFVREENMLEVDCPCVTPETVLKASGHVDKFTDLMVKDEKTGNCFRADHLVKDFCKEKLE  117

Query  451  RDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +DP L A+KVAE +HVLAVLDDLS +E
Sbjct  118  KDPKLSAEKVAELKHVLAVLDDLSVDE  144



>ref|XP_010909743.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Elaeis 
guineensis]
Length=731

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  79   IDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA  258
            + + + +  +  ++EAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA
Sbjct  102  LQAAVSSNGDGSSKEAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA  161

Query  259  FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCN  438
            FWR HFVLEENMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C 
Sbjct  162  FWRHHFVLEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCK  221

Query  439  EKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
             KLE+D  L ++K AE++HV+AVLDDLSAEE
Sbjct  222  GKLEKDLTLSSEKAAEFKHVIAVLDDLSAEE  252



>ref|XP_009353511.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=731

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  79   IDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA  258
            + + + ++  + NREAFRQAV+NTLERRLFYI SF IY GVAGLYDYGPPGCAVKSNVLA
Sbjct  102  LQATLSSSEGSGNREAFRQAVSNTLERRLFYIKSFNIYGGVAGLYDYGPPGCAVKSNVLA  161

Query  259  FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCN  438
            FWRQHFVLEENMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCN
Sbjct  162  FWRQHFVLEENMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCN  221

Query  439  EKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +KL++D N+ A+K  E +H+LAVLDDLS E+
Sbjct  222  DKLQKDLNITAEKAKELKHILAVLDDLSPED  252



>emb|CDX98156.1| BnaC07g09420D [Brassica napus]
Length=727

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQAV NTLERRLFYIPSFKIYRGVAGL+DYGPPGCAVKSNVL+FWRQHF+LEENM
Sbjct  108  NREAFRQAVVNTLERRLFYIPSFKIYRGVAGLFDYGPPGCAVKSNVLSFWRQHFILEENM  167

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C EKLE+D  + A+
Sbjct  168  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTEKLEKDLTISAE  227

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AEY+ VLAV++D S EE
Sbjct  228  KAAEYKDVLAVMEDYSPEE  246



>ref|XP_006659640.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like, partial 
[Oryza brachyantha]
Length=622

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            A  RE  RQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGCAVK+NVL+FWRQHFVLEE
Sbjct  4    AAAREEMRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCAVKANVLSFWRQHFVLEE  63

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPE+VLKASGHVEKFTDLMVKDEKTG CYRADHLLKD+C EK+E+D  L 
Sbjct  64   NMLEVDCPCVTPEIVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDYCKEKVEKDLTLS  123

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
             +K AE++HVLAVLDDLSAEE
Sbjct  124  PEKAAEFKHVLAVLDDLSAEE  144



>ref|XP_008369623.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Malus 
domestica]
Length=689

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            N+EAFRQAV+NTLERRLFYI SF IY GVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM
Sbjct  72   NKEAFRQAVSNTLERRLFYIKSFNIYGGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  131

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFCN+KL++D N+ A+
Sbjct  132  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCNDKLQKDLNITAE  191

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K  E +H+LAVLDDLS E+
Sbjct  192  KAKELKHILAVLDDLSPED  210



>gb|KEH32824.1| glycyl-tRNA synthetase/glycine-tRNA ligase [Medicago truncatula]
Length=640

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  97   AAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHF  276
            +A  + +R+AFRQ+V NTLERRLFYIPSFKIY GVAG YDYGPPGCAVKSNVL+FWRQHF
Sbjct  17   SASGSDSRDAFRQSVVNTLERRLFYIPSFKIYCGVAGFYDYGPPGCAVKSNVLSFWRQHF  76

Query  277  VLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERD  456
            VLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKD+CNEKL++D
Sbjct  77   VLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDYCNEKLQKD  136

Query  457  PNLPADKVAEYRHVLAVLDDLSAEE  531
              L +DK AE +HVLA+LDD S++E
Sbjct  137  LTLSSDKAAELKHVLAMLDDFSSQE  161



>ref|XP_009102802.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Brassica 
rapa]
Length=722

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQAV NTLERRLFYIPSFKIYRGVAGL+DYGPPGCAVKSNVL+FWRQHF+LEENM
Sbjct  103  NREAFRQAVVNTLERRLFYIPSFKIYRGVAGLFDYGPPGCAVKSNVLSFWRQHFILEENM  162

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C EKLE+D  + A+
Sbjct  163  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTEKLEKDLTISAE  222

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AEY+ VLAV++D S EE
Sbjct  223  KAAEYKDVLAVMEDYSPEE  241



>emb|CDY43195.1| BnaA07g07590D [Brassica napus]
Length=722

 Score =   261 bits (666),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQAV NTLERRLFYIPSFKIYRGVAGL+DYGPPGCAVKSNVL+FWRQHF+LEENM
Sbjct  103  NREAFRQAVVNTLERRLFYIPSFKIYRGVAGLFDYGPPGCAVKSNVLSFWRQHFILEENM  162

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C EKLE+D  + A+
Sbjct  163  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTEKLEKDLTISAE  222

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AEY+ VLAV++D S EE
Sbjct  223  KAAEYKDVLAVMEDYSPEE  241



>ref|XP_010530803.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial [Tarenaya hassleriana]
Length=730

 Score =   261 bits (666),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +1

Query  64   HFSPAIDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK  243
                ++  +  +A    +REAFRQA  NTLERRLF+IPSFKIYRGVAGLYDYGPPGCAVK
Sbjct  96   QLQASVSGDGGSADGVLSREAFRQAGVNTLERRLFFIPSFKIYRGVAGLYDYGPPGCAVK  155

Query  244  SNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLL  423
            SNVL FWRQHFVLEENMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLL
Sbjct  156  SNVLQFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLL  215

Query  424  KDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            KD+CNEKL++D  + A+K AE +HVLA+LDDLS EE
Sbjct  216  KDYCNEKLQKDLTISAEKAAELKHVLALLDDLSPEE  251



>gb|EYU21758.1| hypothetical protein MIMGU_mgv1a002954mg [Erythranthe guttata]
Length=622

 Score =   258 bits (659),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +1

Query  91   MDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  270
            MDAA+E +N+EAFR AV NTLERRLF+IPSFKIY GVAGLYDYGPPGCAVKSNVLAFWRQ
Sbjct  1    MDAAQETRNKEAFRHAVVNTLERRLFFIPSFKIYGGVAGLYDYGPPGCAVKSNVLAFWRQ  60

Query  271  HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE  450
            HFVLEENMLEVDCP VTPEVVLKASGHV+KFTDLMVKD KTG CYRADHL+KD+C +K+E
Sbjct  61   HFVLEENMLEVDCPSVTPEVVLKASGHVDKFTDLMVKDLKTGRCYRADHLVKDYCKDKIE  120

Query  451  RDPNLPADKVAEYRHVLAVLDDLSAEE  531
             D NL A+  AE RHVLAVLDDLS EE
Sbjct  121  NDHNLSAELAAELRHVLAVLDDLSEEE  147



>emb|CAE05155.2| OSJNBa0039C07.11 [Oryza sativa Japonica Group]
Length=673

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFR AVTNTLERRLFY+PSFKIY GVAGLYDYGPPGCAVK+NVLAFWRQHFVLEE M
Sbjct  50   NREAFRVAVTNTLERRLFYVPSFKIYGGVAGLYDYGPPGCAVKANVLAFWRQHFVLEEGM  109

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  L  +
Sbjct  110  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLEKDNTLSPE  169

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE+ HVLAVLDDLSAE+
Sbjct  170  KTAEFNHVLAVLDDLSAEQ  188



>dbj|BAJ53123.1| JHL07K02.13 [Jatropha curcas]
 gb|KDP22529.1| hypothetical protein JCGZ_26360 [Jatropha curcas]
Length=699

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            N++AFRQAV NTLERRLFYIPSF IY GVAGLYDYGPPGC VKSNVLAFWRQHFVLEENM
Sbjct  79   NKDAFRQAVVNTLERRLFYIPSFNIYGGVAGLYDYGPPGCGVKSNVLAFWRQHFVLEENM  138

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D ++ A+
Sbjct  139  LEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGNCYRADHLLKDFCKDKLEKDLSISAE  198

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE  HVLA+LDDLSAEE
Sbjct  199  KAAELNHVLAILDDLSAEE  217



>ref|XP_009115209.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial [Brassica rapa]
Length=687

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQAV NTLERRLFYIPSFKIYRGVAGL+DYGPPGCAVKSNVL+FWRQHF+LEENM
Sbjct  70   NREAFRQAVVNTLERRLFYIPSFKIYRGVAGLFDYGPPGCAVKSNVLSFWRQHFILEENM  129

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C +K+E+D  + AD
Sbjct  130  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTDKVEKDLTISAD  189

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE++ VLAV++D S EE
Sbjct  190  KAAEFKDVLAVMEDYSPEE  208



>ref|NP_001062369.1| Os08g0538000 [Oryza sativa Japonica Group]
 dbj|BAD01242.1| putative glycyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAF24283.1| Os08g0538000 [Oryza sativa Japonica Group]
 gb|EAZ07804.1| hypothetical protein OsI_30061 [Oryza sativa Indica Group]
 gb|EAZ43491.1| hypothetical protein OsJ_28106 [Oryza sativa Japonica Group]
Length=698

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            RE  RQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGCAVK+NVLAFWRQHFVLEENML
Sbjct  81   REEMRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCAVKANVLAFWRQHFVLEENML  140

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKD C EKLE+D  L  +K
Sbjct  141  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDHCKEKLEKDLTLSPEK  200

Query  478  VAEYRHVLAVLDDLSAEE  531
             AE +HVLAVLDDLSA+E
Sbjct  201  AAELKHVLAVLDDLSADE  218



>emb|CDX99860.1| BnaC05g22820D [Brassica napus]
Length=690

 Score =   257 bits (656),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQAV NTLERRLFYIPSFKIYRGVAGL+DYGPPGCAVKSNVL+FWRQHF+LEENM
Sbjct  73   NREAFRQAVVNTLERRLFYIPSFKIYRGVAGLFDYGPPGCAVKSNVLSFWRQHFILEENM  132

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C +KLE+D  + A+
Sbjct  133  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTDKLEKDLTISAE  192

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE++ VLAV++D S EE
Sbjct  193  KAAEFKDVLAVMEDYSPEE  211



>gb|AFW64973.1| hypothetical protein ZEAMMB73_056745 [Zea mays]
Length=628

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            RE  RQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGC VK+NVL+FWRQHFVLEENML
Sbjct  75   REELRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCRVKANVLSFWRQHFVLEENML  134

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFC EKLE+D  LP +K
Sbjct  135  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLALPQEK  194

Query  478  VAEYRHVLAVLDDLSAEE  531
              E++ +LA+LDDLSAEE
Sbjct  195  ADEFKRILAILDDLSAEE  212



>dbj|BAJ98760.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=691

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            RE  RQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML
Sbjct  74   REEMRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  133

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  L  + 
Sbjct  134  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCKDKLEKDLTLSPET  193

Query  478  VAEYRHVLAVLDDLSAEE  531
             AE++ VLAVLDDLS EE
Sbjct  194  AAEFKRVLAVLDDLSPEE  211



>ref|XP_008664405.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Zea mays]
 tpg|DAA48288.1| TPA: hypothetical protein ZEAMMB73_481662 [Zea mays]
Length=692

 Score =   256 bits (655),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            RE  RQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGC VK+NVL+FWRQHFVLEENML
Sbjct  75   REELRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCRVKANVLSFWRQHFVLEENML  134

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFC EKLE+D  LP +K
Sbjct  135  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLALPQEK  194

Query  478  VAEYRHVLAVLDDLSAEE  531
              E++ +LA+LDDLSAEE
Sbjct  195  ADEFKRILAILDDLSAEE  212



>ref|NP_001169639.1| uncharacterized protein LOC100383520 [Zea mays]
 gb|ACN34367.1| unknown [Zea mays]
 gb|AFW64972.1| hypothetical protein ZEAMMB73_056745 [Zea mays]
Length=692

 Score =   256 bits (655),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            RE  RQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGC VK+NVL+FWRQHFVLEENML
Sbjct  75   REELRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCRVKANVLSFWRQHFVLEENML  134

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFC EKLE+D  LP +K
Sbjct  135  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLALPQEK  194

Query  478  VAEYRHVLAVLDDLSAEE  531
              E++ +LA+LDDLSAEE
Sbjct  195  ADEFKRILAILDDLSAEE  212



>gb|KFK44815.1| hypothetical protein AALP_AA1G306400 [Arabis alpina]
Length=690

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQAV NTLERRLFYIPSFKIYRGVAGL+DYGPPGCAVKSNVL+FWRQHFVLEENM
Sbjct  73   NREAFRQAVVNTLERRLFYIPSFKIYRGVAGLFDYGPPGCAVKSNVLSFWRQHFVLEENM  132

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C EKLE+D  + AD
Sbjct  133  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTEKLEKDLTISAD  192

Query  475  KVAEYRHVLAVLDDLSAE  528
              AE + VLAV++D +A+
Sbjct  193  TAAELKDVLAVMEDYTAQ  210



>dbj|BAE98387.1| glycyl-tRNA synthetase [Arabidopsis thaliana]
Length=519

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFR+AV NTLERRLFYIPSFKIY GVAGL+DYGPPGCA+KSNVL+FWRQHF+LEENM
Sbjct  73   NREAFRKAVVNTLERRLFYIPSFKIYSGVAGLFDYGPPGCAIKSNVLSFWRQHFILEENM  132

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C EKLE+D  + A+
Sbjct  133  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTEKLEKDLTISAE  192

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE + VLAV++D S E+
Sbjct  193  KAAELKDVLAVMEDFSPEQ  211



>ref|XP_006855551.1| hypothetical protein AMTR_s00057p00219540 [Amborella trichopoda]
 gb|ERN17018.1| hypothetical protein AMTR_s00057p00219540 [Amborella trichopoda]
Length=700

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NR+ FRQ V N LERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWR+HFVLEENM
Sbjct  72   NRDDFRQGVVNALERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWREHFVLEENM  131

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  LP +
Sbjct  132  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLEKDLTLPEE  191

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K  EY+ V+A LDDLS +E
Sbjct  192  KAMEYKRVMATLDDLSGKE  210



>ref|XP_004974034.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Setaria 
italica]
Length=692

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            RE  RQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGC VK+NVL+FWRQHFVLEENML
Sbjct  75   REELRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCRVKANVLSFWRQHFVLEENML  134

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EVDCPCVTPE+VLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFC EKLE+D  LP +K
Sbjct  135  EVDCPCVTPEIVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLALPQEK  194

Query  478  VAEYRHVLAVLDDLSAEE  531
              E++ +LA+LDDLSAEE
Sbjct  195  ADEFKRILAILDDLSAEE  212



>ref|XP_003574845.2| PREDICTED: glycine--tRNA ligase 1, mitochondrial [Brachypodium 
distachyon]
Length=739

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            RE  RQ + NTLER+LFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLA WRQHFVLEENML
Sbjct  122  REELRQVIVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLASWRQHFVLEENML  181

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EVDCPCVTPE+VLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFC EKLE+D  L  +K
Sbjct  182  EVDCPCVTPEIVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLTLSPEK  241

Query  478  VAEYRHVLAVLDDLSAEE  531
             AE++HVLAVLDDLS EE
Sbjct  242  AAEFKHVLAVLDDLSPEE  259



>gb|KEH32823.1| glycyl-tRNA synthetase/glycine-tRNA ligase [Medicago truncatula]
Length=856

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +1

Query  97   AAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHF  276
            +A  + +R+AFRQ+V NTLERRLFYIPSFKIY GVAG YDYGPPGCAVKSNVL+FWRQHF
Sbjct  17   SASGSDSRDAFRQSVVNTLERRLFYIPSFKIYCGVAGFYDYGPPGCAVKSNVLSFWRQHF  76

Query  277  VLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERD  456
            VLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKD+CNEKL++D
Sbjct  77   VLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDYCNEKLQKD  136

Query  457  PNLPADKVAEYRHVLAVLDDLSAEE  531
              L +DK AE +HVLA+LDD S++E
Sbjct  137  LTLSSDKAAELKHVLAMLDDFSSQE  161



>ref|XP_006855617.1| hypothetical protein AMTR_s00044p00082740 [Amborella trichopoda]
 gb|ERN17084.1| hypothetical protein AMTR_s00044p00082740 [Amborella trichopoda]
Length=689

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NR+AFRQ V N LERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVL FWR+HFVL ENM
Sbjct  72   NRDAFRQGVVNALERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLGFWREHFVLVENM  131

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  LP +
Sbjct  132  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLEKDLTLPEE  191

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K  EY+ V+A LDDLSA+E
Sbjct  192  KAMEYKRVMATLDDLSAKE  210



>emb|CDY26309.1| BnaA09g26600D [Brassica napus]
Length=690

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQAV NTLERRLFYIP+FKIYRGVAGL+DYGPPGCAVKSNVL+FWRQHF+LEENM
Sbjct  73   NREAFRQAVVNTLERRLFYIPAFKIYRGVAGLFDYGPPGCAVKSNVLSFWRQHFILEENM  132

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C +K+E+D  + A+
Sbjct  133  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTDKVEKDLTISAE  192

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE++ VLAV++D S EE
Sbjct  193  KAAEFKDVLAVMEDYSPEE  211



>ref|XP_002445793.1| hypothetical protein SORBIDRAFT_07g025840 [Sorghum bicolor]
 gb|EES15288.1| hypothetical protein SORBIDRAFT_07g025840 [Sorghum bicolor]
Length=692

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            RE  RQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGC VK+NVL+FWRQHFVLEENML
Sbjct  75   REELRQAVVNTLERKLFYIPSFKIYRGVAGLYDYGPPGCRVKANVLSFWRQHFVLEENML  134

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFC EKLE+D  LP +K
Sbjct  135  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADHLLKDFCKEKLEKDLALPQEK  194

Query  478  VAEYRHVLAVLDDLSAEE  531
              E + +LA+LDDLSAEE
Sbjct  195  ADELKRILAILDDLSAEE  212



>ref|XP_010066465.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Eucalyptus 
grandis]
Length=729

 Score =   255 bits (651),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  97   AAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHF  276
            A   A  REAFR AV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSN+LA+WRQHF
Sbjct  106  AGDGALTREAFRHAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNILAYWRQHF  165

Query  277  VLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERD  456
            V EENMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCNEKL++D
Sbjct  166  VHEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNEKLQKD  225

Query  457  PNLPADKVAEYRHVLAVLDDLSAEE  531
             ++ A+K AE + VLA LDDLSA++
Sbjct  226  LSISAEKAAELKLVLATLDDLSADK  250



>ref|XP_006306915.1| hypothetical protein CARUB_v10008480mg [Capsella rubella]
 gb|EOA39813.1| hypothetical protein CARUB_v10008480mg [Capsella rubella]
Length=690

 Score =   254 bits (649),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFR+AV NTLERRLFYIPSFKIY GVAGL+DYGPPGCA+KSNVL+FWRQHF+LEENM
Sbjct  73   NREAFRKAVVNTLERRLFYIPSFKIYSGVAGLFDYGPPGCAIKSNVLSFWRQHFILEENM  132

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C EKLE+D  + AD
Sbjct  133  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTEKLEKDLTISAD  192

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE + VLAV++D S E+
Sbjct  193  KAAELKDVLAVMEDFSPEQ  211



>ref|XP_002877358.1| hypothetical protein ARALYDRAFT_323159 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53617.1| hypothetical protein ARALYDRAFT_323159 [Arabidopsis lyrata subsp. 
lyrata]
Length=673

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = +1

Query  76   AIDSEMDAA--REAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSN  249
            A++ ++ A+      NREAFRQ V NTLERRLFYIPSFKIY GVAGL+DYGPPGCAVKSN
Sbjct  51   AVEKQLQASIGNGLHNREAFRQNVVNTLERRLFYIPSFKIYGGVAGLFDYGPPGCAVKSN  110

Query  250  VLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKD  429
            VL+FWRQHF+LEENMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKD
Sbjct  111  VLSFWRQHFILEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKD  170

Query  430  FCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +CNEKLE+D  +  +K AE + VLAV++D S E+
Sbjct  171  YCNEKLEKDLTISGEKAAELKDVLAVMEDFSTEQ  204



>gb|KCW64348.1| hypothetical protein EUGRSUZ_G01975 [Eucalyptus grandis]
Length=777

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  97   AAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHF  276
            A   A  REAFR AV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSN+LA+WRQHF
Sbjct  154  AGDGALTREAFRHAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNILAYWRQHF  213

Query  277  VLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERD  456
            V EENMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCNEKL++D
Sbjct  214  VHEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNEKLQKD  273

Query  457  PNLPADKVAEYRHVLAVLDDLSAEE  531
             ++ A+K AE + VLA LDDLSA++
Sbjct  274  LSISAEKAAELKLVLATLDDLSADK  298



>gb|KCW64347.1| hypothetical protein EUGRSUZ_G01975 [Eucalyptus grandis]
Length=778

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +1

Query  97   AAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHF  276
            A   A  REAFR AV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSN+LA+WRQHF
Sbjct  154  AGDGALTREAFRHAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNILAYWRQHF  213

Query  277  VLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERD  456
            V EENMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCNEKL++D
Sbjct  214  VHEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNEKLQKD  273

Query  457  PNLPADKVAEYRHVLAVLDDLSAEE  531
             ++ A+K AE + VLA LDDLSA++
Sbjct  274  LSISAEKAAELKLVLATLDDLSADK  298



>gb|ACN40407.1| unknown [Picea sitchensis]
Length=740

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            A ++EAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK+NV+AFWRQH+VLEE
Sbjct  121  AMSKEAFRQAVNNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKANVIAFWRQHYVLEE  180

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG+CYRADHLLKD+C +KLE+D  L 
Sbjct  181  NMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGMCYRADHLLKDYCKDKLEKDLLLS  240

Query  469  ADKVAEYRHVLAVLDDLSAE  528
             +KV E + VLAVLD+LSAE
Sbjct  241  PEKVNELKQVLAVLDELSAE  260



>ref|XP_010100026.1| Glycine--tRNA ligase 1 [Morus notabilis]
 gb|EXB81197.1| Glycine--tRNA ligase 1 [Morus notabilis]
Length=693

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            A +REAFRQAV NTLERRLFYI SFKIYRGVAGLYDYGPPGCAV+SNVLAFWRQHFVLEE
Sbjct  72   AVSREAFRQAVLNTLERRLFYILSFKIYRGVAGLYDYGPPGCAVRSNVLAFWRQHFVLEE  131

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEV CP VTPE+VLKASGHV+KFTDLMVKDEKTG C+RADHLLKDFCNEKL++D  + 
Sbjct  132  NMLEVHCPSVTPEIVLKASGHVDKFTDLMVKDEKTGTCFRADHLLKDFCNEKLQKDLTIS  191

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
            A+  AE RHVLA LDDLS++E
Sbjct  192  AETAAELRHVLATLDDLSSDE  212



>ref|XP_010667009.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            ++EAFRQ+V NTLER+LF++PSFKIY GVAGLYDYGPPGCAVK NVLAFWRQHFVLEENM
Sbjct  128  SKEAFRQSVLNTLERKLFFVPSFKIYGGVAGLYDYGPPGCAVKQNVLAFWRQHFVLEENM  187

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG C+RADHLLKDFC E LE+D +L A+
Sbjct  188  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCFRADHLLKDFCKETLEKDLSLSAE  247

Query  475  KVAEYRHVLAVLDDLSAEE  531
            KVAE +H+LAVLD+ S+EE
Sbjct  248  KVAELKHILAVLDEFSSEE  266



>gb|AAM64494.1| glycyl tRNA synthetase, putative [Arabidopsis thaliana]
Length=690

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFR+AV NTLERRLFYIPSFKIY GVAGL+DYGPPGCA+KSNVL+FWRQHF+LEENM
Sbjct  73   NREAFRKAVVNTLERRLFYIPSFKIYSGVAGLFDYGPPGCAIKSNVLSFWRQHFILEENM  132

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C EKLE+D  + A+
Sbjct  133  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTEKLEKDLTISAE  192

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE + VLAV++D S E+
Sbjct  193  KAAELKDVLAVMEDFSPEQ  211



>ref|XP_002893587.1| glycyl-tRNA synthetase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69846.1| glycyl-tRNA synthetase [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFR+AV NTLERRLFYIPSFKIY GVAGL+DYGPPGCA+KSNVL+FWRQHF+LEENM
Sbjct  113  NREAFRKAVVNTLERRLFYIPSFKIYSGVAGLFDYGPPGCAIKSNVLSFWRQHFILEENM  172

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C EKLE+D  + A+
Sbjct  173  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTEKLEKDLTISAE  232

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE + VLAV++D S E+
Sbjct  233  KAAELKDVLAVMEDFSPEQ  251



>ref|NP_564337.1| glycyl-tRNA synthetase / glycine--tRNA ligase [Arabidopsis thaliana]
 sp|O23627.1|SYGM1_ARATH RecName: Full=Glycine--tRNA ligase 1, mitochondrial; AltName: 
Full=Diadenosine tetraphosphate synthetase; Short=AP-4-A synthetase; 
AltName: Full=Glycyl-tRNA synthetase 1; Short=GlyRS 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG10608.1|AC008030_8 glycyl-tRNA synthetase [Arabidopsis thaliana]
 emb|CAA05162.1| glycyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AEE31145.1| glycyl-tRNA synthetase / glycine--tRNA ligase [Arabidopsis thaliana]
Length=729

 Score =   253 bits (645),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFR+AV NTLERRLFYIPSFKIY GVAGL+DYGPPGCA+KSNVL+FWRQHF+LEENM
Sbjct  112  NREAFRKAVVNTLERRLFYIPSFKIYSGVAGLFDYGPPGCAIKSNVLSFWRQHFILEENM  171

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C EKLE+D  + A+
Sbjct  172  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTEKLEKDLTISAE  231

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE + VLAV++D S E+
Sbjct  232  KAAELKDVLAVMEDFSPEQ  250



>gb|AAK92832.1| putative glycyl tRNA synthetase [Arabidopsis thaliana]
Length=729

 Score =   253 bits (645),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFR+AV NTLERRLFYIPSFKIY GVAGL+DYGPPGCA+KSNVL+FWRQHF+LEENM
Sbjct  112  NREAFRKAVVNTLERRLFYIPSFKIYSGVAGLFDYGPPGCAIKSNVLSFWRQHFILEENM  171

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKD+C EKLE+D  + A+
Sbjct  172  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDYCTEKLEKDLTISAE  231

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE + VLAV++D S E+
Sbjct  232  KAAELKDVLAVMEDFSPEQ  250



>ref|XP_006415539.1| hypothetical protein EUTSA_v10006931mg [Eutrema salsugineum]
 gb|ESQ33892.1| hypothetical protein EUTSA_v10006931mg [Eutrema salsugineum]
Length=725

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFRQAV NTLERRLFY+PSFKIYRGVAGL+DYGPPGCAVKSNVL+FWRQHF+ EE+M
Sbjct  106  NREAFRQAVVNTLERRLFYMPSFKIYRGVAGLFDYGPPGCAVKSNVLSFWRQHFIREESM  165

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG C+RADHLLKD+C EKLE+D  + A+
Sbjct  166  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCFRADHLLKDYCTEKLEKDLTISAE  225

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE + VLAV++D S EE
Sbjct  226  KAAELKDVLAVMEDYSPEE  244



>ref|XP_002446361.1| hypothetical protein SORBIDRAFT_06g014710 [Sorghum bicolor]
 gb|EES10689.1| hypothetical protein SORBIDRAFT_06g014710 [Sorghum bicolor]
Length=684

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            +R+AFR AVTNTLERRLF++PSFKIY GVAGLYDYGPPGCAVK+NVLAFWRQHFVLEE M
Sbjct  62   SRDAFRAAVTNTLERRLFFVPSFKIYGGVAGLYDYGPPGCAVKANVLAFWRQHFVLEEGM  121

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  L  +
Sbjct  122  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGNCYRADHLLKDFCKDKLEKDHTLSPE  181

Query  475  KVAEYRHVLAVLDDLSAEE  531
             V EY  VLA+LDDLSAE+
Sbjct  182  MVQEYNRVLAILDDLSAEQ  200



>ref|XP_008779554.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like, partial 
[Phoenix dactylifera]
Length=422

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            ++EAFRQAV NTLERRLFYIPSFKIY GVAGLYDYGPPGC VKSNVLAFW QHFVLEE M
Sbjct  43   SKEAFRQAVVNTLERRLFYIPSFKIYSGVAGLYDYGPPGCVVKSNVLAFWHQHFVLEEGM  102

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            + + C CVTPE+VLKASGHV+KFTDLMVKDEKTG+CYRADHLLKD+C  KLE+D  L  D
Sbjct  103  VVMKCSCVTPEIVLKASGHVDKFTDLMVKDEKTGMCYRADHLLKDYCKGKLEKDLTLLPD  162

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE++HV++VLDDLSAEE
Sbjct  163  KAAEFKHVISVLDDLSAEE  181



>ref|XP_006297101.1| hypothetical protein CARUB_v10013104mg [Capsella rubella]
 gb|EOA29999.1| hypothetical protein CARUB_v10013104mg [Capsella rubella]
Length=691

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAFR+AV NTLERRLFYIPSFKIY+GVAG +DYGPPGCA+KSNVL+FWRQHFVLEENM
Sbjct  73   NREAFRKAVVNTLERRLFYIPSFKIYKGVAGFFDYGPPGCAIKSNVLSFWRQHFVLEENM  132

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPE+VLKASGHV+KFTDLMVKD+KTG  YRADHLLKD+C EKLE+D  + AD
Sbjct  133  LEVDCPCVTPELVLKASGHVDKFTDLMVKDKKTGTGYRADHLLKDYCTEKLEKDLTISAD  192

Query  475  KVAEYRHVLAVLDDLSAEE  531
            K AE ++VLAV++D S E+
Sbjct  193  KAAELKNVLAVMEDYSPEQ  211



>ref|XP_004975463.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Setaria 
italica]
Length=684

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            +R+AFR AVTNTLERRLF++PSFKIY GVAGLYDYGPPGCAVK+NVLAFWRQHFVLEE M
Sbjct  62   SRDAFRAAVTNTLERRLFFVPSFKIYGGVAGLYDYGPPGCAVKANVLAFWRQHFVLEEGM  121

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  L  +
Sbjct  122  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGNCYRADHLLKDFCKDKLEKDHTLSPE  181

Query  475  KVAEYRHVLAVLDDLSAEE  531
            +  EY  +LA+LDDLSAE+
Sbjct  182  QTEEYNKILAILDDLSAEQ  200



>ref|XP_008669487.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Zea mays]
 tpg|DAA38045.1| TPA: hypothetical protein ZEAMMB73_567844 [Zea mays]
Length=679

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            +R+AFR AVTNTLERRLF++PSFKIY GVAGLYDYGPPGCAVK+NVLAFWRQHFVLEE M
Sbjct  57   SRDAFRAAVTNTLERRLFFVPSFKIYGGVAGLYDYGPPGCAVKANVLAFWRQHFVLEEGM  116

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  L  +
Sbjct  117  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGNCYRADHLLKDFCKDKLEKDHTLSPE  176

Query  475  KVAEYRHVLAVLDDLSAEE  531
               EY  VLA+LDDL+AE+
Sbjct  177  MAEEYNRVLAILDDLTAEQ  195



>gb|EMS65218.1| Glycyl-tRNA synthetase 1, mitochondrial [Triticum urartu]
Length=1028

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +1

Query  127  FRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVD  306
             RQAV NTLER+LFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVD
Sbjct  1    MRQAVGNTLERKLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVD  60

Query  307  CPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAE  486
            CPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  L  +  AE
Sbjct  61   CPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCKDKLEKDLTLSPETAAE  120

Query  487  YRHVLAVLDDLSAEE  531
            ++ VLAVLDDLS EE
Sbjct  121  FKRVLAVLDDLSREE  135



>ref|XP_008779279.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like, partial 
[Phoenix dactylifera]
Length=725

 Score =   244 bits (624),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
              N+EAFRQAV NTLERRLFYIPSFKIY GVAGLYDYGPPGCAVKSNVLAFWRQHFV  E
Sbjct  505  GSNKEAFRQAVVNTLERRLFYIPSFKIYGGVAGLYDYGPPGCAVKSNVLAFWRQHFVSAE  564

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
             M EV CPC+TPEVVLKASGHV+KFTDLMVKDEKTG+CYRADHLLKD+C  KLE+D  L 
Sbjct  565  RMSEVWCPCLTPEVVLKASGHVDKFTDLMVKDEKTGMCYRADHLLKDYCKGKLEKDLTLS  624

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
             +K AE++HV+ VLDDLSAEE
Sbjct  625  PNKAAEFKHVITVLDDLSAEE  645


 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  352  VEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            V+KFTDLMVKDEKTG CYRADHLLKD+C  KLERD  L  DK AE++HV++VLD+LSAEE
Sbjct  1    VDKFTDLMVKDEKTGTCYRADHLLKDYCKGKLERDLTLSPDKAAEFKHVISVLDNLSAEE  60



>ref|XP_004310250.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=769

 Score =   243 bits (619),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            N+EA RQAV NTLERRLFYIPSFKIY GVAGLYDYGPPGCAVKSNVL FWRQHFVLEENM
Sbjct  149  NKEALRQAVVNTLERRLFYIPSFKIYGGVAGLYDYGPPGCAVKSNVLGFWRQHFVLEENM  208

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDCPCVTPEVVLKASGHV+KFTDLMVKDE++G CYRADHLLKD+C +KLE+D  + ++
Sbjct  209  LEVDCPCVTPEVVLKASGHVDKFTDLMVKDEESGTCYRADHLLKDYCKDKLEKDLRITSE  268

Query  475  KVAEYRHVLAVLDDLSAEE  531
               E + VL+ LD LSAEE
Sbjct  269  MAMELKEVLSKLDVLSAEE  287



>gb|KEH32825.1| glycyl-tRNA synthetase/glycine-tRNA ligase [Medicago truncatula]
Length=704

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 130/158 (82%), Gaps = 1/158 (1%)
 Frame = +1

Query  58   RSHFSPAIDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCA  237
            +S    +++S + A+  + +R+AFR++V NTL+RR FY  SF+IY G AG +DYGPPG A
Sbjct  53   KSSIEKSLESLLSASG-SNSRKAFRKSVVNTLKRRFFYNSSFQIYGGEAGFFDYGPPGSA  111

Query  238  VKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADH  417
            VK NVL+FWRQHF+LEE MLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADH
Sbjct  112  VKYNVLSFWRQHFMLEEKMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGTCYRADH  171

Query  418  LLKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            LLKD+CN+KL+ D  L ++K AE +HVLA+LD  S++E
Sbjct  172  LLKDYCNQKLQEDLTLSSEKAAELKHVLAMLDGFSSQE  209



>emb|CBI29263.3| unnamed protein product [Vitis vinifera]
Length=599

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 114/141 (81%), Gaps = 24/141 (17%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            A NREAFRQAV NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK+NVLAFWRQHFVLEE
Sbjct  4    AVNREAFRQAVANTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKANVLAFWRQHFVLEE  63

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLP  468
            NMLEVDCPCVTPEVVLKASGHV+KFTDLMVKDEKTG CYRADHL+KDF            
Sbjct  64   NMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLVKDF------------  111

Query  469  ADKVAEYRHVLAVLDDLSAEE  531
                        +LDDLSAEE
Sbjct  112  ------------LLDDLSAEE  120



>gb|KHN24948.1| Glycine--tRNA ligase 1, mitochondrial [Glycine soja]
Length=654

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 123/148 (83%), Gaps = 10/148 (7%)
 Frame = +1

Query  88   EMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWR  267
            E+DAA EA N     ++   ++E  L       IYRGVAGL+DYGPPGC+VKSNVL+FWR
Sbjct  38   EIDAAIEALNALKLEKS---SIEHSL-------IYRGVAGLFDYGPPGCSVKSNVLSFWR  87

Query  268  QHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKL  447
            QHFVLEENMLEVDCPCVTPE+VLKASGHV+KFTDLMVKDEKTG CYRADHLLKDFCN+KL
Sbjct  88   QHFVLEENMLEVDCPCVTPEIVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDFCNDKL  147

Query  448  ERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +RD  L +DKVAE +HVLA+LDD SAEE
Sbjct  148  QRDLALSSDKVAELKHVLAMLDDFSAEE  175



>gb|EMT31842.1| Glycyl-tRNA synthetase 1, mitochondrial [Aegilops tauschii]
Length=644

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 127/167 (76%), Gaps = 13/167 (8%)
 Frame = +1

Query  31   PHYTLSSRRRSHFSPAIDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGL  210
            P   L+ R+      A+D++ DA R  +   A ++ V   +E       + +IYRGVAGL
Sbjct  11   PRRALAERQT-----AVDAQADAVRSLKASGA-KEGVDAAVE-------ALRIYRGVAGL  57

Query  211  YDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEK  390
            YDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEK
Sbjct  58   YDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEK  117

Query  391  TGVCYRADHLLKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            TG CYRADHLLKDFC +KLE+D  L  +  AE++ VLAVLDDLS EE
Sbjct  118  TGTCYRADHLLKDFCKDKLEKDLTLSPETAAEFKRVLAVLDDLSPEE  164



>ref|XP_010451601.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like, partial 
[Camelina sativa]
Length=235

 Score =   211 bits (536),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 126/157 (80%), Gaps = 10/157 (6%)
 Frame = +1

Query  91   MDAAREAQ---------NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK  243
            MDA  E Q         +REAFRQ + NTL RR FY+PSFKIY GV+G YDYGPPG A+K
Sbjct  1    MDAPTEQQQPAQLSSGNDREAFRQTLWNTLLRRSFYLPSFKIYGGVSGFYDYGPPGFALK  60

Query  244  SNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLL  423
            +N+L FWR+HFV EE+MLE++CP VTPE VLKASGHV+KFTDLMVKD+KTG C+RADHLL
Sbjct  61   NNILKFWREHFVYEEHMLEIECPSVTPEAVLKASGHVDKFTDLMVKDDKTGTCFRADHLL  120

Query  424  KDFCNEKLERDP-NLPADKVAEYRHVLAVLDDLSAEE  531
            +D+CN+KLE+D   + A++ +E ++VLA+L+DLS +E
Sbjct  121  RDYCNDKLEKDHLTISAEQASELKNVLALLEDLSCQE  157



>ref|XP_006653348.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like, partial 
[Oryza brachyantha]
Length=600

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +1

Query  178  SFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVE  357
            SFKIY GVAGLYDYGPPGCAVK+NVLAFWRQHFVLEE MLEVDCPCVTPEVVLKASGHV+
Sbjct  1    SFKIYGGVAGLYDYGPPGCAVKANVLAFWRQHFVLEEGMLEVDCPCVTPEVVLKASGHVD  60

Query  358  KFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            KFTDLMVKDEKTG CYRADHLLKDFC +KLE+D  L  +K AE+ HVLAVLDDLSAE+
Sbjct  61   KFTDLMVKDEKTGTCYRADHLLKDFCKDKLEKDNTLSPEKAAEFNHVLAVLDDLSAEQ  118



>gb|EMS46310.1| Glycyl-tRNA synthetase 1, mitochondrial [Triticum urartu]
Length=601

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 116/151 (77%), Gaps = 10/151 (7%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFW--------  264
            A NREAFR AV NTLERRLFY+PSFKIY GVAGLYDYGPPG   KS              
Sbjct  2    AGNREAFRVAVGNTLERRLFYVPSFKIYGGVAGLYDYGPPGDRQKSRFSVIEMCTERYPY  61

Query  265  --RQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCN  438
              ++HFVLEE MLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTG CYRADHLLKDFC 
Sbjct  62   DNKKHFVLEEGMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGSCYRADHLLKDFCK  121

Query  439  EKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            EKLE D  L   KV E  H+LAVLDDLSAE+
Sbjct  122  EKLENDNTLSPQKVEELNHILAVLDDLSAEQ  152



>ref|XP_008390393.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Malus 
domestica]
Length=649

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 114/137 (83%), Gaps = 3/137 (2%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRG---VAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLE  300
            RQA+   L+ RLFYIPSFKIY G    AGL+DYGPPG  +K+NVLAFWRQHFVL ENMLE
Sbjct  51   RQAMAKMLQERLFYIPSFKIYDGAAETAGLFDYGPPGVKLKNNVLAFWRQHFVLGENMLE  110

Query  301  VDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKV  480
            V+CP VTPE+VLKASGHV++FTDLMVKDEK G CYR DHLLKDFC EKL++D N+  +K 
Sbjct  111  VECPSVTPEIVLKASGHVDRFTDLMVKDEKNGNCYRXDHLLKDFCTEKLQKDLNIAEEKA  170

Query  481  AEYRHVLAVLDDLSAEE  531
             E +HVLA+LDDLSAEE
Sbjct  171  KELKHVLALLDDLSAEE  187



>ref|XP_010491514.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Camelina 
sativa]
Length=632

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 126/157 (80%), Gaps = 10/157 (6%)
 Frame = +1

Query  91   MDAAREAQ---------NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK  243
            MDA  E Q         +REAFRQ + NTL RR FY+PSFKIY GV+G YDYGPPG A+K
Sbjct  1    MDAPTEQQQPAQLSSGNDREAFRQTLWNTLLRRSFYLPSFKIYGGVSGFYDYGPPGFALK  60

Query  244  SNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLL  423
            +N+L FWR+HFV EE+MLE++CP VTPE VLKASGHVEKFTDLMVKDEKTG C+RADHLL
Sbjct  61   NNILKFWREHFVYEEHMLEIECPSVTPEAVLKASGHVEKFTDLMVKDEKTGTCFRADHLL  120

Query  424  KDFCNEKLERDP-NLPADKVAEYRHVLAVLDDLSAEE  531
            +D+CN+KLE+D   + A++ +E ++VLA+L+DLS +E
Sbjct  121  RDYCNDKLEKDHLTISAEQASELKNVLALLEDLSCQE  157



>ref|XP_010450296.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Camelina 
sativa]
Length=561

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 126/157 (80%), Gaps = 10/157 (6%)
 Frame = +1

Query  91   MDAAREAQ---------NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK  243
            MDA  E Q         +REAFRQ + NTL RR FY+PSFKIY GV+G YDYGPPG A+K
Sbjct  1    MDAPTEQQQPAQLSSGNDREAFRQTLWNTLLRRSFYLPSFKIYGGVSGFYDYGPPGFALK  60

Query  244  SNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLL  423
            +N+L FWR+HFV EE+MLE++CP VTPE VLKASGHV+KFTDLMVKD+KTG C+RADHLL
Sbjct  61   NNILKFWREHFVYEEHMLEIECPSVTPEAVLKASGHVDKFTDLMVKDDKTGTCFRADHLL  120

Query  424  KDFCNEKLERDP-NLPADKVAEYRHVLAVLDDLSAEE  531
            +D+CN+KLE+D   + A++ +E ++VLA+L+DLS +E
Sbjct  121  RDYCNDKLEKDHLTISAEQASELKNVLALLEDLSCQE  157



>ref|XP_010440657.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=632

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 126/157 (80%), Gaps = 10/157 (6%)
 Frame = +1

Query  91   MDAAREAQ---------NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK  243
            MDA  E Q         +REAFRQ + NTL RR FY+PSFKIY GV+G YDYGPPG A+K
Sbjct  1    MDAPTEQQQPAQLSSGNDREAFRQTLWNTLLRRSFYLPSFKIYGGVSGFYDYGPPGFALK  60

Query  244  SNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLL  423
            +N+L FWR+HFV EE+MLE++CP VTPE VLKASGHV+KFTDLMVKD+KTG C+RADHLL
Sbjct  61   NNILKFWREHFVYEEHMLEIECPSVTPEAVLKASGHVDKFTDLMVKDDKTGTCFRADHLL  120

Query  424  KDFCNEKLERDP-NLPADKVAEYRHVLAVLDDLSAEE  531
            +D+CN+KLE+D   + A++ +E ++VLA+L+DLS +E
Sbjct  121  RDYCNDKLEKDHLTISAEQASELKNVLALLEDLSCQE  157



>ref|XP_010440655.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=660

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 127/161 (79%), Gaps = 10/161 (6%)
 Frame = +1

Query  79   IDSEMDAAREAQ---------NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPG  231
            I   MDA  E Q         +REAFRQ + NTL RR FY+PSFKIY GV+G YDYGPPG
Sbjct  25   IQIPMDAPTEQQQPAQLSSGNDREAFRQTLWNTLLRRSFYLPSFKIYGGVSGFYDYGPPG  84

Query  232  CAVKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRA  411
             A+K+N+L FWR+HFV EE+MLE++CP VTPE VLKASGHV+KFTDLMVKD+KTG C+RA
Sbjct  85   FALKNNILKFWREHFVYEEHMLEIECPSVTPEAVLKASGHVDKFTDLMVKDDKTGTCFRA  144

Query  412  DHLLKDFCNEKLERDP-NLPADKVAEYRHVLAVLDDLSAEE  531
            DHLL+D+CN+KLE+D   + A++ +E ++VLA+L+DLS +E
Sbjct  145  DHLLRDYCNDKLEKDHLTISAEQASELKNVLALLEDLSCQE  185



>ref|XP_010495983.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Camelina 
sativa]
Length=634

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
              +REAFRQ + NTL RR FY+PSFKIY GV+G YDYGPPG A+K+N+L FWR+HFV EE
Sbjct  18   GNDREAFRQTLWNTLLRRSFYLPSFKIYGGVSGFYDYGPPGFALKNNILKFWREHFVYEE  77

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDP-NL  465
            +MLE++CP VTPE VLKASGHV+KFTDLMVKD+KTG C+RADHLL+D+CN+KLE+D   +
Sbjct  78   HMLEIECPSVTPEAVLKASGHVDKFTDLMVKDDKTGTCFRADHLLRDYCNDKLEKDHLTI  137

Query  466  PADKVAEYRHVLAVLDDLSAEE  531
             A++ +E ++VLA+L+DLS +E
Sbjct  138  SAEQASELKNVLALLEDLSCQE  159



>ref|XP_002982576.1| hypothetical protein SELMODRAFT_268613 [Selaginella moellendorffii]
 gb|EFJ16329.1| hypothetical protein SELMODRAFT_268613 [Selaginella moellendorffii]
Length=676

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = +1

Query  97   AAREAQNREA--FRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  270
            AA+EA + +   FR+ VTN L+RRLF++ SFKIY GVAGL+DYGPPG AVK NVL+FW Q
Sbjct  44   AAKEAASAQVKNFRETVTNVLKRRLFFVKSFKIYGGVAGLFDYGPPGSAVKDNVLSFWHQ  103

Query  271  HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE  450
            HFV+ +++L+VDCPC+TPE VLKASGHV++FTDLMVKD K G CYRADH++KDF  + LE
Sbjct  104  HFVVYDDLLKVDCPCLTPEAVLKASGHVDRFTDLMVKDVKLGDCYRADHVVKDFVKDALE  163

Query  451  RDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +DP +PA +  +Y   LA LDD +A+E
Sbjct  164  KDPRMPAAQKEDYARTLASLDDFTADE  190



>ref|XP_002981102.1| hypothetical protein SELMODRAFT_268427 [Selaginella moellendorffii]
 gb|EFJ17803.1| hypothetical protein SELMODRAFT_268427 [Selaginella moellendorffii]
Length=676

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 118/147 (80%), Gaps = 2/147 (1%)
 Frame = +1

Query  97   AAREAQNREA--FRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQ  270
            AA+EA + +   FR+ VTN L+RRLF++ SFKIY GVAGL+DYGPPG AVK NVL+FW Q
Sbjct  44   AAKEAASAQVKNFRETVTNVLKRRLFFVKSFKIYGGVAGLFDYGPPGSAVKDNVLSFWHQ  103

Query  271  HFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE  450
            HFV+ +++L+VDCPC+TPE VLKASGHV++FTDLMVKD K G CYRADH++KDF  + LE
Sbjct  104  HFVVYDDLLKVDCPCLTPEAVLKASGHVDRFTDLMVKDVKLGDCYRADHVVKDFVKDALE  163

Query  451  RDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +DP +PA +  +Y   LA LDD +A+E
Sbjct  164  KDPRMPAAQKEDYARTLASLDDFTADE  190



>ref|XP_001781733.1| predicted protein [Physcomitrella patens]
 gb|EDQ53462.1| predicted protein [Physcomitrella patens]
Length=623

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 107/141 (76%), Gaps = 2/141 (1%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            NREAF+  V NTLERRLFYIPS+KIY GVAG YDYGP GC V++NVL  WRQHFV+EE+M
Sbjct  2    NREAFKTLVKNTLERRLFYIPSYKIYGGVAGFYDYGPWGCQVETNVLNLWRQHFVMEEDM  61

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
             E+ CPCVTPEVVLKASGHV+KFTDLMVKD K G C+RADHLLKDF  + LE D  LP  
Sbjct  62   WEIRCPCVTPEVVLKASGHVDKFTDLMVKDLKLGSCFRADHLLKDFLTKALEDDARLPLT  121

Query  475  KVAEYRHV--LAVLDDLSAEE  531
               + R    LA LD+ S  E
Sbjct  122  PEQKLRMQSDLAGLDEFSGPE  142



>ref|XP_003058222.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58173.1| predicted protein [Micromonas pusilla CCMP1545]
Length=683

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 119/160 (74%), Gaps = 12/160 (8%)
 Frame = +1

Query  76   AIDSEMDAAREAQN-----REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAV  240
            A+D E+ AA  A +     +E FR  ++  LE+RLFYIPSFKIY GVAGLYDYGPPGCAV
Sbjct  51   ALDVEVKAAMAAGDEKLAEKENFRNKMSGALEQRLFYIPSFKIYGGVAGLYDYGPPGCAV  110

Query  241  KSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHL  420
            KSN+ AFWRQHFVL E MLE++CP VTPEVVL+ASGHVEKFTDLMVKD  T  C+RADHL
Sbjct  111  KSNLQAFWRQHFVLNEGMLELECPSVTPEVVLQASGHVEKFTDLMVKDVVTKDCFRADHL  170

Query  421  LKDFCNEKLER---DPNLPADKVAEYRHVLAVLDDLSAEE  531
            ++    E LER   DP  PAD+  E   +LA +++ +AEE
Sbjct  171  VE----ENLERILADPMTPADRRRELEDMLARIEEFTAEE  206



>emb|CEF98749.1| S15/NS1, RNA-binding [Ostreococcus tauri]
Length=676

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 118/156 (76%), Gaps = 6/156 (4%)
 Frame = +1

Query  79   IDSEMDAAREAQNREA-----FRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK  243
            ++SE+   +EA N EA     FR  ++  LE RLFYIPSFKIY GVAGLYDYGPPGCAVK
Sbjct  45   LESELATLKEAGNAEAKAKEEFRSKLSGVLEGRLFYIPSFKIYGGVAGLYDYGPPGCAVK  104

Query  244  SNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLL  423
            +NV AFWRQHFVLEE+MLEV+CP VTPE VL+ASGHVEKFTDLMV D +T  CYRADHLL
Sbjct  105  ANVQAFWRQHFVLEESMLEVECPAVTPEPVLRASGHVEKFTDLMVNDVQTKECYRADHLL  164

Query  424  KDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            ++   E+L RDP L AD+  E   + A +D+L  EE
Sbjct  165  EE-KIEELLRDPMLKADRRRELEDLQARIDELKVEE  199



>ref|XP_002964282.1| hypothetical protein SELMODRAFT_230438 [Selaginella moellendorffii]
 gb|EFJ34615.1| hypothetical protein SELMODRAFT_230438 [Selaginella moellendorffii]
Length=604

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  163  LFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKA  342
            +F+  SF IY GVAGL+DYGPPGCAVK+NVL+FWRQHFV+ +++LEVDCPC+TPE VL+A
Sbjct  1    MFFTNSFGIYGGVAGLFDYGPPGCAVKANVLSFWRQHFVVNDDLLEVDCPCLTPEAVLRA  60

Query  343  SGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLS  522
            SGHVEKFTDLMV+D K G C+RADH+LKDF  + LE+DP +PA K  +Y   LA LDD S
Sbjct  61   SGHVEKFTDLMVRDVKEGHCFRADHVLKDFVKDALEKDPRMPAAKRDDYTRTLASLDDFS  120

Query  523  AEE  531
             EE
Sbjct  121  VEE  123



>ref|XP_002499602.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO60860.1| predicted protein [Micromonas sp. RCC299]
Length=670

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 107/138 (78%), Gaps = 1/138 (1%)
 Frame = +1

Query  118  REAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENML  297
            +E FR  +   LE+RLFYIPSFKIY GVAGLYDYGPPGCAVKSN+ AFWRQHFVL E ML
Sbjct  57   KEQFRSKMNGALEQRLFYIPSFKIYGGVAGLYDYGPPGCAVKSNLQAFWRQHFVLNEAML  116

Query  298  EVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADK  477
            EV+CP VTPEVVLKASGHVEKFTDLMV D  T  C+RADHL+++   E++  DP + ADK
Sbjct  117  EVECPSVTPEVVLKASGHVEKFTDLMVNDVVTKDCFRADHLVEENL-ERMLADPMISADK  175

Query  478  VAEYRHVLAVLDDLSAEE  531
              E   +LA L++ + EE
Sbjct  176  RRELEDMLARLEEFTPEE  193



>ref|XP_010460764.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Camelina 
sativa]
Length=654

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  76   AIDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVL  255
            A++  +  +  + N +AFR+AV NTLERRLFY PSF+IY+GVAGLYD G PG  V+ N++
Sbjct  23   AVEVSLQTSLSSGNLDAFRKAVVNTLERRLFYKPSFEIYKGVAGLYDLGAPGFLVELNII  82

Query  256  AFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFC  435
             FWR+ FV EENM EV C  +TPE VLKASGHV+KFTD MV D  TG C+RADHLLKD+C
Sbjct  83   NFWRKFFVREENMAEVRCASLTPEAVLKASGHVDKFTDPMVNDVITGECHRADHLLKDYC  142

Query  436  NEKLERD-PNLPADKVAEYRHVLAVLDDLSAEE  531
             +KLE+D   + A++  E ++VLAVL+DLS E+
Sbjct  143  EKKLEKDAATISAEEADELKNVLAVLEDLSIED  175



>ref|XP_010478362.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Camelina 
sativa]
Length=651

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +1

Query  76   AIDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVL  255
            A++  +  A  + N EAFR+AV NTLERRLFY PSF+IY+GVAGLYD G PG  V+ N++
Sbjct  23   AVEISLQTALSSGNLEAFRKAVVNTLERRLFYKPSFEIYKGVAGLYDLGAPGFLVELNII  82

Query  256  AFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFC  435
             FWR+ FV EENM EV C  +TPE VLKASGHV+KFTD MV D  TG C+RADHLLKD+C
Sbjct  83   NFWRKFFVREENMAEVRCASLTPEAVLKASGHVDKFTDPMVNDVITGECHRADHLLKDYC  142

Query  436  NEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
             +KLE+D +   ++  E ++VLAVL+DLS E+
Sbjct  143  EKKLEKDHS--GEEADELKNVLAVLEDLSIED  172



>ref|XP_010499503.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Camelina 
sativa]
Length=651

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +1

Query  76   AIDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVL  255
            A++  +  A  + N EAFR+AV NTLERRLFY PSF+IY+GVAGLYD G PG  V+ N++
Sbjct  23   AVEISLQTALSSGNLEAFRKAVVNTLERRLFYKPSFEIYKGVAGLYDLGAPGFLVELNII  82

Query  256  AFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFC  435
             FWR+ FV EENM EV C  +TPE VLKASGHV+KFTD MV D  TG C+RADHLLKD+C
Sbjct  83   NFWRKFFVREENMAEVRCASLTPEAVLKASGHVDKFTDPMVNDVITGECHRADHLLKDYC  142

Query  436  NEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
             +KLE+D +   ++  E ++VLAVL+DLS E+
Sbjct  143  EKKLEKDHS--GEEADELKNVLAVLEDLSIED  172



>ref|XP_007513452.1| glycyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO15977.1| glycyl-tRNA synthetase [Bathycoccus prasinos]
Length=698

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 106/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  112  QNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEEN  291
            +++E FR  V N+LE RLFYIPSFKIY GV GLYDYGPPGCAVK+NV   WRQHFV+EE+
Sbjct  70   KSKEDFRVKVANSLESRLFYIPSFKIYGGVGGLYDYGPPGCAVKANVQKIWRQHFVIEES  129

Query  292  MLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPA  471
            MLEV+CP VT   VLKASGHV++FTDLMVKD KT  C+RADHLL D   E+L  DP    
Sbjct  130  MLEVECPSVTLGTVLKASGHVDRFTDLMVKDAKTEECFRADHLLGDRL-EELIADPATRK  188

Query  472  DKVAEYRHVLAVLDDLSAEE  531
            D+ AE+  + A LD+L  EE
Sbjct  189  DEKAEFEMLYARLDELKEEE  208



>gb|KIY99820.1| glycyl-tRNA synthetase, partial [Monoraphidium neglectum]
Length=455

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 106/140 (76%), Gaps = 1/140 (1%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            +Q++EAFR A+TN LERRLFY+PS+KIY  VAG YDYGPPGCA+K+N+   WRQHFVLEE
Sbjct  70   SQSKEAFRAALTNLLERRLFYVPSYKIYGSVAGFYDYGPPGCAIKNNLTQAWRQHFVLEE  129

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLE-RDPNL  465
            NMLEV+CP VTPE+VLKASGHV++FTD MV D KTG  YRADHL++      LE     L
Sbjct  130  NMLEVECPAVTPEIVLKASGHVDRFTDFMVTDLKTGDPYRADHLVEGHLEALLEDTKAPL  189

Query  466  PADKVAEYRHVLAVLDDLSA  525
             AD+  E + +LA + ++  
Sbjct  190  AADEKREVKDLLAGVGEMDG  209



>ref|XP_001418945.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97238.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=677

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 117/156 (75%), Gaps = 6/156 (4%)
 Frame = +1

Query  79   IDSEMDAAREAQNREA-----FRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVK  243
            ++ +++A +EA N EA     FR  +   LE RLFYIPSFKIY GVAGLYDYGPPGCAVK
Sbjct  45   LEKDLNALKEAGNAEAKAKEEFRAKLGQLLEGRLFYIPSFKIYGGVAGLYDYGPPGCAVK  104

Query  244  SNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLL  423
            SNV  FWRQHFVLEE+MLEV+CP VTPE VL+ASGHVEKFTDLMV D  T  C+RADHLL
Sbjct  105  SNVQQFWRQHFVLEESMLEVECPAVTPEPVLRASGHVEKFTDLMVNDVVTKDCFRADHLL  164

Query  424  KDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            ++   E+L RDP L AD+  E   + A +D+L+ E+
Sbjct  165  EEV-VEELLRDPMLKADRRRELEDLQACIDELNVEQ  199



>ref|XP_001702190.1| hypothetical protein CHLREDRAFT_82920 [Chlamydomonas reinhardtii]
 gb|EDO97121.1| predicted protein [Chlamydomonas reinhardtii]
Length=695

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            +Q++EA R A+   LERR+FYIPSFKIY  VAG YDYGPPGCA+K N+   WR HFVLEE
Sbjct  73   SQSKEALRAALAGVLERRMFYIPSFKIYGSVAGFYDYGPPGCAIKQNMTQVWRTHFVLEE  132

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPN-L  465
            NMLEV+CP VTPEVVLKASGHV++FTD MV D  TG C+RADHLL+      LE   N +
Sbjct  133  NMLEVECPAVTPEVVLKASGHVDRFTDFMVTDVVTGECFRADHLLEGHLEALLEDKKNPV  192

Query  466  PADKVAEYRHVLAVLDDLSAE  528
              +K  E R +LA + +L A+
Sbjct  193  SPEKAKEIRDLLAGVGELKAD  213



>ref|XP_002953140.1| hypothetical protein VOLCADRAFT_75635 [Volvox carteri f. nagariensis]
 gb|EFJ45739.1| hypothetical protein VOLCADRAFT_75635 [Volvox carteri f. nagariensis]
Length=692

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +1

Query  109  AQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEE  288
            AQ++EA R A+   LERR+FYIPSFKIY  VAG YDYGPPGCA+K N+   WR HFVLEE
Sbjct  70   AQSKEALRAALAGVLERRMFYIPSFKIYGSVAGFYDYGPPGCAIKQNMTQTWRNHFVLEE  129

Query  289  NMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPN-L  465
            NMLEV+CP VTPE+VLKASGHV++FTD MV D  TG C+RADHLL+      LE   N +
Sbjct  130  NMLEVECPAVTPEIVLKASGHVDRFTDFMVTDVATGECFRADHLLEGHLEALLEDKKNPV  189

Query  466  PADKVAEYRHVLAVLDDL  519
              +K  E R +LA + +L
Sbjct  190  SPEKAREIRELLASVGEL  207



>gb|KDD74333.1| class II core domain (G, H, P, S and T) tRNA synthetase, partial 
[Helicosporidium sp. ATCC 50920]
Length=521

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 105/147 (71%), Gaps = 1/147 (1%)
 Frame = +1

Query  88   EMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWR  267
            E +AA  +  REAFRQ V N LERRLF+IPSFKIY  VAGLYDYGPPGC +K+NV   WR
Sbjct  63   EYEAATGSGTREAFRQNVLNALERRLFFIPSFKIYGSVAGLYDYGPPGCGIKANVTQAWR  122

Query  268  QHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKL  447
            QHFVLEE MLEV+CP VTP  VLKASGHV++F D MV D+ TG C+RADHLL+    E++
Sbjct  123  QHFVLEEGMLEVECPAVTPAAVLKASGHVDRFVDYMVSDKATGECHRADHLLEAEL-ERV  181

Query  448  ERDPNLPADKVAEYRHVLAVLDDLSAE  528
              D    A    E + +LA + +L AE
Sbjct  182  IADAKTEAGSRREAQDLLARVGELGAE  208



>ref|XP_010437044.1| PREDICTED: glycine--tRNA ligase 1, mitochondrial-like [Camelina 
sativa]
Length=659

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 108/137 (79%), Gaps = 1/137 (1%)
 Frame = +1

Query  121  EAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLE  300
            EAFRQAV N LERR FY PSF IY GVAGL DYGP G  V+ NVL+ WR++FV EE+MLE
Sbjct  51   EAFRQAVANILERRSFYNPSFDIYGGVAGLLDYGPSGRLVELNVLSLWRKYFVNEEDMLE  110

Query  301  VDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKV  480
            V C  +TPE+V  ASGHV+KFTDLMVKDE TG  +RADHL+K +C E+ ++D ++ A+K 
Sbjct  111  VGCSALTPEIVFNASGHVKKFTDLMVKDEITGAFHRADHLIKGYC-ERRKKDVSISAEKA  169

Query  481  AEYRHVLAVLDDLSAEE  531
            AE+ ++LA ++DLSAEE
Sbjct  170  AEFDNLLAAVEDLSAEE  186



>ref|XP_011402058.1| Glycine-tRNA ligase 1, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM29009.1| Glycine-tRNA ligase 1, mitochondrial [Auxenochlorella protothecoides]
Length=694

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  112  QNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEEN  291
            Q+RE+FR  V N LER+LF IPSFKIY  VAG YDYGPPGCA+KSNV   WRQHFVLEE 
Sbjct  74   QSRESFRANVVNALERKLFVIPSFKIYGSVAGFYDYGPPGCAIKSNVTQAWRQHFVLEEG  133

Query  292  MLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPA  471
            MLEV+CP VTPE+VLKASGHVE+FTD MV D KTG C+RADHLL+       E     PA
Sbjct  134  MLEVECPAVTPEIVLKASGHVERFTDFMVTDVKTGDCHRADHLLEAALEAVFEGRTTPPA  193

Query  472  DK  477
             +
Sbjct  194  GE  195



>ref|XP_005850566.1| hypothetical protein CHLNCDRAFT_34068 [Chlorella variabilis]
 gb|EFN58464.1| hypothetical protein CHLNCDRAFT_34068 [Chlorella variabilis]
Length=696

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 106/142 (75%), Gaps = 5/142 (4%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            N+EAFR A+ N LERRLF+IPSFKIY  VAG YDYGPPGCA+K NV   WR HF+LEENM
Sbjct  73   NKEAFRSAMLNALERRLFFIPSFKIYGSVAGFYDYGPPGCAMKQNVTQTWRNHFILEENM  132

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKL--ERDPNLP  468
            LE++CP VTPE+VLKASGHVE+FTD MV D KTG C+RADHLL+      L   ++P  P
Sbjct  133  LELECPAVTPEIVLKASGHVERFTDFMVTDVKTGDCHRADHLLEGALEALLEDRKNPASP  192

Query  469  -ADKVAEYRHVLAVLDDLSAEE  531
             A K A  R +LA + +L AEE
Sbjct  193  EAAKAA--RDLLARVGELGAEE  212



>ref|XP_002868880.1| hypothetical protein ARALYDRAFT_352903 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45139.1| hypothetical protein ARALYDRAFT_352903 [Arabidopsis lyrata subsp. 
lyrata]
Length=679

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +1

Query  121  EAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLE  300
            EAFRQAV N LERRLFY PSF IY G+ GL DYGP G  V+ NVL+ WR+ FV EE+MLE
Sbjct  62   EAFRQAVGNILERRLFYNPSFDIYGGITGLLDYGPSGRLVELNVLSLWRKFFVNEEDMLE  121

Query  301  VDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKV  480
            V C  +TPE+V  ASGHV+KFTDLMVKDE  G  +RADHL+K +C E  ++D  + A+K 
Sbjct  122  VGCSALTPEIVFNASGHVKKFTDLMVKDEVNGAFHRADHLVKGYC-ESRKKDVTISAEKA  180

Query  481  AEYRHVLAVLDDLSAEE  531
            AE  +VLAV++DLSAEE
Sbjct  181  AELDNVLAVVEDLSAEE  197



>ref|XP_010468097.1| PREDICTED: LOW QUALITY PROTEIN: putative glycine--tRNA ligase, 
cytoplasmic [Camelina sativa]
Length=383

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 106/137 (77%), Gaps = 2/137 (1%)
 Frame = +1

Query  121  EAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLE  300
            EAFRQAV N LE+R FY PSF IY GVAGL DYGP G  V+ NVL+FWR++FV  E+MLE
Sbjct  60   EAFRQAVANILEKRSFYNPSFDIYGGVAGLLDYGPSGRLVELNVLSFWRKYFV-NEDMLE  118

Query  301  VDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKV  480
            V C  +TPE+V  ASGHV+KFTDLMVKDE TG  +RADHL+K +C E+ ++D ++  +K 
Sbjct  119  VGCSALTPEIVFNASGHVKKFTDLMVKDEITGAFHRADHLIKGYC-ERRKKDVSISDEKS  177

Query  481  AEYRHVLAVLDDLSAEE  531
            AE  ++LAV +DLSAEE
Sbjct  178  AELDNLLAVAEDLSAEE  194



>gb|EFA82757.1| glycyl-tRNA synthetase [Polysphondylium pallidum PN500]
Length=643

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  V + ++RR F  P+F+IY GVAGLYDYGPPGCA+K+N++ FWRQHF L E+MLEVDC
Sbjct  34   RAGVEDLMKRRFFITPAFQIYGGVAGLYDYGPPGCAIKANLINFWRQHFALNEDMLEVDC  93

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE+VLK SGHV KF D MVKDE TG+CYRADH+L+    EKL    ++  +K AEY
Sbjct  94   TALTPEIVLKTSGHVAKFADFMVKDEVTGMCYRADHILEAHV-EKLLEGKDVNEEKKAEY  152

Query  490  RHVLAVLDDLSAEE  531
            +HVLA   D   EE
Sbjct  153  KHVLARAGDAGQEE  166



>ref|XP_003292434.1| hypothetical protein DICPUDRAFT_157146 [Dictyostelium purpureum]
 gb|EGC31046.1| hypothetical protein DICPUDRAFT_157146 [Dictyostelium purpureum]
Length=686

 Score =   173 bits (438),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = +1

Query  103  REAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVL  282
            +  +N+E  R  +   ++RR F  P+F+IYRGVAGLYDYGPPGCAVK+N++ +WRQHFVL
Sbjct  66   KNMENKEKIRNGLEELMKRRFFITPAFQIYRGVAGLYDYGPPGCAVKANLINYWRQHFVL  125

Query  283  EENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPN  462
             E+M EVDC  VTPE+VLK SGHV KF+D MVKDE T + +RADH+L+    EKL  D  
Sbjct  126  NEDMSEVDCTSVTPEIVLKTSGHVAKFSDFMVKDEVTKLYFRADHVLEGHI-EKLLLDTK  184

Query  463  LPADKVAEYRHVLAVLDDLSAEE  531
            L  DKV E +HVL    D + +E
Sbjct  185  LTEDKVKELKHVLTKAGDYNQQE  207



>ref|XP_002989527.1| hypothetical protein SELMODRAFT_269525 [Selaginella moellendorffii]
 gb|EFJ09403.1| hypothetical protein SELMODRAFT_269525 [Selaginella moellendorffii]
Length=597

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 95/123 (77%), Gaps = 7/123 (6%)
 Frame = +1

Query  163  LFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKA  342
            +F+  SF IY GVAGL+DYGPPGCAVK+N       HFV+ +++LEVDCPC+TPE VL+A
Sbjct  1    MFFTNSFGIYGGVAGLFDYGPPGCAVKAN-------HFVVNDDLLEVDCPCLTPEAVLRA  53

Query  343  SGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLS  522
            SGHVEKFTDLMV+D K G C+RADH+LKDF  + LE+DP +PA K  +Y   LA LDD S
Sbjct  54   SGHVEKFTDLMVRDVKEGHCFRADHVLKDFLKDALEKDPRMPAAKRDDYTRTLASLDDFS  113

Query  523  AEE  531
            AEE
Sbjct  114  AEE  116



>ref|XP_005644380.1| glycyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE19836.1| glycyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=637

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = +1

Query  124  AFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEV  303
            A ++  TN LERRLF+IPSFKIY  VAG YD+GPPGCA+K NV   WRQHF+LEE+MLEV
Sbjct  20   AVKEGSTNVLERRLFFIPSFKIYGSVAGFYDFGPPGCAIKQNVTQLWRQHFILEESMLEV  79

Query  304  DCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDP--NLPADK  477
            +CP VTPE VLKASGHV++FTD MV D KTG C+RADHLLK    E L  DP   L  +K
Sbjct  80   ECPAVTPEAVLKASGHVDRFTDFMVTDAKTGDCHRADHLLKA-ALEALLEDPKAGLMPEK  138

Query  478  VAEYRHVLAVLDDL  519
             +E   VLA +D+L
Sbjct  139  KSEAEDVLARIDEL  152



>gb|EWM21480.1| glycyl-trna synthetase [Nannochloropsis gaditana]
Length=728

 Score =   167 bits (422),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 111/157 (71%), Gaps = 5/157 (3%)
 Frame = +1

Query  76   AIDSEMDAAREA-----QNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAV  240
            A+ +E DAAR+A      ++   R A  + ++R++F + +F+I+ GV GL+D GP  CA+
Sbjct  47   ALRAEFDAARKAADGNNTDKPFNRAAFDDLVKRKMFVVSAFEIHGGVGGLFDLGPASCAL  106

Query  241  KSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHL  420
            K+N+L  WRQHF+LEENMLE++C C+TPEVVLK SGHVEKFTDLMVKDE TG C+RAD L
Sbjct  107  KANILDVWRQHFILEENMLEMECTCLTPEVVLKTSGHVEKFTDLMVKDESTGDCHRADKL  166

Query  421  LKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            L+DF +  LE +P L  ++  E+R V    D  + EE
Sbjct  167  LEDFIDSFLESNPTLSREEQDEHRRVQRQADAYTPEE  203



>dbj|GAM27924.1| hypothetical protein SAMD00019534_111000 [Acytostelium subglobosum 
LB1]
Length=627

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 100/140 (71%), Gaps = 2/140 (1%)
 Frame = +1

Query  115  NREA-FRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEEN  291
            N+E   R  V + ++RR F  P+F+IY GVAGLYDYGPPGCA+K+N++++WRQHF   E+
Sbjct  9    NKEVNIRAGVEDLMKRRFFITPAFQIYGGVAGLYDYGPPGCAIKANLISYWRQHFANYED  68

Query  292  MLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPA  471
            MLE+DC  +TPE+VLK SGHV KF D +VKD  TG CYRADHLL+    EKL  D  L  
Sbjct  69   MLEIDCTALTPEIVLKTSGHVAKFADFVVKDTVTGACYRADHLLEGHI-EKLLVDKTLSE  127

Query  472  DKVAEYRHVLAVLDDLSAEE  531
            +K+ EY+H+L+   D   +E
Sbjct  128  EKIKEYKHILSRAGDAPQDE  147



>ref|XP_004356903.1| glycyl-tRNA synthetase [Dictyostelium fasciculatum]
 gb|EGG18010.1| glycyl-tRNA synthetase [Dictyostelium fasciculatum]
Length=683

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 98/135 (73%), Gaps = 2/135 (1%)
 Frame = +1

Query  115  NREAF-RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEEN  291
            +++AF R  + + ++RR F  P+F+IY GVAGLYDYGPPGCA+K+N++  WRQHFV+ E+
Sbjct  58   SQQAFSRAGLEDLMKRRFFITPAFEIYGGVAGLYDYGPPGCAIKANLINLWRQHFVINED  117

Query  292  MLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPA  471
            MLEVDC  +TPEVVLK SGHV KF D MVKDE T  CYRADHLL+   ++ LE D  + A
Sbjct  118  MLEVDCTSLTPEVVLKTSGHVAKFADFMVKDEITKQCYRADHLLEQHIDKLLE-DKKITA  176

Query  472  DKVAEYRHVLAVLDD  516
            ++  E  HV A   D
Sbjct  177  ERKEELTHVRAKAGD  191



>ref|XP_005707414.1| glycyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME30894.1| glycyl-tRNA synthetase [Galdieria sulphuraria]
Length=1249

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R+A+   L+RR F  PSF+IY GVAGLYDYGPPG AVK+N++  WRQHFV+EENMLE++ 
Sbjct  640  REALEGLLKRRFFIAPSFEIYGGVAGLYDYGPPGTAVKNNIIQLWRQHFVVEENMLELEG  699

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
             C+TP++VL+ASGHV+KF+D++VKD +TG C+RADHLLK+  N KL +D NL  +K    
Sbjct  700  SCLTPDIVLRASGHVDKFSDMLVKDIETGDCFRADHLLKEQLN-KLLQDSNLSVEKRELA  758

Query  490  RHVLAVLDDLSAEE  531
               L  +D++  +E
Sbjct  759  ETTLTTIDEIDLDE  772



>ref|XP_010765453.1| PREDICTED: glycine--tRNA ligase-like [Notothenia coriiceps]
Length=285

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  62   RVKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQVWRQHFIQEEQILEIDC  121

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD KTG CYRADHLLK    ++L  D    A+K AE 
Sbjct  122  TMLTPEPVLKTSGHVDKFADYMVKDAKTGECYRADHLLKAHL-KQLMSDNKCSAEKAAEL  180

Query  490  RHVLAVLDDLSAEE  531
              V+  +D+ + +E
Sbjct  181  EDVITQMDNYTQQE  194



>ref|XP_008295957.1| PREDICTED: glycine--tRNA ligase-like [Stegastes partitus]
Length=343

 Score =   157 bits (396),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  62   RVKLDDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQAWRQHFIQEEQILEIDC  121

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD KTG CYRADHLLK    +KL  D    A+KV E 
Sbjct  122  TMLTPEPVLKTSGHVDKFADYMVKDAKTGECYRADHLLKAHL-KKLMSDEKCSAEKVTEM  180

Query  490  RHVLAVLDDLSAEE  531
              V+  +D+ + +E
Sbjct  181  EDVITQMDNYTQQE  194



>ref|NP_174280.2| putative glycine--tRNA ligase [Arabidopsis thaliana]
 sp|Q9FXG2.2|SYGC_ARATH RecName: Full=Putative glycine--tRNA ligase, cytoplasmic; AltName: 
Full=Diadenosine tetraphosphate synthetase; Short=AP-4-A 
synthetase; AltName: Full=Glycyl-tRNA synthetase; Short=GlyRS 
[Arabidopsis thaliana]
 gb|AEE31144.1| putative glycine--tRNA ligase [Arabidopsis thaliana]
Length=463

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 102/140 (73%), Gaps = 1/140 (1%)
 Frame = +1

Query  112  QNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEEN  291
            ++RE FR+AV  TL+R LF   SF IY GVAGLYD+GP G  V+ N+L+ WR+ FV EE+
Sbjct  55   KDREDFREAVVKTLDRLLFVHKSFDIYHGVAGLYDFGPHGRTVELNILSLWRKCFVDEED  114

Query  292  MLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPA  471
            M+EV C  +TPE V  ASGHV+KFTDLMVKDE  G  +RADHL+K +C E  ++DP + A
Sbjct  115  MMEVACTALTPEAVFNASGHVKKFTDLMVKDEVDGAFHRADHLVKSYC-ENRKKDPTISA  173

Query  472  DKVAEYRHVLAVLDDLSAEE  531
            +  AE   V+A ++DLSAEE
Sbjct  174  ENAAELDKVIAHVEDLSAEE  193



>gb|AAG10609.1|AC008030_9 Putative glycyl-tRNA synthetase [Arabidopsis thaliana]
Length=464

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 102/140 (73%), Gaps = 1/140 (1%)
 Frame = +1

Query  112  QNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEEN  291
            ++RE FR+AV  TL+R LF   SF IY GVAGLYD+GP G  V+ N+L+ WR+ FV EE+
Sbjct  55   KDREDFREAVVKTLDRLLFVHKSFDIYHGVAGLYDFGPHGRTVELNILSLWRKCFVDEED  114

Query  292  MLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPA  471
            M+EV C  +TPE V  ASGHV+KFTDLMVKDE  G  +RADHL+K +C E  ++DP + A
Sbjct  115  MMEVACTALTPEAVFNASGHVKKFTDLMVKDEVDGAFHRADHLVKSYC-ENRKKDPTISA  173

Query  472  DKVAEYRHVLAVLDDLSAEE  531
            +  AE   V+A ++DLSAEE
Sbjct  174  ENAAELDKVIAHVEDLSAEE  193



>emb|CAF89444.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=291

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  14   RAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPMGCALKNNILQVWRQHFIQEEQILEIDC  73

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  74   TMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  132

Query  490  RHVLAVLDDLSAEE  531
              V+  +D+ + EE
Sbjct  133  EEVITQMDNYTQEE  146



>ref|XP_001637887.1| predicted protein [Nematostella vectensis]
 gb|EDO45824.1| predicted protein [Nematostella vectensis]
Length=681

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 104/142 (73%), Gaps = 2/142 (1%)
 Frame = +1

Query  109  AQNREAF-RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLE  285
            A   E+F R  + + L+RR F++P+F+IY GVAGLYDYGP GCA++SNV+  W++HF+LE
Sbjct  59   APQDESFDRGKLEDLLKRRFFFVPAFEIYGGVAGLYDYGPAGCAMESNVINLWKKHFILE  118

Query  286  ENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNL  465
            E+MLE+    +TP  VLKASGHV++F D+MVKD KTG CYRADHLL+    EKL  D  L
Sbjct  119  EHMLEIRAALLTPHPVLKASGHVDRFADVMVKDVKTGDCYRADHLLEGHL-EKLMADKKL  177

Query  466  PADKVAEYRHVLAVLDDLSAEE  531
            P DK  EY+ VL  +D+ + +E
Sbjct  178  PEDKRNEYQSVLNKIDNYNMQE  199



>ref|XP_011487263.1| PREDICTED: glycine--tRNA ligase [Oryzias latipes]
Length=749

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  131  RSKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQAWRQHFIQEEQILEIDC  190

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHVEKF D MVKD K G C+RADHLLK F  +KL  D    ADK AE 
Sbjct  191  TMLTPEPVLKTSGHVEKFADYMVKDVKNGECFRADHLLKAFL-QKLMSDKKCSADKKAEM  249

Query  490  RHVLAVLDDLSAEE  531
              V+  LD+ S +E
Sbjct  250  ESVIVQLDNYSQQE  263



>ref|XP_006283325.1| hypothetical protein CARUB_v10004365mg [Capsella rubella]
 gb|EOA16223.1| hypothetical protein CARUB_v10004365mg [Capsella rubella]
Length=631

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +1

Query  121  EAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLE  300
            EAFR+A+   L+ R F  PSF IY+GV GL DYGP G  V+ NVL+ WR++FV EE+MLE
Sbjct  23   EAFRKALAIILKERSFSYPSFDIYKGVTGLLDYGPSGRLVELNVLSLWRKYFVNEEDMLE  82

Query  301  VDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKV  480
            V C  +TPE+V  ASGHV+KFTDLMVKD   G  +RADHL+K +C E+L++D  + A+K 
Sbjct  83   VGCTALTPEIVFNASGHVKKFTDLMVKDVINGKNHRADHLVKGYC-ERLKKDVTISAEKA  141

Query  481  AEYRHVLAVLDDLSAEE  531
            AE  ++L+V+++LSAEE
Sbjct  142  AELDNLLSVVENLSAEE  158



>gb|EMP29421.1| Glycyl-tRNA synthetase [Chelonia mydas]
Length=367

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 112/190 (59%), Gaps = 16/190 (8%)
 Frame = +1

Query  7    HYRIGIFYPHYTLSSRRRSHFSPAID-----SEMDA----------AREAQNREAFRQAV  141
            H R     P   L  + +   +P +D     +E+ A          A + ++    R  +
Sbjct  30   HLRFSCVLPQGELVRKLKEEKAPQVDVDRAVAELKARKRILEAKELALQPKDDIVDRTKM  89

Query  142  TNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVT  321
             +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ E+ +LE+DC  +T
Sbjct  90   EDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEDQILEIDCTMLT  149

Query  322  PEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEYRHVL  501
            PE VLK SGHVEKF D MVKD K G C+RADHLLK    +KL  D    A+K  E  +VL
Sbjct  150  PEPVLKTSGHVEKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKTEMENVL  208

Query  502  AVLDDLSAEE  531
              LD+ S +E
Sbjct  209  TQLDNYSQQE  218



>ref|XP_003585085.2| PREDICTED: glycine--tRNA ligase-like [Bos taurus]
Length=125

 Score =   147 bits (371),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 1/120 (1%)
 Frame = +1

Query  145  NTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVTP  324
            +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC  +TP
Sbjct  3    DTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTP  62

Query  325  EVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEYRHVLA  504
            E VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K +E   VLA
Sbjct  63   EPVLKTSGHVDKFADFMVKDLKNGECFRADHLLKAHL-QKLMSDKKCSAEKKSEMESVLA  121



>gb|AJO66533.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
Length=273

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR+HF+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKHFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>ref|XP_009039546.1| hypothetical protein AURANDRAFT_30354, partial [Aureococcus anophagefferens]
 gb|EGB05707.1| hypothetical protein AURANDRAFT_30354, partial [Aureococcus anophagefferens]
Length=226

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 103/163 (63%), Gaps = 5/163 (3%)
 Frame = +1

Query  43   LSSRRRSHFSPAIDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYG  222
            L + R    +  +  E D    + NR+ F + V     RR+F +P+F+I+ GV GL+D G
Sbjct  18   LHTLRNDLAAATVALESDEFENSLNRKLFDETVL----RRMFVVPAFEIHGGVTGLFDLG  73

Query  223  PPGCAVKSNVLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVC  402
            PPGCA+K+NV+  WR+HFVLEE MLE++C C+TPE VLK SGHV++FTDLMVKD +TG C
Sbjct  74   PPGCALKANVVDMWRRHFVLEEKMLEMECTCLTPEPVLKTSGHVDRFTDLMVKDIETGDC  133

Query  403  YRADHLLKDFCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            YRAD LL+D  +  L      P     E+R V    D  S EE
Sbjct  134  YRADKLLEDHIDALLNGGTVAPT-TAEEHRKVQRQADAYSPEE  175



>gb|AEB61024.1| glycyl-tRNA synthetase-like protein, partial [Equus caballus]
Length=335

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  15   RAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDC  74

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K +E 
Sbjct  75   TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCSAEKKSEM  133

Query  490  RHVLAVLDDLSAEE  531
              VLA LD+   +E
Sbjct  134  ESVLAQLDNHGQQE  147



>ref|XP_010751960.1| PREDICTED: glycine--tRNA ligase-like [Larimichthys crocea]
Length=738

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  122  RVKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQVWRQHFIQEEQILEIDC  181

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD KTG CYRADHLLK    +KL  D    A+KVAE 
Sbjct  182  TMLTPEPVLKTSGHVDKFADYMVKDAKTGECYRADHLLKAHL-KKLMSDEKCSAEKVAEM  240

Query  490  RHVLAVLDDLSAEE  531
              V+  +D+ + +E
Sbjct  241  DDVITQMDNYTQQE  254



>ref|XP_007066625.1| PREDICTED: glycine--tRNA ligase [Chelonia mydas]
Length=411

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ E+ +LE+DC
Sbjct  98   RTKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEDQILEIDC  157

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHVEKF D MVKD K G C+RADHLLK    +KL  D    A+K  E 
Sbjct  158  TMLTPEPVLKTSGHVEKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKTEM  216

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+ S +E
Sbjct  217  ENVLTQLDNYSQQE  230



>gb|KFV89732.1| Glycine--tRNA ligase, partial [Fulmarus glacialis]
Length=379

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RVKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKRAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>gb|AJO66493.1| glycyl-tRNA synthetase, partial [Heliconius egeria]
Length=223

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  55   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  114

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  115  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  173

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  174  EDILVKLDGMTADE  187



>gb|AJO66523.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
Length=270

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N+ A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNMKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|ADI80823.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80825.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80826.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80827.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80839.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|AJO66524.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
Length=273

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N+ A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNMKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>ref|XP_009586419.1| PREDICTED: glycine--tRNA ligase, partial [Fulmarus glacialis]
Length=420

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RVKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKRAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>gb|AJO66526.1| glycyl-tRNA synthetase, partial [Heliconius hierax]
Length=272

 Score =   150 bits (379),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N+ A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNMKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66484.1| glycyl-tRNA synthetase, partial [Heliconius cydno weymeri]
Length=226

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  20   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  79

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  80   SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  138

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  139  EDILVKLDGMTADE  152



>gb|AJO66525.1| glycyl-tRNA synthetase, partial [Heliconius hierax]
Length=273

 Score =   150 bits (379),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N+ A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNMKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66499.1| glycyl-tRNA synthetase, partial [Heliconius erato demophoon]
Length=243

 Score =   149 bits (376),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  44   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  103

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  104  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  162

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  163  EDILVKLDGMTADE  176



>ref|XP_010126389.1| PREDICTED: glycine--tRNA ligase, partial [Chlamydotis macqueenii]
Length=665

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RVKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD KTG C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKTGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>gb|KFP45624.1| Glycine--tRNA ligase, partial [Chlamydotis macqueenii]
Length=665

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RVKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD KTG C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKTGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>gb|AJO66516.1| glycyl-tRNA synthetase, partial [Heliconius hecalesia]
Length=236

 Score =   149 bits (375),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNAKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66480.1| glycyl-tRNA synthetase, partial [Heliconius cydno alithea]
Length=258

 Score =   149 bits (377),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  52   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  111

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  112  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  170

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  171  EDILVKLDGMTADE  184



>gb|AAH96883.1| Si:dkey-276i5.1 protein [Danio rerio]
Length=764

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  146  RTKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQVWRQHFIQEEQILEIDC  205

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D   PA+K AE 
Sbjct  206  TMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHL-QKLMSDKKCPAEKKAEM  264

Query  490  RHVLAVLDDLSAEE  531
             +V+  +D+ + +E
Sbjct  265  DNVITQMDNYTQQE  278



>ref|XP_008579391.1| PREDICTED: glycine--tRNA ligase, partial [Galeopterus variegatus]
Length=408

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  67   RAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQIWRQHFIQEEQILEIDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K +E 
Sbjct  127  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCSAEKKSEM  185

Query  490  RHVLAVLDDLSAEE  531
              VLA L++   +E
Sbjct  186  ESVLAQLENYGQQE  199



>gb|AJO66522.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
Length=260

 Score =   149 bits (376),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  54   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  113

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  114  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  172

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  173  EDILVKLDGMTADE  186



>gb|AJO66541.1| glycyl-tRNA synthetase, partial [Heliconius pachinus]
Length=250

 Score =   149 bits (376),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>ref|XP_009874724.1| PREDICTED: glycine--tRNA ligase, partial [Apaloderma vittatum]
Length=492

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RAKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>ref|XP_007909967.1| PREDICTED: glycine--tRNA ligase [Callorhinchus milii]
Length=686

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  68   RAKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNMLQLWRQHFIQEEQILEIDC  127

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    EKL  D    A+K  E 
Sbjct  128  TMLTPEAVLKTSGHVDKFADYMVKDGKNGECFRADHLLKAHL-EKLMSDKKCSAEKKTEM  186

Query  490  RHVLAVLDDLSAEE  531
             +V+  +D+ S +E
Sbjct  187  ENVIVQMDNYSQQE  200



>gb|KFP79239.1| Glycine--tRNA ligase, partial [Apaloderma vittatum]
Length=492

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RAKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>ref|XP_009295729.1| PREDICTED: glycine--tRNA ligase [Danio rerio]
Length=779

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 96/134 (72%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  161  RTKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQVWRQHFIQEEQILEIDC  220

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D   PA+K AE 
Sbjct  221  TMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHL-QKLMSDKKCPAEKKAEM  279

Query  490  RHVLAVLDDLSAEE  531
             +V+  +D+ + +E
Sbjct  280  DNVITQMDNYTQQE  293



>gb|KFQ47149.1| Glycine--tRNA ligase, partial [Nestor notabilis]
Length=665

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RVKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHVEKF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVEKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>gb|ADI80800.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
 gb|ADI80804.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
 gb|ADI80807.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
 gb|ADI80811.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
Length=273

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EEILVKLDGMTADE  199



>gb|AJO66531.1| glycyl-tRNA synthetase, partial [Heliconius melpomene ecuadorensis]
Length=236

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  54   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  113

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  114  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  172

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A E
Sbjct  173  EDILVKLDGMTAAE  186



>gb|AJO66527.1| glycyl-tRNA synthetase, partial [Heliconius himera]
Length=257

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66563.1| glycyl-tRNA synthetase, partial [Heliconius wallacei]
Length=260

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|EJW81070.1| glycyl-tRNA synthetase [Wuchereria bancrofti]
Length=678

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R    + L++R FY  SF IY GV GLYD+GP GCA+K+N++  WR HFVL+ENMLEVDC
Sbjct  68   RLKFEDLLKQRFFYDQSFAIYGGVTGLYDFGPMGCAMKANMINLWRNHFVLQENMLEVDC  127

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHV++F+D MVKD KTG C+RADHL+K+F  EK+  D   PA    E 
Sbjct  128  SVLTPENVLKASGHVDRFSDWMVKDLKTGECFRADHLIKNFV-EKMCEDTKTPASVKEEL  186

Query  490  RHVLAVLDDLS  522
            + VLA L+  +
Sbjct  187  KEVLAKLEGFN  197



>ref|XP_010010079.1| PREDICTED: glycine--tRNA ligase, partial [Nestor notabilis]
Length=665

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RVKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHVEKF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVEKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>gb|AJO66528.1| glycyl-tRNA synthetase, partial [Heliconius ismenius]
Length=269

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  63   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  122

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  123  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  181

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  182  EDILVKLDGMTADE  195



>gb|AJO66519.1| glycyl-tRNA synthetase, partial [Heliconius hecuba]
Length=254

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66471.1| glycyl-tRNA synthetase, partial [Neruda aoede]
Length=271

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  65   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  124

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  125  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  183

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  184  EDILVKLDGMTADE  197



>gb|AJO66538.1| glycyl-tRNA synthetase, partial [Heliconius melpomene rosina]
Length=273

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +DYGP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDYGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A   AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAXLKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>ref|XP_002893585.1| hypothetical protein ARALYDRAFT_890516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69844.1| hypothetical protein ARALYDRAFT_890516 [Arabidopsis lyrata subsp. 
lyrata]
Length=576

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 103/154 (67%), Gaps = 18/154 (12%)
 Frame = +1

Query  70   SPAIDSEMDAAREAQNREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSN  249
            S A++S + +   + N EAFRQA+   L  R FYIPSFKI+ G       GP   +    
Sbjct  34   SSAVESALSSGNVSHNPEAFRQALNKVLYGRSFYIPSFKIHDG-------GPAHSS----  82

Query  250  VLAFWRQHFVLEENMLEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKD  429
                   HFV EE MLE++C CVTPEVVLKASGHV+KFTD+MVKD  TG  YRADHL+KD
Sbjct  83   -------HFVREEKMLEIECTCVTPEVVLKASGHVDKFTDVMVKDVTTGSYYRADHLVKD  135

Query  430  FCNEKLERDPNLPADKVAEYRHVLAVLDDLSAEE  531
            +CNEKLE+D  + A+K AE + +L VL++LS E+
Sbjct  136  YCNEKLEKDVTISAEKAAELKDLLVVLENLSIED  169



>ref|XP_007544426.1| PREDICTED: glycine--tRNA ligase [Poecilia formosa]
 ref|XP_007544427.1| PREDICTED: glycine--tRNA ligase [Poecilia formosa]
Length=751

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  133  RTKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQVWRQHFIQEEQILEIDC  192

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHVEKF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  193  TMLTPEPVLKTSGHVEKFADYMVKDVKNGECFRADHLLKAHL-QKLMSDKKCAAEKKAEM  251

Query  490  RHVLAVLDDLSAEE  531
              V+  LD+ S +E
Sbjct  252  DSVITQLDNYSQQE  265



>gb|AJO66479.1| glycyl-tRNA synthetase, partial [Heliconius congener]
 gb|AJO66494.1| glycyl-tRNA synthetase, partial [Heliconius eleuchia eleuchia]
 gb|AJO66553.1| glycyl-tRNA synthetase, partial [Heliconius sara]
Length=257

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDIKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66557.1| glycyl-tRNA synthetase, partial [Heliconius telesiphe]
Length=256

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66485.1| glycyl-tRNA synthetase, partial [Heliconius cydno weymeri]
Length=270

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>ref|XP_002675607.1| Glycyl-tRNA synthetase [Naegleria gruberi]
 gb|EFC42863.1| Glycyl-tRNA synthetase [Naegleria gruberi]
Length=650

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 92/134 (69%), Gaps = 4/134 (3%)
 Frame = +1

Query  115  NREAFRQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENM  294
            N E F + +T    RR F IPSF+IY GVAGLYDYGPP CA+K+N+L  WR+HFV EENM
Sbjct  23   NPEEFNELLT----RRFFVIPSFEIYGGVAGLYDYGPPACAIKANILDLWRRHFVNEENM  78

Query  295  LEVDCPCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPAD  474
            LEVDC  +TPE V  ASGHV++F D MVKD  T  C+RAD L+ +F + +LE +  L  +
Sbjct  79   LEVDCSSLTPETVFVASGHVQRFADWMVKDVVTNDCFRADKLVGEFIDTELEENSELTQE  138

Query  475  KVAEYRHVLAVLDD  516
            K  EY  V   +DD
Sbjct  139  KTEEYALVKKKIDD  152



>gb|AJO66568.1| glycyl-tRNA synthetase, partial [Heliconius xanthocles]
Length=270

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  64   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  123

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  124  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  182

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  183  EDILVKLDGMTADE  196



>gb|AJO66560.1| glycyl-tRNA synthetase, partial [Heliconius timareta timareta]
Length=273

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66475.1| glycyl-tRNA synthetase, partial [Heliconius charithonia]
Length=273

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66567.1| glycyl-tRNA synthetase, partial [Heliconius xanthocles mellitus]
Length=271

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66552.1| glycyl-tRNA synthetase, partial [Heliconius sara]
Length=258

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDIKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66540.1| glycyl-tRNA synthetase, partial [Heliconius numata]
Length=273

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66521.1| glycyl-tRNA synthetase, partial [Heliconius hermathena]
Length=273

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|KFP45981.1| Glycine--tRNA ligase, partial [Cathartes aura]
Length=464

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RVKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>gb|AJO66465.1| glycyl-tRNA synthetase, partial [Eueides lybia]
Length=256

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66564.1| glycyl-tRNA synthetase, partial [Heliconius wallacei flavescens]
Length=272

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|ADI80798.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
Length=273

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>ref|XP_008394435.1| PREDICTED: glycine--tRNA ligase [Poecilia reticulata]
Length=752

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  134  RTKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQVWRQHFIQEEQILEIDC  193

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHVEKF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  194  TMLTPEPVLKTSGHVEKFADYMVKDVKNGECFRADHLLKAHL-QKLMSDKKCAAEKKAEM  252

Query  490  RHVLAVLDDLSAEE  531
              V+  LD+ S +E
Sbjct  253  DSVITQLDNYSQQE  266



>ref|XP_005797884.1| PREDICTED: glycine--tRNA ligase-like [Xiphophorus maculatus]
Length=751

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  133  RTKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQVWRQHFIQEEQILEIDC  192

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHVEKF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  193  TMLTPEPVLKTSGHVEKFADYMVKDVKNGECFRADHLLKAHL-QKLMSDKKCAAEKKAEM  251

Query  490  RHVLAVLDDLSAEE  531
              V+  LD+ S +E
Sbjct  252  DSVITQLDNYSQQE  265



>gb|ADI80796.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
 gb|ADI80797.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
 gb|ADI80808.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
 gb|ADI80809.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
 gb|ADI80810.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
 gb|ADI80816.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80817.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80818.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80819.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80820.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80821.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80822.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80824.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80828.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80830.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80831.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80832.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80833.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80834.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80835.1| glycyl-tRNA synthetase, partial [Heliconius heurippa]
 gb|ADI80836.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80837.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80838.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80840.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80841.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80842.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80843.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80844.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80846.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80847.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80848.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80849.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80850.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80851.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80852.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80853.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|ADI80854.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|AJO66481.1| glycyl-tRNA synthetase, partial [Heliconius cydno chioneus]
 gb|AJO66483.1| glycyl-tRNA synthetase, partial [Heliconius cydno cordula]
 gb|AJO66542.1| glycyl-tRNA synthetase, partial [Heliconius pachinus]
 gb|AJO66559.1| glycyl-tRNA synthetase, partial [Heliconius timareta]
 gb|AJO66561.1| glycyl-tRNA synthetase, partial [Heliconius timareta]
Length=273

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66473.1| glycyl-tRNA synthetase, partial [Heliconius besckei]
Length=273

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|ADI80801.1| glycyl-tRNA synthetase, partial [Heliconius melpomene melpomene]
Length=273

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66474.1| glycyl-tRNA synthetase, partial [Heliconius burneyi]
 gb|AJO66562.1| glycyl-tRNA synthetase, partial [Heliconius wallacei]
 gb|AJO66565.1| glycyl-tRNA synthetase, partial [Heliconius wallacei flavescens]
Length=273

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|KFM63062.1| Glycine--tRNA ligase, partial [Stegodyphus mimosarum]
Length=306

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 92/134 (69%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + L+RR +   SF IY GV G +D+GP GC +K+N+L+ WR HF+LEE MLEVDC
Sbjct  134  RARMEDLLKRRFYVDQSFAIYGGVTGQFDFGPVGCGIKNNILSLWRSHFILEEQMLEVDC  193

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHV++F DLMVKD K G C+R DHL+K    EKL  D N+  ++ AEY
Sbjct  194  TILTPENVLKASGHVDRFADLMVKDLKNGECFRLDHLIKAHL-EKLMTDKNVTPEQYAEY  252

Query  490  RHVLAVLDDLSAEE  531
              ++  LD  S EE
Sbjct  253  EDIIVKLDGYSKEE  266



>gb|AJO66486.1| glycyl-tRNA synthetase, partial [Heliconius demeter]
 gb|AJO66498.1| glycyl-tRNA synthetase, partial [Heliconius erato chestertonii]
 gb|AJO66501.1| glycyl-tRNA synthetase, partial [Heliconius erato erato]
 gb|AJO66502.1| glycyl-tRNA synthetase, partial [Heliconius erato favorinus]
 gb|AJO66504.1| glycyl-tRNA synthetase, partial [Heliconius erato hydara]
 gb|AJO66505.1| glycyl-tRNA synthetase, partial [Heliconius erato lativitta]
 gb|AJO66506.1| glycyl-tRNA synthetase, partial [Heliconius erato notabilis]
 gb|AJO66507.1| glycyl-tRNA synthetase, partial [Heliconius erato petiverana]
 gb|AJO66508.1| glycyl-tRNA synthetase, partial [Heliconius demeter eratosignis]
Length=273

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66500.1| glycyl-tRNA synthetase, partial [Heliconius erato emma]
Length=273

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66470.1| glycyl-tRNA synthetase, partial [Neruda aoede]
Length=273

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66551.1| glycyl-tRNA synthetase, partial [Heliconius sapho]
Length=270

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDIKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66520.1| glycyl-tRNA synthetase, partial [Heliconius hecuba]
Length=273

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66566.1| glycyl-tRNA synthetase, partial [Heliconius xanthocles]
Length=273

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66476.1| glycyl-tRNA synthetase, partial [Heliconius clysonymus]
Length=266

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDIKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66495.1| glycyl-tRNA synthetase, partial [Heliconius eleuchia]
Length=273

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDIKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66469.1| glycyl-tRNA synthetase, partial [Eueides vibilia unifasciatus]
Length=272

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66478.1| glycyl-tRNA synthetase, partial [Heliconius clysonymus]
Length=273

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDIKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66464.1| glycyl-tRNA synthetase, partial [Eueides lybia]
Length=273

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66535.1| glycyl-tRNA synthetase, partial [Heliconius melpomene meriana]
Length=271

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  65   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  124

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  125  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  183

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  184  EDILVKLDGMTADE  197



>gb|AJO66549.1| glycyl-tRNA synthetase, partial [Heliconius sapho sapho]
 gb|AJO66554.1| glycyl-tRNA synthetase, partial [Heliconius sara sara]
 gb|AJO66555.1| glycyl-tRNA synthetase, partial [Heliconius sara]
Length=273

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDIKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>gb|AJO66468.1| glycyl-tRNA synthetase, partial [Eueides vibilia]
Length=273

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILVKLDGMTADE  199



>ref|XP_005722749.1| PREDICTED: glycine--tRNA ligase-like [Pundamilia nyererei]
Length=749

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  131  RTKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQAWRQHFIQEEQILEIDC  190

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  191  TMLTPESVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  249

Query  490  RHVLAVLDDLSAEE  531
              V+  LD+ + EE
Sbjct  250  ESVITQLDNYTQEE  263



>gb|AJO66489.1| glycyl-tRNA synthetase, partial [Laparus doris]
Length=272

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILIKLDGMTADE  199



>gb|AJO66490.1| glycyl-tRNA synthetase, partial [Laparus doris]
Length=273

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILIKLDGMTADE  199



>gb|KFO06291.1| Glycine--tRNA ligase, partial [Balearica regulorum gibbericeps]
Length=464

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RVKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-KKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>ref|XP_010308438.1| PREDICTED: glycine--tRNA ligase, partial [Balearica regulorum 
gibbericeps]
Length=464

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RVKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-KKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>gb|AJO66466.1| glycyl-tRNA synthetase, partial [Eueides lybia lybia]
Length=270

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  65   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  124

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  125  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  183

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  184  EDILVKLDGMTADE  197



>gb|KFP30201.1| Glycine--tRNA ligase, partial [Colius striatus]
Length=665

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RAKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>gb|KFO90361.1| Glycine--tRNA ligase, partial [Buceros rhinoceros silvestris]
Length=665

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RAKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>ref|XP_010196388.1| PREDICTED: glycine--tRNA ligase, partial [Colius striatus]
Length=665

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RAKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>gb|AJO66487.1| glycyl-tRNA synthetase, partial [Laparus doris]
Length=273

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILIKLDGMTADE  199



>ref|XP_005150074.1| PREDICTED: glycine--tRNA ligase [Melopsittacus undulatus]
Length=724

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  106  RVKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  165

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHVEKF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  166  TMLTPEPVLKTSGHVEKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  224

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  225  ENVLTQLDNYGQQE  238



>ref|XP_005912357.1| PREDICTED: glycine--tRNA ligase-like [Haplochromis burtoni]
Length=749

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  131  RTKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQAWRQHFIQEEQILEIDC  190

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  191  TMLTPESVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  249

Query  490  RHVLAVLDDLSAEE  531
              V+  LD+ + EE
Sbjct  250  ESVITQLDNYTQEE  263



>gb|AJO66488.1| glycyl-tRNA synthetase, partial [Laparus doris]
 gb|AJO66491.1| glycyl-tRNA synthetase, partial [Laparus doris doris]
 gb|AJO66492.1| glycyl-tRNA synthetase, partial [Laparus doris delila]
Length=273

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 95/134 (71%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + + ++RR FY  SF IY G+ G +D+GP GCA+KSN++  WR++F+L+E MLEVDC
Sbjct  67   RAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIQLWRKYFILQEQMLEVDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHVE+F DLM KD K+G C+R DHL+K    EK++ + N  A+  AE 
Sbjct  127  SILTPEPVLKASGHVERFADLMTKDVKSGECFRLDHLIKAHL-EKIKSEKNTKAELKAEI  185

Query  490  RHVLAVLDDLSAEE  531
              +L  LD ++A+E
Sbjct  186  EDILIKLDGMTADE  199



>ref|XP_010135464.1| PREDICTED: glycine--tRNA ligase, partial [Buceros rhinoceros 
silvestris]
Length=665

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RAKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +VL  LD+   +E
Sbjct  166  ENVLTQLDNYGQQE  179



>ref|XP_004546800.1| PREDICTED: glycine--tRNA ligase-like [Maylandia zebra]
Length=749

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N+L  WRQHF+ EE +LE+DC
Sbjct  131  RTKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQAWRQHFIQEEQILEIDC  190

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  191  TMLTPESVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  249

Query  490  RHVLAVLDDLSAEE  531
              V+  LD+ + EE
Sbjct  250  ESVITQLDNYTQEE  263



>ref|XP_003141464.1| glycyl-tRNA synthetase [Loa loa]
 gb|EFO22603.1| glycyl-tRNA synthetase [Loa loa]
Length=747

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R    + L++R FY  SF IY GV GLYD+GP GCA+K+N++  WR HFVLEENMLEVDC
Sbjct  137  RLKFEDLLKQRFFYDQSFAIYGGVTGLYDFGPMGCAMKANMINLWRNHFVLEENMLEVDC  196

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLKASGHV++F+D MVKD KTG C+RADHL+K+F  EK+  D   PA    E 
Sbjct  197  SVLTPEAVLKASGHVDRFSDWMVKDLKTGECFRADHLIKNFV-EKMCEDIKTPASVKEEL  255

Query  490  RHVLAVLDDLS  522
            + V+  L+  +
Sbjct  256  KEVMTKLEGFN  266



>ref|XP_006736909.1| PREDICTED: glycine--tRNA ligase-like [Leptonychotes weddellii]
Length=520

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  67   RAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDC  126

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K +E 
Sbjct  127  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCSAEKKSEM  185

Query  490  RHVLAVLDDLSAEE  531
              VLA LD+   +E
Sbjct  186  ESVLAQLDNYGQQE  199



>gb|EGW05197.1| Glycyl-tRNA synthetase [Cricetulus griseus]
Length=634

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  109  RAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDC  168

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K +E 
Sbjct  169  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCSAEKKSEM  227

Query  490  RHVLAVLDDLSAEE  531
              VLA LD+   +E
Sbjct  228  ESVLAQLDNYGQQE  241



>ref|XP_005030460.1| PREDICTED: glycine--tRNA ligase-like, partial [Anas platyrhynchos]
Length=464

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = +1

Query  130  RQAVTNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLAFWRQHFVLEENMLEVDC  309
            R  + +TL+RR FY  +F IY GV+GLYD+GP GCA+K+N++  WRQHF+ EE +LE+DC
Sbjct  47   RVKMEDTLKRRFFYDQAFSIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDC  106

Query  310  PCVTPEVVLKASGHVEKFTDLMVKDEKTGVCYRADHLLKDFCNEKLERDPNLPADKVAEY  489
              +TPE VLK SGHV+KF D MVKD K G C+RADHLLK    +KL  D    A+K AE 
Sbjct  107  TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHL-QKLMSDKKCTAEKKAEM  165

Query  490  RHVLAVLDDLSAEE  531
             +V+  LD+   +E
Sbjct  166  ENVITQLDNYGQQE  179



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200