BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K13

Length=518
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010055612.1|  PREDICTED: elicitor-responsive protein 3           215   5e-68   Eucalyptus grandis [rose gum]
ref|XP_007040166.1|  Elicitor-responsive protein, putative              214   1e-67   Theobroma cacao [chocolate]
emb|CDP19756.1|  unnamed protein product                                213   6e-67   Coffea canephora [robusta coffee]
gb|AFK33561.1|  unknown                                                 211   2e-66   Lotus japonicus
ref|XP_010255470.1|  PREDICTED: elicitor-responsive protein 3           207   8e-65   Nelumbo nucifera [Indian lotus]
gb|EYU38371.1|  hypothetical protein MIMGU_mgv1a015742mg                207   9e-65   Erythranthe guttata [common monkey flower]
ref|XP_011072306.1|  PREDICTED: elicitor-responsive protein 3           204   1e-63   Sesamum indicum [beniseed]
ref|XP_009589207.1|  PREDICTED: elicitor-responsive protein 3           203   2e-63   Nicotiana tomentosiformis
ref|XP_002282926.1|  PREDICTED: elicitor-responsive protein 3           203   3e-63   Vitis vinifera
ref|XP_008437230.1|  PREDICTED: elicitor-responsive protein 3           202   7e-63   Cucumis melo [Oriental melon]
ref|XP_003532401.1|  PREDICTED: elicitor-responsive protein 3-like      201   3e-62   Glycine max [soybeans]
ref|XP_006827728.1|  hypothetical protein AMTR_s00009p00261350          200   3e-62   Amborella trichopoda
ref|XP_009390540.1|  PREDICTED: elicitor-responsive protein 3-like      198   2e-61   
gb|KDP25475.1|  hypothetical protein JCGZ_20631                         199   2e-61   Jatropha curcas
ref|XP_010089150.1|  Elicitor-responsive protein 3                      198   2e-61   Morus notabilis
ref|XP_003524467.1|  PREDICTED: elicitor-responsive protein 3-like      198   3e-61   
gb|AET97660.1|  elicitor responsive protein 3                           197   8e-61   Camellia sinensis [black tea]
ref|XP_009408144.1|  PREDICTED: elicitor-responsive protein 3-like      196   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB39632.1|  hypothetical protein B456_007G022600                    196   3e-60   Gossypium raimondii
ref|NP_001047544.1|  Os02g0640000                                       195   3e-60   
ref|XP_010918511.1|  PREDICTED: elicitor-responsive protein 3-lik...    195   4e-60   Elaeis guineensis
ref|XP_007160032.1|  hypothetical protein PHAVU_002G286900g             195   5e-60   Phaseolus vulgaris [French bean]
ref|XP_003569961.1|  PREDICTED: elicitor-responsive protein 3-like      195   5e-60   Brachypodium distachyon [annual false brome]
emb|CDP09783.1|  unnamed protein product                                195   6e-60   Coffea canephora [robusta coffee]
ref|XP_006652558.1|  PREDICTED: elicitor-responsive protein 3-like      194   9e-60   Oryza brachyantha
ref|XP_004143927.1|  PREDICTED: elicitor-responsive protein 3-like      194   9e-60   Cucumis sativus [cucumbers]
ref|XP_006440580.1|  hypothetical protein CICLE_v10024188mg             194   1e-59   Citrus clementina [clementine]
ref|XP_006477594.1|  PREDICTED: C2 domain-containing protein At1g...    194   1e-59   Citrus sinensis [apfelsine]
ref|XP_006391765.1|  hypothetical protein EUTSA_v10023745mg             194   1e-59   Eutrema salsugineum [saltwater cress]
ref|XP_002301337.2|  C2 domain-containing family protein                194   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006647585.1|  PREDICTED: elicitor-responsive protein 3-like      193   2e-59   Oryza brachyantha
ref|XP_010273137.1|  PREDICTED: elicitor-responsive protein 3-like      193   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_011023395.1|  PREDICTED: C2 domain-containing protein At1g...    193   3e-59   Populus euphratica
ref|XP_009112965.1|  PREDICTED: C2 domain-containing protein At1g...    193   3e-59   Brassica rapa
ref|XP_008796734.1|  PREDICTED: elicitor-responsive protein 3-like      192   4e-59   Phoenix dactylifera
gb|KHG14406.1|  Elicitor-responsive 3                                   192   8e-59   Gossypium arboreum [tree cotton]
ref|XP_003627626.1|  Elicitor-responsive protein                        192   1e-58   Medicago truncatula
ref|XP_006300562.1|  hypothetical protein CARUB_v10021114mg             191   1e-58   Capsella rubella
ref|XP_010430413.1|  PREDICTED: C2 domain-containing protein At1g...    191   1e-58   Camelina sativa [gold-of-pleasure]
ref|NP_001053394.1|  Os04g0531100                                       191   2e-58   
gb|KHN16847.1|  Elicitor-responsive protein 3                           190   2e-58   Glycine soja [wild soybean]
ref|XP_010418347.1|  PREDICTED: C2 domain-containing protein At1g...    191   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010553510.1|  PREDICTED: C2 domain-containing protein At1g...    190   4e-58   Tarenaya hassleriana [spider flower]
ref|XP_009782393.1|  PREDICTED: elicitor-responsive protein 3           189   6e-58   Nicotiana sylvestris
gb|AFK41181.1|  unknown                                                 189   7e-58   Lotus japonicus
ref|XP_006827727.1|  hypothetical protein AMTR_s00009p00261310          189   8e-58   Amborella trichopoda
ref|XP_011091761.1|  PREDICTED: elicitor-responsive protein 3-like      189   9e-58   Sesamum indicum [beniseed]
ref|XP_010940440.1|  PREDICTED: elicitor-responsive protein 3-like      189   1e-57   Elaeis guineensis
ref|XP_010533699.1|  PREDICTED: C2 domain-containing protein At1g...    189   1e-57   Tarenaya hassleriana [spider flower]
ref|NP_176511.1|  calcium-dependent lipid-binding domain-containi...    189   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887967.1|  C2 domain-containing protein                       189   1e-57   Arabidopsis lyrata subsp. lyrata
gb|AAM63058.1|  putative elicitor-responsive gene                       188   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003627627.1|  Elicitor-responsive protein                        188   2e-57   Medicago truncatula
ref|XP_002452514.1|  hypothetical protein SORBIDRAFT_04g027270          188   2e-57   Sorghum bicolor [broomcorn]
ref|XP_009340615.1|  PREDICTED: elicitor-responsive protein 3-like      189   2e-57   Pyrus x bretschneideri [bai li]
ref|NP_001265948.1|  uncharacterized protein LOC101501238               188   3e-57   Cicer arietinum [garbanzo]
ref|NP_001152622.1|  LOC100286263                                       188   3e-57   Zea mays [maize]
ref|XP_009112738.1|  PREDICTED: C2 domain-containing protein At1g...    188   3e-57   Brassica rapa
ref|XP_010473560.1|  PREDICTED: C2 domain-containing protein At1g...    187   3e-57   Camelina sativa [gold-of-pleasure]
emb|CDY49885.1|  BnaC09g51250D                                          187   6e-57   Brassica napus [oilseed rape]
ref|XP_010671812.1|  PREDICTED: elicitor-responsive protein 3-like      187   6e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008383330.1|  PREDICTED: elicitor-responsive protein 3-like      187   1e-56   Malus domestica [apple tree]
ref|XP_009376904.1|  PREDICTED: elicitor-responsive protein 3-like      187   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_004953244.1|  PREDICTED: elicitor-responsive protein 3-lik...    186   2e-56   Setaria italica
ref|XP_002509753.1|  Elicitor-responsive protein, putative              185   8e-56   
ref|NP_001235509.1|  uncharacterized protein LOC100500006               184   1e-55   Glycine max [soybeans]
gb|EMS59136.1|  Elicitor-responsive protein 3                           183   2e-55   Triticum urartu
gb|KFK40522.1|  hypothetical protein AALP_AA2G006600                    183   3e-55   Arabis alpina [alpine rockcress]
ref|XP_009349693.1|  PREDICTED: elicitor-responsive protein 3-like      183   3e-55   Pyrus x bretschneideri [bai li]
gb|ADC34699.1|  elicitor responsive gene 3                              182   5e-55   Triticum aestivum [Canadian hard winter wheat]
gb|KJB25785.1|  hypothetical protein B456_004G209300                    183   8e-55   Gossypium raimondii
gb|ABK22624.1|  unknown                                                 181   9e-55   Picea sitchensis
ref|XP_006358893.1|  PREDICTED: elicitor-responsive protein 3-like      181   1e-54   Solanum tuberosum [potatoes]
ref|XP_004245627.1|  PREDICTED: elicitor-responsive protein 3           181   1e-54   Solanum lycopersicum
ref|XP_004953245.1|  PREDICTED: elicitor-responsive protein 3-lik...    181   1e-54   Setaria italica
ref|XP_002511813.1|  synaptotagmin protein, putative                    181   1e-54   
emb|CDY47345.1|  BnaCnng14820D                                          181   2e-54   Brassica napus [oilseed rape]
gb|EMT03713.1|  hypothetical protein F775_27946                         181   2e-54   
gb|ACN40760.1|  unknown                                                 181   2e-54   Picea sitchensis
ref|XP_002446840.1|  hypothetical protein SORBIDRAFT_06g023480          180   2e-54   Sorghum bicolor [broomcorn]
ref|XP_008668134.1|  PREDICTED: LOC100285451 isoform X1                 178   1e-53   
gb|ACU20820.1|  unknown                                                 178   2e-53   Glycine max [soybeans]
ref|XP_008778588.1|  PREDICTED: elicitor-responsive protein 3-lik...    177   3e-53   Phoenix dactylifera
ref|NP_001151816.1|  LOC100285451                                       177   3e-53   Zea mays [maize]
gb|AFW63158.1|  hypothetical protein ZEAMMB73_507702                    178   3e-53   
gb|KHN04637.1|  C2 domain-containing protein                            177   4e-53   Glycine soja [wild soybean]
ref|XP_006364243.1|  PREDICTED: C2 domain-containing protein At1g...    178   6e-53   Solanum tuberosum [potatoes]
gb|EPS70123.1|  hypothetical protein M569_04644                         176   8e-53   Genlisea aurea
ref|XP_008232757.1|  PREDICTED: elicitor-responsive protein 3-like      176   9e-53   Prunus mume [ume]
ref|XP_006653041.1|  PREDICTED: elicitor-responsive protein 3-like      176   1e-52   Oryza brachyantha
ref|XP_003580201.1|  PREDICTED: elicitor-responsive protein 3-like      176   1e-52   Brachypodium distachyon [annual false brome]
ref|XP_004960032.1|  PREDICTED: C2 domain-containing protein At1g...    176   2e-52   Setaria italica
ref|XP_007135004.1|  hypothetical protein PHAVU_010G093800g             176   2e-52   Phaseolus vulgaris [French bean]
ref|XP_004976328.1|  PREDICTED: elicitor-responsive protein 3-like      175   2e-52   Setaria italica
gb|EEC73678.1|  hypothetical protein OsI_08227                          179   2e-52   Oryza sativa Indica Group [Indian rice]
ref|XP_008344050.1|  PREDICTED: C2 domain-containing protein At1g...    175   3e-52   Malus domestica [apple tree]
ref|XP_009600806.1|  PREDICTED: elicitor-responsive protein 3-like      179   3e-52   Nicotiana tomentosiformis
ref|XP_008383313.1|  PREDICTED: elicitor-responsive protein 3-like      174   7e-52   
ref|XP_009793673.1|  PREDICTED: elicitor-responsive protein 3-like      176   1e-51   Nicotiana sylvestris
ref|XP_008778579.1|  PREDICTED: elicitor-responsive protein 3-lik...    173   2e-51   
ref|XP_009112966.1|  PREDICTED: C2 domain-containing protein At1g...    173   2e-51   Brassica rapa
ref|NP_001054294.1|  Os04g0682100                                       173   2e-51   
ref|XP_011023396.1|  PREDICTED: C2 domain-containing protein At1g...    172   5e-51   Populus euphratica
ref|XP_007139962.1|  hypothetical protein PHAVU_008G073400g             170   1e-50   Phaseolus vulgaris [French bean]
ref|XP_007218552.1|  hypothetical protein PRUPE_ppa012874mg             170   2e-50   Prunus persica
pdb|1WFJ|A  Chain A, C2 Domain-Containing Protein From Putative E...    169   3e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007219498.1|  hypothetical protein PRUPE_ppa022324mg             169   4e-50   
ref|XP_004960033.1|  PREDICTED: C2 domain-containing protein At1g...    169   7e-50   Setaria italica
dbj|BAK01234.1|  predicted protein                                      169   8e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAD45283.1|  unknown                                                 167   2e-49   Zea mays [maize]
ref|XP_010676509.1|  PREDICTED: elicitor-responsive protein 3           168   2e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004248567.1|  PREDICTED: C2 domain-containing protein At1g...    170   2e-49   Solanum lycopersicum
ref|XP_008232758.1|  PREDICTED: elicitor-responsive protein 3-like      168   2e-49   Prunus mume [ume]
ref|XP_009375786.1|  PREDICTED: elicitor-responsive protein 3-like      167   3e-49   Pyrus x bretschneideri [bai li]
ref|XP_008392558.1|  PREDICTED: elicitor-responsive protein 3-like      167   3e-49   Malus domestica [apple tree]
gb|ACR36998.1|  unknown                                                 167   3e-49   Zea mays [maize]
ref|XP_002447341.1|  hypothetical protein SORBIDRAFT_06g033270          167   4e-49   Sorghum bicolor [broomcorn]
ref|XP_004960030.1|  PREDICTED: C2 domain-containing protein At1g...    167   4e-49   
ref|XP_008232808.1|  PREDICTED: glycine-rich cell wall structural...    171   4e-49   Prunus mume [ume]
ref|XP_008389105.1|  PREDICTED: TATA-binding protein-associated f...    171   4e-49   
gb|AEH05973.1|  elicitor-responsive protein                             166   7e-49   Hevea brasiliensis [jebe]
ref|XP_007218373.1|  hypothetical protein PRUPE_ppa011300mg             168   8e-49   
ref|XP_004300766.1|  PREDICTED: elicitor-responsive protein 3-like      166   1e-48   Fragaria vesca subsp. vesca
ref|XP_003551645.1|  PREDICTED: C2 domain-containing protein At1g...    166   1e-48   Glycine max [soybeans]
ref|XP_004498695.1|  PREDICTED: elicitor-responsive protein 3-like      165   2e-48   Cicer arietinum [garbanzo]
ref|XP_009376903.1|  PREDICTED: elicitor-responsive protein 3-lik...    165   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_004306823.1|  PREDICTED: elicitor-responsive protein 3-like      166   2e-48   Fragaria vesca subsp. vesca
ref|NP_001105741.1|  uncharacterized protein LOC542763                  165   3e-48   Zea mays [maize]
gb|ABK26300.1|  unknown                                                 165   3e-48   Picea sitchensis
ref|XP_009376934.1|  PREDICTED: C2 domain-containing protein At1g...    168   4e-48   
ref|XP_009349691.1|  PREDICTED: glycine-rich cell wall structural...    169   8e-48   Pyrus x bretschneideri [bai li]
ref|XP_011093160.1|  PREDICTED: elicitor-responsive protein 3-like      163   1e-47   Sesamum indicum [beniseed]
ref|XP_009376902.1|  PREDICTED: C2 domain-containing protein At1g...    162   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_006491030.1|  PREDICTED: elicitor-responsive protein 3-lik...    162   3e-47   Citrus sinensis [apfelsine]
gb|ACG31673.1|  hypothetical protein                                    161   5e-47   Zea mays [maize]
ref|XP_006602765.1|  PREDICTED: C2 domain-containing protein At1g...    160   9e-47   Glycine max [soybeans]
gb|EEE57455.1|  hypothetical protein OsJ_07677                          162   2e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960031.1|  PREDICTED: C2 domain-containing protein At1g...    160   2e-46   
ref|XP_006491029.1|  PREDICTED: elicitor-responsive protein 3-lik...    158   1e-45   Citrus sinensis [apfelsine]
ref|XP_007218375.1|  hypothetical protein PRUPE_ppa011300mg             159   2e-45   Prunus persica
ref|XP_007218551.1|  hypothetical protein PRUPE_ppa012874mg             157   2e-45   
ref|XP_006491031.1|  PREDICTED: elicitor-responsive protein 3-lik...    157   2e-45   Citrus sinensis [apfelsine]
ref|XP_007218374.1|  hypothetical protein PRUPE_ppa011300mg             160   2e-45   
ref|XP_008232759.1|  PREDICTED: elicitor-responsive protein 3-like      158   2e-45   Prunus mume [ume]
ref|XP_010240624.1|  PREDICTED: elicitor-responsive protein 3-like      157   6e-45   Brachypodium distachyon [annual false brome]
ref|XP_008238904.1|  PREDICTED: elicitor-responsive protein 3-like      156   9e-45   
ref|XP_004510849.1|  PREDICTED: C2 domain-containing protein At1g...    155   1e-44   
gb|EMT18888.1|  hypothetical protein F775_28053                         154   2e-44   
ref|NP_001077765.1|  calcium-dependent lipid-binding domain-conta...    154   4e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AES58842.2|  elicitor-responsive-like protein                        153   5e-44   Medicago truncatula
ref|XP_010918512.1|  PREDICTED: elicitor-responsive protein 3-lik...    152   8e-44   
gb|KJB39636.1|  hypothetical protein B456_007G022600                    151   3e-43   Gossypium raimondii
ref|XP_003588591.1|  Elicitor-responsive protein                        152   7e-43   
gb|EMS45321.1|  Elicitor-responsive protein 3                           155   3e-42   Triticum urartu
ref|XP_004306820.1|  PREDICTED: proline-rich protein HaeIII subfa...    153   9e-42   Fragaria vesca subsp. vesca
ref|XP_007210830.1|  hypothetical protein PRUPE_ppa016686mg             147   2e-41   
ref|XP_009776717.1|  PREDICTED: elicitor-responsive protein 3-like      147   2e-41   Nicotiana sylvestris
ref|XP_009587344.1|  PREDICTED: elicitor-responsive protein 3-like      147   2e-41   Nicotiana tomentosiformis
ref|XP_004306821.1|  PREDICTED: C2 domain-containing protein At1g...    148   1e-40   Fragaria vesca subsp. vesca
ref|XP_004306822.1|  PREDICTED: elicitor-responsive protein 3-lik...    147   4e-40   Fragaria vesca subsp. vesca
gb|KJB39634.1|  hypothetical protein B456_007G022600                    143   5e-40   Gossypium raimondii
gb|KJB39635.1|  hypothetical protein B456_007G022600                    142   1e-39   Gossypium raimondii
gb|KJB39633.1|  hypothetical protein B456_007G022600                    140   1e-39   Gossypium raimondii
emb|CAJ86293.1|  H0124B04.10                                            141   6e-39   Oryza sativa [red rice]
ref|XP_006584181.1|  PREDICTED: C2 domain-containing protein At1g...    138   5e-38   Glycine max [soybeans]
gb|ADT92193.1|  C2 domain-containing protein                            137   3e-37   Zea mays [maize]
ref|XP_009349690.1|  PREDICTED: elicitor-responsive protein 3-like      134   1e-36   
ref|XP_006491033.1|  PREDICTED: elicitor-responsive protein 3-lik...    134   1e-36   Citrus sinensis [apfelsine]
ref|XP_006445119.1|  hypothetical protein CICLE_v10022928mg             134   1e-36   
ref|XP_006364238.1|  PREDICTED: elicitor-responsive protein 3-like      134   2e-36   Solanum tuberosum [potatoes]
gb|KDO86047.1|  hypothetical protein CISIN_1g037768mg                   130   2e-35   Citrus sinensis [apfelsine]
ref|XP_006491032.1|  PREDICTED: elicitor-responsive protein 3-lik...    130   3e-35   Citrus sinensis [apfelsine]
tpg|DAA36704.1|  TPA: hypothetical protein ZEAMMB73_836368              127   3e-33   
ref|XP_007208897.1|  hypothetical protein PRUPE_ppa026834mg             125   7e-33   Prunus persica
ref|XP_002972816.1|  hypothetical protein SELMODRAFT_148785             124   1e-32   
ref|XP_004306824.1|  PREDICTED: elicitor-responsive protein 3-like      123   1e-32   Fragaria vesca subsp. vesca
ref|XP_010030954.1|  PREDICTED: elicitor-responsive protein 1 iso...    124   3e-32   Eucalyptus grandis [rose gum]
gb|EPS63491.1|  hypothetical protein M569_11295                         122   6e-32   Genlisea aurea
ref|XP_008238902.1|  PREDICTED: elicitor-responsive protein 3-like      121   3e-31   Prunus mume [ume]
ref|XP_002984391.1|  hypothetical protein SELMODRAFT_229026             120   3e-31   
ref|XP_002283485.1|  PREDICTED: elicitor-responsive protein 1           121   3e-31   Vitis vinifera
gb|KJB73946.1|  hypothetical protein B456_011G262100                    120   5e-31   Gossypium raimondii
ref|XP_009600805.1|  PREDICTED: elicitor-responsive protein 3-like      119   9e-31   Nicotiana tomentosiformis
ref|XP_010030953.1|  PREDICTED: elicitor-responsive protein 1 iso...    118   5e-30   Eucalyptus grandis [rose gum]
ref|XP_009626088.1|  PREDICTED: elicitor-responsive protein 1 iso...    118   6e-30   Nicotiana tomentosiformis
ref|XP_009626087.1|  PREDICTED: elicitor-responsive protein 1 iso...    118   6e-30   Nicotiana tomentosiformis
gb|AFK38368.1|  unknown                                                 117   1e-29   Lotus japonicus
ref|XP_008360762.1|  PREDICTED: elicitor-responsive protein 3-like      116   3e-29   Malus domestica [apple tree]
ref|XP_010931272.1|  PREDICTED: elicitor-responsive protein 1 iso...    116   3e-29   
ref|XP_006445118.1|  hypothetical protein CICLE_v10022928mg             114   4e-29   
emb|CDP00102.1|  unnamed protein product                                115   5e-29   Coffea canephora [robusta coffee]
ref|XP_006486477.1|  PREDICTED: elicitor-responsive protein 1-like      115   8e-29   Citrus sinensis [apfelsine]
ref|XP_009357731.1|  PREDICTED: elicitor-responsive protein 1-like      115   8e-29   
ref|XP_007141870.1|  hypothetical protein PHAVU_008G232700g             115   9e-29   Phaseolus vulgaris [French bean]
ref|NP_001280934.1|  uncharacterized protein LOC103435157               114   1e-28   Malus domestica [apple tree]
ref|XP_009420100.1|  PREDICTED: elicitor-responsive protein 1-lik...    114   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004236744.1|  PREDICTED: elicitor-responsive protein 1 iso...    114   2e-28   Solanum lycopersicum
ref|XP_008776985.1|  PREDICTED: elicitor-responsive protein 1 iso...    114   2e-28   Phoenix dactylifera
ref|XP_009759471.1|  PREDICTED: elicitor-responsive protein 1-lik...    114   2e-28   Nicotiana sylvestris
ref|XP_002316284.1|  C2 domain-containing family protein                114   3e-28   
ref|XP_009759472.1|  PREDICTED: elicitor-responsive protein 1-lik...    114   3e-28   Nicotiana sylvestris
ref|XP_006435544.1|  hypothetical protein CICLE_v10032979mg             113   4e-28   Citrus clementina [clementine]
ref|XP_011027208.1|  PREDICTED: elicitor-responsive protein 1-like      113   4e-28   Populus euphratica
ref|NP_001148526.1|  elicitor-responsive protein 1                      113   5e-28   Zea mays [maize]
gb|EMS57440.1|  Elicitor-responsive protein 3                           115   5e-28   Triticum urartu
ref|XP_006365698.1|  PREDICTED: elicitor-responsive protein 1-lik...    112   1e-27   Solanum tuberosum [potatoes]
ref|XP_010931271.1|  PREDICTED: elicitor-responsive protein 1 iso...    112   2e-27   
ref|XP_008370572.1|  PREDICTED: elicitor-responsive protein 1-lik...    111   2e-27   
ref|XP_010319255.1|  PREDICTED: elicitor-responsive protein 1 iso...    111   2e-27   Solanum lycopersicum
ref|XP_009343533.1|  PREDICTED: elicitor-responsive protein 1-like      111   2e-27   Pyrus x bretschneideri [bai li]
emb|CDM84945.1|  unnamed protein product                                111   3e-27   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004960029.1|  PREDICTED: C2 domain-containing protein At1g...    110   3e-27   
ref|XP_006595905.1|  PREDICTED: elicitor-responsive protein 1-like      110   3e-27   Glycine max [soybeans]
ref|XP_009369053.1|  PREDICTED: elicitor-responsive protein 3           110   7e-27   
ref|XP_008776969.1|  PREDICTED: elicitor-responsive protein 1 iso...    110   8e-27   Phoenix dactylifera
ref|XP_006365697.1|  PREDICTED: elicitor-responsive protein 1-lik...    109   1e-26   Solanum tuberosum [potatoes]
ref|XP_008776977.1|  PREDICTED: elicitor-responsive protein 1 iso...    109   1e-26   Phoenix dactylifera
gb|KJB73947.1|  hypothetical protein B456_011G262100                    110   1e-26   Gossypium raimondii
ref|XP_002311172.1|  C2 domain-containing family protein                109   1e-26   
ref|XP_007009306.1|  Calcium-dependent lipid-binding family prote...    109   2e-26   
ref|XP_009420099.1|  PREDICTED: elicitor-responsive protein 1-lik...    109   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006366176.1|  PREDICTED: elicitor-responsive protein 3-like      107   3e-26   
ref|XP_002456619.1|  hypothetical protein SORBIDRAFT_03g039490          108   3e-26   
ref|XP_007218541.1|  hypothetical protein PRUPE_ppa012756mg             108   3e-26   Prunus persica
ref|NP_001235151.1|  uncharacterized protein LOC100500493               108   3e-26   Glycine max [soybeans]
ref|XP_008370566.1|  PREDICTED: elicitor-responsive protein 1-lik...    108   4e-26   
ref|XP_003518383.1|  PREDICTED: elicitor-responsive protein 1-like      108   5e-26   Glycine max [soybeans]
ref|XP_004970539.1|  PREDICTED: elicitor-responsive protein 1-like      107   8e-26   
gb|AAC04628.1|  Os-FIERG2 gene product                                  107   8e-26   Oryza sativa [red rice]
ref|XP_009794955.1|  PREDICTED: elicitor-responsive protein 1-lik...    107   9e-26   Nicotiana sylvestris
ref|XP_004490894.1|  PREDICTED: elicitor-responsive protein 1-like      107   9e-26   Cicer arietinum [garbanzo]
ref|XP_009794959.1|  PREDICTED: elicitor-responsive protein 1-lik...    107   1e-25   Nicotiana sylvestris
gb|AES99366.2|  elicitor-responsive-like protein                        107   1e-25   Medicago truncatula
ref|XP_003616407.1|  Elicitor-responsive protein                        106   1e-25   Medicago truncatula
ref|XP_010256915.1|  PREDICTED: elicitor-responsive protein 1-like      106   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_009793672.1|  PREDICTED: elicitor-responsive protein 3-like      103   3e-25   Nicotiana sylvestris
ref|XP_008776962.1|  PREDICTED: elicitor-responsive protein 1 iso...    105   5e-25   Phoenix dactylifera
ref|XP_008458867.1|  PREDICTED: elicitor-responsive protein 1-lik...    105   5e-25   Cucumis melo [Oriental melon]
ref|XP_010232545.1|  PREDICTED: elicitor-responsive protein 1 iso...    104   8e-25   Brachypodium distachyon [annual false brome]
gb|EMT23935.1|  hypothetical protein F775_03303                         104   8e-25   
ref|XP_007220086.1|  hypothetical protein PRUPE_ppa024243mg             104   1e-24   
gb|EMS48714.1|  Elicitor-responsive protein 1                           104   1e-24   Triticum urartu
gb|EMT23934.1|  hypothetical protein F775_17616                         104   1e-24   
ref|XP_007141871.1|  hypothetical protein PHAVU_008G232800g             103   1e-24   Phaseolus vulgaris [French bean]
ref|XP_004960028.1|  PREDICTED: C2 domain-containing protein At1g...    103   2e-24   
emb|CDM84975.1|  unnamed protein product                                103   3e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003616408.1|  Elicitor-responsive protein                        105   4e-24   
ref|XP_004307500.1|  PREDICTED: elicitor-responsive protein 1           102   7e-24   Fragaria vesca subsp. vesca
ref|XP_004142762.1|  PREDICTED: elicitor-responsive protein 1-like      102   7e-24   
ref|XP_004170950.1|  PREDICTED: elicitor-responsive protein 1-like      102   7e-24   
gb|AAC04627.1|  Os-FIERG1 gene product                                  102   9e-24   Oryza sativa [red rice]
ref|NP_001044769.1|  Os01g0841700                                       102   1e-23   
ref|XP_004490896.1|  PREDICTED: elicitor-responsive protein 1-lik...    101   1e-23   Cicer arietinum [garbanzo]
ref|XP_003564589.1|  PREDICTED: elicitor-responsive protein 1 iso...    101   2e-23   Brachypodium distachyon [annual false brome]
ref|XP_002533151.1|  Elicitor-responsive protein, putative              101   2e-23   Ricinus communis
gb|EMS48713.1|  Elicitor-responsive protein 1                           101   2e-23   Triticum urartu
gb|EMS58952.1|  Elicitor-responsive protein 1                           103   2e-23   Triticum urartu
ref|XP_008458869.1|  PREDICTED: elicitor-responsive protein 1-like      100   2e-23   Cucumis melo [Oriental melon]
gb|EMS48715.1|  Elicitor-responsive protein 1                           100   3e-23   Triticum urartu
ref|XP_003623815.1|  Elicitor-responsive protein                      99.0    3e-23   
emb|CDM84974.1|  unnamed protein product                                101   3e-23   Triticum aestivum [Canadian hard winter wheat]
gb|EMT23936.1|  hypothetical protein F775_30247                         100   3e-23   
ref|XP_002316283.1|  C2 domain-containing family protein                100   4e-23   
ref|XP_003519347.1|  PREDICTED: elicitor-responsive protein 1-like      100   5e-23   Glycine max [soybeans]
ref|NP_001241108.1|  uncharacterized protein LOC100805025               100   5e-23   Glycine max [soybeans]
gb|KDP44950.1|  hypothetical protein JCGZ_01450                       99.8    8e-23   Jatropha curcas
gb|AAP47157.1|  elicitor-responsive protein                           99.4    9e-23   Oryza sativa Indica Group [Indian rice]
emb|CDM84973.1|  unnamed protein product                              99.4    1e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006644991.1|  PREDICTED: elicitor-responsive protein 1-like    99.4    1e-22   Oryza brachyantha
ref|XP_010264438.1|  PREDICTED: elicitor-responsive protein 1-like    99.0    2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010690675.1|  PREDICTED: elicitor-responsive protein 1 iso...  98.6    2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004142763.1|  PREDICTED: elicitor-responsive protein 1-like    98.6    2e-22   
ref|XP_010256916.1|  PREDICTED: elicitor-responsive protein 1-like    97.4    5e-22   Nelumbo nucifera [Indian lotus]
ref|NP_001236545.1|  uncharacterized protein LOC100526962             97.1    7e-22   Glycine max [soybeans]
ref|XP_009403442.1|  PREDICTED: elicitor-responsive protein 1-like    96.3    9e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007141869.1|  hypothetical protein PHAVU_008G232600g           95.9    2e-21   Phaseolus vulgaris [French bean]
gb|KEH28255.1|  elicitor-responsive-like protein                      95.1    3e-21   Medicago truncatula
ref|XP_010690670.1|  PREDICTED: elicitor-responsive protein 1 iso...  95.1    3e-21   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY02942.1|  BnaC04g25440D                                        95.1    4e-21   
ref|NP_001078296.1|  calcium-dependent lipid-binding domain-conta...  94.0    1e-20   
ref|XP_004490895.1|  PREDICTED: elicitor-responsive protein 1-lik...  94.4    1e-20   
ref|XP_006291981.1|  hypothetical protein CARUB_v10018170mg           93.6    1e-20   
gb|KFK34795.1|  hypothetical protein AALP_AA5G194200                  93.2    2e-20   
ref|XP_009139161.1|  PREDICTED: elicitor-responsive protein 1-like    92.8    3e-20   
dbj|BAJ92111.1|  predicted protein                                    92.0    7e-20   
ref|XP_010108758.1|  Elicitor-responsive protein 1                    90.9    1e-19   
ref|XP_009116242.1|  PREDICTED: 16 kDa phloem protein 2               90.9    2e-19   
gb|AFW56019.1|  hypothetical protein ZEAMMB73_183378                  94.4    3e-19   
gb|AFW64247.1|  hypothetical protein ZEAMMB73_592768                  92.4    3e-19   
ref|XP_002876305.1|  C2 domain-containing protein                     89.4    6e-19   
ref|XP_008245732.1|  PREDICTED: elicitor-responsive protein 1         87.8    6e-19   
ref|NP_191107.1|  calcium-dependent lipid-binding domain-containi...  89.4    7e-19   
ref|XP_006403454.1|  hypothetical protein EUTSA_v10010786mg           89.0    7e-19   
ref|XP_006291982.1|  hypothetical protein CARUB_v10018170mg           89.0    8e-19   
ref|XP_010516122.1|  PREDICTED: 16 kDa phloem protein 2-like isof...  87.8    2e-18   
gb|EYU19912.1|  hypothetical protein MIMGU_mgv1a015394mg              87.4    3e-18   
ref|XP_006445120.1|  hypothetical protein CICLE_v10022928mg           85.5    3e-18   
ref|XP_010554608.1|  PREDICTED: LOW QUALITY PROTEIN: elicitor-res...  87.0    4e-18   
ref|XP_010427321.1|  PREDICTED: 16 kDa phloem protein 2-like isof...  87.0    5e-18   
ref|XP_010504406.1|  PREDICTED: 16 kDa phloem protein 2-like isof...  86.7    5e-18   
ref|XP_007009307.1|  Calcium-dependent lipid-binding family prote...  85.1    1e-17   
gb|EYU45452.1|  hypothetical protein MIMGU_mgv1a017407mg              83.6    1e-17   
ref|XP_008240867.1|  PREDICTED: elicitor-responsive protein 1-like    84.7    2e-17   
gb|KJB73941.1|  hypothetical protein B456_011G262500                  83.2    6e-17   
gb|EYU33217.1|  hypothetical protein MIMGU_mgv1a021668mg              83.2    1e-16   
ref|XP_011077215.1|  PREDICTED: elicitor-responsive protein 1         83.2    1e-16   
ref|XP_010516121.1|  PREDICTED: 16 kDa phloem protein 2-like isof...  83.2    1e-16   
gb|EYU33222.1|  hypothetical protein MIMGU_mgv1a025637mg              82.4    1e-16   
ref|XP_010427320.1|  PREDICTED: 16 kDa phloem protein 2-like isof...  82.4    2e-16   
ref|XP_010504405.1|  PREDICTED: 16 kDa phloem protein 2-like isof...  82.4    2e-16   
ref|XP_004347886.1|  hypothetical protein CAOG_04061                  83.6    3e-16   
ref|XP_007206782.1|  hypothetical protein PRUPE_ppa025489mg           80.9    5e-16   
ref|XP_009405068.1|  PREDICTED: elicitor-responsive protein 1-like    81.6    5e-16   
ref|XP_008387767.1|  PREDICTED: elicitor-responsive protein 1-lik...  80.5    7e-16   
ref|XP_010241942.1|  PREDICTED: elicitor-responsive protein 3         81.6    7e-16   
sp|Q9ZT47.3|PP16A_CUCMA  RecName: Full=16 kDa phloem protein 1        80.5    1e-15   
gb|AAY96409.1|  16 kDa. phloem protein 1                              80.5    1e-15   
gb|ABK41003.1|  16 kDa phloem protein 2                               79.7    1e-15   
gb|ABK41004.1|  16 kDa phloem protein 1                               80.1    1e-15   
gb|AAY96411.1|  16 kDa. phloem protein 2                              79.0    3e-15   
sp|Q9ZT46.3|PP16B_CUCMA  RecName: Full=16 kDa phloem protein 2        77.4    1e-14   
ref|XP_006577376.1|  PREDICTED: elicitor-responsive protein 3-like    77.8    2e-14   
gb|EYU33258.1|  hypothetical protein MIMGU_mgv1a022993mg              76.6    2e-14   
ref|XP_002270608.2|  PREDICTED: elicitor-responsive protein 1-lik...  76.3    3e-14   
ref|XP_009783132.1|  PREDICTED: elicitor-responsive protein 1-like    75.5    4e-14   
ref|XP_010256917.1|  PREDICTED: elicitor-responsive protein 1-like    75.9    4e-14   
gb|ACA02977.1|  16kDa phloem protein 1                                75.9    4e-14   
ref|XP_008387768.1|  PREDICTED: elicitor-responsive protein 1-lik...  75.5    5e-14   
ref|XP_006396245.1|  hypothetical protein EUTSA_v10029141mg           76.3    6e-14   
gb|ABK41005.1|  16 kDa phloem protein 2                               75.1    8e-14   
gb|KEH18859.1|  elicitor-responsive-like protein                      75.5    1e-13   
gb|EMT23937.1|  hypothetical protein F775_24678                       77.0    1e-13   
gb|AAY96406.1|  16 kDa. phloem protein 1                              74.3    2e-13   
gb|AAY96413.1|  16 kDa. phloem protein 1                              73.9    2e-13   
ref|NP_001118904.1|  Calcium-dependent lipid-binding (CaLB domain...  74.3    3e-13   
ref|XP_001783086.1|  predicted protein                                73.2    4e-13   
ref|XP_006290212.1|  hypothetical protein CARUB_v10003903mg           73.9    4e-13   
ref|XP_004510829.1|  PREDICTED: elicitor-responsive protein 3-like    73.6    5e-13   
ref|XP_010466601.1|  PREDICTED: elicitor-responsive protein 3-like    73.6    6e-13   
gb|ERZ98489.1|  hypothetical protein GLOINDRAFT_334431                73.6    7e-13   
ref|XP_001775871.1|  predicted protein                                74.7    8e-13   
ref|XP_002872950.1|  hypothetical protein ARALYDRAFT_327726           73.2    8e-13   
ref|XP_001689911.1|  predicted protein                                73.6    9e-13   
ref|XP_008232931.1|  PREDICTED: elicitor-responsive protein 3         72.0    9e-13   
ref|XP_008338885.1|  PREDICTED: elicitor-responsive protein 3         72.8    1e-12   
ref|XP_010256918.1|  PREDICTED: elicitor-responsive protein 1-like    72.0    1e-12   
ref|XP_010526966.1|  PREDICTED: amyloid beta A4 precursor protein...  73.2    1e-12   
ref|XP_004302777.1|  PREDICTED: elicitor-responsive protein 1-like    72.0    1e-12   
ref|XP_010424036.1|  PREDICTED: uncharacterized protein LOC104709066  72.4    1e-12   
gb|EYU33219.1|  hypothetical protein MIMGU_mgv1a026361mg              71.6    1e-12   
gb|AAY96415.1|  16 kDa. phloem protein 2                              71.6    1e-12   
ref|XP_010654280.1|  PREDICTED: elicitor-responsive protein 1-lik...  71.2    2e-12   
gb|EJY88244.1|  XYPPX repeat family protein                           72.8    2e-12   
gb|AAY96408.1|  16 kDa. phloem protein 2                              70.9    2e-12   
ref|XP_010243161.1|  PREDICTED: elicitor-responsive protein 3-like    71.6    3e-12   
ref|XP_010457024.1|  PREDICTED: elicitor-responsive protein 3-like    71.2    3e-12   
ref|XP_010530752.1|  PREDICTED: splicing factor 3A subunit 2 isof...  72.0    3e-12   
gb|AES80033.2|  elicitor-responsive-like protein                      68.9    3e-12   
ref|XP_007219769.1|  hypothetical protein PRUPE_ppa025593mg           70.1    4e-12   
ref|XP_008458868.1|  PREDICTED: elicitor-responsive protein 1-lik...  70.1    4e-12   
gb|KDP28627.1|  hypothetical protein JCGZ_14398                       70.1    6e-12   
ref|XP_009762118.1|  PREDICTED: elicitor-responsive protein 3         70.5    7e-12   
ref|XP_010432455.1|  PREDICTED: uclacyanin-3-like                     70.5    8e-12   
gb|ESA04928.1|  hypothetical protein GLOINDRAFT_230726                68.9    9e-12   
ref|XP_010327382.1|  PREDICTED: elicitor-responsive protein 3         70.1    9e-12   
ref|XP_002956682.1|  hypothetical protein VOLCADRAFT_119476           70.1    1e-11   
ref|XP_007051808.1|  Calcium-dependent lipid-binding (CaLB domain...  69.3    1e-11   
emb|CDY57743.1|  BnaC03g77080D                                        69.7    1e-11   
ref|XP_010447128.1|  PREDICTED: protein diaphanous homolog 1-like     69.7    1e-11   
gb|EXX74104.1|  Tcb1p                                                 68.6    1e-11   
ref|XP_010530751.1|  PREDICTED: uncharacterized protein LOC104807...  70.9    2e-11   
emb|CDP06607.1|  unnamed protein product                              68.9    2e-11   
gb|AAF13346.1|AF122022_1  unknown                                     69.7    2e-11   
ref|XP_009138262.1|  PREDICTED: splicing factor 3A subunit 2-like     69.7    2e-11   
ref|XP_001699936.1|  hypothetical protein CHLREDRAFT_166690           67.4    2e-11   
ref|XP_004298784.1|  PREDICTED: elicitor-responsive protein 3-like    67.8    3e-11   
ref|XP_002962236.1|  hypothetical protein SELMODRAFT_27199            67.4    3e-11   
emb|CDY07215.1|  BnaCnng02300D                                        68.6    3e-11   
gb|KDP47127.1|  hypothetical protein JCGZ_22123                       68.9    3e-11   
gb|KJB49487.1|  hypothetical protein B456_008G121500                  67.8    3e-11   
ref|XP_010523018.1|  PREDICTED: elicitor-responsive protein 3         68.6    3e-11   
emb|CDY49277.1|  BnaA03g50900D                                        68.9    3e-11   
gb|EMS59188.1|  hypothetical protein TRIUR3_04856                     69.3    3e-11   
ref|XP_004308376.2|  PREDICTED: elicitor-responsive protein 3         68.2    3e-11   
ref|XP_009116236.1|  PREDICTED: amyloid beta A4 precursor protein...  68.9    4e-11   
emb|CDY51156.1|  BnaA09g51910D                                        68.2    4e-11   
ref|XP_006284369.1|  hypothetical protein CARUB_v10005541mg           68.6    4e-11   
ref|XP_010444977.1|  PREDICTED: elicitor-responsive protein 3-like    67.8    5e-11   
gb|AID60147.1|  calcium-dependent lipid-binding (CaLB domain) fam...  68.2    6e-11   
ref|XP_009108746.1|  PREDICTED: elicitor-responsive protein 3-like    67.8    7e-11   
emb|CDX76264.1|  BnaA08g11360D                                        67.8    7e-11   
ref|XP_009367879.1|  PREDICTED: elicitor-responsive protein 3-like    67.4    7e-11   
ref|XP_011036280.1|  PREDICTED: elicitor-responsive protein 3         67.4    8e-11   
ref|XP_010670397.1|  PREDICTED: elicitor-responsive protein 3         67.0    1e-10   
ref|XP_002518703.1|  protein binding protein, putative                67.4    1e-10   
ref|XP_009617242.1|  PREDICTED: elicitor-responsive protein 3         67.0    1e-10   
ref|XP_002298742.1|  C2 domain-containing family protein              67.4    1e-10   
gb|KJB58566.1|  hypothetical protein B456_009G215200                  67.0    1e-10   
gb|EJY79391.1|  hypothetical protein OXYTRI_23338                     67.4    1e-10   
ref|XP_002869171.1|  hypothetical protein ARALYDRAFT_912986           67.0    1e-10   
gb|ERZ98791.1|  hypothetical protein GLOINDRAFT_339436                64.7    2e-10   
emb|CDX72452.1|  BnaC07g44740D                                        67.0    2e-10   
ref|XP_010661790.1|  PREDICTED: putative pentatricopeptide repeat...  69.3    2e-10   
ref|NP_001231830.1|  CLB1                                             68.6    2e-10   
ref|XP_002967329.1|  hypothetical protein SELMODRAFT_439849           68.2    2e-10   
ref|XP_007200572.1|  hypothetical protein PRUPE_ppa009854mg           67.0    2e-10   
gb|KFK30047.1|  hypothetical protein AALP_AA7G210100                  66.6    2e-10   
ref|XP_001763607.1|  integral membrane single C2 domain protein       68.6    2e-10   
ref|XP_008236567.1|  PREDICTED: formin-like protein 18                66.6    3e-10   
gb|AAY96407.1|  16 kDa. phloem protein 2                              65.1    3e-10   
ref|XP_007200571.1|  hypothetical protein PRUPE_ppa009854mg           66.6    3e-10   
gb|ERZ98793.1|  hypothetical protein GLOINDRAFT_283640                64.7    3e-10   
ref|XP_006339511.1|  PREDICTED: synaptotagmin-4-like isoform X1       68.2    3e-10   
gb|EMT28892.1|  hypothetical protein F775_02399                       67.0    3e-10   
ref|XP_002511861.1|  pentatricopeptide repeat-containing protein,...  68.6    3e-10   
ref|XP_002600004.1|  hypothetical protein BRAFLDRAFT_74122            68.6    3e-10   
ref|XP_009358734.1|  PREDICTED: branchpoint-bridging protein-like     65.9    4e-10   
ref|XP_003075103.1|  C2 domain-containing protein (ISS)               65.9    4e-10   
ref|XP_011000144.1|  PREDICTED: C2 domain-containing protein At1g...  65.5    5e-10   
gb|EPB85108.1|  hypothetical protein HMPREF1544_08160                 64.3    5e-10   
ref|XP_003537311.1|  PREDICTED: formin-like protein 18-like           65.5    5e-10   
gb|EXX74105.1|  Tcb1p                                                 63.9    6e-10   
ref|XP_006422957.1|  hypothetical protein CICLE_v10029976mg           63.9    6e-10   
ref|XP_009622026.1|  PREDICTED: extensin-like                         65.1    6e-10   
gb|KIO02386.1|  hypothetical protein M404DRAFT_667115                 67.8    6e-10   
ref|XP_001755175.1|  integral membrane single C2 domain protein       66.6    9e-10   
gb|EXX74107.1|  Tcb3p                                                 63.5    9e-10   
dbj|GAN01669.1|  elicitor-responsive protein 1-like                   63.5    9e-10   
gb|KJB58567.1|  hypothetical protein B456_009G215200                  65.5    9e-10   
gb|EYU38540.1|  hypothetical protein MIMGU_mgv1a005460mg              66.6    1e-09   
ref|XP_008367185.1|  PREDICTED: LOW QUALITY PROTEIN: branchpoint-...  64.7    1e-09   
gb|AAF21062.1|  calcium-dependent protein kinase                      66.6    1e-09   
ref|XP_002956180.1|  hypothetical protein VOLCADRAFT_97168            65.1    1e-09   
ref|XP_003572794.1|  PREDICTED: elicitor-responsive protein 3         63.5    1e-09   
ref|XP_011088218.1|  PREDICTED: adhesive plaque matrix protein        64.3    1e-09   
gb|KJB32137.1|  hypothetical protein B456_005G225900                  65.1    1e-09   
emb|CDO97208.1|  unnamed protein product                              63.9    2e-09   
emb|CDW82660.1|  xyppx repeat family protein                          63.9    2e-09   
ref|XP_006412268.1|  hypothetical protein EUTSA_v10026060mg           63.9    2e-09   
ref|XP_007136999.1|  hypothetical protein PHAVU_009G091600g           65.5    2e-09   
ref|XP_006356574.1|  PREDICTED: protein transport protein SEC31-like  63.9    2e-09   
ref|XP_009788122.1|  PREDICTED: elicitor-responsive protein 1-lik...  63.9    2e-09   
dbj|GAN05382.1|  hypothetical protein MAM1_0089d04852                 62.4    2e-09   
ref|XP_010096987.1|  Extended synaptotagmin-3                         65.9    2e-09   
ref|XP_006590855.1|  PREDICTED: synaptotagmin-2-like isoform X2       65.5    2e-09   
ref|XP_001697138.1|  hypothetical protein CHLREDRAFT_192466           65.5    2e-09   
emb|CEP07717.1|  hypothetical protein                                 62.0    2e-09   
ref|XP_010648679.1|  PREDICTED: synaptotagmin-5 isoform X2            65.5    2e-09   
ref|XP_001691239.1|  hypothetical protein CHLREDRAFT_94296            61.2    2e-09   
ref|XP_010250240.1|  PREDICTED: synaptotagmin-5-like isoform X1       65.5    3e-09   
emb|CBI21067.3|  unnamed protein product                              65.5    3e-09   
ref|XP_010648678.1|  PREDICTED: synaptotagmin-5 isoform X1            65.5    3e-09   
ref|XP_004159903.1|  PREDICTED: uncharacterized protein LOC101231889  63.5    3e-09   
ref|XP_009769847.1|  PREDICTED: extensin-like                         63.2    3e-09   
ref|XP_010658397.1|  PREDICTED: synaptotagmin-3 isoform X3            65.1    3e-09   
ref|XP_008609447.1|  hypothetical protein SDRG_05509                  64.3    3e-09   
emb|CDX69030.1|  BnaC01g04230D                                        65.1    4e-09   
gb|KHN25474.1|  Synaptotagmin-7                                       63.9    4e-09   
ref|XP_010270400.1|  PREDICTED: synaptotagmin-3-like                  65.1    4e-09   
emb|CEI97236.1|  hypothetical protein RMCBS344292_11372               61.6    4e-09   
ref|XP_009606823.1|  PREDICTED: vacuolar protein-sorting protein ...  62.8    4e-09   
gb|KJB32138.1|  hypothetical protein B456_005G225900                  64.3    4e-09   
ref|XP_011459165.1|  PREDICTED: synaptotagmin-4-like                  64.7    4e-09   
ref|XP_004034724.1|  xyppx repeat family protein                      63.9    4e-09   
ref|XP_002772871.1|  Elicitor-responsive protein, putative            62.0    4e-09   
ref|XP_001319932.1|  C2 domain containing protein                     61.2    5e-09   
ref|XP_010107861.1|  C2 domain-containing protein                     62.8    5e-09   
ref|XP_004169537.1|  PREDICTED: synaptotagmin-4-like                  64.7    5e-09   
ref|XP_006287395.1|  hypothetical protein CARUB_v10000601mg           64.7    5e-09   
ref|XP_007512872.1|  predicted protein                                61.6    5e-09   
gb|KDO73461.1|  hypothetical protein CISIN_1g008214mg                 64.7    5e-09   
ref|NP_567956.1|  calcium-dependent lipid-binding domain-containi...  62.8    5e-09   
gb|KDO73460.1|  hypothetical protein CISIN_1g008214mg                 64.3    6e-09   
ref|XP_006491463.1|  PREDICTED: elicitor-responsive protein 3-like    62.0    6e-09   
ref|XP_006453105.1|  hypothetical protein CICLE_v10007855mg           64.3    6e-09   
gb|KDO73463.1|  hypothetical protein CISIN_1g008214mg                 64.3    6e-09   
ref|XP_010028412.1|  PREDICTED: leucine-rich repeat extensin-like...  62.8    6e-09   
ref|XP_004136361.1|  PREDICTED: synaptotagmin-4-like                  64.3    6e-09   
gb|AFK37292.1|  unknown                                               62.4    6e-09   
ref|XP_008466436.1|  PREDICTED: synaptotagmin-4-like                  64.3    6e-09   
dbj|BAG16524.1|  C2 domain-containing protein                         62.4    6e-09   
ref|XP_003636010.1|  Unc-13-like protein                              62.4    6e-09   
gb|KDO73462.1|  hypothetical protein CISIN_1g008214mg                 64.3    6e-09   
gb|KDO29388.1|  hypothetical protein SPRG_05925                       63.5    6e-09   
emb|CDX91908.1|  BnaC03g32100D                                        64.3    6e-09   
ref|XP_009781504.1|  PREDICTED: synaptotagmin-3-like isoform X3       63.9    7e-09   
dbj|BAH78126.1|  hypothetical protein                                 62.0    7e-09   
emb|CEP07009.1|  hypothetical protein                                 60.8    7e-09   
ref|XP_004248759.1|  PREDICTED: elicitor-responsive protein 1         62.4    7e-09   
emb|CDS05235.1|  hypothetical protein LRAMOSA07764                    60.8    7e-09   
ref|XP_009596609.1|  PREDICTED: synaptotagmin-3-like                  63.9    7e-09   
gb|EPB91183.1|  hypothetical protein HMPREF1544_01888                 60.8    7e-09   
ref|XP_010067312.1|  PREDICTED: synaptotagmin-3 isoform X2            63.5    8e-09   
ref|XP_002313138.1|  hypothetical protein POPTR_0009s10070g           61.6    8e-09   
ref|XP_003517605.1|  PREDICTED: formin-like protein 5-like            62.4    9e-09   
gb|EPS64823.1|  hypothetical protein M569_09959                       60.1    9e-09   
gb|EPZ35595.1|  C2 calcium/lipid-binding, CaLB domain-containing ...  62.4    9e-09   
gb|KJB32325.1|  hypothetical protein B456_005G235700                  61.6    9e-09   
ref|XP_010555014.1|  PREDICTED: synaptotagmin-4                       63.9    9e-09   
gb|KCW55158.1|  hypothetical protein EUGRSUZ_I01113                   62.4    9e-09   



>ref|XP_010055612.1| PREDICTED: elicitor-responsive protein 3 [Eucalyptus grandis]
 gb|KCW72121.1| hypothetical protein EUGRSUZ_E00562 [Eucalyptus grandis]
Length=147

 Score =   215 bits (548),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 3/146 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQG LEV+L +AKGLEN+DFL NMDPY IL CRTQEKKSSVA G+G+ PEW+ETFLF V
Sbjct  1    MPQGKLEVLLVAAKGLENSDFLSNMDPYVILICRTQEKKSSVAQGQGAEPEWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SDGVSEL++K+MDSDN  SDD VGEA IPLE VF+EGS+P  +YNVVKDE + GEIRV+L
Sbjct  61   SDGVSELRLKLMDSDNFSSDDFVGEATIPLEPVFTEGSLPPAAYNVVKDEEYRGEIRVSL  120

Query  429  IFRPEMS--RGFEPEEESYGGWKESS  500
             F PE    R F+P EESYGGWK+SS
Sbjct  121  TFTPEERNERDFQP-EESYGGWKQSS  145



>ref|XP_007040166.1| Elicitor-responsive protein, putative [Theobroma cacao]
 gb|EOY24667.1| Elicitor-responsive protein, putative [Theobroma cacao]
Length=148

 Score =   214 bits (545),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 123/146 (84%), Gaps = 3/146 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQGTLEVVL SAKGLENTDFLCNMDPY +LTCRTQE+KSSVASGKGS+PEW+ETF+FN+
Sbjct  1    MPQGTLEVVLVSAKGLENTDFLCNMDPYVLLTCRTQEQKSSVASGKGSDPEWNETFVFNI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+GVSELK+KIMDSD    DD VGEA IPLE VF EG++P  +YNVVKDE + GEIR+ L
Sbjct  61   SEGVSELKLKIMDSDCSSQDDFVGEATIPLEPVFMEGNLPPAAYNVVKDEEYHGEIRLGL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F PE   +R F+  EES+GGWK+SS
Sbjct  121  TFTPEERHTRDFQV-EESFGGWKQSS  145



>emb|CDP19756.1| unnamed protein product [Coffea canephora]
Length=149

 Score =   213 bits (541),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 124/149 (83%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +GTLEV+L SAKGLENTD L NMDPYAI+TCRTQEKKSSVASG+GS PEW+ETFLF +
Sbjct  1    MQRGTLEVLLVSAKGLENTDLLSNMDPYAIITCRTQEKKSSVASGQGSEPEWNETFLFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+GV+ELKIK+MDSDN+ +DD VGE+ IPL +V +EGS+P  SYNVVKD+ +CGEIR+ L
Sbjct  61   SEGVTELKIKLMDSDNLTNDDFVGESTIPLGAVLAEGSVPIASYNVVKDDKYCGEIRIGL  120

Query  429  IFRPEMS--RGFEPEEESYGGWKESSRDF  509
             F+ E     G+  +EES+GGW +SSRD+
Sbjct  121  NFKREAGSDEGYYGQEESFGGWSQSSRDY  149



>gb|AFK33561.1| unknown [Lotus japonicus]
 gb|AFK33822.1| unknown [Lotus japonicus]
Length=143

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 121/143 (85%), Gaps = 2/143 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQGTLEV+L SAKGLENTD+LCNMDPY ILTCRTQ+++SS+ASGKGS+PEW+E+F+FN+
Sbjct  1    MPQGTLEVLLISAKGLENTDYLCNMDPYVILTCRTQQQQSSIASGKGSDPEWNESFVFNL  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S GVSELK+KIMDSD     D VGEA IPL+++F++G+IP  SYNVVKDE++CGEIR+ L
Sbjct  61   SHGVSELKLKIMDSDTGTGHDFVGEATIPLDALFTDGNIPAMSYNVVKDEHYCGEIRIGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKES  497
             F PE     E +E S+GGWKES
Sbjct  121  TFTPEARD--ERQERSFGGWKES  141



>ref|XP_010255470.1| PREDICTED: elicitor-responsive protein 3 [Nelumbo nucifera]
Length=152

 Score =   207 bits (527),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQGTLEV+L SAKGLEN+D+LCNMDPY ILTCRTQEKKSSVASG+G+ PEW+E F+F V
Sbjct  1    MPQGTLEVLLVSAKGLENSDYLCNMDPYVILTCRTQEKKSSVASGQGAEPEWNENFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +EL IKIMDSD+   DD VGEA I LE +FSEGS+P   YNVVKD+ +CGEI++ L
Sbjct  61   SEGATELNIKIMDSDSGTEDDFVGEATISLEPLFSEGSLPPTPYNVVKDQQYCGEIKIGL  120

Query  429  IFRPE----MSRGFEPEEESYGGWKESSRDF  509
             F P+      RG+  +EESY GWKESS  F
Sbjct  121  TFTPDPEGGCDRGYCAQEESYDGWKESSSSF  151



>gb|EYU38371.1| hypothetical protein MIMGU_mgv1a015742mg [Erythranthe guttata]
Length=147

 Score =   207 bits (527),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +GTLEV+L  AKGLENTDFL NMDPYAI+TCRTQE KSSVASGKGS+PEW+ETF+F V
Sbjct  1    MARGTLEVLLVGAKGLENTDFLSNMDPYAIITCRTQEHKSSVASGKGSDPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD V EL IK++DSD + +DD VGEA IPLE +F EGS+P  SYNVVKDE +CGEI++ L
Sbjct  61   SDDVPELLIKLLDSDGVSADDFVGEAKIPLEPLFLEGSVPPMSYNVVKDEEYCGEIKIGL  120

Query  429  IFRPEMS--RGFEPEEESYGGWKESS  500
             F  E    RGF  EEESYGGWKESS
Sbjct  121  KFTRERRCERGFGEEEESYGGWKESS  146



>ref|XP_011072306.1| PREDICTED: elicitor-responsive protein 3 [Sesamum indicum]
Length=147

 Score =   204 bits (519),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 117/146 (80%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +GTLEV+L  AKGLENTDFL NMDPY  +TCRTQEKKSSVASGKGS+PEW+ETF+F +
Sbjct  1    MVRGTLEVLLVGAKGLENTDFLSNMDPYVTITCRTQEKKSSVASGKGSDPEWNETFVFAL  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+ V EL IKI+DSD +  DD VGEA IPLE +F+EGSIP  SYNVVKDE +CGEIRV L
Sbjct  61   SNDVPELLIKILDSDGVSGDDFVGEAKIPLEPLFAEGSIPPMSYNVVKDEEYCGEIRVGL  120

Query  429  IFRPEMS--RGFEPEEESYGGWKESS  500
             F PE     GF  +EESYGGWKESS
Sbjct  121  NFTPERGCEEGFGEQEESYGGWKESS  146



>ref|XP_009589207.1| PREDICTED: elicitor-responsive protein 3 [Nicotiana tomentosiformis]
Length=144

 Score =   203 bits (517),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV+L  AKGL+NTDFL NMDPY +LTCR+QEKKSSVASGKG  PEW+ETF+F++
Sbjct  1    MARGKLEVLLVGAKGLDNTDFLNNMDPYVVLTCRSQEKKSSVASGKGCEPEWNETFVFSI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+GV EL +KIMDSD++G DD VGEA I +E VFSEGSIP  +YNVVK+E +CGEI+V L
Sbjct  61   SEGVEELFLKIMDSDSVGEDDFVGEAKIAIEPVFSEGSIPTTAYNVVKNEEYCGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F P+  R +E +EESYGGWKESS
Sbjct  121  TFTPQEERDYE-QEESYGGWKESS  143



>ref|XP_002282926.1| PREDICTED: elicitor-responsive protein 3 [Vitis vinifera]
 emb|CBI34741.3| unnamed protein product [Vitis vinifera]
Length=147

 Score =   203 bits (516),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 118/146 (81%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQGTLEV+L  AKGLENTDFLCNMDPY +LTCRTQE+KSSVASGKGS+PEW+E F+F +
Sbjct  1    MPQGTLEVLLVGAKGLENTDFLCNMDPYVVLTCRTQEQKSSVASGKGSDPEWNEHFVFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G+SEL IKIMDSD+   DD VGEA IPLE++F+EGS+    YNVVKD+ +CGEIRV L
Sbjct  61   SEGISELTIKIMDSDSGSGDDFVGEATIPLEALFTEGSLEPAPYNVVKDQEYCGEIRVGL  120

Query  429  IF--RPEMSRGFEPEEESYGGWKESS  500
             F  + E       +EE+YGGWKESS
Sbjct  121  TFTQKGECDGESCAQEENYGGWKESS  146



>ref|XP_008437230.1| PREDICTED: elicitor-responsive protein 3 [Cucumis melo]
Length=149

 Score =   202 bits (514),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 119/146 (82%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L SAKGLENTD+LCNMDPY  LTCR+QE++SSVASGKGS+PEW+ETFLF +
Sbjct  1    MPAGTLEVLLVSAKGLENTDYLCNMDPYVTLTCRSQEQRSSVASGKGSDPEWNETFLFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G  EL +KI+DSD+   DD VG+  IPLE V+ EGS+P+ +YNVVKDE + GEI+++L
Sbjct  61   SEGAEELILKILDSDSGTQDDFVGQVKIPLEPVYLEGSLPETAYNVVKDEEYRGEIKISL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F PE    R F+ EEE+YGGWK+SS
Sbjct  121  KFSPEERTERNFQVEEETYGGWKQSS  146



>ref|XP_003532401.1| PREDICTED: elicitor-responsive protein 3-like [Glycine max]
Length=146

 Score =   201 bits (510),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQG+LEV L +AKGLENTD+LCNMDPY IL CRTQE+KSSVASG+GS PEW+E F+FNV
Sbjct  1    MPQGSLEVFLVNAKGLENTDYLCNMDPYVILICRTQEQKSSVASGQGSEPEWNEAFVFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+GVS+L++KIMDSD+  + D+VGEA IPL+ +F EG+IP  SYNVVKD ++CGEIR+ L
Sbjct  61   SEGVSDLRLKIMDSDSTTAHDLVGEATIPLDGLFIEGNIPPTSYNVVKDGHYCGEIRIGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKES  497
             F P+  R     EE++GGWKES
Sbjct  121  TFTPQ-DRSERCPEENFGGWKES  142



>ref|XP_006827728.1| hypothetical protein AMTR_s00009p00261350 [Amborella trichopoda]
 gb|ERM95144.1| hypothetical protein AMTR_s00009p00261350 [Amborella trichopoda]
Length=147

 Score =   200 bits (509),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 119/148 (80%), Gaps = 7/148 (5%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L SAKGLENTDFLCNMDPYAI+TCRTQE+KSSVASGKG+ PEW+E F+F++
Sbjct  1    MPRGTLEVLLVSAKGLENTDFLCNMDPYAIITCRTQEQKSSVASGKGTEPEWNENFVFSI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SDGVSEL IKIMDSD   +DD VGE  IPLE +F EG++P  +YNVV  D+ +CGEIRV 
Sbjct  61   SDGVSELNIKIMDSDGATADDFVGEVSIPLEPLFMEGNLPPTAYNVVSSDQTYCGEIRVG  120

Query  426  LIFRPEMS----RGFEPEEESYGGWKES  497
            L F PE +    R FE   E++GGWKES
Sbjct  121  LTFTPEETSYADRDFEA--ENFGGWKES  146



>ref|XP_009390540.1| PREDICTED: elicitor-responsive protein 3-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390550.1| PREDICTED: elicitor-responsive protein 3-like [Musa acuminata 
subsp. malaccensis]
Length=144

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV+L  AKGLENTDFLC MDPYA+LTCRTQE+KSSVASGKGS+PEW E+F+F V
Sbjct  1    MVRGKLEVLLVGAKGLENTDFLCKMDPYAVLTCRTQEQKSSVASGKGSDPEWHESFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD V EL IK+MDSD   SDD VGEA IPLE+VF EG+IP   YNVVKD+ +CGEI++ L
Sbjct  61   SDSVPELTIKLMDSDTGSSDDFVGEATIPLEAVFFEGNIPPTVYNVVKDQKYCGEIKIGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F  E +RG +   + YGGW ESS
Sbjct  121  SFIAEETRGSDFLAQRYGGWNESS  144



>gb|KDP25475.1| hypothetical protein JCGZ_20631 [Jatropha curcas]
Length=149

 Score =   199 bits (505),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L +AKGLE+TDFL NMDPY IL+CR+QE+KSSVASGKGSNPEW+E+F+F +
Sbjct  1    MPRGTLEVLLVNAKGLEDTDFLNNMDPYVILSCRSQEQKSSVASGKGSNPEWNESFVFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD V+++++KIMDSD   +DD VGEA+IPLE +F EGS+P  SYNVVKD+ + GEIR+ L
Sbjct  61   SDTVTDIRLKIMDSDVGTADDFVGEAIIPLEPLFMEGSLPTTSYNVVKDQEYKGEIRLGL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F P+   +RGF+ EEE++GG+K+SS
Sbjct  121  NFIPQERTNRGFQAEEENWGGYKQSS  146



>ref|XP_010089150.1| Elicitor-responsive protein 3 [Morus notabilis]
 gb|EXB37397.1| Elicitor-responsive protein 3 [Morus notabilis]
Length=148

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 119/149 (80%), Gaps = 3/149 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L SAKGLENTDFL NMDPY ILT RTQE+KSS+ASGKGS+PEW+ETF+FNV
Sbjct  1    MLQGTLEVLLVSAKGLENTDFLNNMDPYVILTYRTQEQKSSIASGKGSDPEWNETFVFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+GVSEL ++IMDSD I  DD VGE  I LE +  EGSIP  +YNVVKD+ + GEIR+ L
Sbjct  61   SEGVSELGLRIMDSD-ISQDDFVGEITISLEPLLLEGSIPTTTYNVVKDQEYRGEIRIGL  119

Query  429  IFRPEMSR--GFEPEEESYGGWKESSRDF  509
             F+PE+S   G+  EEE +GGWKESS  +
Sbjct  120  TFKPEVSSDIGYGVEEERFGGWKESSSAY  148



>ref|XP_003524467.1| PREDICTED: elicitor-responsive protein 3-like [Glycine max]
 gb|KHN23668.1| Elicitor-responsive protein 3 [Glycine soja]
Length=146

 Score =   198 bits (503),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQG+LEV L +AKGL+NTD+LCNMDPY IL CRTQE+KSSVA+G GS PEW+E F+FNV
Sbjct  1    MPQGSLEVFLVNAKGLDNTDYLCNMDPYVILICRTQEQKSSVATGHGSEPEWNENFVFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+GVS+L++KIMDSD+  + D+VGEA IPL++++ EGSIP  SYNVVKD ++CGEI++ L
Sbjct  61   SEGVSDLRLKIMDSDSTTAHDLVGEATIPLDALYIEGSIPPTSYNVVKDGHYCGEIKIGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKES  497
             F P+  R     EE++GGWKES
Sbjct  121  TFTPQ-DRSERCLEENFGGWKES  142



>gb|AET97660.1| elicitor responsive protein 3 [Camellia sinensis]
Length=147

 Score =   197 bits (500),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 114/146 (78%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L  AKGLENTDFL NMDPY ILTCRTQE+KSSVASGKGS PEW+E+FLF V
Sbjct  1    MPRGTLEVLLVGAKGLENTDFLSNMDPYVILTCRTQEQKSSVASGKGSEPEWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SDG +EL IKIMDSD+  +DD VGEA IPLE VF EGS+   SYNVVKDE + GEI++ L
Sbjct  61   SDGTTELLIKIMDSDHGSADDFVGEATIPLEPVFIEGSMATASYNVVKDEEYHGEIKIGL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F  E      F  +EES+GGWKE S
Sbjct  121  TFTSEEGCEAVFCEQEESFGGWKEFS  146



>ref|XP_009408144.1| PREDICTED: elicitor-responsive protein 3-like [Musa acuminata 
subsp. malaccensis]
Length=143

 Score =   196 bits (499),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 115/145 (79%), Gaps = 2/145 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +GTLEV+L SAKGLE+ DF   MDPYA+LT R+QE+KSS ASG GSNPEW+ETF+FNV
Sbjct  1    MVRGTLEVLLVSAKGLEDVDFFGKMDPYAVLTYRSQEQKSSTASGAGSNPEWNETFVFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD VSEL +KIMDSD    DD VGEA IPLE+VF+EGS+P   Y+VVKD+ +CGEI+V L
Sbjct  61   SDNVSELIVKIMDSDTFSKDDFVGEAKIPLEAVFAEGSLPPTIYSVVKDQRYCGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSR  503
             F P  +RGF  +EE++GGWK S+ 
Sbjct  121  TFTPVETRGF--DEEAFGGWKHSAH  143



>gb|KJB39632.1| hypothetical protein B456_007G022600 [Gossypium raimondii]
Length=148

 Score =   196 bits (497),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQG L+VVL SAKGLENTDFLCNMDPY +LTCRTQE+KSSVASGKGS PEW+E F+FN+
Sbjct  1    MPQGKLQVVLVSAKGLENTDFLCNMDPYVLLTCRTQEQKSSVASGKGSEPEWNEDFIFNI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G SEL +KIMDSD    DD VGE  IPLE VF E +IP  +Y VVKD  + GEI++ L
Sbjct  61   SEGASELALKIMDSDTGSQDDFVGEVAIPLEPVFIERNIPLTAYTVVKDGEYRGEIKLGL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F PE   SR FE  EES+GGWK+SS
Sbjct  121  TFTPEERESRDFEV-EESFGGWKQSS  145



>ref|NP_001047544.1| Os02g0640000 [Oryza sativa Japonica Group]
 dbj|BAD25356.1| putative elicitor-responsive gene-3 [Oryza sativa Japonica Group]
 dbj|BAF09458.1| Os02g0640000 [Oryza sativa Japonica Group]
 dbj|BAH00199.1| unnamed protein product [Oryza sativa Japonica Group]
Length=143

 Score =   195 bits (496),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 114/145 (79%), Gaps = 5/145 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  GTLEV+L  AKGLENTD+LCNMDPYAIL CR+QE++SS+ASGKGSNPEW+E F+F V
Sbjct  1    MVHGTLEVLLVGAKGLENTDYLCNMDPYAILKCRSQEQRSSIASGKGSNPEWNENFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  +EL IK++DSD   +DD VGEA IPLE+V++EGSIP   YNVVKDE++CGEI+V L
Sbjct  61   SDKATELLIKLLDSDTGSADDFVGEATIPLEAVYTEGSIPPTLYNVVKDEHYCGEIKVGL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKES  497
             F PE    RG     E +GGWK+S
Sbjct  121  TFTPEDVRQRGL---PEDFGGWKQS  142



>ref|XP_010918511.1| PREDICTED: elicitor-responsive protein 3-like isoform X1 [Elaeis 
guineensis]
Length=144

 Score =   195 bits (496),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L SAKGLENTDFLCNMDPYAIL  RTQE+KSSVASGKGS+PEW+E+F+F +
Sbjct  1    MVQGTLEVLLVSAKGLENTDFLCNMDPYAILIYRTQEQKSSVASGKGSDPEWNESFVFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD V+EL IK+MDSD  G DD VGEA IPLE +F+EGS+P   YNVVKD+ + GEI+V L
Sbjct  61   SDNVTELCIKLMDSDAGGGDDFVGEAKIPLEPLFAEGSLPPTVYNVVKDQEYHGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F P+ +R    +EE++GGW+ S+
Sbjct  121  TFTPQENRQQGFDEENFGGWRASN  144



>ref|XP_007160032.1| hypothetical protein PHAVU_002G286900g [Phaseolus vulgaris]
 gb|ESW32026.1| hypothetical protein PHAVU_002G286900g [Phaseolus vulgaris]
Length=146

 Score =   195 bits (495),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQGTLEV L  AKGLENTD+L NMDPY I TCRTQE+KSSVA+GKGSNP+W+E F+FN+
Sbjct  1    MPQGTLEVSLVGAKGLENTDYLANMDPYVIFTCRTQEQKSSVATGKGSNPKWNENFVFNI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+GV+EL++KIMDSD++ +DD+VGE  I L+++F EGSIP  SYNVVKD ++ GEIR+ L
Sbjct  61   SEGVNELRLKIMDSDSMSADDLVGEVTISLDALFREGSIPPTSYNVVKDNHYSGEIRIGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKES  497
             F+    R     EE +GGWKES
Sbjct  121  TFKQRDHRE-RCIEEDFGGWKES  142



>ref|XP_003569961.1| PREDICTED: elicitor-responsive protein 3-like [Brachypodium distachyon]
Length=143

 Score =   195 bits (495),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 114/145 (79%), Gaps = 5/145 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  GTLEV+L  AKGLENTD+LCNMDPYA+L CR+QE++SS+ASGKGSNPEW+E F+F V
Sbjct  1    MVHGTLEVLLIGAKGLENTDYLCNMDPYAVLKCRSQEQRSSIASGKGSNPEWNENFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  +EL +K+MDSD+   DD VGEA IPLE+V++EGSIP   YNVVKDE++CGEI+V L
Sbjct  61   SDQATELSVKLMDSDSGTGDDFVGEATIPLEAVYAEGSIPPTVYNVVKDEHYCGEIKVGL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKES  497
             F PE    RG     E +GGWK+S
Sbjct  121  TFTPEDVRQRGL---PEDFGGWKQS  142



>emb|CDP09783.1| unnamed protein product [Coffea canephora]
Length=147

 Score =   195 bits (495),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L +AKGLE+TDFL NMDPY I+TCR+ E+KSSVASG+GS PEW+ETF F +
Sbjct  1    MPRGTLEVLLVNAKGLEDTDFLNNMDPYVIITCRSHEQKSSVASGQGSQPEWNETFQFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD V EL IKI+DSD    DD VGEA IPLE  F EG+IP  +YNVVKDE F GEIRV L
Sbjct  61   SDSVPELVIKILDSDAGSGDDFVGEAKIPLEPAFIEGAIPTTTYNVVKDEEFKGEIRVGL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F PE    R    +EESYGGWKESS
Sbjct  121  TFTPEEGYERDSSAQEESYGGWKESS  146



>ref|XP_006652558.1| PREDICTED: elicitor-responsive protein 3-like [Oryza brachyantha]
Length=144

 Score =   194 bits (493),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QG LEV+L  AKGLENTD+LCNMDPYAIL CR+QE+KSSVASGKGS+PEW+ETF+F+V
Sbjct  1    MVQGMLEVLLVGAKGLENTDYLCNMDPYAILKCRSQEQKSSVASGKGSDPEWNETFMFSV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            +   +EL IK+MDSD+   DD VGEA IPLE++++EGSIP   YNVVKDE + GEI+V L
Sbjct  61   THNATELIIKLMDSDSGTDDDFVGEATIPLEAIYTEGSIPPTVYNVVKDEEYRGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F PE  R     EE  GGWK+SS
Sbjct  121  TFTPEDDRDRGLSEEDIGGWKQSS  144



>ref|XP_004143927.1| PREDICTED: elicitor-responsive protein 3-like [Cucumis sativus]
 ref|XP_004159964.1| PREDICTED: elicitor-responsive protein 3-like [Cucumis sativus]
 gb|KGN50129.1| hypothetical protein Csa_5G154910 [Cucumis sativus]
Length=148

 Score =   194 bits (493),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L SAKGLENTD+LCNMDPY  LTCR+QE+KSSVASGKGS+PEW+ETFLF +
Sbjct  1    MPAGTLEVLLVSAKGLENTDYLCNMDPYVTLTCRSQEQKSSVASGKGSDPEWNETFLFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G  EL +KI DSD    DD VG+  IPLE V+ EGS+P+ +YNVVKDE + GEI++ L
Sbjct  61   SEGAEELILKISDSDTGTQDDFVGQVKIPLEPVYLEGSLPETAYNVVKDEEYRGEIKIRL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F PE    R F+  EE+YGGWK+SS
Sbjct  121  KFSPEERTERNFQV-EETYGGWKQSS  145



>ref|XP_006440580.1| hypothetical protein CICLE_v10024188mg [Citrus clementina]
 gb|ESR53820.1| hypothetical protein CICLE_v10024188mg [Citrus clementina]
 gb|KDO55601.1| hypothetical protein CISIN_1g046962mg [Citrus sinensis]
Length=161

 Score =   194 bits (494),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 117/162 (72%), Gaps = 20/162 (12%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L  AKGL++TDFL NMDPY +L+CRTQEK+SSVASG+G+ P W+E F+F +
Sbjct  1    MPKGTLEVLLVCAKGLQDTDFLSNMDPYVVLSCRTQEKRSSVASGQGTTPNWNENFVFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G + LK+KIMDSD +  DD VGEA+IPL SVF  G++PQQ+YNVVKD+ F GE+RV L
Sbjct  61   SEGTTALKLKIMDSDTVSQDDFVGEAIIPLHSVFEAGNVPQQAYNVVKDKKFQGEVRVGL  120

Query  429  IFRPEMS------------------RGFEPEEESYGGWKESS  500
             F+PE                    RG+    ESYGGWKESS
Sbjct  121  TFKPEGGHGHHSHGRAAGESHSGGDRGYGG--ESYGGWKESS  160



>ref|XP_006477594.1| PREDICTED: C2 domain-containing protein At1g63220-like [Citrus 
sinensis]
Length=160

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 118/161 (73%), Gaps = 19/161 (12%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L  AKGL++TDFL NMDPY +L+CRTQEK+SSVASG+G+ P W+E F+F +
Sbjct  1    MPKGTLEVLLVCAKGLQDTDFLSNMDPYVVLSCRTQEKRSSVASGQGTTPNWNENFVFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G ++LK+KIMDSD +  DD VGEA+IPL SVF  G++PQQ+YNVVKD+ F GE+RV L
Sbjct  61   SEGTTDLKLKIMDSDTLSQDDFVGEAIIPLHSVFEAGNVPQQAYNVVKDKKFQGEVRVGL  120

Query  429  IFRPEMS-----------------RGFEPEEESYGGWKESS  500
             F+PE                   RG+    ESYGGWKESS
Sbjct  121  TFKPEGGHGHHSHGRAGGSYSGGDRGYGG--ESYGGWKESS  159



>ref|XP_006391765.1| hypothetical protein EUTSA_v10023745mg [Eutrema salsugineum]
 gb|ESQ29051.1| hypothetical protein EUTSA_v10023745mg [Eutrema salsugineum]
Length=147

 Score =   194 bits (492),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 115/149 (77%), Gaps = 4/149 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEVVL SAKGLE+TDF+ NMDPY +LTCRTQ++KS+VA G+G+ PEW+ETF+FNV
Sbjct  1    MPRGTLEVVLVSAKGLEDTDFMNNMDPYVLLTCRTQDQKSNVAPGQGTTPEWNETFIFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D D    DD VGEA +PLE VF EG IP  +YNVVKDE F GEI + L
Sbjct  61   SEGTTELKAKIFDKDVGTEDDAVGEATVPLEPVFLEGDIPPSAYNVVKDEEFKGEIWIAL  120

Query  429  IFRP--EMSRGFEPEEESYGGWKESSRDF  509
             F+P  + SRGF  EEESYGGWK S   +
Sbjct  121  SFKPSEDRSRGF--EEESYGGWKNSEASY  147



>ref|XP_002301337.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|ABK94300.1| unknown [Populus trichocarpa]
 gb|EEE80610.2| C2 domain-containing family protein [Populus trichocarpa]
Length=149

 Score =   194 bits (492),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 116/146 (79%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GT++VVL  AKGLENTDF  N+DPY +LTCR+QE++SSVASG+GS PEW+ETF+F +
Sbjct  1    MPEGTIQVVLVGAKGLENTDFFTNIDPYVLLTCRSQEQRSSVASGQGSEPEWNETFVFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G SEL +KI+D D +  DD +G+A IPLE +F EG++P  +YNVVKDE + GEIRV L
Sbjct  61   SEGTSELVLKIVDHDTLTDDDYLGKASIPLEPLFIEGNLPTTAYNVVKDEEYRGEIRVGL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F PE   SR F+  EESYGGWKES+
Sbjct  121  SFTPERRTSRTFDAGEESYGGWKESA  146



>ref|XP_006647585.1| PREDICTED: elicitor-responsive protein 3-like [Oryza brachyantha]
Length=143

 Score =   193 bits (491),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 114/145 (79%), Gaps = 5/145 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  GTLEV+L  AKGLENTD+LCNMDPYA+L CR+QE++SS+ASGKGSNPEW+E F+F V
Sbjct  1    MVHGTLEVLLIGAKGLENTDYLCNMDPYAVLKCRSQEQRSSIASGKGSNPEWNENFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  +EL IK++DSD   +DD VGEA IPLE+V++EGSIP   YNVVKDE++CGEI+V L
Sbjct  61   SDRATELLIKLLDSDTGSADDFVGEATIPLEAVYTEGSIPPTLYNVVKDEHYCGEIKVGL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKES  497
             F PE    RG     E +GGW++S
Sbjct  121  TFTPEDVRQRGL---PEDFGGWRQS  142



>ref|XP_010273137.1| PREDICTED: elicitor-responsive protein 3-like [Nelumbo nucifera]
Length=150

 Score =   193 bits (491),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 111/146 (76%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQG LEV+L SAKGL+NTDFL  MDPY ILTC TQ++KSSVASG+G+ PEW+E F+F V
Sbjct  2    MPQGKLEVLLVSAKGLKNTDFLSKMDPYVILTCCTQQQKSSVASGQGTKPEWNEIFVFTV  61

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S GV+EL IKIMD D    DD VGE+ I L+ +F EGS P   Y+VVKD+ FCGEI+V L
Sbjct  62   SQGVTELHIKIMDRDRFTKDDFVGESTISLKPLFVEGSFPPTPYSVVKDQQFCGEIKVGL  121

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F PE    +G+  EEESYGGWKESS
Sbjct  122  TFTPEDDYEQGYYAEEESYGGWKESS  147



>ref|XP_011023395.1| PREDICTED: C2 domain-containing protein At1g63220 isoform X1 
[Populus euphratica]
Length=149

 Score =   193 bits (490),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 116/146 (79%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GT++V+L  AKGLENTDF  N+DPY +LTCR+QE++SSVASG+GS PEW+ETF+F +
Sbjct  1    MPEGTIQVLLVGAKGLENTDFFSNIDPYVLLTCRSQEQRSSVASGQGSEPEWNETFVFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G SEL +KI+D D +  DD +G+A IPLE +F EG++P  +YNVVKDE + GEIRV L
Sbjct  61   SEGTSELVLKIVDHDTLTDDDYLGKASIPLEPLFIEGNLPTTAYNVVKDEEYRGEIRVGL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F PE   SR F+  EESYGGWKES+
Sbjct  121  SFTPERRTSRAFDAGEESYGGWKESA  146



>ref|XP_009112965.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X1 [Brassica rapa]
 emb|CDY49191.1| BnaA09g10870D [Brassica napus]
Length=147

 Score =   193 bits (490),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 116/149 (78%), Gaps = 4/149 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE++DFL +MDPY +LTCRTQ++KS+VASG+G+ PEW+ETF+FNV
Sbjct  1    MPHGTLEVVLVSAKGLEDSDFLNSMDPYVLLTCRTQDQKSNVASGQGTTPEWNETFIFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D+D    DD +GEA IPLE+VF EG IP  +YNVVKDE F GEI + L
Sbjct  61   SEGTTELKAKIFDTDVGTEDDPLGEATIPLEAVFLEGDIPPAAYNVVKDEEFKGEIWIAL  120

Query  429  IFRP--EMSRGFEPEEESYGGWKESSRDF  509
             F+P    SRGF  EEESYGGWK S   +
Sbjct  121  SFKPSENRSRGF--EEESYGGWKNSEASY  147



>ref|XP_008796734.1| PREDICTED: elicitor-responsive protein 3-like [Phoenix dactylifera]
Length=144

 Score =   192 bits (489),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  AKGLENTDFLCNMDPYAIL CRTQE+KSSVASGKGS+PEW+E+F+F +
Sbjct  1    MVQGTLEVLLVGAKGLENTDFLCNMDPYAILVCRTQEQKSSVASGKGSDPEWNESFVFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  +EL IK+MDSD    DD VGEA IPLE VF+EGS+P   YNVVKD+ + GEI+V L
Sbjct  61   SDNATELCIKLMDSDAGSGDDFVGEAEIPLEPVFAEGSLPPTVYNVVKDQEYRGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F P+ +R     EE++GGW+ S+
Sbjct  121  TFTPQENRQQGFVEENFGGWRASN  144



>gb|KHG14406.1| Elicitor-responsive 3 [Gossypium arboreum]
Length=148

 Score =   192 bits (487),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 113/146 (77%), Gaps = 3/146 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQG L+VVL SAKGLENTDFLCNMDPY +LT RTQE+KSSVASGKGS PEW+E F+FN+
Sbjct  1    MPQGKLQVVLVSAKGLENTDFLCNMDPYVLLTYRTQEQKSSVASGKGSEPEWNEDFIFNI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G SEL +KIMDSD    DD VGE  IPLE VF E +IP  +Y VVKD  + GEI++ L
Sbjct  61   SEGASELALKIMDSDAGSQDDFVGEVAIPLEPVFIESNIPLTAYTVVKDGEYRGEIKLGL  120

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F PE   SR FE  EES+GGWK+SS
Sbjct  121  TFTPEERESRDFEV-EESFGGWKQSS  145



>ref|XP_003627626.1| Elicitor-responsive protein [Medicago truncatula]
 gb|AET02102.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
 gb|AFK37811.1| unknown [Medicago truncatula]
Length=148

 Score =   192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEVVL SAKGLE+ DFL ++DPY ILT R QE KS+V  G GSNP+W+ETFLF V
Sbjct  1    MPRGTLEVVLISAKGLEDNDFLSSIDPYVILTYRAQEHKSTVQEGAGSNPQWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD   EL +KIM+ DN  +DD +GE +IPLE+V  EGS+P+ SY +VKDE +CGE++V L
Sbjct  61   SDTAYELNLKIMEKDNYSADDNLGEVIIPLETVIQEGSVPENSYKLVKDEKYCGEVKVAL  120

Query  429  IFRPEMS--RGFEPEEESYGGWKESSRDF  509
             F PE +  R +  EEE+ GGWK+S+RDF
Sbjct  121  TFTPERNYERSYNQEEET-GGWKQSARDF  148



>ref|XP_006300562.1| hypothetical protein CARUB_v10021114mg [Capsella rubella]
 gb|EOA33460.1| hypothetical protein CARUB_v10021114mg [Capsella rubella]
Length=147

 Score =   191 bits (485),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE+ DFL NMDPY  LTCRTQ++KSSVA+G G+ PEW+ETF+F V
Sbjct  1    MPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSSVATGMGTTPEWNETFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D D    DD VGEA IPLE VF EG IP  +YNVVKDE F GEI V L
Sbjct  61   SEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFLEGDIPPTAYNVVKDEEFKGEIWVAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F+P  +R    EEESYGGWK S   +
Sbjct  121  SFKPSENRSRGVEEESYGGWKNSEASY  147



>ref|XP_010430413.1| PREDICTED: C2 domain-containing protein At1g63220 [Camelina sativa]
Length=147

 Score =   191 bits (485),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE+ DFL NMDPY  LTCRTQ++KSSVA+G G+ PEW+ETF+F V
Sbjct  1    MPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSSVATGMGTTPEWNETFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D D    DD VGEA IPLE VF EG IP  +YNVVKDE F GEI V L
Sbjct  61   SEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFLEGEIPPTAYNVVKDEEFKGEIWVAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F+P  +R    EEESYGGWK S   +
Sbjct  121  SFKPSENRSRGIEEESYGGWKNSEASY  147



>ref|NP_001053394.1| Os04g0531100 [Oryza sativa Japonica Group]
 sp|Q25AG5.1|ERG3_ORYSI RecName: Full=Elicitor-responsive protein 3; AltName: Full=16 
kDa phloem protein; AltName: Full=RPP16 [Oryza sativa Indica 
Group]
 sp|Q0JBH9.1|ERG3_ORYSJ RecName: Full=Elicitor-responsive protein 3; AltName: Full=16 
kDa phloem protein; AltName: Full=RPP16 [Oryza sativa Japonica 
Group]
 gb|AAC35866.1| elicitor-responsive gene-3 [Oryza sativa Indica Group]
 dbj|BAC06444.1| RPP16 [Oryza sativa Japonica Group]
 emb|CAE03867.2| OSJNBa0081C01.13 [Oryza sativa Japonica Group]
 emb|CAH68390.1| B1011H02.6 [Oryza sativa Indica Group]
 dbj|BAF15308.1| Os04g0531100 [Oryza sativa Japonica Group]
 emb|CAJ86400.1| OSIGBa0125M19.3 [Oryza sativa Indica Group]
 gb|EAY94946.1| hypothetical protein OsI_16751 [Oryza sativa Indica Group]
 gb|EAZ31431.1| hypothetical protein OsJ_15565 [Oryza sativa Japonica Group]
 dbj|BAG88779.1| unnamed protein product [Oryza sativa Japonica Group]
Length=144

 Score =   191 bits (484),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  AKGLENTD+LCNMDPYA+L CR+QE+KSSVASGKGS+PEW+ETF+F+V
Sbjct  1    MVQGTLEVLLVGAKGLENTDYLCNMDPYAVLKCRSQEQKSSVASGKGSDPEWNETFMFSV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            +   +EL IK+MDSD+   DD VGEA I LE++++EGSIP   YNVVK+E + GEI+V L
Sbjct  61   THNATELIIKLMDSDSGTDDDFVGEATISLEAIYTEGSIPPTVYNVVKEEEYRGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F PE  R     EE  GGWK+SS
Sbjct  121  TFTPEDDRDRGLSEEDIGGWKQSS  144



>gb|KHN16847.1| Elicitor-responsive protein 3 [Glycine soja]
Length=131

 Score =   190 bits (483),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQG+LEV L +AKGLENTD+LCNMDPY IL CRTQE+KSSVASG+GS PEW+E F+FNV
Sbjct  1    MPQGSLEVFLVNAKGLENTDYLCNMDPYVILICRTQEQKSSVASGQGSEPEWNEAFVFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+GVS+L++KIMDSD+  + D+VGEA IPL+ +F EG+IP  SYNVVKD ++CGEIR+ L
Sbjct  61   SEGVSDLRLKIMDSDSTTAHDLVGEATIPLDGLFIEGNIPPTSYNVVKDGHYCGEIRIGL  120

Query  429  IFRPE  443
             F P+
Sbjct  121  TFTPQ  125



>ref|XP_010418347.1| PREDICTED: C2 domain-containing protein At1g63220-like [Camelina 
sativa]
Length=147

 Score =   191 bits (484),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE+ DFL NMDPY  LTCRTQ++KSSVA+G G+ PEW+ETF+F V
Sbjct  1    MPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSSVATGMGTAPEWNETFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D D    DD VGEA IPLE VF EG IP  +YNVVKDE F GEI V L
Sbjct  61   SEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFLEGEIPPTAYNVVKDEEFKGEIWVAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F+P  +R    EEESYGGWK S   +
Sbjct  121  SFKPSENRSRGIEEESYGGWKNSEASY  147



>ref|XP_010553510.1| PREDICTED: C2 domain-containing protein At1g63220-like [Tarenaya 
hassleriana]
Length=146

 Score =   190 bits (483),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 115/147 (78%), Gaps = 1/147 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQGTLEV+L +AKGLE++DFL NMDPY ++TCRTQ++KSSVASG+GS PEW+ETF+F V
Sbjct  1    MPQGTLEVLLVNAKGLEDSDFLNNMDPYVVITCRTQDQKSSVASGQGSTPEWNETFMFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G SELK+KI+D D    DD VGEA+I LE VF EG IP ++YNVVKDE + GEI V L
Sbjct  61   SEGTSELKLKILDKDTGTQDDSVGEALITLEPVFMEGKIPPKAYNVVKDEEYKGEIWVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F P  +R  +  EESYGGWK+S   +
Sbjct  121  TFTPLETREID-FEESYGGWKQSEESY  146



>ref|XP_009782393.1| PREDICTED: elicitor-responsive protein 3 [Nicotiana sylvestris]
Length=147

 Score =   189 bits (481),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV+L  AKGL+NTDFL NMDPY ILTCR+QEKKSSVASGKG  PEW+E F+F++
Sbjct  1    MSRGMLEVLLVGAKGLDNTDFLNNMDPYVILTCRSQEKKSSVASGKGCEPEWNENFIFSI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+GV EL +KIMDSD++G DD VGEA IP+E V SEGSIP  +YNVVK+E +CGEI+V L
Sbjct  61   SEGVEELFLKIMDSDSVGEDDFVGEAKIPIEPVCSEGSIPTTAYNVVKNEEYCGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F P+     E +EESYGGWKESS
Sbjct  121  TFTPQ-DEREEEQEESYGGWKESS  143



>gb|AFK41181.1| unknown [Lotus japonicus]
Length=148

 Score =   189 bits (481),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 115/148 (78%), Gaps = 1/148 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEVVL  AKGL++++FL N+DPY IL  + QE KS+V  G GSNP+W+ETFLF V
Sbjct  1    MPRGTLEVVLVGAKGLDDSEFLSNIDPYVILAYKAQEHKSTVQEGAGSNPQWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  SEL ++IM+ DN  +DD +GEA+IPL+++F EGS+P+ SYNVVKDE +CGEI+V L
Sbjct  61   SDSASELTLRIMEKDNYNNDDSLGEAIIPLDALFEEGSLPETSYNVVKDEEYCGEIKVAL  120

Query  429  IFRPEMSRGFEP-EEESYGGWKESSRDF  509
             F  E + G+   EEES GGW+ESS D+
Sbjct  121  TFTAERNGGYNAEEEESCGGWRESSGDY  148



>ref|XP_006827727.1| hypothetical protein AMTR_s00009p00261310 [Amborella trichopoda]
 gb|ERM95143.1| hypothetical protein AMTR_s00009p00261310 [Amborella trichopoda]
Length=147

 Score =   189 bits (481),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 114/148 (77%), Gaps = 7/148 (5%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L SAKGLE+ D L NMDPY I+TCRTQE+KSSVASG+G+ P W+E F+F++
Sbjct  1    MPRGTLEVLLVSAKGLESNDILSNMDPYVIITCRTQEQKSSVASGQGTEPNWNENFVFSI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SDGVSEL IKIMD D   SDD VGEA IPLE +F EGSIP  +YNVV  D+ +CGEIRV 
Sbjct  61   SDGVSELNIKIMDKDTFTSDDFVGEASIPLEPLFMEGSIPPTAYNVVSSDQTYCGEIRVG  120

Query  426  LIFRPEMS----RGFEPEEESYGGWKES  497
            L F PE +    R F  E E++GGWKES
Sbjct  121  LTFTPEETSYADRDF--EAENFGGWKES  146



>ref|XP_011091761.1| PREDICTED: elicitor-responsive protein 3-like [Sesamum indicum]
Length=146

 Score =   189 bits (480),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQGTLEVVL SA GLENTDFL NMDPY ILTC++QEKKS VASG+GS+P+W+ETFLF V
Sbjct  1    MPQGTLEVVLVSAIGLENTDFLANMDPYVILTCQSQEKKSKVASGQGSSPKWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S G  EL I+I+D D+  +DDVVGEA IPL  VF +  +P  +YNVVKD+ +CG IR+ L
Sbjct  61   SSGAKELNIRILDKDDFTADDVVGEANIPLAPVFDQEDVPPTTYNVVKDDQYCGGIRIGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRD  506
             F  + +R     EE  GGW+ SSRD
Sbjct  121  KFTHQGARDRGFPEEELGGWRSSSRD  146



>ref|XP_010940440.1| PREDICTED: elicitor-responsive protein 3-like [Elaeis guineensis]
Length=146

 Score =   189 bits (480),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  AKGL++TDFL  MDPYAIL CRTQE++SS+ASG GS+PEW+ETF+F +
Sbjct  1    MVQGTLEVLLVGAKGLDDTDFLSKMDPYAILICRTQEQRSSIASGAGSDPEWNETFVFTL  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            +D VSEL IK+MDSD++ +DD VGEA IPLES+F+EGS+P   YNVVKD+ + GEI+V L
Sbjct  61   TDHVSELTIKLMDSDSVSNDDYVGEAKIPLESLFTEGSLPPTVYNVVKDQEYRGEIKVGL  120

Query  429  IFRPEMS--RGFEPEEESYGGWKESS  500
             F P  S  R     EE+YGGW+ESS
Sbjct  121  TFTPTESCCRHGCSGEENYGGWRESS  146



>ref|XP_010533699.1| PREDICTED: C2 domain-containing protein At1g63220 [Tarenaya hassleriana]
Length=146

 Score =   189 bits (479),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 113/147 (77%), Gaps = 1/147 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L +AKGLE+TDFL NMDPY ++TCRTQ++KSSVASG+GS+PEW+ETF+F V
Sbjct  1    MPHGTLEVLLVNAKGLEDTDFLNNMDPYVVITCRTQDQKSSVASGQGSDPEWNETFMFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            ++G SEL++KI+D D    DD VGEA IPLE VF EG I   +YNVVK+E + GEI V L
Sbjct  61   TEGTSELRMKILDKDTFTEDDFVGEATIPLEPVFIEGKIAPIAYNVVKEEEYKGEIWVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F PE +R  +  EESYGGWK S   +
Sbjct  121  SFTPEETRSLD-FEESYGGWKHSEASY  146



>ref|NP_176511.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 sp|Q9C8S6.1|Y1322_ARATH RecName: Full=C2 domain-containing protein At1g63220 [Arabidopsis 
thaliana]
 gb|AAG52148.1|AC022355_9 putative elicitor-responsive gene; 59810-58583 [Arabidopsis thaliana]
 gb|AAK96814.1| putative elicitor-responsive gene [Arabidopsis thaliana]
 gb|AAM10066.1| putative elicitor-responsive gene [Arabidopsis thaliana]
 gb|AEE34071.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=147

 Score =   189 bits (479),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE+ DFL NMDPY  LTCRTQ++KS+VA G G+ PEW+ETF+F V
Sbjct  1    MPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D D    DD VGEA IPLE VF EGSIP  +YNVVKDE + GEI V L
Sbjct  61   SEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFVEGSIPPTAYNVVKDEEYKGEIWVAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F+P  +R    +EESYGGWK S   +
Sbjct  121  SFKPSENRSRGMDEESYGGWKNSEASY  147



>ref|XP_002887967.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64226.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=147

 Score =   189 bits (479),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE+ DFL NMDPY  LTCRTQ++KSSVA G G+ PEW+ETF+F V
Sbjct  1    MPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSSVAEGMGTTPEWNETFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D D    DD VGEA IPLE VF EGSIP  +YNVVKDE + GEI + L
Sbjct  61   SEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFVEGSIPPTAYNVVKDEEYKGEIWIAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F+P  +R     EESYGGWK S   +
Sbjct  121  SFKPSENRSRGINEESYGGWKNSEASY  147



>gb|AAM63058.1| putative elicitor-responsive gene [Arabidopsis thaliana]
Length=147

 Score =   188 bits (478),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE+ DFL NMDPY  LTCRTQ++KS+VA G G+ PEW+ETF+F V
Sbjct  1    MPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D D    DD VGEA IPLE VF EGSIP  +YNVVKDE + GEI V L
Sbjct  61   SEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFVEGSIPPTAYNVVKDEEYKGEIWVAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F+P  +R    +EESYGGWK S   +
Sbjct  121  SFKPSGNRSRGMDEESYGGWKNSEASY  147



>ref|XP_003627627.1| Elicitor-responsive protein [Medicago truncatula]
 gb|AET02103.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
 gb|AFK38684.1| unknown [Medicago truncatula]
 gb|AFK46100.1| unknown [Medicago truncatula]
Length=148

 Score =   188 bits (478),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 116/149 (78%), Gaps = 3/149 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L SAKGL++ DFL ++DPY IL+   QE KS+V  G GSNP+W+ETFLF V
Sbjct  1    MPRGTLEVILISAKGLDDNDFLSSIDPYVILSYSGQEHKSTVQEGAGSNPQWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  SEL +KIM+ DN  +DD +GEA+IPLE+VF EGS+P+ +YN+VKDE +CGEI+V L
Sbjct  61   SDNASELNLKIMEKDNYNNDDNIGEAIIPLEAVFEEGSLPENAYNLVKDEEYCGEIKVAL  120

Query  429  IFRPEMS--RGFEPEEESYGGWKESSRDF  509
             F PE +  + +  EEE+ GGWKES+ DF
Sbjct  121  TFTPERNDDQSYNEEEET-GGWKESASDF  148



>ref|XP_002452514.1| hypothetical protein SORBIDRAFT_04g027270 [Sorghum bicolor]
 gb|EES05490.1| hypothetical protein SORBIDRAFT_04g027270 [Sorghum bicolor]
Length=143

 Score =   188 bits (478),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 112/144 (78%), Gaps = 1/144 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  GTLEV+L  AKGLENTD+LCNMDPYAIL CR+QE+KSS+A+GKG++PEW+E F+F V
Sbjct  1    MVHGTLEVLLVGAKGLENTDYLCNMDPYAILKCRSQEQKSSIAAGKGTSPEWNENFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  ++L IK+MDSD   +DD VGEA IPLE+V++E SIP   YNVVK E +CGEI+V L
Sbjct  61   SDRTTDLLIKLMDSDTGTADDFVGEATIPLEAVYTERSIPPTCYNVVKGEKYCGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F PE +R      E +GGWK+SS
Sbjct  121  TFTPEDTRQ-RGLPEDFGGWKQSS  143



>ref|XP_009340615.1| PREDICTED: elicitor-responsive protein 3-like [Pyrus x bretschneideri]
Length=156

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 115/152 (76%), Gaps = 8/152 (5%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTL+V+L  AKGL+N DF+ +MDPY +LT +TQEK+S+VASG+GS PEW+ETFLF V
Sbjct  1    MPLGTLQVLLVDAKGLDNNDFMADMDPYVLLTVKTQEKQSTVASGQGSAPEWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SD VSEL +KIM+ DN  +DD VGEA I LE VFSEGS+P  +YNVV KD+ FCGEI++ 
Sbjct  61   SDDVSELHLKIMEKDNFSADDFVGEATICLEPVFSEGSLPPAAYNVVNKDKEFCGEIKIG  120

Query  426  LIFRPEMSR-------GFEPEEESYGGWKESS  500
            L F PE  R       G+   EESYGGWK+SS
Sbjct  121  LTFTPEPERSNDFPSGGYGESEESYGGWKQSS  152



>ref|NP_001265948.1| uncharacterized protein LOC101501238 [Cicer arietinum]
 emb|CAA10133.1| hypothetical protein [Cicer arietinum]
Length=143

 Score =   188 bits (477),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 114/147 (78%), Gaps = 4/147 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEVVL SAKGLE+ DFL ++DPY IL+ R QE KS+V  G GSNP+W+ETFLF V
Sbjct  1    MPRGTLEVVLISAKGLEDNDFLSSIDPYVILSYRAQEHKSTVQEGAGSNPQWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  SEL ++IM+ DN  +DD +GEA+IPLE+VF EGS+ + +Y +VK++ +CGEI+V L
Sbjct  61   SDSASELNLRIMEKDNFNNDDNLGEAIIPLEAVFEEGSLAENAYKLVKEQEYCGEIKVAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F PE +     EEE+ GGWKES+RDF
Sbjct  121  TFTPERN----DEEETCGGWKESTRDF  143



>ref|NP_001152622.1| LOC100286263 [Zea mays]
 gb|ACG48610.1| elicitor-responsive protein 3 [Zea mays]
 gb|ACN27037.1| unknown [Zea mays]
 gb|AFW63159.1| elicitor-responsive protein 3 [Zea mays]
Length=143

 Score =   188 bits (477),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  GTLEV+L  AKGLENTD+LCNMDPYAIL CR+QE+KSS+A+GKG+ PEW+E F+F V
Sbjct  1    MVHGTLEVLLVGAKGLENTDYLCNMDPYAILKCRSQEQKSSIATGKGTTPEWNENFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  ++L IK+MDSD   +DD VGEA IPLE+V++E SIP   YNVVK E +CGEI+V L
Sbjct  61   SDRTTDLVIKLMDSDTGTADDFVGEATIPLEAVYTERSIPPTLYNVVKGEKYCGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F PE +R      E +GGWK+SS
Sbjct  121  TFTPEDTRQ-RGLPEDFGGWKQSS  143



>ref|XP_009112738.1| PREDICTED: C2 domain-containing protein At1g63220 [Brassica rapa]
Length=147

 Score =   188 bits (477),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE+TDFL +MDPY   TCRTQ++KS++ASG+G+ PEW+ETF+FNV
Sbjct  1    MPHGTLEVVLVSAKGLEDTDFLSSMDPYVQFTCRTQDQKSNIASGQGTTPEWNETFIFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D D    DD VGEA IPLE VF EG IP  +YNVVKD  F GEI + L
Sbjct  61   SEGTTELKAKIFDKDVGTEDDPVGEATIPLEPVFLEGDIPPSAYNVVKDGEFKGEIWIAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F+P  +R    EEESYGGWK S   +
Sbjct  121  SFKPSENRSRGVEEESYGGWKNSEASY  147



>ref|XP_010473560.1| PREDICTED: C2 domain-containing protein At1g63220-like [Camelina 
sativa]
Length=147

 Score =   187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE+ DFL NMDPY  LTCRTQ++KSS+A+G G+ PEW+ETF+F V
Sbjct  1    MPHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSSIATGMGTTPEWNETFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +EL  KI D D    DD VGEA IPLE VF EG IP  +YNVVKDE F GEI V L
Sbjct  61   SEGTTELIAKIFDKDVGTEDDAVGEATIPLEPVFLEGEIPPSAYNVVKDEEFKGEIWVAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F+P  +R    EEESYGGWK S   +
Sbjct  121  SFKPSENRSRGIEEESYGGWKNSEASY  147



>emb|CDY49885.1| BnaC09g51250D [Brassica napus]
 emb|CDY45375.1| BnaA09g12600D [Brassica napus]
Length=147

 Score =   187 bits (475),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE+TDFL +MDPY   TCRTQ++KS++ASG+G+ PEW+ETF+FNV
Sbjct  1    MPHGTLEVVLVSAKGLEDTDFLNSMDPYVQFTCRTQDQKSNIASGQGTTPEWNETFIFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D D    DD VGEA IPLE VF EG IP  +YNVVKD  F GEI + L
Sbjct  61   SEGTTELKAKIFDKDVGTEDDPVGEATIPLEPVFLEGDIPPSAYNVVKDGEFKGEIWIAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F+P  +R    EEESYGGWK S   +
Sbjct  121  SFKPSENRSRGVEEESYGGWKNSEASY  147



>ref|XP_010671812.1| PREDICTED: elicitor-responsive protein 3-like [Beta vulgaris 
subsp. vulgaris]
Length=146

 Score =   187 bits (475),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L SAKGLEN+DFL +MDPY ILTCRTQE+KSSVA+  GS PEW+ETF+F +
Sbjct  1    MSQGTLEVLLVSAKGLENSDFLSSMDPYVILTCRTQEQKSSVATDNGSAPEWNETFVFRI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            +    EL +KIMD D   +DD VGEA IPL  VF EGS+P  +YNVVKD  + GEIRV L
Sbjct  61   AGHAPELHLKIMDKDTFTADDFVGEANIPLNIVFEEGSLPPTAYNVVKDGEYKGEIRVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRD  506
             F PE   G +  EE  GGWKESS D
Sbjct  121  TFTPETYHGRDLPEEELGGWKESSYD  146



>ref|XP_008383330.1| PREDICTED: elicitor-responsive protein 3-like [Malus domestica]
Length=156

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 113/152 (74%), Gaps = 8/152 (5%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L  AKGL+N DF+ +MDPY ILT +TQEK S+V SG+GS PEW+ETFLF V
Sbjct  1    MPLGTLEVLLVEAKGLDNNDFMADMDPYVILTVKTQEKNSNVVSGQGSTPEWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SD VSEL +KIM+ DN  +DD VGEA I LE VF+EGS+P  +YNVV KD+ FCGEI++ 
Sbjct  61   SDDVSELNLKIMEKDNFSADDFVGEATICLEPVFTEGSLPPAAYNVVNKDKEFCGEIKIG  120

Query  426  LIFRPEMSR-------GFEPEEESYGGWKESS  500
            L F PE  R       G+   EESYGGWK+SS
Sbjct  121  LTFTPEPERSDNIPSGGYGETEESYGGWKQSS  152



>ref|XP_009376904.1| PREDICTED: elicitor-responsive protein 3-like [Pyrus x bretschneideri]
Length=156

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 113/152 (74%), Gaps = 8/152 (5%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L  AKGL+N DF+ +MDPY ILT +TQEK S+V SG+GS PEW+ETFLF V
Sbjct  1    MPVGTLEVLLVEAKGLDNNDFMADMDPYVILTVKTQEKNSNVVSGQGSTPEWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SD VSEL +KIM+ DN  +DD VGEA I LE VF+EGS+P  +YNVV KD+ FCGEI++ 
Sbjct  61   SDDVSELNLKIMEKDNFSADDFVGEATICLEPVFTEGSLPPAAYNVVNKDKEFCGEIKIG  120

Query  426  LIFRPEMSR-------GFEPEEESYGGWKESS  500
            L F PE  R       G+   EESYGGWK+SS
Sbjct  121  LTFTPEPERSDNIPSGGYGESEESYGGWKQSS  152



>ref|XP_004953244.1| PREDICTED: elicitor-responsive protein 3-like isoform X1 [Setaria 
italica]
Length=143

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 111/144 (77%), Gaps = 1/144 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  GTLEV+L  AKGLENTD+LCNMDPYAIL CR+QE++SS+A+GKG+NPEW+E F+F V
Sbjct  1    MVHGTLEVLLVGAKGLENTDYLCNMDPYAILKCRSQEQRSSIAAGKGTNPEWNENFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  ++L IK+MDSD   +DD VGEA IPLE+V+SE SIP   YNVVK E +CGEI+V L
Sbjct  61   SDRTTDLLIKLMDSDTGTADDFVGEATIPLEAVYSERSIPPTIYNVVKGEKYCGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F PE +R     ++  GGWK+S 
Sbjct  121  TFTPENTRQRGLPDDC-GGWKQSH  143



>ref|XP_002509753.1| Elicitor-responsive protein, putative [Ricinus communis]
 gb|EEF51140.1| Elicitor-responsive protein, putative [Ricinus communis]
Length=174

 Score =   185 bits (469),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  AKGLENTDFL NMDPY ILTCR+QE+KSSVASGKG  PEW+E F+F +
Sbjct  1    MSQGTLEVLLVGAKGLENTDFLNNMDPYVILTCRSQEQKSSVASGKGCEPEWNENFIFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            ++GV+EL +KIMDSD    DD VGEA IPLE +F EGS+P  +YNVVKDE + GEIRV L
Sbjct  61   TEGVTELALKIMDSDAGSQDDFVGEATIPLEPLFLEGSVPSTAYNVVKDEEYKGEIRVAL  120

Query  429  IFRPEM  446
             F+PE+
Sbjct  121  TFKPEL  126



>ref|NP_001235509.1| uncharacterized protein LOC100500006 [Glycine max]
 gb|ACU14574.1| unknown [Glycine max]
 gb|KHN27295.1| C2 domain-containing protein [Glycine soja]
Length=149

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEVVL SAKG+++ DFL ++DPY ILT R QEKKS+V    GS P+W+E+FLF V
Sbjct  1    MPRGTLEVVLISAKGIDDNDFLSSIDPYVILTYRAQEKKSTVQEDAGSKPQWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  SEL +KIMD DN   DD +GEA I L+ VF  GSIP+ +Y VVKDE +CGEI+V L
Sbjct  61   SDSASELNLKIMDKDNFSQDDCLGEATIHLDPVFEAGSIPETAYKVVKDEEYCGEIKVAL  120

Query  429  IFRPEMS--RGFEPEEESYGGWKESSRDF  509
             F  E +  +G++  EESYGGWKESS ++
Sbjct  121  TFTAERNEEQGYDAPEESYGGWKESSGEY  149



>gb|EMS59136.1| Elicitor-responsive protein 3 [Triticum urartu]
Length=144

 Score =   183 bits (464),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  AKGLENTD+LCNMDPYA+L C +QE+KS+VASGKGS+PEW+ETF+F V
Sbjct  1    MAQGTLEVLLVGAKGLENTDYLCNMDPYAVLKCTSQEQKSTVASGKGSDPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+  +EL IK++DSD    DD VGEA IPL+ V++EGSIP   YNVVKDE + GEI++ L
Sbjct  61   SENATELVIKLLDSDGGTDDDSVGEATIPLDGVYTEGSIPPTVYNVVKDEEYRGEIKIGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F PE +R  +  EE+YGGW +SS
Sbjct  121  TFTPEETRNEDQPEENYGGWNQSS  144



>gb|KFK40522.1| hypothetical protein AALP_AA2G006600 [Arabis alpina]
Length=147

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 109/149 (73%), Gaps = 4/149 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL+SAKGLE+TDF+ NMDPY +  CRTQE+KSS++SG+G+ PEW+ETF+F V
Sbjct  1    MPHGTLEVVLSSAKGLEDTDFMNNMDPYVLFICRTQEQKSSISSGQGTTPEWNETFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D D    DD VGEA IPLE VF EG I   +YNVVKD  F GEI + L
Sbjct  61   SEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFVEGEIQPTAYNVVKDGEFKGEIWIAL  120

Query  429  IFRP--EMSRGFEPEEESYGGWKESSRDF  509
             F+P    SRGF  E E+YGGWK S   +
Sbjct  121  SFKPSENRSRGF--ENETYGGWKNSEASY  147



>ref|XP_009349693.1| PREDICTED: elicitor-responsive protein 3-like [Pyrus x bretschneideri]
Length=156

 Score =   183 bits (464),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 111/152 (73%), Gaps = 8/152 (5%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L  AKGL+N DF+ +MDPY ILT +TQEK S+V SG+GS PEW+ETFLF V
Sbjct  1    MPIGTLEVLLVEAKGLDNNDFMADMDPYVILTVKTQEKNSNVVSGQGSTPEWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SD VSEL +KIM+ DN  +DD VGEA I LE VF+EGS+P   YNVV KD+ FCGEI++ 
Sbjct  61   SDDVSELYLKIMEKDNFSADDFVGEATICLEPVFTEGSLPPAPYNVVNKDKEFCGEIKIG  120

Query  426  LIFRPEMSR-------GFEPEEESYGGWKESS  500
            L F PE  R       G+   EESYGGW +SS
Sbjct  121  LTFTPEPERSDNIPSGGYGESEESYGGWTQSS  152



>gb|ADC34699.1| elicitor responsive gene 3 [Triticum aestivum]
Length=144

 Score =   182 bits (462),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  AKGLENTD+LCNMDPYA+L C +QE+KS+VASGKGS+PEW+ETF+F V
Sbjct  1    MAQGTLEVLLVGAKGLENTDYLCNMDPYAVLKCTSQEQKSTVASGKGSDPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+  +EL IK++DSD    DD VGEA IPL+ V++EGSIP   YNVVKDE + GEI++ L
Sbjct  61   SENATELVIKLLDSDGGTDDDSVGEATIPLDGVYTEGSIPPTVYNVVKDEEYRGEIKIGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F PE +R  +  EE+YGGW +SS
Sbjct  121  TFTPEEARDEDQPEENYGGWNQSS  144



>gb|KJB25785.1| hypothetical protein B456_004G209300 [Gossypium raimondii]
Length=192

 Score =   183 bits (464),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 5/147 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQG+LEV LASAKGLE+TDFL  MDPY ILTCRTQE+KSSVAS  GS P W+E F+FNV
Sbjct  1    MPQGSLEVFLASAKGLEDTDFLFKMDPYVILTCRTQEQKSSVAS--GSEPVWNENFIFNV  58

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G  ELK+KIMDSD IG+DD VGEA I L+SV  EG IP  +YN+VK++ FCGEI+V L
Sbjct  59   SEGAEELKLKIMDSD-IGNDDFVGEAEICLKSVLREGRIPPTAYNIVKNKEFCGEIKVGL  117

Query  429  IFRPE--MSRGFEPEEESYGGWKESSR  503
             F PE   SR ++  +E   GWKESS 
Sbjct  118  TFNPEERSSRDYDDRDEYSRGWKESSH  144



>gb|ABK22624.1| unknown [Picea sitchensis]
Length=148

 Score =   181 bits (460),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 113/147 (77%), Gaps = 3/147 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L +A+GLEN+DFLCNMDPY I+ CRTQ++KSSVASG+GSNPEW++ F+F V
Sbjct  1    MPRGTLEVLLVNAEGLENSDFLCNMDPYVIIQCRTQQQKSSVASGQGSNPEWNQQFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            ++GV++L +KIMDSDN   DD VGEA IPLE VF EGS+P   YNVV  D+ +CGEI+V 
Sbjct  61   AEGVTDLTLKIMDSDNANEDDFVGEASIPLEGVFMEGSLPPTHYNVVLPDKTYCGEIKVG  120

Query  426  LIF--RPEMSRGFEPEEESYGGWKESS  500
            L F  + E     E   E  GGWK+SS
Sbjct  121  LTFTIKEEEDCCEEAATEEVGGWKQSS  147



>ref|XP_006358893.1| PREDICTED: elicitor-responsive protein 3-like [Solanum tuberosum]
Length=146

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G L V L  AKGLENTDFL +MDPY ILTCR+QEKKS+VASGKG  PEW+ETF+F++
Sbjct  1    MVRGKLVVQLVGAKGLENTDFLNDMDPYVILTCRSQEKKSTVASGKGCEPEWNETFVFSI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G  EL +KIMDSD+IG DD+VGEA IP+E V SEGSIP   YNVVKDE +CGEI+V L
Sbjct  61   SEGTEELFLKIMDSDSIGEDDIVGEAKIPIEPVLSEGSIPITCYNVVKDEEYCGEIKVGL  120

Query  429  IFRP-EMSRGFEPEEESYGGWKESS  500
             F P E S     EEE+ GGWKESS
Sbjct  121  TFTPEESSEREYEEEENLGGWKESS  145



>ref|XP_004245627.1| PREDICTED: elicitor-responsive protein 3 [Solanum lycopersicum]
Length=145

 Score =   181 bits (459),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G L V L  AKGLENTDFL +MDPY ILT R+QEKKS+VASGKG  PEW+ETF+F++
Sbjct  1    MVRGKLVVQLVGAKGLENTDFLNDMDPYVILTYRSQEKKSTVASGKGCEPEWNETFVFSI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+   EL +KIMDSD+IG DD+VGEA IP+E VFSEGSIP   YNVVKDE +CGEI+V L
Sbjct  61   SEDAEELFLKIMDSDSIGEDDIVGEAKIPIEPVFSEGSIPITCYNVVKDEEYCGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F PE     E EEE+ GGWKESS
Sbjct  121  TFTPEEYSEREYEEENLGGWKESS  144



>ref|XP_004953245.1| PREDICTED: elicitor-responsive protein 3-like isoform X2 [Setaria 
italica]
Length=131

 Score =   181 bits (458),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  GTLEV+L  AKGLENTD+LCNMDPYAIL CR+QE++SS+A+GKG+NPEW+E F+F V
Sbjct  1    MVHGTLEVLLVGAKGLENTDYLCNMDPYAILKCRSQEQRSSIAAGKGTNPEWNENFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  ++L IK+MDSD   +DD VGEA IPLE+V+SE SIP   YNVVK E +CGEI+V L
Sbjct  61   SDRTTDLLIKLMDSDTGTADDFVGEATIPLEAVYSERSIPPTIYNVVKGEKYCGEIKVGL  120

Query  429  IFRPEMS  449
             F PE+ 
Sbjct  121  TFTPEVH  127



>ref|XP_002511813.1| synaptotagmin protein, putative [Ricinus communis]
 gb|EEF50482.1| synaptotagmin protein, putative [Ricinus communis]
Length=140

 Score =   181 bits (458),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 111/144 (77%), Gaps = 4/144 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQGTLEV+L +AK L +TDF+  MDPY  L CR+QE+KSSVASGKGS PEW+ETF+F +
Sbjct  1    MPQGTLEVLLVAAKALPDTDFITKMDPYVRLICRSQEQKSSVASGKGSEPEWNETFVFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G SEL +KIMD D   +DD VGEA+IPLE VF+EGS+   +YNVVKD+ FCGEI++ L
Sbjct  61   SEGASELILKIMDGDRFTNDDFVGEAIIPLEPVFTEGSL---AYNVVKDQEFCGEIKIGL  117

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F PE   G    EESYG W+E++
Sbjct  118  AFTPERV-GRVHTEESYGVWEENA  140



>emb|CDY47345.1| BnaCnng14820D [Brassica napus]
Length=147

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 111/149 (74%), Gaps = 4/149 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE++DFL +MDPY +LTCRTQ++KS+VASG+G+ PEW+ETF+FN 
Sbjct  1    MPHGTLEVVLVSAKGLEDSDFLNSMDPYVLLTCRTQDQKSNVASGQGTTPEWNETFIFNS  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
                +ELK KI D+D    DD +GEA I LE+VF EG IP  +YNVVKDE F GEI + L
Sbjct  61   RVRTTELKAKIFDTDVGTEDDPLGEATISLEAVFLEGDIPPSAYNVVKDEEFKGEIWIAL  120

Query  429  IFRP--EMSRGFEPEEESYGGWKESSRDF  509
             F+P    SRGFE  EESYGGWK S   +
Sbjct  121  SFKPSENRSRGFE--EESYGGWKNSEASY  147



>gb|EMT03713.1| hypothetical protein F775_27946 [Aegilops tauschii]
Length=144

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  AK LENTD+LCNMDPYA+L C +QE+KS+VASGKGS+PEW+ETF+F V
Sbjct  1    MAQGTLEVLLVGAKALENTDYLCNMDPYAVLKCTSQEQKSTVASGKGSDPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+  +EL IK++DSD    DD VGEA IPL+ V++EGSIP   YNVVKDE + GEI++ L
Sbjct  61   SENATELVIKLLDSDGGTDDDSVGEATIPLDGVYTEGSIPPTVYNVVKDEEYRGEIKIGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F PE +R  +  EE+YGGW +SS
Sbjct  121  TFTPEEARDQDQPEENYGGWNQSS  144



>gb|ACN40760.1| unknown [Picea sitchensis]
Length=148

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 113/147 (77%), Gaps = 3/147 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L +A+GLEN+DFLCNMDPY I+ CRTQ++KSSVASG+GSNPEW++ F+F V
Sbjct  1    MPRGTLEVLLVNAEGLENSDFLCNMDPYVIIQCRTQQQKSSVASGQGSNPEWNQQFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            ++GV++L +KIMDSDN   DD VGEA IPLE VF EGS+P   YNVV  D+ +CGEI+V 
Sbjct  61   AEGVTDLTLKIMDSDNANEDDFVGEASIPLEGVFMEGSLPPTPYNVVLPDKTYCGEIKVG  120

Query  426  LIF--RPEMSRGFEPEEESYGGWKESS  500
            L F  + E     E   E  GGWK+SS
Sbjct  121  LTFTIKEEEDCCEEAATEEVGGWKQSS  147



>ref|XP_002446840.1| hypothetical protein SORBIDRAFT_06g023480 [Sorghum bicolor]
 gb|EES11168.1| hypothetical protein SORBIDRAFT_06g023480 [Sorghum bicolor]
Length=133

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  75   QGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVSD  254
            QGTLEV+L  AKGLENTD+L NMDPYA+L CR+ E+KSSVASGKG  PEW+ETF+F VSD
Sbjct  4    QGTLEVLLVGAKGLENTDYLSNMDPYALLQCRSHEQKSSVASGKGCEPEWNETFVFTVSD  63

Query  255  GVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTLIF  434
            G +EL IK++DSD    DD VGEA IPLE+V++EGSIP   YNVVKDE + GEI+V L F
Sbjct  64   GATELFIKLLDSDGGTDDDFVGEATIPLEAVYTEGSIPPTVYNVVKDEEYRGEIKVGLTF  123

Query  435  RPEMSR  452
             PE SR
Sbjct  124  TPEDSR  129



>ref|XP_008668134.1| PREDICTED: LOC100285451 isoform X1 [Zea mays]
Length=130

 Score =   178 bits (452),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  A+GLENTD+L NMDPYA+L CR+ E+KSSVASGKG  PEW+ETF+F V
Sbjct  1    MAQGTLEVLLVGARGLENTDYLSNMDPYALLQCRSHEQKSSVASGKGCEPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SDG +EL IK++DSD    DD VGEA IPLE+V++EG+IP   YNVVKDE + GEI+V L
Sbjct  61   SDGAAELFIKLLDSDGGTDDDFVGEATIPLEAVYTEGNIPPTVYNVVKDEEYRGEIKVGL  120

Query  429  IFRPEMSR  452
             F PE++ 
Sbjct  121  TFTPEVNH  128



>gb|ACU20820.1| unknown [Glycine max]
Length=149

 Score =   178 bits (451),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEVVL SAKG+++ DFL ++DPY ILT R QEKKS+V    GS P+W+E+FLF V
Sbjct  1    MPRGTLEVVLVSAKGIDDNDFLSSIDPYVILTYRAQEKKSTVQEDAGSKPQWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  SEL +KIMD DN   DD +G A I L+ VF  GSIP+ +Y VVKDE +CGEI+V L
Sbjct  61   SDSASELNLKIMDKDNFSQDDCLGVATIHLDPVFEAGSIPETAYKVVKDEEYCGEIKVAL  120

Query  429  IFRPEMS--RGFEPEEESYGGWKESSRDF  509
             F  E +  + +   EESYGGWKESS +F
Sbjct  121  TFTVEKNEEQDYAEPEESYGGWKESSGEF  149



>ref|XP_008778588.1| PREDICTED: elicitor-responsive protein 3-like isoform X2 [Phoenix 
dactylifera]
Length=146

 Score =   177 bits (450),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 114/146 (78%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  AKGL+++DFL  MDPYAIL CRTQE++SS+ASG GS+PEW+ETF+F +
Sbjct  1    MVQGTLEVLLVGAKGLDDSDFLSKMDPYAILICRTQEQRSSIASGAGSDPEWNETFVFTL  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            +D VSEL IK+MDSD++ +DD VGEA I LE +F EGS+P  +YNVVKD+ + GE++V L
Sbjct  61   TDHVSELTIKLMDSDSVSNDDFVGEAKILLEPLFMEGSLPPTAYNVVKDQEYRGEVKVGL  120

Query  429  IFR-PEMSRGFE-PEEESYGGWKESS  500
             F   E  R     EEE+YGGW+ESS
Sbjct  121  TFTLTESCREHGCCEEENYGGWRESS  146



>ref|NP_001151816.1| LOC100285451 [Zea mays]
 gb|ACG44414.1| elicitor-responsive protein 3 [Zea mays]
 tpg|DAA36705.1| TPA: elicitor-responsive protein 3 [Zea mays]
Length=129

 Score =   177 bits (448),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  A+GLENTD+L NMDPYA+L CR+ E+KSSVASGKG  PEW+ETF+F V
Sbjct  1    MAQGTLEVLLVGARGLENTDYLSNMDPYALLQCRSHEQKSSVASGKGCEPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SDG +EL IK++DSD    DD VGEA IPLE+V++EG+IP   YNVVKDE + GEI+V L
Sbjct  61   SDGAAELFIKLLDSDGGTDDDFVGEATIPLEAVYTEGNIPPTVYNVVKDEEYRGEIKVGL  120

Query  429  IFRPEMSRGF  458
             F PE  +GF
Sbjct  121  TFTPE-DQGF  129



>gb|AFW63158.1| hypothetical protein ZEAMMB73_507702 [Zea mays]
Length=169

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  GTLEV+L  AKGLENTD+LCNMDPYAIL CR+QE+KSS+A+GKG+ PEW+E F+F V
Sbjct  1    MVHGTLEVLLVGAKGLENTDYLCNMDPYAILKCRSQEQKSSIATGKGTTPEWNENFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  ++L IK+MDSD   +DD VGEA IPLE+V++E SIP   YNVVK E +CGEI+V L
Sbjct  61   SDRTTDLVIKLMDSDTGTADDFVGEATIPLEAVYTERSIPPTLYNVVKGEKYCGEIKVGL  120

Query  429  IFRPEM  446
             F PE+
Sbjct  121  TFTPEV  126



>gb|KHN04637.1| C2 domain-containing protein [Glycine soja]
Length=149

 Score =   177 bits (450),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEVVL SAKG+++ DFL ++DPY ILT R QEKKS+V    GS P+W+E+FLF V
Sbjct  1    MPRGTLEVVLISAKGIDDNDFLSSIDPYVILTYRAQEKKSTVQEDAGSKPQWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  SEL +KIMD DN   DD +G A I L+ VF  GSIP+ +Y VVKDE +CGEI+V L
Sbjct  61   SDSASELNLKIMDKDNFSQDDCLGVATIHLDPVFEAGSIPETAYKVVKDEEYCGEIKVAL  120

Query  429  IFRPEMS--RGFEPEEESYGGWKESSRDF  509
             F  E +  + +   EESYGGWKESS +F
Sbjct  121  TFTVEKNEEQDYAEPEESYGGWKESSGEF  149



>ref|XP_006364243.1| PREDICTED: C2 domain-containing protein At1g63220-like [Solanum 
tuberosum]
Length=190

 Score =   178 bits (452),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV L +AKGLE+ ++L +M+PY ILTCRTQEK+S VASG+G++PEW+ETF+F +
Sbjct  1    MPSGTLEVFLGNAKGLEDQNWLTSMNPYVILTCRTQEKESGVASGEGTDPEWNETFVFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S  V E+ ++IMD D +GSDD VGEA IPL  V  EG + +++YNVVKDE +CGEI+++L
Sbjct  61   SSDVEEITVRIMDKDTLGSDDFVGEATIPLHEVLREGEVSERAYNVVKDEEYCGEIKLSL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRD  506
             F  E        EE YGG ++S  D
Sbjct  121  TFTSESGSHRGSHEEEYGGRRKSRHD  146



>gb|EPS70123.1| hypothetical protein M569_04644, partial [Genlisea aurea]
Length=124

 Score =   176 bits (445),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVAS-GKGSNPEWDETFLFN  245
            M +GTLEV+L  AKGLENTDFL  +DPYAI+TCRTQEKKSSVAS G+G++PEW+ETFLF 
Sbjct  1    MARGTLEVLLVGAKGLENTDFLGGIDPYAIITCRTQEKKSSVASAGQGTSPEWNETFLFT  60

Query  246  VSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVT  425
            VS GV++LKIKIMD D   SDD +GEA IPLE+VF E  IP  SY+VVKDE +CGEI+V 
Sbjct  61   VSGGVTQLKIKIMDKDTFTSDDFLGEATIPLEAVFEEEEIPPVSYSVVKDEEYCGEIKVG  120

Query  426  LIF  434
            L F
Sbjct  121  LRF  123



>ref|XP_008232757.1| PREDICTED: elicitor-responsive protein 3-like [Prunus mume]
Length=151

 Score =   176 bits (447),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 110/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL  AKGL+NTDFL  +DPY + T +TQEKKS+VA G+G+  EW+E+FLF V
Sbjct  1    MPLGTLEVVLVEAKGLKNTDFLSKIDPYVVFTVKTQEKKSNVAKGQGNEAEWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            S+ VSEL++KIMD D   +DD VGEA IPLE +F+EGS+P   YNVV KD ++ GEI++ 
Sbjct  61   SEDVSELRLKIMDKDTFTADDFVGEATIPLEPLFAEGSLPPTMYNVVNKDRDYHGEIKIG  120

Query  426  LIFRPEMSRG-FEPE----EESYGGWKESS  500
            L F PE  R  F       EE+YGGWKESS
Sbjct  121  LTFTPEPERNSFRSRDYAAEENYGGWKESS  150



>ref|XP_006653041.1| PREDICTED: elicitor-responsive protein 3-like [Oryza brachyantha]
Length=143

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L  AKGLE+TD L NMDPY ILTCRTQE+KSSVA G GS PEW+ETF+F V
Sbjct  1    MVHGKLEVLLVCAKGLEDTDLLNNMDPYVILTCRTQEQKSSVAKGAGSEPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S  V EL +KIMDSD   +DD VGEA IPLE+VF EGS+P   + VVK+E +CGEI+V L
Sbjct  61   SGDVPELNVKIMDSDTFSADDFVGEANIPLEAVFLEGSLPPAVHRVVKEEKYCGEIKVAL  120

Query  429  IFRP--EMSRGFEPEEESYGGW  488
             F P  E       EEE Y  W
Sbjct  121  TFTPAEETRHHHRTEEEGYSSW  142



>ref|XP_003580201.1| PREDICTED: elicitor-responsive protein 3-like [Brachypodium distachyon]
Length=131

 Score =   176 bits (445),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  AKGLENTDFL NMDPYA+L C +QE+KS+VASGKGS+PEW+ETF+F V
Sbjct  1    MAQGTLEVLLVGAKGLENTDFLSNMDPYAVLICTSQEQKSTVASGKGSDPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+  +EL IK++DSDN   DD VGEA IPLE+V++EGSI    YNVVKDE + GEI++ L
Sbjct  61   SENATELIIKLLDSDNGTEDDCVGEATIPLEAVYTEGSISPTVYNVVKDEEYRGEIKIGL  120

Query  429  IFRPE  443
             F PE
Sbjct  121  TFTPE  125



>ref|XP_004960032.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X5 [Setaria italica]
Length=140

 Score =   176 bits (445),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGLE+TDFL NMDPY ILTCRTQE+KSS A+G GS PEW+ETF+F V
Sbjct  1    MVHGKLEVLLVSAKGLEDTDFLNNMDPYVILTCRTQEQKSSAANGAGSEPEWNETFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD   +L +KIMDSD +  DD VGEA IPLE++F EGS+P   + VVK+E +CGEI++ L
Sbjct  61   SDDTPQLHLKIMDSD-VTDDDFVGEATIPLEALFQEGSLPPTVHPVVKEEKYCGEIKIAL  119

Query  429  IFRPEMSRGFEPEEESYGGW  488
             F P  +R  + EE +Y  W
Sbjct  120  TFTPAETRRPDNEEGTYSSW  139



>ref|XP_007135004.1| hypothetical protein PHAVU_010G093800g [Phaseolus vulgaris]
 gb|ESW06998.1| hypothetical protein PHAVU_010G093800g [Phaseolus vulgaris]
Length=147

 Score =   176 bits (445),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 106/147 (72%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L SAKG+++ DFL ++DPY ILT RTQE KS+V    GS P+W+E FLF V
Sbjct  1    MPRGTLEVILISAKGIDDNDFLSSIDPYVILTYRTQEHKSTVQKDSGSKPQWNENFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  SEL +KIMD DN   DD +GEA I L  +F  GS+P+  + VVKDE +CGEI+V L
Sbjct  61   SDSTSELNLKIMDKDNFTQDDFLGEATIDLGPLFEAGSLPETVHKVVKDEEYCGEIKVAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F  E +  +  E+++YGGWKES+ +F
Sbjct  121  TFTAERNEEYSVEDDNYGGWKESNEEF  147



>ref|XP_004976328.1| PREDICTED: elicitor-responsive protein 3-like [Setaria italica]
Length=132

 Score =   175 bits (444),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  AKGLENTD+L NMDPYA+L CR+QE+KSSVASGKG +PEW+ETF+F V
Sbjct  1    MAQGTLEVLLVGAKGLENTDYLSNMDPYAVLRCRSQEQKSSVASGKGCDPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  +EL IK++DSD    DD VGEA IPLE+VF+EGSIP   Y VVKDE + GEI+V L
Sbjct  61   SDSSTELFIKLLDSDGGTDDDFVGEATIPLEAVFTEGSIPPTVYIVVKDEEYRGEIKVGL  120

Query  429  IFRPE  443
             F PE
Sbjct  121  TFTPE  125



>gb|EEC73678.1| hypothetical protein OsI_08227 [Oryza sativa Indica Group]
Length=273

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 114/177 (64%), Gaps = 37/177 (21%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVAS----------------  200
            M  GTLEV+L  AKGLENTD+LCNMDPYAIL CR+QE++SS+AS                
Sbjct  99   MVHGTLEVLLVGAKGLENTDYLCNMDPYAILKCRSQEQRSSIASVLWCIADEWNDLTVKI  158

Query  201  ----------------GKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVGEAVI  332
                            GKGSNPEW+E F+F VSD  +EL IK++DSD   +DD VGEA I
Sbjct  159  IPKECIAMCNFCYVDCGKGSNPEWNENFVFTVSDKATELLIKLLDSDTGSADDFVGEATI  218

Query  333  PLESVFSEGSIPQQSYNVVKDENFCGEIRVTLIFRPE--MSRGFEPEEESYGGWKES  497
            PLE+V++EGSIP   YNVVKDE++CGEI+V L F PE    RG     E +GGWK+S
Sbjct  219  PLEAVYTEGSIPPTLYNVVKDEHYCGEIKVGLTFTPEDVRQRGL---PEDFGGWKQS  272



>ref|XP_008344050.1| PREDICTED: C2 domain-containing protein At1g63220-like [Malus 
domestica]
Length=147

 Score =   175 bits (443),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 109/146 (75%), Gaps = 2/146 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            MP GTLEV+L  AKGL+N DFL N MDPY I T +TQEKKS+VA GKG +PEW+E+FLF 
Sbjct  1    MPLGTLEVLLVEAKGLKNKDFLFNKMDPYVIFTVKTQEKKSTVAKGKGCDPEWNESFLFT  60

Query  246  VSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRV  422
            V+D VSEL++KIMD D    DD VGEA++PLE +F++G +P  +YNVV KD+ + GEI +
Sbjct  61   VTDDVSELRLKIMDKDTFTKDDFVGEAIVPLEPLFADGRLPPTAYNVVNKDQEYRGEIII  120

Query  423  TLIFRPEMSRGFEPEEESYGGWKESS  500
             + F PE +     +EE+YGGWKE S
Sbjct  121  GITFTPEEAASRRYDEENYGGWKELS  146



>ref|XP_009600806.1| PREDICTED: elicitor-responsive protein 3-like [Nicotiana tomentosiformis]
Length=271

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L +AKGLE+ ++L +M+PY ++TCRTQEK+SSVASG+GS PEW+ETFLF +
Sbjct  1    MPTGTLEVILGNAKGLEDQNWLTSMNPYVVITCRTQEKESSVASGEGSEPEWNETFLFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S GV E+ ++IMD D   SDD VGEA I L  VF E  +P +SYNVVKDE +CGEI++ L
Sbjct  61   SQGVEEITLRIMDKDTFSSDDFVGEATISLHEVFREREVPTRSYNVVKDEEYCGEIKLGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F  E +     +EE YGG ++S  D+
Sbjct  121  TFTAESNSERGCDEEGYGGRRQSRDDY  147



>ref|XP_008383313.1| PREDICTED: elicitor-responsive protein 3-like [Malus domestica]
Length=154

 Score =   174 bits (442),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 108/153 (71%), Gaps = 9/153 (6%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCN--------MDPYAILTCRTQEKKSSVASGKGSNPEW  224
            MP GTLEV+L  AKGL+N DFLCN        MDPY I T +TQEKKS+V  GKG +PEW
Sbjct  1    MPLGTLEVLLVEAKGLKNKDFLCNSXPLSFNKMDPYVIFTVKTQEKKSTVXKGKGCDPEW  60

Query  225  DETFLFNVSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDEN  401
            +E+FLF V+D VSEL++KIMD D    DD VGEA++PLE +F++G +P  +YNVV KD+ 
Sbjct  61   NESFLFTVTDDVSELRLKIMDKDTFTKDDFVGEAIVPLEPLFADGRLPPTAYNVVNKDQE  120

Query  402  FCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            + GEI +   F PE +     +EE+YGGWKE S
Sbjct  121  YRGEIIIGJTFTPEEAAXRRYDEENYGGWKELS  153



>ref|XP_009793673.1| PREDICTED: elicitor-responsive protein 3-like [Nicotiana sylvestris]
Length=237

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L +AKGLE+ ++L +M+PY ++TCRTQEK+SSVASG+GS PEW+ETFLF +
Sbjct  1    MPTGTLEVILGNAKGLEDQNWLTSMNPYVVITCRTQEKESSVASGEGSEPEWNETFLFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S GV E+ ++IMD D   SDD VGEA I L  VF E  +P +SYNV++DE +CGE+++ L
Sbjct  61   SQGVEEITLRIMDKDTFSSDDFVGEATISLHEVFREREVPTRSYNVIQDEEYCGELKLGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F  E+      +EE YGG ++S  D+
Sbjct  121  TFTAELGSERGCDEEGYGGRRQSRDDY  147



>ref|XP_008778579.1| PREDICTED: elicitor-responsive protein 3-like isoform X1 [Phoenix 
dactylifera]
Length=147

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 114/147 (78%), Gaps = 3/147 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLC-NMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            M QGTLEV+L  AKGL+++DFL   MDPYAIL CRTQE++SS+ASG GS+PEW+ETF+F 
Sbjct  1    MVQGTLEVLLVGAKGLDDSDFLTGKMDPYAILICRTQEQRSSIASGAGSDPEWNETFVFT  60

Query  246  VSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVT  425
            ++D VSEL IK+MDSD++ +DD VGEA I LE +F EGS+P  +YNVVKD+ + GE++V 
Sbjct  61   LTDHVSELTIKLMDSDSVSNDDFVGEAKILLEPLFMEGSLPPTAYNVVKDQEYRGEVKVG  120

Query  426  LIFR-PEMSRGFE-PEEESYGGWKESS  500
            L F   E  R     EEE+YGGW+ESS
Sbjct  121  LTFTLTESCREHGCCEEENYGGWRESS  147



>ref|XP_009112966.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X2 [Brassica rapa]
Length=139

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 108/149 (72%), Gaps = 12/149 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAK         +MDPY +LTCRTQ++KS+VASG+G+ PEW+ETF+FNV
Sbjct  1    MPHGTLEVVLVSAKD--------SMDPYVLLTCRTQDQKSNVASGQGTTPEWNETFIFNV  52

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D+D    DD +GEA IPLE+VF EG IP  +YNVVKDE F GEI + L
Sbjct  53   SEGTTELKAKIFDTDVGTEDDPLGEATIPLEAVFLEGDIPPAAYNVVKDEEFKGEIWIAL  112

Query  429  IFRP--EMSRGFEPEEESYGGWKESSRDF  509
             F+P    SRGF  EEESYGGWK S   +
Sbjct  113  SFKPSENRSRGF--EEESYGGWKNSEASY  139



>ref|NP_001054294.1| Os04g0682100 [Oryza sativa Japonica Group]
 emb|CAE03432.2| OSJNBa0032F06.15 [Oryza sativa Japonica Group]
 dbj|BAF16208.1| Os04g0682100 [Oryza sativa Japonica Group]
 dbj|BAG92018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78270.1| hypothetical protein OsI_17964 [Oryza sativa Indica Group]
 gb|EEE61924.1| hypothetical protein OsJ_16664 [Oryza sativa Japonica Group]
Length=145

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 100/144 (69%), Gaps = 4/144 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L  AKGLE+TDFL +MDPY ILTCRTQE+KSSVA G GS PEW+ETF+F V
Sbjct  1    MVHGKLEVLLVCAKGLEDTDFLNDMDPYVILTCRTQEQKSSVAKGAGSEPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD V +L +KIMDSD   +DD VGEA IPLE VF EGS+P   + VVK+E +CGEI+V L
Sbjct  61   SDDVPQLNVKIMDSDAFSADDFVGEANIPLEPVFLEGSLPPAVHRVVKEEKYCGEIKVAL  120

Query  429  IFRP----EMSRGFEPEEESYGGW  488
             F P          E E E Y  W
Sbjct  121  TFTPAAETRHHHNHENEGEGYSSW  144



>ref|XP_011023396.1| PREDICTED: C2 domain-containing protein At1g63220 isoform X2 
[Populus euphratica]
Length=141

 Score =   172 bits (435),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 109/146 (75%), Gaps = 10/146 (7%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GT++V+L  AK         N+DPY +LTCR+QE++SSVASG+GS PEW+ETF+F +
Sbjct  1    MPEGTIQVLLVGAK--------ANIDPYVLLTCRSQEQRSSVASGQGSEPEWNETFVFTI  52

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G SEL +KI+D D +  DD +G+A IPLE +F EG++P  +YNVVKDE + GEIRV L
Sbjct  53   SEGTSELVLKIVDHDTLTDDDYLGKASIPLEPLFIEGNLPTTAYNVVKDEEYRGEIRVGL  112

Query  429  IFRPE--MSRGFEPEEESYGGWKESS  500
             F PE   SR F+  EESYGGWKES+
Sbjct  113  SFTPERRTSRAFDAGEESYGGWKESA  138



>ref|XP_007139962.1| hypothetical protein PHAVU_008G073400g [Phaseolus vulgaris]
 gb|ESW11956.1| hypothetical protein PHAVU_008G073400g [Phaseolus vulgaris]
Length=131

 Score =   170 bits (431),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L SA  L N+DF   MDPY ILT RTQE +SSVA G GS P W+E+FLF V
Sbjct  1    MPRGTLEVILTSANHLHNSDFFGKMDPYVILTYRTQEHRSSVAKGAGSKPRWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD VSEL +++MD D +  DD +GE  I LE VF  GSIP+ SYNVVKD+N+CGE++V L
Sbjct  61   SDSVSELSLRLMDKDTLTKDDFLGETRINLEPVFDVGSIPESSYNVVKDQNYCGEVKVAL  120

Query  429  IFRPEMSRGFE  461
             F PE   G E
Sbjct  121  TFNPERGYGEE  131



>ref|XP_007218552.1| hypothetical protein PRUPE_ppa012874mg [Prunus persica]
 gb|EMJ19751.1| hypothetical protein PRUPE_ppa012874mg [Prunus persica]
Length=151

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 110/150 (73%), Gaps = 6/150 (4%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL  A+GL+ TDFL  +DPY + T +TQEKKS+VA G+G+  EW+E+FLF V
Sbjct  1    MPLGTLEVVLVEARGLKKTDFLSKIDPYVVFTVKTQEKKSNVAKGQGNEAEWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            S+ VSEL++KIMD D   +DD VGEA IPLE +F+EGS+P   Y+VV K++++ GEI++ 
Sbjct  61   SEDVSELRLKIMDKDTFTADDFVGEATIPLEPLFAEGSLPPTMYDVVNKNQDYHGEIKIG  120

Query  426  LIFRPEMSR-GFEPE----EESYGGWKESS  500
            L F PE  R  F       EE+YGGWKESS
Sbjct  121  LTFTPEPERSNFRSRDYAAEENYGGWKESS  150



>pdb|1WFJ|A Chain A, C2 Domain-Containing Protein From Putative Elicitor- 
Responsive Gene
Length=136

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +3

Query  72   PQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVS  251
            P GTLEVVL SAKGLE+ DFL NMDPY  LTCRTQ++KS+VA G G+ PEW+ETF+F VS
Sbjct  8    PHGTLEVVLVSAKGLEDADFLNNMDPYVQLTCRTQDQKSNVAEGMGTTPEWNETFIFTVS  67

Query  252  DGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTLI  431
            +G +ELK KI D D    DD VGEA IPLE VF EGSIP  +YNVVKDE + GEI V L 
Sbjct  68   EGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFVEGSIPPTAYNVVKDEEYKGEIWVALS  127

Query  432  FRP  440
            F+P
Sbjct  128  FKP  130



>ref|XP_007219498.1| hypothetical protein PRUPE_ppa022324mg, partial [Prunus persica]
 gb|EMJ20697.1| hypothetical protein PRUPE_ppa022324mg, partial [Prunus persica]
Length=144

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L SAKGL N DFL +MDPY ILT RTQ+KKS++ SG+GS PEW+ETF FNV
Sbjct  1    MPHGTLEVLLVSAKGLHNNDFLADMDPYVILTVRTQDKKSTILSGQGSEPEWNETFSFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDEN-FCGEIRVT  425
            SD V EL++KIMD D+  +DD VGEA +PLE+VF EG++P   YNVV  E  + GEI+V 
Sbjct  61   SDEVDELRLKIMDKDSFSADDFVGEATVPLEAVFIEGNLPPTPYNVVNQEKEYHGEIKVG  120

Query  426  LIFRPEM  446
            L F PE+
Sbjct  121  LTFTPEV  127



>ref|XP_004960033.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X6 [Setaria italica]
Length=138

 Score =   169 bits (427),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 103/140 (74%), Gaps = 3/140 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGLE+TDFL NMDPY ILTCRTQE+KSS A+  GS PEW+ETF+F V
Sbjct  1    MVHGKLEVLLVSAKGLEDTDFLNNMDPYVILTCRTQEQKSSAAN--GSEPEWNETFIFTV  58

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD   +L +KIMDSD +  DD VGEA IPLE++F EGS+P   + VVK+E +CGEI++ L
Sbjct  59   SDDTPQLHLKIMDSD-VTDDDFVGEATIPLEALFQEGSLPPTVHPVVKEEKYCGEIKIAL  117

Query  429  IFRPEMSRGFEPEEESYGGW  488
             F P  +R  + EE +Y  W
Sbjct  118  TFTPAETRRPDNEEGTYSSW  137



>dbj|BAK01234.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=141

 Score =   169 bits (427),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV+L SAKGL+++DF  +MDPY ILTCR+ E+KS+VASG GS PEW+ETF+F V
Sbjct  1    MVRGKLEVLLVSAKGLDDSDFFNSMDPYVILTCRSHEQKSTVASGAGSEPEWNETFVFAV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S    EL++KIMDSD   +DD+VGEA IPLE+VF EGS+P   + V+KDE + GEI++ L
Sbjct  61   SGNAPELRVKIMDSDAFSADDLVGEACIPLEAVFQEGSLPPAVHRVIKDEEYRGEIKIAL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F P        EEESYGGW +S+
Sbjct  121  TFTPAEEDE---EEESYGGWNQST  141



>gb|AAD45283.1| unknown [Zea mays]
Length=128

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGLE+TDFL NMDP+ ILTCRTQE+KSSVA+G GS PEW+ETF+F V
Sbjct  1    MVHGKLEVLLVSAKGLEDTDFLNNMDPFVILTCRTQEQKSSVANGAGSEPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD   +L +KIMDSD + +DD VGEA IPLE+VF EGS+P   + VVK+E +CGE+++ L
Sbjct  61   SDDTPQLHLKIMDSD-LTNDDFVGEATIPLEAVFQEGSLPPAVHPVVKEEKYCGEVKLAL  119

Query  429  IFRP  440
             F P
Sbjct  120  TFTP  123



>ref|XP_010676509.1| PREDICTED: elicitor-responsive protein 3 [Beta vulgaris subsp. 
vulgaris]
Length=148

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEVVL +AKGLENTDFL NMDPY IL+   +++ S VASG+GS PEW+ETF FNV
Sbjct  1    MTQGTLEVVLINAKGLENTDFLNNMDPYVILSYGGRKQNSKVASGQGSEPEWNETFTFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            + G  +L +KI+DSD    DD VGEA IPLE VF EG +P  SYNVVKD+ F G+I+++L
Sbjct  61   NSGGVDLTLKILDSDCGTEDDCVGEATIPLEPVFHEGRVPTTSYNVVKDQEFRGQIKLSL  120

Query  429  IFRPEMSRGFE--PEEESYGGWKESSRD  506
             F  +   G     +  SYGGW+ESS D
Sbjct  121  SFTHKAPSGGRETTQHGSYGGWRESSLD  148



>ref|XP_004248567.1| PREDICTED: C2 domain-containing protein At1g63220-like [Solanum 
lycopersicum]
Length=221

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV L +AKGLE+ ++L +M+PY ILTCRTQEK+SSVASG+G+NPEW+ETF+F +
Sbjct  1    MPSGTLEVFLVNAKGLEDQNWLTSMNPYVILTCRTQEKESSVASGEGTNPEWNETFVFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S  V E+ ++IMD D + SDD VGEA IPL  V  EG + +++YNVVKDE + GEI+++L
Sbjct  61   SGDVEEITLRIMDKDTLSSDDFVGEAKIPLREVLREGEVSERAYNVVKDEEYSGEIKLSL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRD  506
             F+ E       +EE Y G +  SR+
Sbjct  121  TFKSESGSCRGGDEEGYSGRRNKSRN  146



>ref|XP_008232758.1| PREDICTED: elicitor-responsive protein 3-like [Prunus mume]
Length=155

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 100/126 (79%), Gaps = 1/126 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L  AKGL+N DFL +MDPY +LT RTQEKKS+V SG+GS PEW+ETF+F+V
Sbjct  1    MPLGTLEVLLVDAKGLDNNDFLADMDPYVLLTLRTQEKKSNVVSGQGSAPEWNETFVFSV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SD VSEL +KIMD DN  +DD VGEA I LE VF+EGSIP  +YNVV +D+ + GEI+V 
Sbjct  61   SDDVSELHLKIMDKDNFSADDFVGEANISLEPVFTEGSIPPTAYNVVNQDKEYRGEIKVG  120

Query  426  LIFRPE  443
            L F PE
Sbjct  121  LRFTPE  126



>ref|XP_009375786.1| PREDICTED: elicitor-responsive protein 3-like [Pyrus x bretschneideri]
Length=143

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV L +AKGL+NT+F  NMDPY I+TC+ Q+KKS VA+ +GSNPEW+E+F+F V
Sbjct  1    MPRGTLEVNLVNAKGLKNTEFFGNMDPYVIITCKKQQKKSKVATAQGSNPEWNESFVFGV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            +DGV+EL + IMD D   +DD VGE  IPL +++ EG +P   YNV++++ + GEI++  
Sbjct  61   ADGVTELHLMIMDKDTGTADDFVGELSIPLRTIYEEGKLPPMKYNVLRNKKYHGEIKIGF  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F P ++   + E E  GGWKESS
Sbjct  121  TFTPAVTN--DRELEFVGGWKESS  142



>ref|XP_008392558.1| PREDICTED: elicitor-responsive protein 3-like [Malus domestica]
Length=143

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV L +AKGL+NT+F  NMDPY I+TC+ Q+KKS VA+ +GSNPEW+E F+F+V
Sbjct  1    MPRGTLEVNLVNAKGLKNTEFFGNMDPYVIITCKKQQKKSKVATAQGSNPEWNENFVFSV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            +DGV+EL + IMD D   +DD VGE  IPL +++ EG +P   YNV++++ + GEI++  
Sbjct  61   ADGVTELHLMIMDKDTGTADDFVGELSIPLRTIYEEGKLPPMKYNVLRNKKYHGEIKIGF  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F P ++   + E E  GGWKESS
Sbjct  121  TFTPAVTN--DRELEFVGGWKESS  142



>gb|ACR36998.1| unknown [Zea mays]
 gb|AFW59941.1| hypothetical protein ZEAMMB73_175116 [Zea mays]
Length=143

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 105/143 (73%), Gaps = 4/143 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGLE+TDFL NMDP+ ILTCRTQE+KSSVA+G GS PEW+ETF+F V
Sbjct  1    MVHGKLEVLLVSAKGLEDTDFLNNMDPFVILTCRTQEQKSSVANGAGSEPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD   +L +KIMDSD + +DD VGEA IPLE+VF EGS+P   + VVK+E +CGE+++ L
Sbjct  61   SDDTPQLHLKIMDSD-LTNDDFVGEATIPLEAVFQEGSLPPAVHPVVKEEKYCGEVKLAL  119

Query  429  IFRP--EMSRGFEPEE-ESYGGW  488
             F P  E  R  + EE   Y  W
Sbjct  120  TFTPAAETRRPDDNEEGPPYSSW  142



>ref|XP_002447341.1| hypothetical protein SORBIDRAFT_06g033270 [Sorghum bicolor]
 gb|EES11669.1| hypothetical protein SORBIDRAFT_06g033270 [Sorghum bicolor]
Length=136

 Score =   167 bits (422),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGLE+TDFL NMDP+ ILTCRTQE+KSSVA+G GS PEW+ETF+F V
Sbjct  1    MVHGKLEVLLVSAKGLEDTDFLNNMDPFVILTCRTQEQKSSVANGAGSEPEWNETFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD   +L +KIMDSD + +DD VGEA IPLE VF EGS+P   + VVK+E +CGEI++ L
Sbjct  61   SDETPQLHLKIMDSD-VTNDDFVGEATIPLEVVFQEGSLPPAVHPVVKEEKYCGEIKLAL  119

Query  429  IFRP  440
             F P
Sbjct  120  TFTP  123



>ref|XP_004960030.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X3 [Setaria italica]
Length=147

 Score =   167 bits (423),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGLE+TDFL NMDPY ILTCRTQE+KSS A+G GS PEW+ETF+F V
Sbjct  1    MVHGKLEVLLVSAKGLEDTDFLNNMDPYVILTCRTQEQKSSAANGAGSEPEWNETFIFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD   +L +KIMDSD +  DD VGEA IPLE++F EGS+P   + VVK+E +CGEI++ L
Sbjct  61   SDDTPQLHLKIMDSD-VTDDDFVGEATIPLEALFQEGSLPPTVHPVVKEEKYCGEIKIAL  119

Query  429  IFRP  440
             F P
Sbjct  120  TFTP  123



>ref|XP_008232808.1| PREDICTED: glycine-rich cell wall structural protein 2-like [Prunus 
mume]
Length=291

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 106/150 (71%), Gaps = 5/150 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L SAKGL N DFL +MDPY IL  RTQ+KKS++ SG+GS PEW+ETF FNV
Sbjct  1    MPHGTLEVLLVSAKGLHNNDFLADMDPYVILIVRTQDKKSTIVSGQGSEPEWNETFSFNV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDEN-FCGEIRVT  425
            SD V EL++KIMD D+  +DD VGEA +PLE+VF EG++P   YNVV  E  + GEI+V 
Sbjct  61   SDEVDELRLKIMDKDSFSADDFVGEATVPLEAVFIEGNLPPTPYNVVNQEKEYHGEIKVG  120

Query  426  LIFRPE----MSRGFEPEEESYGGWKESSR  503
            L F PE     S  +    ESYGG K SS 
Sbjct  121  LTFTPEGGSHGSGDYGDGSESYGGRKGSSH  150



>ref|XP_008389105.1| PREDICTED: TATA-binding protein-associated factor 2N-like [Malus 
domestica]
Length=287

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 107/151 (71%), Gaps = 6/151 (4%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L SAKGL+N DFL NMDPY ILT RTQ+KKS+V SG+GS PEW+ETF F V
Sbjct  1    MPHGTLEVLLVSAKGLDNNDFLGNMDPYVILTVRTQDKKSTVVSGQGSEPEWNETFSFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SD V EL++KIMD D   SDD +GEA + LE +F+EGS+P   YNVV +D+ + GEI+V 
Sbjct  61   SDDVDELRLKIMDKDTFSSDDFIGEATVALEPLFAEGSLPPTPYNVVNQDKEYSGEIKVG  120

Query  426  LIFRPEM-----SRGFEPEEESYGGWKESSR  503
            L F PE      S G   + E YGG ++ S 
Sbjct  121  LTFTPERSGHGDSSGDYGDSEGYGGERKGSH  151



>gb|AEH05973.1| elicitor-responsive protein [Hevea brasiliensis]
Length=140

 Score =   166 bits (420),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GT+EV+L  AKGLENTDFL  +DPY +L CRTQE+KSSVASGKGS PEW+E F F V
Sbjct  1    MPLGTVEVLLVGAKGLENTDFLNGVDPYVVLACRTQEQKSSVASGKGSEPEWNEKFSFEV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SDG +EL +KIMDSD   +DD VGEA IPLE +F EG++P  +Y VVK++ + GEI V L
Sbjct  61   SDGDTELTLKIMDSDVGAADDFVGEATIPLEPLFLEGNLPSTAYKVVKEQEYKGEITVGL  120

Query  429  IFRPEM  446
             F PE+
Sbjct  121  TFTPEV  126



>ref|XP_007218373.1| hypothetical protein PRUPE_ppa011300mg [Prunus persica]
 gb|EMJ19572.1| hypothetical protein PRUPE_ppa011300mg [Prunus persica]
Length=196

 Score =   168 bits (425),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +3

Query  63   PSMPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLF  242
            P+MP GTLEV+L  AKGL+N DFL +MDPY +LT RTQEKKS+V SG+GS PEW+ETF+F
Sbjct  40   PNMPLGTLEVLLVDAKGLDNNDFLADMDPYVLLTLRTQEKKSNVVSGQGSAPEWNETFVF  99

Query  243  NVSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIR  419
             VSD VSEL +KIMD DN  +DD VGEA I LE VF+EG IP  +YNVV +D+ + GEI+
Sbjct  100  TVSDDVSELHLKIMDKDNFSADDFVGEATISLEPVFTEGGIPPTAYNVVNQDKEYRGEIK  159

Query  420  VTLIFRPE  443
            V L F PE
Sbjct  160  VGLRFTPE  167



>ref|XP_004300766.1| PREDICTED: elicitor-responsive protein 3-like [Fragaria vesca 
subsp. vesca]
Length=143

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQGTL+V L +AKGL+NT+F   MDPY I+ C+ QEK+S VA+ +GS P W+E F+F V
Sbjct  1    MPQGTLDVHLMNAKGLKNTEFFGKMDPYVIIQCKNQEKRSKVATSQGSKPVWNEKFVFRV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            ++GV+ELK+ IMD D    DD VGE  IPL+++F EG  P   YNV++++ + GEI+V L
Sbjct  61   TEGVTELKLTIMDKDTAVRDDFVGELSIPLKTLFQEGKFPPMKYNVLRNKKYYGEIKVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F P + R  +  EES+GGWKESS
Sbjct  121  SFTPSVQR--DISEESFGGWKESS  142



>ref|XP_003551645.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X1 [Glycine max]
 gb|KHN03172.1| C2 domain-containing protein [Glycine soja]
Length=135

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L SAK L+++DF   MDPY ILT R Q+ +SSVA G GS P W+E+FLF V
Sbjct  1    MPRGTLEVILISAKDLKDSDFFGKMDPYVILTYRAQKHRSSVAKGAGSKPRWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD VSEL +++MD D + SDD +G+A I LE VF+ GSIP+ SYNVVKD+ +CGEI+V L
Sbjct  61   SDSVSELNLRLMDQDLLTSDDFLGDAKINLEPVFAVGSIPETSYNVVKDQKYCGEIKVAL  120

Query  429  IFRPEMSRGF  458
             F PE   G 
Sbjct  121  TFNPERGSGL  130



>ref|XP_004498695.1| PREDICTED: elicitor-responsive protein 3-like [Cicer arietinum]
Length=129

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L  AK L +TDF   MDPY ILT R+QE KSSVA   GSNP W+E+FLF V
Sbjct  1    MPRGTLEVILIGAKALRDTDFFKKMDPYVILTYRSQEHKSSVAKNAGSNPRWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
             D VSEL +++MD D    DD++GEA I L +V +E SIP+ +YNVVK+EN+CGE+RV L
Sbjct  61   CDNVSELNLRLMDEDTFTKDDLLGEAKIHLGAVIAERSIPESAYNVVKNENYCGEVRVAL  120

Query  429  IFRPE  443
             F PE
Sbjct  121  TFHPE  125



>ref|XP_009376903.1| PREDICTED: elicitor-responsive protein 3-like isoform X2 [Pyrus 
x bretschneideri]
Length=133

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            MP GTLEV+L  AKGL+N DFL N MDPY I T +TQEKKS+VA GKGS+PEW+E+FLF 
Sbjct  1    MPLGTLEVLLVEAKGLKNKDFLFNKMDPYVIFTVKTQEKKSTVAKGKGSDPEWNESFLFT  60

Query  246  VSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRV  422
            V+D VSEL++KIMD D    DD VGEA++PLE +F++G +P  +YNVV KD+ + GEI +
Sbjct  61   VTDDVSELRLKIMDKDTFTKDDFVGEAIVPLEPLFADGRLPPTAYNVVNKDQEYRGEIII  120

Query  423  TLIFRPEMSR  452
             L F PE  R
Sbjct  121  GLTFTPEPQR  130



>ref|XP_004306823.1| PREDICTED: elicitor-responsive protein 3-like [Fragaria vesca 
subsp. vesca]
Length=158

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 105/155 (68%), Gaps = 12/155 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L  A GL+N DF+ +MDPY +LT  TQEKKS+V S +GSNPEW+ETFLF V
Sbjct  1    MPIGTLEVLLVDASGLDNNDFMADMDPYVLLTVNTQEKKSTVVSAQGSNPEWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDEN-FCGEIRVT  425
            SD  ++L +KIM+ DN  +DD VGEA I LE VF EGS+   SYNVV  E  +CG I+V 
Sbjct  61   SDDSADLHLKIMEKDNFSADDYVGEATISLEPVFEEGSLLPTSYNVVNQEKEYCGGIKVG  120

Query  426  LIFRPEMS----------RGFEPEEESYGGWKESS  500
            L F PE             G E  EESYGGWK+S+
Sbjct  121  LKFTPETKPEERSEYGSGEGAEA-EESYGGWKQSA  154



>ref|NP_001105741.1| uncharacterized protein LOC542763 [Zea mays]
 gb|AAB06331.1| novel protein [Zea mays]
Length=143

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 104/143 (73%), Gaps = 4/143 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGLE+TDFL NMDP+ ILTCRTQE+KSSVA+G GS PEW+ETF+F V
Sbjct  1    MVHGKLEVLLVSAKGLEDTDFLNNMDPFVILTCRTQEQKSSVANGAGSEPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD   +L +KIMDSD + +DD VGE  IPLE+VF EGS+P   + VVK+E +CGE+++ L
Sbjct  61   SDDTPQLHLKIMDSD-LTNDDFVGERTIPLEAVFQEGSLPPAVHPVVKEEKYCGEVKLAL  119

Query  429  IFRP--EMSRGFEPEE-ESYGGW  488
             F P  E  R  + EE   Y  W
Sbjct  120  TFTPAAETRRPDDNEEGPPYSSW  142



>gb|ABK26300.1| unknown [Picea sitchensis]
Length=140

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L +AKGL+ TDFLC MDPY I+ CRTQ++KS+VAS +G NPEW+E FLFN+
Sbjct  1    MPKGTLEVLLLNAKGLQTTDFLCKMDPYCIIKCRTQQQKSTVASDQGRNPEWNEKFLFNI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            S+GVS+L I+IMD D   +DD +GEA IPL+ VF  G++P  +YNVV  D  +CG+I+V 
Sbjct  61   SEGVSDLVIRIMDKDTFTADDFIGEANIPLDGVFEAGNLPPLTYNVVMGDYTYCGQIKVG  120

Query  426  LIFRPEMSR  452
            L F P+  +
Sbjct  121  LTFIPKTEK  129



>ref|XP_009376934.1| PREDICTED: C2 domain-containing protein At1g63220-like [Pyrus 
x bretschneideri]
Length=272

 Score =   168 bits (426),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 107/151 (71%), Gaps = 6/151 (4%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L SAKGL+N DFL NMDPY ILT RTQ+KKS+V SG+GS PEW+ETF F V
Sbjct  1    MPHGTLEVLLVSAKGLDNNDFLGNMDPYVILTVRTQDKKSTVVSGQGSEPEWNETFSFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SD V EL++KIMD D   SDD +GEA + LE +F+EGS+P   YNVV +D+ + GEI+V 
Sbjct  61   SDDVDELRLKIMDKDTFSSDDFIGEATVALEPLFAEGSLPPTPYNVVNQDKEYSGEIKVG  120

Query  426  LIFRPEM-----SRGFEPEEESYGGWKESSR  503
            L F  E      S G   + ESYGG ++ S 
Sbjct  121  LTFTLERSGHGDSSGDYGDVESYGGGRKGSH  151



>ref|XP_009349691.1| PREDICTED: glycine-rich cell wall structural protein 1.0-like 
[Pyrus x bretschneideri]
Length=314

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 107/151 (71%), Gaps = 6/151 (4%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L SAKGL+N DFL NMDPY ILT RTQ+KKS+V SG+GS PEW+ETF F V
Sbjct  1    MPHGTLEVLLVSAKGLDNNDFLGNMDPYVILTVRTQDKKSTVVSGQGSEPEWNETFSFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SD V EL++KIMD D   SDD +GEA + LE +F+EGS+P   YNVV +D+ + GEI+V 
Sbjct  61   SDDVDELRLKIMDKDTFSSDDFIGEATVALEPLFAEGSLPPTPYNVVNQDKEYSGEIKVG  120

Query  426  LIFRPEM-----SRGFEPEEESYGGWKESSR  503
            L F  E      S G   + ESYGG ++ S 
Sbjct  121  LTFTLERSGHGDSSGDYGDVESYGGGRKGSH  151



>ref|XP_011093160.1| PREDICTED: elicitor-responsive protein 3-like [Sesamum indicum]
Length=146

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L SAKGL++TDFL + DPYAILTCRTQEKKSSVASG GS+PEW+ETFLF V
Sbjct  1    MSQGTLEVLLVSAKGLDDTDFLSSTDPYAILTCRTQEKKSSVASGAGSSPEWNETFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S GV+ELKIKI+D D    DD +GEA IPLE+VF+  S+P  SY+VVKD+ + GEIRV L
Sbjct  61   SGGVTELKIKILDKDTFTDDDFLGEATIPLEAVFAAESVPPTSYSVVKDQEYRGEIRVGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F  + SR  E   E +GGWKESS
Sbjct  121  KFTHQESRDREFFVEEFGGWKESS  144



>ref|XP_009376902.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X1 [Pyrus x bretschneideri]
Length=134

 Score =   162 bits (410),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 98/131 (75%), Gaps = 3/131 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLC--NMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLF  242
            MP GTLEV+L  AKGL+N DFL    MDPY I T +TQEKKS+VA GKGS+PEW+E+FLF
Sbjct  1    MPLGTLEVLLVEAKGLKNKDFLSVNKMDPYVIFTVKTQEKKSTVAKGKGSDPEWNESFLF  60

Query  243  NVSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIR  419
             V+D VSEL++KIMD D    DD VGEA++PLE +F++G +P  +YNVV KD+ + GEI 
Sbjct  61   TVTDDVSELRLKIMDKDTFTKDDFVGEAIVPLEPLFADGRLPPTAYNVVNKDQEYRGEII  120

Query  420  VTLIFRPEMSR  452
            + L F PE  R
Sbjct  121  IGLTFTPEPQR  131



>ref|XP_006491030.1| PREDICTED: elicitor-responsive protein 3-like isoform X2 [Citrus 
sinensis]
Length=136

 Score =   162 bits (409),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L   KGLE++DFL ++DPY +LTCRTQE+KSS+ SG G  PEW+ETF+F +
Sbjct  1    MPRGTLEVLLVGCKGLEDSDFLGSVDPYVVLTCRTQEQKSSIGSGSG--PEWNETFVFTI  58

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            +  V+EL +KIMD D   +DD +GEA I LE +F EGS+P  +YNVVK++ +CGEIRV L
Sbjct  59   TGDVTELTLKIMDKDTFSNDDYLGEATISLEPLFMEGSLPPTAYNVVKNQEYCGEIRVGL  118

Query  429  IFRPEM  446
             F PE+
Sbjct  119  TFTPEI  124



>gb|ACG31673.1| hypothetical protein [Zea mays]
Length=129

 Score =   161 bits (407),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGLE+TDFL NMDP+ ILTCRTQE+KSSVA+G GS PEW+ETF+F V
Sbjct  1    MVHGKLEVLLVSAKGLEDTDFLNNMDPFVILTCRTQEQKSSVANGAGSEPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD   +L +KIMDSD + +DD VGEA IPLE+VF EGS+P   + VVK+E +CGE+++  
Sbjct  61   SDDTPQLHLKIMDSD-LTNDDFVGEATIPLEAVFQEGSLPPAVHPVVKEEKYCGEVKLAH  119

Query  429  I  431
            +
Sbjct  120  L  120



>ref|XP_006602765.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X2 [Glycine max]
Length=133

 Score =   160 bits (406),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 97/130 (75%), Gaps = 2/130 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L SAK L+++DF   MDPY ILT R Q+ +SSVA  KGS P W+E+FLF V
Sbjct  1    MPRGTLEVILISAKDLKDSDFFGKMDPYVILTYRAQKHRSSVA--KGSKPRWNESFLFTV  58

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD VSEL +++MD D + SDD +G+A I LE VF+ GSIP+ SYNVVKD+ +CGEI+V L
Sbjct  59   SDSVSELNLRLMDQDLLTSDDFLGDAKINLEPVFAVGSIPETSYNVVKDQKYCGEIKVAL  118

Query  429  IFRPEMSRGF  458
             F PE   G 
Sbjct  119  TFNPERGSGL  128



>gb|EEE57455.1| hypothetical protein OsJ_07677 [Oryza sativa Japonica Group]
Length=212

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 107/174 (61%), Gaps = 37/174 (21%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVAS-------------------  200
            G      +  +GLENTD+LCNMDPYAIL CR+QE++SS+AS                   
Sbjct  41   GRWRCCSSGPRGLENTDYLCNMDPYAILKCRSQEQRSSIASVLWCIADEWNDLTVRIIPK  100

Query  201  -------------GKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVGEAVIPLE  341
                         GKGSNPEW+E F+F VSD  +EL IK++DSD   +DD VGEA IPLE
Sbjct  101  ECIAMCNFCYVDCGKGSNPEWNENFVFTVSDKATELLIKLLDSDTGSADDFVGEATIPLE  160

Query  342  SVFSEGSIPQQSYNVVKDENFCGEIRVTLIFRPE--MSRGFEPEEESYGGWKES  497
            +V++EGSIP   YNVVKDE++CGEI+V L F PE    RG     E +GGWK+S
Sbjct  161  AVYTEGSIPPTLYNVVKDEHYCGEIKVGLTFTPEDVRQRGL---PEDFGGWKQS  211



>ref|XP_004960031.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X4 [Setaria italica]
Length=145

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 95/124 (77%), Gaps = 3/124 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGLE+TDFL NMDPY ILTCRTQE+KSS A+  GS PEW+ETF+F V
Sbjct  1    MVHGKLEVLLVSAKGLEDTDFLNNMDPYVILTCRTQEQKSSAAN--GSEPEWNETFIFTV  58

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD   +L +KIMDSD +  DD VGEA IPLE++F EGS+P   + VVK+E +CGEI++ L
Sbjct  59   SDDTPQLHLKIMDSD-VTDDDFVGEATIPLEALFQEGSLPPTVHPVVKEEKYCGEIKIAL  117

Query  429  IFRP  440
             F P
Sbjct  118  TFTP  121



>ref|XP_006491029.1| PREDICTED: elicitor-responsive protein 3-like isoform X1 [Citrus 
sinensis]
Length=137

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 98/127 (77%), Gaps = 3/127 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLC-NMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            MP+GTLEV+L   KGLE++DFL  ++DPY +LTCRTQE+KSS+ SG G  PEW+ETF+F 
Sbjct  1    MPRGTLEVLLVGCKGLEDSDFLAGSVDPYVVLTCRTQEQKSSIGSGSG--PEWNETFVFT  58

Query  246  VSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVT  425
            ++  V+EL +KIMD D   +DD +GEA I LE +F EGS+P  +YNVVK++ +CGEIRV 
Sbjct  59   ITGDVTELTLKIMDKDTFSNDDYLGEATISLEPLFMEGSLPPTAYNVVKNQEYCGEIRVG  118

Query  426  LIFRPEM  446
            L F PE+
Sbjct  119  LTFTPEI  125



>ref|XP_007218375.1| hypothetical protein PRUPE_ppa011300mg [Prunus persica]
 gb|EMJ19574.1| hypothetical protein PRUPE_ppa011300mg [Prunus persica]
Length=175

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 109/172 (63%), Gaps = 29/172 (17%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L  AKGL+N DFL +MDPY +LT RTQEKKS+V SG+GS PEW+ETF+F V
Sbjct  1    MPLGTLEVLLVDAKGLDNNDFLADMDPYVLLTLRTQEKKSNVVSGQGSAPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SD VSEL +KIM+ DN  +DD VGEA I LE +F+EGSIP  +YNVV +D+ + GEI+V 
Sbjct  61   SDDVSELHLKIMEKDNFSADDFVGEATISLEPIFTEGSIPPTAYNVVNQDKEYRGEIKVG  120

Query  426  LIFRPEMSRGFEPEEESYG---------------------------GWKESS  500
            L F PE  +  E     YG                           GWK+SS
Sbjct  121  LRFTPEPEQN-EGASGEYGRNDGPSGGYGRNDGPSGEYGGSEEGYGGWKQSS  171



>ref|XP_007218551.1| hypothetical protein PRUPE_ppa012874mg [Prunus persica]
 gb|EMJ19750.1| hypothetical protein PRUPE_ppa012874mg [Prunus persica]
Length=130

 Score =   157 bits (396),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL  A+GL+ TDFL  +DPY + T +TQEKKS+VA G+G+  EW+E+FLF V
Sbjct  1    MPLGTLEVVLVEARGLKKTDFLSKIDPYVVFTVKTQEKKSNVAKGQGNEAEWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            S+ VSEL++KIMD D   +DD VGEA IPLE +F+EGS+P   Y+VV K++++ GEI++ 
Sbjct  61   SEDVSELRLKIMDKDTFTADDFVGEATIPLEPLFAEGSLPPTMYDVVNKNQDYHGEIKIG  120

Query  426  LIFRPE  443
            L F PE
Sbjct  121  LTFTPE  126



>ref|XP_006491031.1| PREDICTED: elicitor-responsive protein 3-like isoform X3 [Citrus 
sinensis]
Length=131

 Score =   157 bits (397),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLC-NMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            MP+GTLEV+L   KGLE++DFL  ++DPY +LTCRTQE+KSS+ SG G  PEW+ETF+F 
Sbjct  1    MPRGTLEVLLVGCKGLEDSDFLAGSVDPYVVLTCRTQEQKSSIGSGSG--PEWNETFVFT  58

Query  246  VSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVT  425
            ++  V+EL +KIMD D   +DD +GEA I LE +F EGS+P  +YNVVK++ +CGEIRV 
Sbjct  59   ITGDVTELTLKIMDKDTFSNDDYLGEATISLEPLFMEGSLPPTAYNVVKNQEYCGEIRVG  118

Query  426  LIFRPE  443
            L F PE
Sbjct  119  LTFTPE  124



>ref|XP_007218374.1| hypothetical protein PRUPE_ppa011300mg [Prunus persica]
 gb|EMJ19573.1| hypothetical protein PRUPE_ppa011300mg [Prunus persica]
Length=216

 Score =   160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 111/174 (64%), Gaps = 29/174 (17%)
 Frame = +3

Query  63   PSMPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLF  242
            P+MP GTLEV+L  AKGL+N DFL +MDPY +LT RTQEKKS+V SG+GS PEW+ETF+F
Sbjct  40   PNMPLGTLEVLLVDAKGLDNNDFLADMDPYVLLTLRTQEKKSNVVSGQGSAPEWNETFVF  99

Query  243  NVSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIR  419
             VSD VSEL +KIM+ DN  +DD VGEA I LE +F+EGSIP  +YNVV +D+ + GEI+
Sbjct  100  TVSDDVSELHLKIMEKDNFSADDFVGEATISLEPIFTEGSIPPTAYNVVNQDKEYRGEIK  159

Query  420  VTLIFRPEMSRGFEPEEESYG---------------------------GWKESS  500
            V L F PE  +  E     YG                           GWK+SS
Sbjct  160  VGLRFTPEPEQN-EGASGEYGRNDGPSGGYGRNDGPSGEYGGSEEGYGGWKQSS  212



>ref|XP_008232759.1| PREDICTED: elicitor-responsive protein 3-like [Prunus mume]
Length=175

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 109/171 (64%), Gaps = 27/171 (16%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L  AKGL+N DFL +MDPY +LT RTQEKKS+V SG+GS PEW+ETF+F V
Sbjct  1    MPLGTLEVLLVDAKGLDNNDFLADMDPYVLLTLRTQEKKSNVVSGQGSAPEWNETFVFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SD VSEL +KIM+ DN  +DD VGEA I LE +F+EGSIP  +YNVV +D+ + GEI+V 
Sbjct  61   SDDVSELHLKIMEKDNFSADDFVGEATISLEPIFTEGSIPPTAYNVVNQDKEYRGEIKVG  120

Query  426  LIFRPE------MSRGFEPEEESYGG--------------------WKESS  500
            L F PE       S  +   +   GG                    WK+SS
Sbjct  121  LRFTPEPEQNDGASGEYGRNDGPSGGYGRNDGPSGEYGGSEEGYGGWKQSS  171



>ref|XP_010240624.1| PREDICTED: elicitor-responsive protein 3-like [Brachypodium distachyon]
Length=157

 Score =   157 bits (396),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 106/157 (68%), Gaps = 13/157 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  AKGL+++DF   MDPY ILTCR+QE+KS+VA G G  PEW+ETF+F V
Sbjct  1    MVQGTLEVLLVCAKGLDDSDFFNKMDPYVILTCRSQEQKSTVAKGAGGEPEWNETFVFTV  60

Query  249  S----DGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEI  416
            S    D   EL +KIMDSD + +DD VGEA IPLE+V  EG++    + VVK++ +CGEI
Sbjct  61   SVGDDDDAPELIVKIMDSDELSADDFVGEATIPLEAVLLEGNLAPAVHRVVKEDEYCGEI  120

Query  417  RVTLIFRPEMS---------RGFEPEEESYGGWKESS  500
            ++ L F PE           R  E EEE YGGWK S+
Sbjct  121  KLALTFTPEDHQARARRHGYREEEEEEEVYGGWKLSN  157



>ref|XP_008238904.1| PREDICTED: elicitor-responsive protein 3-like [Prunus mume]
 ref|XP_008238905.1| PREDICTED: elicitor-responsive protein 3-like [Prunus mume]
Length=146

 Score =   156 bits (394),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 103/147 (70%), Gaps = 2/147 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV L +AKGL+NT+    MDPY ++TC+ Q+KKS+VA+  GSNPEW+E+F+F V
Sbjct  1    MPRGTLEVNLVNAKGLKNTEVFGKMDPYVVITCKKQQKKSTVATAMGSNPEWNESFVFGV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD V+EL + IMD D    DD VGE  IPL+++F E  +P   YNV++++ + GEI++ L
Sbjct  61   SDDVNELHVMIMDKDTGSKDDFVGELTIPLKTLFVEKKLPPMKYNVLRNKKYHGEIKLGL  120

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F P +    + + +  GGWKESS  +
Sbjct  121  TFTPAVHN--DRDLDFVGGWKESSSSY  145



>ref|XP_004510849.1| PREDICTED: C2 domain-containing protein At1g63220-like [Cicer 
arietinum]
Length=125

 Score =   155 bits (391),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 95/126 (75%), Gaps = 3/126 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L SAKGL+N DFL N+DPY ILT RTQE KS+V   KGSNP W+E+FLF +
Sbjct  1    MPRGTLEVILISAKGLDNMDFLNNIDPYVILTYRTQEHKSTVV--KGSNPRWNESFLFTI  58

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVT  425
            SD V +L +K+MD D    DD +GEA I L+ VF EGSIP+  YNVV  ++ +CGEI+V 
Sbjct  59   SDDVCKLNLKLMDKDTFTQDDFLGEAKIHLDPVFYEGSIPETVYNVVNNNQEYCGEIKVA  118

Query  426  LIFRPE  443
            L+F P+
Sbjct  119  LVFFPK  124



>gb|EMT18888.1| hypothetical protein F775_28053 [Aegilops tauschii]
Length=138

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 103/144 (72%), Gaps = 6/144 (4%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV+L SAKGL+++DF  +MDPY ILTCR+ E+KS+VASG GS PEW+ETF F V
Sbjct  1    MVRGKLEVLLVSAKGLDDSDFFNSMDPYVILTCRSHEQKSTVASGAGSEPEWNETFFFAV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S    EL++KIMDSD + +DD+VGEA    ++V  EGS+P   + VVKDE + GEI++ L
Sbjct  61   SGDAPELRVKIMDSDALSADDLVGEA---WQAVLQEGSLPPAVHRVVKDEEYRGEIKIAL  117

Query  429  IFRPEMSRGFEPEEESYGGWKESS  500
             F P        EEESYGGW +S+
Sbjct  118  TFTPAEENE---EEESYGGWNQST  138



>ref|NP_001077765.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE34072.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis 
thaliana]
Length=133

 Score =   154 bits (388),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 96/147 (65%), Gaps = 14/147 (10%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEVVL SAKGLE+ DFL               +KS+VA G G+ PEW+ETF+F V
Sbjct  1    MPHGTLEVVLVSAKGLEDADFL--------------NQKSNVAEGMGTTPEWNETFIFTV  46

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            S+G +ELK KI D D    DD VGEA IPLE VF EGSIP  +YNVVKDE + GEI V L
Sbjct  47   SEGTTELKAKIFDKDVGTEDDAVGEATIPLEPVFVEGSIPPTAYNVVKDEEYKGEIWVAL  106

Query  429  IFRPEMSRGFEPEEESYGGWKESSRDF  509
             F+P  +R    +EESYGGWK S   +
Sbjct  107  SFKPSENRSRGMDEESYGGWKNSEASY  133



>gb|AES58842.2| elicitor-responsive-like protein [Medicago truncatula]
Length=129

 Score =   153 bits (387),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEVVL  AK L ++D    MDPY IL+ R+QE KSSVA   GSNP W+E+FLF V
Sbjct  1    MPRGTLEVVLIGAKDLHDSDLFEKMDPYVILSYRSQEHKSSVAKNAGSNPRWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  +EL +++MD D    DD++GE  I L  V   GSIP+ +YNVVK +N+CGE+ V L
Sbjct  61   SDNAAELNLRLMDEDTFTKDDLLGEVKIHLGPVLEYGSIPETAYNVVKQQNYCGEVHVAL  120

Query  429  IFRPEMSR  452
             F PE  R
Sbjct  121  TFHPEGGR  128



>ref|XP_010918512.1| PREDICTED: elicitor-responsive protein 3-like isoform X2 [Elaeis 
guineensis]
Length=120

 Score =   152 bits (385),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  141  MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVG  320
            MDPYAIL  RTQE+KSSVASGKGS+PEW+E+F+F +SD V+EL IK+MDSD  G DD VG
Sbjct  1    MDPYAILIYRTQEQKSSVASGKGSDPEWNESFVFTISDNVTELCIKLMDSDAGGGDDFVG  60

Query  321  EAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            EA IPLE +F+EGS+P   YNVVKD+ + GEI+V L F P+ +R    +EE++GGW+ S+
Sbjct  61   EAKIPLEPLFAEGSLPPTVYNVVKDQEYHGEIKVGLTFTPQENRQQGFDEENFGGWRASN  120



>gb|KJB39636.1| hypothetical protein B456_007G022600 [Gossypium raimondii]
Length=124

 Score =   151 bits (382),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 92/122 (75%), Gaps = 3/122 (2%)
 Frame = +3

Query  141  MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVG  320
            MDPY +LTCRTQE+KSSVASGKGS PEW+E F+FN+S+G SEL +KIMDSD    DD VG
Sbjct  1    MDPYVLLTCRTQEQKSSVASGKGSEPEWNEDFIFNISEGASELALKIMDSDTGSQDDFVG  60

Query  321  EAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTLIFRPE--MSRGFEPEEESYGGWKE  494
            E  IPLE VF E +IP  +Y VVKD  + GEI++ L F PE   SR FE  EES+GGWK+
Sbjct  61   EVAIPLEPVFIERNIPLTAYTVVKDGEYRGEIKLGLTFTPEERESRDFEV-EESFGGWKQ  119

Query  495  SS  500
            SS
Sbjct  120  SS  121



>ref|XP_003588591.1| Elicitor-responsive protein [Medicago truncatula]
Length=167

 Score =   152 bits (383),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEVVL  AK L ++D    MDPY IL+ R+QE KSSVA   GSNP W+E+FLF V
Sbjct  1    MPRGTLEVVLIGAKDLHDSDLFEKMDPYVILSYRSQEHKSSVAKNAGSNPRWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  +EL +++MD D    DD++GE  I L  V   GSIP+ +YNVVK +N+CGE+ V L
Sbjct  61   SDNAAELNLRLMDEDTFTKDDLLGEVKIHLGPVLEYGSIPETAYNVVKQQNYCGEVHVAL  120

Query  429  IFRPEMSR  452
             F PE  R
Sbjct  121  TFHPEGLR  128



>gb|EMS45321.1| Elicitor-responsive protein 3 [Triticum urartu]
Length=339

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 104/148 (70%), Gaps = 6/148 (4%)
 Frame = +3

Query  57   GAPSMPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETF  236
            G   M +G LEV+L SAKGL+++DF  +MDPY ILTCR+ E+KS+VASG GS PEW+ETF
Sbjct  198  GGGDMVRGKLEVLLVSAKGLDDSDFFNSMDPYVILTCRSHEQKSTVASGAGSEPEWNETF  257

Query  237  LFNVSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEI  416
             F VS    EL++KIMDSD + +DD+VGEA    ++V  EGS+P   + VVKDE + GEI
Sbjct  258  FFAVSGDAPELRVKIMDSDALSADDLVGEA---WQAVLQEGSLPPAVHRVVKDEEYRGEI  314

Query  417  RVTLIFRPEMSRGFEPEEESYGGWKESS  500
            ++ L F P        EEESYGGW +S+
Sbjct  315  KIALTFTPAEENE---EEESYGGWNQST  339



>ref|XP_004306820.1| PREDICTED: proline-rich protein HaeIII subfamily 1-like [Fragaria 
vesca subsp. vesca]
Length=321

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 96/127 (76%), Gaps = 2/127 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEVVLA A+GL+N DFL  + PYA+LT +TQEKKS+V +GKGSNPEW+++FLF +
Sbjct  1    MPRGTLEVVLADARGLDNNDFLAKISPYAVLTVKTQEKKSTVLTGKGSNPEWNQSFLFTI  60

Query  249  SDG-VSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRV  422
            SD  V EL + IMD DN  +DD VGEA IPL   F +G++   +YN+V K++ FCG +++
Sbjct  61   SDDEVKELHLTIMDKDNFSADDYVGEATIPLLPAFVKGTVNPTTYNIVNKEKEFCGGVKL  120

Query  423  TLIFRPE  443
             L F PE
Sbjct  121  GLTFTPE  127



>ref|XP_007210830.1| hypothetical protein PRUPE_ppa016686mg, partial [Prunus persica]
 gb|EMJ12029.1| hypothetical protein PRUPE_ppa016686mg, partial [Prunus persica]
Length=125

 Score =   147 bits (370),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV L +AKGL+NT+    MDPY ++TC+ Q+KKS+VA+  GSNPEW+E+F+F +
Sbjct  1    MPRGTLEVNLVNAKGLKNTEIFGKMDPYVVITCKKQQKKSTVATAMGSNPEWNESFVFGI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD V+EL + IMD D+   DD VGE  IPL+++F E  +P   YNV++++ + GEI++ L
Sbjct  61   SDDVNELHVMIMDKDSGSKDDFVGELTIPLKTLFVEEKLPPMKYNVLRNKKYHGEIKLGL  120

Query  429  IFRP  440
             F P
Sbjct  121  TFTP  124



>ref|XP_009776717.1| PREDICTED: elicitor-responsive protein 3-like [Nicotiana sylvestris]
Length=134

 Score =   147 bits (370),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP G LEV +A+A+GL++T++L +M+PY ++TCRT+EKKSS ASG+GS+PEW+E+FLF +
Sbjct  1    MPYGQLEVYVANARGLDDTNWLTDMNPYVVVTCRTEEKKSSTASGEGSDPEWNESFLFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            + G  EL IK+MD +    DD +GEA I LE VF EG +   SY + KD+  CG IR+ L
Sbjct  61   TRGCDELHIKLMDENTFQDDDFLGEATISLEEVFREGEVGSTSYQLYKDDEECGSIRLGL  120

Query  429  IFRPE  443
             F  E
Sbjct  121  TFTRE  125



>ref|XP_009587344.1| PREDICTED: elicitor-responsive protein 3-like [Nicotiana tomentosiformis]
Length=134

 Score =   147 bits (370),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP G LEV +A+A+GL++T++L +M+PY ++TCRT+EKKSS ASG+GS+PEW+E+FLF +
Sbjct  1    MPYGQLEVYVANARGLDDTNWLTDMNPYVVVTCRTEEKKSSTASGEGSDPEWNESFLFTI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            + G  EL IK+MD +    DD +GEA I LE VF EG +   SY + KD+  CG IR+ L
Sbjct  61   TRGCDELHIKLMDENTFQDDDFLGEATISLEEVFREGEVGSTSYQLYKDDEDCGSIRLGL  120

Query  429  IFRPE  443
             F  E
Sbjct  121  TFTRE  125



>ref|XP_004306821.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=254

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP GTLEV+L  AK L + DF   MDPY +L+ RTQEKKS+VASG+GS PEW+ETF F V
Sbjct  1    MPHGTLEVLLVGAKDLADHDFFGKMDPYVLLSLRTQEKKSTVASGQGSTPEWNETFQFTV  60

Query  249  -SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDEN-FCGEIRV  422
             SD V+EL +KI D D    DD +GEA IPLE+VF EGS     YNVV + N + G+I V
Sbjct  61   SSDDVTELSLKIYDKDTFTPDDFLGEATIPLETVFMEGSTEPTKYNVVNENNEYHGDITV  120

Query  423  TLIFRPEM--SRGFEPEEESYGGWKESSR  503
             L F  E   SR    +EE +GG    SR
Sbjct  121  GLTFTRERIGSRAGGYDEEEHGGKHGGSR  149



>ref|XP_004306822.1| PREDICTED: elicitor-responsive protein 3-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=254

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP G L+V+L  A+ LE ++F C MDPY +L+ RTQEKKS+VASG+GS PEW+ETF F V
Sbjct  1    MPHGRLDVLLVGAQDLEGSNFFCKMDPYVLLSLRTQEKKSTVASGQGSTPEWNETFQFTV  60

Query  249  -SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDEN-FCGEIRV  422
             SD V+EL +KI D D    DD +GEA IPLE+VF EGS     YNVV + N + G+I V
Sbjct  61   SSDDVTELSLKIYDKDTFTPDDFLGEATIPLETVFMEGSTEPTKYNVVNENNEYHGDITV  120

Query  423  TLIFRPEM--SRGFEPEEESYGGWKESSR  503
             L F  E   SR    +EE +GG    SR
Sbjct  121  GLTFTRERIGSRAGGYDEEEHGGKHGGSR  149



>gb|KJB39634.1| hypothetical protein B456_007G022600 [Gossypium raimondii]
Length=119

 Score =   143 bits (360),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 86/116 (74%), Gaps = 11/116 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQG L+VVL SAKGLENTDFLCNMDPY +LTCRTQE+KSSVASGKGS PEW+E F+FN+
Sbjct  1    MPQGKLQVVLVSAKGLENTDFLCNMDPYVLLTCRTQEQKSSVASGKGSEPEWNEDFIFNI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGE------AVIPLESVFSEGS-----IPQQSYN  383
            S+G SEL +KIMDSD    DD VGE       ++ L+++   GS     I Q +Y+
Sbjct  61   SEGASELALKIMDSDTGSQDDFVGEVANVKAGILKLKNLLEGGSSLHTLIRQATYS  116



>gb|KJB39635.1| hypothetical protein B456_007G022600 [Gossypium raimondii]
Length=136

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQG L+VVL SAKGLENTDFLCNMDPY +LTCRTQE+KSSVASGKGS PEW+E F+FN+
Sbjct  1    MPQGKLQVVLVSAKGLENTDFLCNMDPYVLLTCRTQEQKSSVASGKGSEPEWNEDFIFNI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVI  332
            S+G SEL +KIMDSD    DD VGE  +
Sbjct  61   SEGASELALKIMDSDTGSQDDFVGEVAM  88



>gb|KJB39633.1| hypothetical protein B456_007G022600 [Gossypium raimondii]
Length=87

 Score =   140 bits (354),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MPQG L+VVL SAKGLENTDFLCNMDPY +LTCRTQE+KSSVASGKGS PEW+E F+FN+
Sbjct  1    MPQGKLQVVLVSAKGLENTDFLCNMDPYVLLTCRTQEQKSSVASGKGSEPEWNEDFIFNI  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGE  323
            S+G SEL +KIMDSD    DD VGE
Sbjct  61   SEGASELALKIMDSDTGSQDDFVGE  85



>emb|CAJ86293.1| H0124B04.10 [Oryza sativa Indica Group]
Length=163

 Score =   141 bits (356),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  141  MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVG  320
            MDPY ILTCRTQE+KSSVA G GS PEW+ETF+F VSD V +L +KIMDSD   +DD VG
Sbjct  1    MDPYVILTCRTQEQKSSVAKGAGSEPEWNETFVFTVSDDVPQLNVKIMDSDAFSADDFVG  60

Query  321  EAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTLIFRP  440
            EA IPLE VF EGS+P   + VVK+E +CGEI+V L F P
Sbjct  61   EANIPLEPVFLEGSLPPAVHRVVKEEKYCGEIKVALTFTP  100



>ref|XP_006584181.1| PREDICTED: C2 domain-containing protein At1g63220-like [Glycine 
max]
Length=129

 Score =   138 bits (347),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 94/149 (63%), Gaps = 22/149 (15%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEVVL SAKG+++ DFL    P A                 GS P+W+E+FLF V
Sbjct  1    MPRGTLEVVLISAKGIDDNDFLL---PDA-----------------GSKPQWNESFLFTV  40

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            SD  SEL +KIMD DN   DD +G A I L+ VF  GSIP+ +Y VVKDE +CGEI+V L
Sbjct  41   SDSASELNLKIMDKDNFSQDDCLGVATIHLDPVFEAGSIPETAYKVVKDEEYCGEIKVAL  100

Query  429  IFRPEMS--RGFEPEEESYGGWKESSRDF  509
             F  E +  + +   EESYGGWKESS +F
Sbjct  101  TFTVEKNEEQDYAEPEESYGGWKESSGEF  129



>gb|ADT92193.1| C2 domain-containing protein [Zea mays]
Length=159

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 4/120 (3%)
 Frame = +3

Query  138  NMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVV  317
            NMDP+ ILTCRTQE+KSSVA+G GS PEW+ETF+F VSD   +L +KIMDSD + +DD V
Sbjct  40   NMDPFVILTCRTQEQKSSVANGAGSEPEWNETFVFTVSDDTPQLHLKIMDSD-LTNDDFV  98

Query  318  GEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTLIFRP--EMSRGFEPEE-ESYGGW  488
            GEA IPLE+VF EGS+P   + VVK+E +CGE+++ L F P  E  R  + EE   Y  W
Sbjct  99   GEATIPLEAVFQEGSLPPAVHPVVKEEKYCGEVKLALTFTPAAETRRPDDNEEGPPYSSW  158



>ref|XP_009349690.1| PREDICTED: elicitor-responsive protein 3-like [Pyrus x bretschneideri]
Length=113

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = +3

Query  141  MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVG  320
            MDPY I T +TQEKKS+VA GKGS+PEW+E+FLF V+D VSEL++KIMD D    DD VG
Sbjct  1    MDPYVIFTVKTQEKKSTVAKGKGSDPEWNESFLFTVTDDVSELRLKIMDKDTFTKDDFVG  60

Query  321  EAVIPLESVFSEGSIPQQSYNVV-KDENFCGEIRVTLIFRPE  443
            EA++PLE +F++G +P  +YNVV KD+ + GEI + L F PE
Sbjct  61   EAIVPLEPLFADGRLPPTAYNVVNKDQEYRGEIIIGLTFTPE  102



>ref|XP_006491033.1| PREDICTED: elicitor-responsive protein 3-like isoform X5 [Citrus 
sinensis]
Length=121

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 86/126 (68%), Gaps = 17/126 (13%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L   KGLE++DFL ++DPY +LTCRTQE+KSS+ SG               
Sbjct  1    MPRGTLEVLLVGCKGLEDSDFLGSVDPYVVLTCRTQEQKSSIGSGD--------------  46

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
               V+EL +KIMD D   +DD +GEA I LE +F EGS+P  +YNVVK++ +CGEIRV L
Sbjct  47   ---VTELTLKIMDKDTFSNDDYLGEATISLEPLFMEGSLPPTAYNVVKNQEYCGEIRVGL  103

Query  429  IFRPEM  446
             F PE+
Sbjct  104  TFTPEI  109



>ref|XP_006445119.1| hypothetical protein CICLE_v10022928mg [Citrus clementina]
 gb|ESR58359.1| hypothetical protein CICLE_v10022928mg [Citrus clementina]
Length=115

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 85/125 (68%), Gaps = 17/125 (14%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L   KGLE++DFL ++DPY +LTCRTQE+KSS+ SG               
Sbjct  1    MPRGTLEVLLVGCKGLEDSDFLGSVDPYVVLTCRTQEQKSSIGSGD--------------  46

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
               V+EL +KIMD D   +DD +GEA I LE +F EGS+P  +YNVVK++ +CGEIRV L
Sbjct  47   ---VTELTLKIMDKDTFSNDDYLGEATISLEPLFMEGSLPPTAYNVVKNQEYCGEIRVGL  103

Query  429  IFRPE  443
             F PE
Sbjct  104  TFTPE  108



>ref|XP_006364238.1| PREDICTED: elicitor-responsive protein 3-like [Solanum tuberosum]
Length=134

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP G LEV +  A+GLE+ ++L +M+PY ++TC T+EKK+S ASG+G +PEW+++FLF V
Sbjct  1    MPYGQLEVYIGYARGLEDQNWLTDMNPYVVITCHTEEKKTSTASGEGEDPEWNDSFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTL  428
            + G  E+ IKIMD +    DD +GE  I LE VF EG +    Y++  D+  CG I++ L
Sbjct  61   THGCDEVHIKIMDENTFQDDDFIGETTIQLEEVFREGEVEATMYDLYNDDENCGSIKIGL  120

Query  429  IFRPE  443
             F  E
Sbjct  121  TFTRE  125



>gb|KDO86047.1| hypothetical protein CISIN_1g037768mg, partial [Citrus sinensis]
Length=111

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 78/102 (76%), Gaps = 2/102 (2%)
 Frame = +3

Query  138  NMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVV  317
            ++DPY +LTCRTQE+KSS+ SG G  PEW+ETF+F ++  V+EL +KIMD D   +DD +
Sbjct  12   SVDPYVVLTCRTQEQKSSIGSGSG--PEWNETFVFTITGDVTELTLKIMDKDTFSNDDYL  69

Query  318  GEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTLIFRPE  443
            GEA I LE +F EGS+P  +YNVVK++ +CGEIRV L F PE
Sbjct  70   GEATISLEPLFMEGSLPPTAYNVVKNQEYCGEIRVGLTFTPE  111



>ref|XP_006491032.1| PREDICTED: elicitor-responsive protein 3-like isoform X4 [Citrus 
sinensis]
Length=122

 Score =   130 bits (328),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 86/127 (68%), Gaps = 18/127 (14%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLC-NMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            MP+GTLEV+L   KGLE++DFL  ++DPY +LTCRTQE+KSS+ SG              
Sbjct  1    MPRGTLEVLLVGCKGLEDSDFLAGSVDPYVVLTCRTQEQKSSIGSGD-------------  47

Query  246  VSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVT  425
                V+EL +KIMD D   +DD +GEA I LE +F EGS+P  +YNVVK++ +CGEIRV 
Sbjct  48   ----VTELTLKIMDKDTFSNDDYLGEATISLEPLFMEGSLPPTAYNVVKNQEYCGEIRVG  103

Query  426  LIFRPEM  446
            L F PE+
Sbjct  104  LTFTPEI  110



>tpg|DAA36704.1| TPA: hypothetical protein ZEAMMB73_836368, partial [Zea mays]
Length=168

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M QGTLEV+L  A+GLENTD+L NMDPYA+L CR+ E+KSSVASGKG  PEW+ETF+F V
Sbjct  82   MAQGTLEVLLVGARGLENTDYLSNMDPYALLQCRSHEQKSSVASGKGCEPEWNETFVFTV  141

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAV  329
            SDG +EL IK++DSD    DD VGEA 
Sbjct  142  SDGAAELFIKLLDSDGGTDDDFVGEAT  168



>ref|XP_007208897.1| hypothetical protein PRUPE_ppa026834mg [Prunus persica]
 gb|EMJ10096.1| hypothetical protein PRUPE_ppa026834mg [Prunus persica]
Length=161

 Score =   125 bits (315),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 87/132 (66%), Gaps = 4/132 (3%)
 Frame = +3

Query  72   PQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVS  251
            P+GTLEV L  AK L+N D +  MDPY + T + QEKKS VA+G+GS P+W+ETFLF ++
Sbjct  3    PRGTLEVTLVGAKDLKNMDTMGMMDPYVVFTYKDQEKKSQVANGQGSEPDWNETFLFTIA  62

Query  252  DGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFS----EGSIPQQSYNVVKDENFCGEIR  419
                EL++K+ D D+  +DD VGE  IPL+++ +    EG +P   Y+V++++   GEI 
Sbjct  63   GAEDELRLKLYDEDSGSTDDSVGELTIPLDAIVTDSGCEGRMPATPYDVMRNDKVRGEIT  122

Query  420  VTLIFRPEMSRG  455
            + L F PE   G
Sbjct  123  IGLFFNPEPGSG  134



>ref|XP_002972816.1| hypothetical protein SELMODRAFT_148785 [Selaginella moellendorffii]
 gb|EFJ26037.1| hypothetical protein SELMODRAFT_148785 [Selaginella moellendorffii]
Length=137

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 81/132 (61%), Gaps = 1/132 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  A G++NTDFL   DPYAILTC  Q  +S+ A  +GSNP W++ FLF V
Sbjct  1    MVKGALEVHLRGATGIKNTDFLKKCDPYAILTCWRQSFQSTTAKRQGSNPIWNQKFLFVV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDE-NFCGEIRVT  425
             DGVSEL IK+ D D    DD +G A +PL  V SE   P  SYNV++      GE+ V 
Sbjct  61   EDGVSELFIKLYDEDRFTGDDFIGSAKVPLNRVLSELDHPLASYNVIRPSGKVKGEVMVA  120

Query  426  LIFRPEMSRGFE  461
            L F P++ R + 
Sbjct  121  LKFTPKVRRHYR  132



>ref|XP_004306824.1| PREDICTED: elicitor-responsive protein 3-like [Fragaria vesca 
subsp. vesca]
Length=108

 Score =   123 bits (309),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = +3

Query  141  MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVG  320
            MDPY I + +TQEK+S+VA G+G NPEW+E+FLF V+D V+EL++KIMD D + SDD VG
Sbjct  1    MDPYVIFSVKTQEKRSTVAKGQGVNPEWNESFLFTVTDDVTELRLKIMDKDTLSSDDFVG  60

Query  321  EAVIPLE-SVFSEGSIPQQSYNVV-KDENFCGEIRVTLIFRPEMSRGF  458
            EA IPL+ ++F  GS+P  SYNVV K +   GEI++ L F P+  + +
Sbjct  61   EATIPLDPALFIHGSLPPTSYNVVNKHQKHRGEIKLGLNFTPDPHQNY  108



>ref|XP_010030954.1| PREDICTED: elicitor-responsive protein 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW50186.1| hypothetical protein EUGRSUZ_J00003 [Eucalyptus grandis]
Length=155

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 90/157 (57%), Gaps = 18/157 (11%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGL NTDF   MDPY ++  +TQE+KSS+A G+GSNP W E F F V
Sbjct  1    MAVGVLEVLLVSAKGLGNTDFFGKMDPYVLIQYKTQERKSSIARGQGSNPSWGEKFTFRV  60

Query  249  ------SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVK  392
                       +L +KIMD D   +DD +G A I LE   + G       +    Y VV+
Sbjct  61   EYPGEDDHHQFKLNLKIMDKDTFSADDYIGSATIFLEDFLALGVENGTAELHPSKYRVVR  120

Query  393  -DENFCGEIRVTLIFRPEMSRGFEPE-EESYGGWKES  497
             D+++CGEI+V L F        EPE  E YGGWK+S
Sbjct  121  MDQSYCGEIQVGLTFNLRE----EPEINEEYGGWKQS  153



>gb|EPS63491.1| hypothetical protein M569_11295, partial [Genlisea aurea]
Length=111

 Score =   122 bits (305),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 78/109 (72%), Gaps = 3/109 (3%)
 Frame = +3

Query  141  MDPYAILTCRTQEKKS---SVASGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDD  311
            +D YA+L+C  QEK+S   SV S +GS PEW+ET LFN+S   +EL+I+IMD D + +DD
Sbjct  2    IDAYAVLSCHGQEKRSNVVSVHSSQGSKPEWNETHLFNISGRENELRIRIMDKDTLTADD  61

Query  312  VVGEAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTLIFRPEMSRGF  458
             +GE +IPL+ VF E SIP  +YN++KDE +CG +RV L F  + +R F
Sbjct  62   FLGEVLIPLQPVFEEESIPNTTYNLIKDERYCGGVRVGLKFTHQRTREF  110



>ref|XP_008238902.1| PREDICTED: elicitor-responsive protein 3-like [Prunus mume]
Length=159

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 92/150 (61%), Gaps = 9/150 (6%)
 Frame = +3

Query  72   PQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVS  251
            P+GTLEV L  AK L+N D +  MDPY + T + QEKKS VA+G+GS P+W+ET LF ++
Sbjct  3    PRGTLEVTLVGAKDLKNMDSMGMMDPYVVFTYKDQEKKSKVANGQGSEPDWNETLLFTIA  62

Query  252  DGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFS----EGSIPQQSYNVVKDENFCGEIR  419
                EL++K+ D D+  +DD VGE  IPL+++ +    EG +P   Y V++++   GEI 
Sbjct  63   GAEDELRLKLYDEDSGSTDDDVGELTIPLDAIVTDSGCEGRMPPTPYEVMRNDKVRGEIT  122

Query  420  VTLIFRPEMSRGFEPEEESYG-GWKESSRD  506
            + L F PE   G    +  YG G +   RD
Sbjct  123  IGLYFNPEPGSG----DRDYGSGDRSGDRD  148



>ref|XP_002984391.1| hypothetical protein SELMODRAFT_229026, partial [Selaginella 
moellendorffii]
 gb|EFJ14441.1| hypothetical protein SELMODRAFT_229026, partial [Selaginella 
moellendorffii]
Length=135

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 78/126 (62%), Gaps = 1/126 (1%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  A G++NTDFL   DPYAILTC  Q  +S+ A  +GSNP W++ FLF V
Sbjct  1    MVKGALEVHLRGATGIKNTDFLKKCDPYAILTCWRQRFQSTTAKRQGSNPIWNQKFLFVV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSYNVVKDE-NFCGEIRVT  425
             DGVSEL IK+ D D    DD +G A +PL  V SE   P  SYNV++      GE+ V 
Sbjct  61   EDGVSELFIKLYDEDRFTGDDFIGSAKVPLNRVLSELDHPLASYNVIRPSGKVKGEVMVA  120

Query  426  LIFRPE  443
            L F P+
Sbjct  121  LKFTPK  126



>ref|XP_002283485.1| PREDICTED: elicitor-responsive protein 1 [Vitis vinifera]
 emb|CBI31668.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   121 bits (303),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 13/154 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L  A+GL++TDFL  MDPY ++  + QE+KSSVA G+G +P W+E F F V
Sbjct  1    MTIGMLEVLLLDARGLQDTDFLGGMDPYVLIQYKNQERKSSVARGEGGSPVWNEKFTFRV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQS------YNVVK-D  395
                 +G  +L +KIMD D   +DD +G+A I LE + + G    +S      Y VV+ D
Sbjct  61   EYPGGEGQYKLVLKIMDKDTFSADDFLGQASIYLEDLLALGVENGKSELHPCKYRVVRTD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
            + +CGEIRV + F P++    E +E   GGWKES
Sbjct  121  QTYCGEIRVGINFTPKVKE--EKDEIQVGGWKES  152



>gb|KJB73946.1| hypothetical protein B456_011G262100 [Gossypium raimondii]
Length=152

 Score =   120 bits (302),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 15/154 (10%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV L SAKGL+++DFL +MDPY I+  + QE+KSS A G GS+P W+E F F V
Sbjct  1    MAVGILEVFLVSAKGLQDSDFLGDMDPYVIIQYKGQERKSSAARGDGSSPSWNEKFTFKV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS-------IPQQSYNVVKD  395
                S G  +L +KIMD D   SDD VG+A I ++ + + G+        P +   V  +
Sbjct  61   EYPGSGGDYKLVLKIMDKDTFSSDDFVGQATIFVKDLLAVGADEGSAELHPTKHSVVNAE  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
            + +CGEI V L F    ++  E +EE YGGW+ES
Sbjct  121  QRYCGEIVVGLTF----TKKEENDEEEYGGWRES  150



>ref|XP_009600805.1| PREDICTED: elicitor-responsive protein 3-like [Nicotiana tomentosiformis]
Length=110

 Score =   119 bits (297),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 71/101 (70%), Gaps = 0/101 (0%)
 Frame = +3

Query  141  MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVG  320
            M+PY ++TCRT+EKKSS ASG+GS+PEW+E+FLF ++ G  EL IK+MD +    DD +G
Sbjct  1    MNPYVVVTCRTEEKKSSTASGEGSDPEWNESFLFTITRGCDELHIKLMDENTFQDDDFLG  60

Query  321  EAVIPLESVFSEGSIPQQSYNVVKDENFCGEIRVTLIFRPE  443
            EA I LE VF EG +   S+ + KD+  CG IR+ L F  E
Sbjct  61   EATISLEEVFREGEVGSTSHQLYKDDEECGSIRLGLTFTRE  101



>ref|XP_010030953.1| PREDICTED: elicitor-responsive protein 1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW50187.1| hypothetical protein EUGRSUZ_J00003 [Eucalyptus grandis]
Length=159

 Score =   118 bits (296),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 91/161 (57%), Gaps = 22/161 (14%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDF----LCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETF  236
            M  G LEV+L SAKGL NTDF    +  MDPY ++  +TQE+KSS+A G+GSNP W E F
Sbjct  1    MAVGVLEVLLVSAKGLGNTDFFDGLIGKMDPYVLIQYKTQERKSSIARGQGSNPSWGEKF  60

Query  237  LFNV------SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSY  380
             F V           +L +KIMD D   +DD +G A I LE   + G       +    Y
Sbjct  61   TFRVEYPGEDDHHQFKLNLKIMDKDTFSADDYIGSATIFLEDFLALGVENGTAELHPSKY  120

Query  381  NVVK-DENFCGEIRVTLIFRPEMSRGFEPE-EESYGGWKES  497
             VV+ D+++CGEI+V L F        EPE  E YGGWK+S
Sbjct  121  RVVRMDQSYCGEIQVGLTFNLRE----EPEINEEYGGWKQS  157



>ref|XP_009626088.1| PREDICTED: elicitor-responsive protein 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=154

 Score =   118 bits (295),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 94/152 (62%), Gaps = 17/152 (11%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV--  248
            GT+EV L +A+GL+N +FL   +DPY ++  R QE+KS+ A G+GS PEW+E F F V  
Sbjct  6    GTMEVNLVNARGLKNNEFLGGGIDPYVLIQYRAQERKSTTAKGQGSKPEWNERFNFRVEY  65

Query  249  --SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KDEN  401
              +D   +L +K+MD D   SDD +GEA I L+ +   G       I  + Y+VV  D++
Sbjct  66   PSTDKQYKLILKLMDHDTFSSDDSLGEATIYLKELIELGVENGRAEIHPRKYSVVGSDQS  125

Query  402  FCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
            +CGEI+V L F P+ +      EE YGGWKES
Sbjct  126  YCGEIQVGLTFTPKTA-----AEEEYGGWKES  152



>ref|XP_009626087.1| PREDICTED: elicitor-responsive protein 1 isoform X1 [Nicotiana 
tomentosiformis]
Length=155

 Score =   118 bits (295),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 94/152 (62%), Gaps = 16/152 (11%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV--  248
            GT+EV L +A+GL+N +FL   +DPY ++  R QE+KS+ A G+GS PEW+E F F V  
Sbjct  6    GTMEVNLVNARGLKNNEFLGGGIDPYVLIQYRAQERKSTTAKGQGSKPEWNERFNFRVEY  65

Query  249  --SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KDEN  401
              +D   +L +K+MD D   SDD +GEA I L+ +   G       I  + Y+VV  D++
Sbjct  66   PSTDKQYKLILKLMDHDTFSSDDSLGEATIYLKELIELGVENGRAEIHPRKYSVVGSDQS  125

Query  402  FCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
            +CGEI+V L F P+ +      EE YGGWKES
Sbjct  126  YCGEIQVGLTFTPKKTAA----EEEYGGWKES  153



>gb|AFK38368.1| unknown [Lotus japonicus]
 gb|AFK48312.1| unknown [Lotus japonicus]
Length=153

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G +EV+L  AKGL+  D    MDPY +L  + QE+KSSV    G NP WDE F+F V
Sbjct  1    MASGLMEVLLVKAKGLQEHDIFARMDPYVLLQYKGQERKSSVLHEGGRNPVWDEKFIFRV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS------IPQQSYNVVK-D  395
                S G  +L +KIMD D   +DD VG+A I ++ + +EG+      I  + Y+VV+ D
Sbjct  61   EYPGSGGPYKLNLKIMDKDVFSADDFVGQATIYVKDLLAEGAENGSAEIRTRKYSVVRAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
            +++CGEI V + F+ +     E     +GGWKES
Sbjct  121  QSYCGEIEVGITFKRKEE---EYSNNDFGGWKES  151



>ref|XP_008360762.1| PREDICTED: elicitor-responsive protein 3-like [Malus domestica]
Length=147

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 88/141 (62%), Gaps = 11/141 (8%)
 Frame = +3

Query  72   PQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVS  251
            P+GTLEV L  AK L+N D +  MDPY ++T + Q+KKS VA G+GS P+W+ET LF ++
Sbjct  3    PRGTLEVQLVGAKDLKNMD-VGMMDPYCVITYKDQQKKSGVARGQGSMPDWNETLLFTIA  61

Query  252  DGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFS----EGSIPQQSYNVVKDENFCGEIR  419
             G  +L+IKI D D+   DD VGE  IPL+++ +    EG +P   Y V++++   GEI 
Sbjct  62   GGEDDLRIKIYDQDSGSLDDYVGELKIPLDAIVTDTGCEGRMPPTPYEVMRNDEVKGEIT  121

Query  420  VTLIFRPEMSRGFEPEEESYG  482
            + L F P      EP  ES G
Sbjct  122  IGLFFNP------EPGHESRG  136



>ref|XP_010931272.1| PREDICTED: elicitor-responsive protein 1 isoform X2 [Elaeis guineensis]
Length=155

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 90/156 (58%), Gaps = 13/156 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL +TDFL + DPY ++  RTQE+KSS+  G+GSNP W+ETF F +
Sbjct  1    MGKGILEVQLIDAKGLADTDFLGDADPYVLIQYRTQERKSSICRGQGSNPSWNETFKFVI  60

Query  249  SDGVSE----LKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS-------IPQQSYNVVKD  395
                 E    L +KIMD D   +DD +GEA I +  V + G         P +   V+ D
Sbjct  61   HSPSDERQHKLILKIMDHDTFTADDFMGEATINVADVIALGMENGIGELRPCKHRVVLAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSR  503
              +CGEIRV + F  EM    E EEE  GGWK S R
Sbjct  121  GTYCGEIRVGVKFTTEMKE--EEEEEELGGWKHSFR  154



>ref|XP_006445118.1| hypothetical protein CICLE_v10022928mg [Citrus clementina]
 gb|ESR58358.1| hypothetical protein CICLE_v10022928mg [Citrus clementina]
Length=95

 Score =   114 bits (285),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP+GTLEV+L   KGLE++DFL ++DPY +LTCRTQE+KSS+ SG G  PEW+ETF+F +
Sbjct  1    MPRGTLEVLLVGCKGLEDSDFLGSVDPYVVLTCRTQEQKSSIGSGSG--PEWNETFVFTI  58

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVF  350
            +  V+EL +KIMD D   +DD +GEA   + S+F
Sbjct  59   TGDVTELTLKIMDKDTFSNDDYLGEATSVVFSLF  92



>emb|CDP00102.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G +EV L  A+GL++T+F   +DPY ++  R QE+KSS+A G+GSNP W+E F F  
Sbjct  1    MTIGIMEVTLVGARGLKDTEFFGGIDPYVLIQYRGQERKSSIARGQGSNPAWNEKFTFRA  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KD  395
                 D   +L +KIMD D   SDD +G++ I L+ +   G       I  Q Y++V  D
Sbjct  61   EYPGGDNQYKLILKIMDHDTFSSDDYLGQSTIYLKELLELGVENGKAEIHPQKYSIVASD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
            + F GEI+V + F P+        EE +GGWKES
Sbjct  121  QTFSGEIQVGITFTPKEDAN---AEEEFGGWKES  151



>ref|XP_006486477.1| PREDICTED: elicitor-responsive protein 1-like [Citrus sinensis]
 gb|KDO69300.1| hypothetical protein CISIN_1g035563mg [Citrus sinensis]
Length=153

 Score =   115 bits (287),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 93/155 (60%), Gaps = 16/155 (10%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGL NTDFL ++DPY I+  +TQE+ SSVA G+G +  W+E F F V
Sbjct  1    MAIGLLEVLLESAKGLANTDFLGDIDPYVIIQYKTQERTSSVAQGRGGSWTWNERFTFRV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVK-D  395
                S G  +L +KIMD D    DD +GEA I +E + ++G       +  + Y+VV+ D
Sbjct  61   EYPGSGGQYKLILKIMDKDTFTKDDFLGEATIYVEDLLAQGMENGTAELHSRKYSVVQAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPE-EESYGGWKES  497
              + GEI+V L     M+   E E +  +GGWKES
Sbjct  121  GTYFGEIQVGL----SMTHKVEVETDRDFGGWKES  151



>ref|XP_009357731.1| PREDICTED: elicitor-responsive protein 1-like [Pyrus x bretschneideri]
 ref|XP_009357733.1| PREDICTED: elicitor-responsive protein 1-like [Pyrus x bretschneideri]
Length=156

 Score =   115 bits (287),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 92/155 (59%), Gaps = 13/155 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV L SAKGL +TD    MDPY ++  + QEKKSSVA  +GSNPEW+E F F  
Sbjct  1    MAVGLLEVNLVSAKGLGDTDLFTRMDPYVVMQYKGQEKKSSVAREQGSNPEWNEKFTFRA  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVKDE  398
                S    ++ +KIMD D   SDD +G+A I ++ + ++G       +    Y+VV+ +
Sbjct  61   EYPGSGEQYKITLKIMDKDTFTSDDYIGQATIYVKDLLAQGVQNGTAELHPLKYSVVRAD  120

Query  399  N-FCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            N + GEI+V L F P + + +    +++GGWK S+
Sbjct  121  NTYRGEIKVGLTFTPRVEQDYGG--QTFGGWKHSA  153



>ref|XP_007141870.1| hypothetical protein PHAVU_008G232700g [Phaseolus vulgaris]
 gb|ESW13864.1| hypothetical protein PHAVU_008G232700g [Phaseolus vulgaris]
Length=163

 Score =   115 bits (288),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 92/158 (58%), Gaps = 14/158 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G +EV L  AKGL +TD    MDPY ++  + QEK+S VA G+G NP W+E F+F V
Sbjct  1    MATGFMEVQLVKAKGLRDTDIFGKMDPYVLIQYKGQEKRSRVARGQGKNPVWNEQFMFKV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVK-D  395
                S+   +L  KIMD D +  DD VGEA++ +  + ++G       +    Y VV+ +
Sbjct  61   DYVGSNDQHKLIFKIMDKD-LYKDDFVGEAIVHVGDLLAQGVENGGAKLQTLKYRVVRAN  119

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSRDF  509
            +++CGEI V + F P++   F   EE  GGWKES + F
Sbjct  120  KSYCGEIDVGVTFTPKVEDKF--VEEEIGGWKESHKHF  155



>ref|NP_001280934.1| uncharacterized protein LOC103435157 [Malus domestica]
 emb|CAZ15550.1| C2 domain-containing protein [Malus domestica]
Length=156

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 92/155 (59%), Gaps = 13/155 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV L SAKGL +TD    MDPY ++  + QEKKSSVA  +GSNPEW+E F F  
Sbjct  1    MAVGLLEVNLVSAKGLGDTDLFTRMDPYVVIQYKGQEKKSSVAREQGSNPEWNEKFTFRA  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVKDE  398
                S    ++ +KIMD D   SDD +G+A I ++ + ++G       +    Y+VV+ +
Sbjct  61   EYPGSGEQYKITLKIMDKDTFTSDDYIGQATIYVKDLLAQGVQNGTAELHPLKYSVVRAD  120

Query  399  N-FCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            N + GEI+V L F P + + +    +++GGWK S+
Sbjct  121  NTYRGEIKVGLTFTPRVEQDYGG--QTFGGWKHSA  153



>ref|XP_009420100.1| PREDICTED: elicitor-responsive protein 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=156

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 89/156 (57%), Gaps = 16/156 (10%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL++TD +  +DPY ++  R QE+KS  A G+GSNP W+ETF F V
Sbjct  1    MAKGILEVQLIDAKGLKDTDLIGKIDPYVVIQYRGQERKSKTARGQGSNPSWNETFKFLV  60

Query  249  SDGVS------ELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS-------IPQQSYNVV  389
            +   +      ++ +++MD D   SDD +GE+ I +  + ++G         P +   V+
Sbjct  61   NSAAAGNHQQHKITMRVMDHDTFTSDDFLGESTIHVGDLITQGMENGTGELRPTKYSVVL  120

Query  390  KDENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
             D ++CGEIRV + F  +M    E   E +GGW  S
Sbjct  121  SDRSYCGEIRVGVTFTAKME---EENTEEFGGWSHS  153



>ref|XP_004236744.1| PREDICTED: elicitor-responsive protein 1 isoform X2 [Solanum 
lycopersicum]
Length=159

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 91/153 (59%), Gaps = 14/153 (9%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVS-  251
            G +EV L SA+GL+N +F    +DPY ++  R QE+KSS   G+GS PEW+E F F +  
Sbjct  6    GIMEVNLVSARGLKNNEFWGGGIDPYVLIQYRGQERKSSTIRGQGSKPEWNEKFTFKIEY  65

Query  252  ---DGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KDEN  401
               DG  +L +K+MD D   SDD +GEA I L+     G       +  + Y+VV  D++
Sbjct  66   PSVDGQYKLILKLMDHDTFSSDDYLGEATIYLKEFLEVGLENGRAEVHPKKYSVVGSDQS  125

Query  402  FCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            +CGEI+V + F P+  +     EE YGGWKES+
Sbjct  126  YCGEIQVGITFTPK--KATHDVEEEYGGWKESN  156



>ref|XP_008776985.1| PREDICTED: elicitor-responsive protein 1 isoform X4 [Phoenix 
dactylifera]
Length=155

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 90/156 (58%), Gaps = 13/156 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL +TDFL + DPY ++  R+QE+KSS+  G+GSNP W+ETF F V
Sbjct  1    MGKGILEVQLIDAKGLASTDFLGDTDPYVLIQYRSQERKSSICRGQGSNPSWNETFKFVV  60

Query  249  SDGVSE----LKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS-------IPQQSYNVVKD  395
                 E    L +K+MD D   +DD +GEA I +  V + G         P +   V+ D
Sbjct  61   HSPSGEHQHKLILKLMDHDTFTADDFMGEATINVMDVIALGMENGIGELRPCKHRVVLAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSR  503
              +CGEIRV + F  EM    E EEE  GGWK S R
Sbjct  121  GTYCGEIRVGVKFTTEMKE--EEEEEELGGWKHSFR  154



>ref|XP_009759471.1| PREDICTED: elicitor-responsive protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=154

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 94/153 (61%), Gaps = 16/153 (10%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV--  248
            GT+EV L +A+GL+N +F    +DPY +L  R QE+KS+ A G+GS P W+E F F V  
Sbjct  6    GTMEVNLVNARGLKNNEFWGGGIDPYVLLQYRAQERKSTTAKGQGSKPMWNEKFTFRVEY  65

Query  249  --SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KDEN  401
              +D   +L +K+MD D+  SDD +G+A I L+ +   G       I  + Y+VV  +++
Sbjct  66   PSADKQYKLILKLMDHDSFSSDDYLGQATIYLKELIELGVEKGRAEIHPRKYSVVGSNQS  125

Query  402  FCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            +CGEI+V + F P+ +      EE YGGWKES+
Sbjct  126  YCGEIQVGITFTPKKA----AAEEEYGGWKESA  154



>ref|XP_002316284.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF02455.1| C2 domain-containing family protein [Populus trichocarpa]
Length=154

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 88/155 (57%), Gaps = 13/155 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV L  AKGL N DF  NMDPY ++  ++QE+KS VA G+G  P W+ET  F V
Sbjct  1    MAVGILEVKLVKAKGLGNPDFFANMDPYVLVKYKSQERKSKVARGQGGRPVWNETLTFKV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVK-D  395
                  G  +L +KIMD D   +DD VGEA I ++ + + G       +  Q Y VV  D
Sbjct  61   EYPGQGGNYKLILKIMDKDTFSADDSVGEATIYVKDLLALGVEKGTAELQTQKYRVVNAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            +++ GEI+V + F  +     E   E YGGW++SS
Sbjct  121  KSYRGEIQVGVTFTLKAEE--EDAGEDYGGWRQSS  153



>ref|XP_009759472.1| PREDICTED: elicitor-responsive protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=153

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 94/153 (61%), Gaps = 17/153 (11%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV--  248
            GT+EV L +A+GL+N +F    +DPY +L  R QE+KS+ A G+GS P W+E F F V  
Sbjct  6    GTMEVNLVNARGLKNNEFWGGGIDPYVLLQYRAQERKSTTAKGQGSKPMWNEKFTFRVEY  65

Query  249  --SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KDEN  401
              +D   +L +K+MD D+  SDD +G+A I L+ +   G       I  + Y+VV  +++
Sbjct  66   PSADKQYKLILKLMDHDSFSSDDYLGQATIYLKELIELGVEKGRAEIHPRKYSVVGSNQS  125

Query  402  FCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            +CGEI+V + F P+ +      EE YGGWKES+
Sbjct  126  YCGEIQVGITFTPKAA-----AEEEYGGWKESA  153



>ref|XP_006435544.1| hypothetical protein CICLE_v10032979mg [Citrus clementina]
 gb|ESR48784.1| hypothetical protein CICLE_v10032979mg [Citrus clementina]
Length=153

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 92/155 (59%), Gaps = 16/155 (10%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGL NTDFL ++DPY I+  + QE+ SSVA G+G +  W+E F F V
Sbjct  1    MAIGLLEVLLESAKGLANTDFLGDIDPYVIIQYKAQERTSSVAQGRGGSWTWNERFTFRV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVK-D  395
                S G  +L +KIMD D    DD +GEA I +E + ++G       +  + Y+VV+ D
Sbjct  61   EYPGSGGQYKLILKIMDKDTFTKDDFLGEATIYVEDLLAQGMENGTAELHSRKYSVVQAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPE-EESYGGWKES  497
              + GEI+V L     M+   E E +  +GGWKES
Sbjct  121  GTYFGEIQVGL----SMTHKVEVETDRDFGGWKES  151



>ref|XP_011027208.1| PREDICTED: elicitor-responsive protein 1-like [Populus euphratica]
Length=154

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 93/155 (60%), Gaps = 13/155 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L +AKGL +TDF+ +MDPY I+  ++QE+KSSVA G+G +P W+E   F V
Sbjct  1    MASGILEVLLVNAKGLGDTDFIGDMDPYVIVQYKSQERKSSVARGQGGHPVWNERLTFKV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KD  395
                  G  +L +KIMD D   +DD +GEA I ++ + + G       +    Y VV   
Sbjct  61   EYPGQAGEYKLSLKIMDKDTFSADDFIGEATIYVKDLLTSGVENGSAELHPCKYRVVSAT  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            E++ GEI+V + F  +  + ++ EE  YGGW +SS
Sbjct  121  ESYIGEIQVGVTFTLKEEKDYDREE--YGGWNQSS  153



>ref|NP_001148526.1| elicitor-responsive protein 1 [Zea mays]
 gb|ACG31844.1| elicitor-responsive protein 1 [Zea mays]
 tpg|DAA56889.1| TPA: elicitor-responsive protein 1 [Zea mays]
Length=157

 Score =   113 bits (282),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 90/155 (58%), Gaps = 12/155 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL   DFL  +DPY I+  R+QE+KSSVA  +G NP W+E F F +
Sbjct  1    MGKGVLEVHLVDAKGLSGNDFLGKLDPYVIMQYRSQERKSSVARDQGRNPCWNEVFKFQI  60

Query  249  SDGVS----ELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS------IPQQSYNVV-KD  395
            +   +    +L ++IMD DN  SDD +GEA I +  + S G+      +    +NVV  D
Sbjct  61   NSAAANVQHKLILRIMDHDNFSSDDFLGEATIDVTDIVSLGAERGTYHLNAAKHNVVLAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            + + GEI+V + F    ++  + +  + GGW+ SS
Sbjct  121  KTYHGEIKVAITFTSTQTQ-VQEDGGAIGGWRHSS  154



>gb|EMS57440.1| Elicitor-responsive protein 3 [Triticum urartu]
Length=222

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +3

Query  201  GKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQSY  380
            GKGSNPEW+E+F+F VSD  +EL IK+MDSD+  SDD VGEA IPLE+V++EGS P   Y
Sbjct  60   GKGSNPEWNESFVFTVSDQATELVIKLMDSDSGTSDDFVGEATIPLEAVYTEGSFPPTVY  119

Query  381  NVVKDENFCGEIRVTLIFRPE  443
            NVVK E++CGEI+V L F PE
Sbjct  120  NVVKGEHYCGEIKVGLTFTPE  140



>ref|XP_006365698.1| PREDICTED: elicitor-responsive protein 1-like isoform X2 [Solanum 
tuberosum]
Length=158

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 89/152 (59%), Gaps = 14/152 (9%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVS-  251
            G +EV L SA+GL+N +F    +DPY ++  R QE+KSS   G+GS PEW+E F F +  
Sbjct  6    GIMEVNLVSARGLKNNEFWGGGIDPYVLIQYRGQERKSSTIRGQGSKPEWNEKFTFKIEY  65

Query  252  ---DGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KDEN  401
               DG  +L +K+MD D   SDD +GEA I L+     G       I  + Y+VV  D+ 
Sbjct  66   PSVDGQYKLILKLMDHDTFSSDDYLGEATIYLKEFLEVGLENGRAEIHPKKYSVVGSDQC  125

Query  402  FCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
            +CGEI+V + F P+  +     EE YGGWKES
Sbjct  126  YCGEIQVGVTFTPK--KATHDVEEEYGGWKES  155



>ref|XP_010931271.1| PREDICTED: elicitor-responsive protein 1 isoform X1 [Elaeis guineensis]
Length=156

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 90/157 (57%), Gaps = 14/157 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLC-NMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            M +G LEV L  AKGL +TDFL  + DPY ++  RTQE+KSS+  G+GSNP W+ETF F 
Sbjct  1    MGKGILEVQLIDAKGLADTDFLGGDADPYVLIQYRTQERKSSICRGQGSNPSWNETFKFV  60

Query  246  VSDGVSE----LKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS-------IPQQSYNVVK  392
            +     E    L +KIMD D   +DD +GEA I +  V + G         P +   V+ 
Sbjct  61   IHSPSDERQHKLILKIMDHDTFTADDFMGEATINVADVIALGMENGIGELRPCKHRVVLA  120

Query  393  DENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSR  503
            D  +CGEIRV + F  EM    E EEE  GGWK S R
Sbjct  121  DGTYCGEIRVGVKFTTEMKE--EEEEEELGGWKHSFR  155



>ref|XP_008370572.1| PREDICTED: elicitor-responsive protein 1-like isoform X2 [Malus 
domestica]
Length=156

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 92/155 (59%), Gaps = 13/155 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV L SAKGL  T     MDPY ++  + QE+KSSVA  +GS+PEW+E F F  
Sbjct  1    MAVGLLEVNLVSAKGLGETHLFSRMDPYVVIEYKGQERKSSVAREQGSSPEWNEKFTFRA  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG---SIPQQS---YNVVKDE  398
                S G  ++ +KIMD D   SDD +G+A I ++ + + G      +Q    Y+VV+  
Sbjct  61   EYPGSGGEYKITLKIMDQDTFTSDDFIGQATIYVKELLAXGVQNGTAEQHPLYYSVVRAN  120

Query  399  N-FCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            N + GEI+V L F P++ +  +  E+S+GGWK S+
Sbjct  121  NTYHGEIKVGLTFTPQVEQ--DDGEQSFGGWKNSA  153



>ref|XP_010319255.1| PREDICTED: elicitor-responsive protein 1 isoform X1 [Solanum 
lycopersicum]
Length=160

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 93/154 (60%), Gaps = 15/154 (10%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSS-VASGKGSNPEWDETFLFNVS  251
            G +EV L SA+GL+N +F    +DPY ++  R QE+KSS + +G+GS PEW+E F F + 
Sbjct  6    GIMEVNLVSARGLKNNEFWGGGIDPYVLIQYRGQERKSSTIRAGQGSKPEWNEKFTFKIE  65

Query  252  ----DGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KDE  398
                DG  +L +K+MD D   SDD +GEA I L+     G       +  + Y+VV  D+
Sbjct  66   YPSVDGQYKLILKLMDHDTFSSDDYLGEATIYLKEFLEVGLENGRAEVHPKKYSVVGSDQ  125

Query  399  NFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            ++CGEI+V + F P+  +     EE YGGWKES+
Sbjct  126  SYCGEIQVGITFTPK--KATHDVEEEYGGWKESN  157



>ref|XP_009343533.1| PREDICTED: elicitor-responsive protein 1-like [Pyrus x bretschneideri]
Length=156

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 92/155 (59%), Gaps = 13/155 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV L SAKGL  T     MDPY ++  + QE+KSSVA  +GS+PEW+E F F  
Sbjct  1    MAVGLLEVNLVSAKGLGETHLFSRMDPYVVIEYKGQERKSSVAREQGSSPEWNEKFTFRA  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFS----EGSIPQQ--SYNVVKDE  398
                S G  ++ +KIMD D   SDD +G+A I ++ + +     G+  Q    Y+VV+  
Sbjct  61   EYPGSGGEYKITLKIMDKDTFTSDDFIGQATIYVKDLLALGVQNGTAEQHPLYYSVVRAN  120

Query  399  N-FCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            N + GEI+V L F P++ +  +  E+S+GGWK S+
Sbjct  121  NTYHGEIKVGLTFTPQVEQ--DDGEQSFGGWKNSA  153



>emb|CDM84945.1| unnamed protein product [Triticum aestivum]
 emb|CDJ26460.1| unnamed protein product [Triticum aestivum]
Length=154

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 88/157 (56%), Gaps = 14/157 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL  +DFL  +DPY I+  R+QE+KSS +  +G NP W+E F F +
Sbjct  1    MGRGVLEVHLVDAKGLFGSDFLGKIDPYVIVQYRSQERKSSTSRDEGRNPSWNEVFRFQI  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVK-D  395
                ++G  +L ++IMD DN  SDD +G+A I +  + S G       +    Y+VV  D
Sbjct  61   NSSAANGQHKLFLRIMDHDNFSSDDFLGQATINVTDLISTGMESGASQLNAAKYSVVSAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSRD  506
             ++ GEIRV L F        E +    GGW  SSR+
Sbjct  121  NSYHGEIRVGLTFTATK---VEEDGGQVGGWTHSSRE  154



>ref|XP_004960029.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X2 [Setaria italica]
Length=157

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +3

Query  198  SGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQS  377
            SG GS PEW+ETF+F VSD   +L +KIMDSD +  DD VGEA IPLE++F EGS+P   
Sbjct  61   SGAGSEPEWNETFIFTVSDDTPQLHLKIMDSD-VTDDDFVGEATIPLEALFQEGSLPPTV  119

Query  378  YNVVKDENFCGEIRVTLIFRPEMSRGFEPEEESYGGW  488
            + VVK+E +CGEI++ L F P  +R  + EE +Y  W
Sbjct  120  HPVVKEEKYCGEIKIALTFTPAETRRPDNEEGTYSSW  156



>ref|XP_006595905.1| PREDICTED: elicitor-responsive protein 1-like [Glycine max]
 gb|KHN20926.1| Elicitor-responsive protein 1 [Glycine soja]
Length=156

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 91/156 (58%), Gaps = 14/156 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G +EV L  AKGL +TD    MDPY ++  + QEK+S VA+GKG NP W+E F+F V
Sbjct  1    MAIGFMEVQLVKAKGLRDTDIFGKMDPYVLIQYKGQEKRSGVANGKGKNPVWNEKFIFKV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVK-D  395
                S    +L +KIMD D + +DD VGEA+I +  + ++G       +    Y VV+ +
Sbjct  61   EYPGSSNQHKLILKIMDKD-LYTDDFVGEAIIHVGDLLAQGVENGGAKLQTLKYRVVRAN  119

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSR  503
            +++CGEI V + F  ++   F   EE  GGWKES  
Sbjct  120  KSYCGEIDVGVTFTRKVEDKF--VEEDIGGWKESDH  153



>ref|XP_009369053.1| PREDICTED: elicitor-responsive protein 3 [Pyrus x bretschneideri]
Length=148

 Score =   110 bits (274),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 84/141 (60%), Gaps = 11/141 (8%)
 Frame = +3

Query  72   PQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNVS  251
            P+GTLEV L  AK L+N D +  MDPY ++T + Q+KKS   +G+GS P+W+ET LF ++
Sbjct  3    PRGTLEVQLVGAKDLKNMD-VGMMDPYCVITYKDQQKKSGXGAGQGSMPDWNETLLFTIA  61

Query  252  DGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFS----EGSIPQQSYNVVKDENFCGEIR  419
                +L+IKI D D+   DD VGE  IPL+++ +    EG +P   Y V + +   GEI 
Sbjct  62   GAEDDLRIKIYDQDSGSLDDYVGELKIPLDAIVTDTGCEGRMPPTPYEVTRHDKVKGEIT  121

Query  420  VTLIFRPEMSRGFEPEEESYG  482
            + L F P      EP  ES G
Sbjct  122  IGLYFNP------EPGHESRG  136



>ref|XP_008776969.1| PREDICTED: elicitor-responsive protein 1 isoform X2 [Phoenix 
dactylifera]
Length=157

 Score =   110 bits (274),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSV--ASGKGSNPEWDETFLF  242
            M +G LEV L  AKGL +TDFL + DPY ++  R+QE+KSS+   +G+GSNP W+ETF F
Sbjct  1    MGKGILEVQLIDAKGLASTDFLGDTDPYVLIQYRSQERKSSICRGAGQGSNPSWNETFKF  60

Query  243  NVSDGVSE----LKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS-------IPQQSYNVV  389
             V     E    L +K+MD D   +DD +GEA I +  V + G         P +   V+
Sbjct  61   VVHSPSGEHQHKLILKLMDHDTFTADDFMGEATINVMDVIALGMENGIGELRPCKHRVVL  120

Query  390  KDENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSR  503
             D  +CGEIRV + F  EM    E EEE  GGWK S R
Sbjct  121  ADGTYCGEIRVGVKFTTEMKE--EEEEEELGGWKHSFR  156



>ref|XP_006365697.1| PREDICTED: elicitor-responsive protein 1-like isoform X1 [Solanum 
tuberosum]
Length=159

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 91/153 (59%), Gaps = 15/153 (10%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSS-VASGKGSNPEWDETFLFNVS  251
            G +EV L SA+GL+N +F    +DPY ++  R QE+KSS + +G+GS PEW+E F F + 
Sbjct  6    GIMEVNLVSARGLKNNEFWGGGIDPYVLIQYRGQERKSSTIRAGQGSKPEWNEKFTFKIE  65

Query  252  ----DGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KDE  398
                DG  +L +K+MD D   SDD +GEA I L+     G       I  + Y+VV  D+
Sbjct  66   YPSVDGQYKLILKLMDHDTFSSDDYLGEATIYLKEFLEVGLENGRAEIHPKKYSVVGSDQ  125

Query  399  NFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
             +CGEI+V + F P+  +     EE YGGWKES
Sbjct  126  CYCGEIQVGVTFTPK--KATHDVEEEYGGWKES  156



>ref|XP_008776977.1| PREDICTED: elicitor-responsive protein 1 isoform X3 [Phoenix 
dactylifera]
Length=156

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 90/157 (57%), Gaps = 14/157 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLC-NMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            M +G LEV L  AKGL +TDFL  + DPY ++  R+QE+KSS+  G+GSNP W+ETF F 
Sbjct  1    MGKGILEVQLIDAKGLASTDFLGGDTDPYVLIQYRSQERKSSICRGQGSNPSWNETFKFV  60

Query  246  VSDGVSE----LKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS-------IPQQSYNVVK  392
            V     E    L +K+MD D   +DD +GEA I +  V + G         P +   V+ 
Sbjct  61   VHSPSGEHQHKLILKLMDHDTFTADDFMGEATINVMDVIALGMENGIGELRPCKHRVVLA  120

Query  393  DENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSR  503
            D  +CGEIRV + F  EM    E EEE  GGWK S R
Sbjct  121  DGTYCGEIRVGVKFTTEMKE--EEEEEELGGWKHSFR  155



>gb|KJB73947.1| hypothetical protein B456_011G262100 [Gossypium raimondii]
Length=176

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 89/154 (58%), Gaps = 13/154 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV L SAKGL+++DFL +MDPY I+  + QE+KSS A G GS+P W+E F F V
Sbjct  1    MAVGILEVFLVSAKGLQDSDFLGDMDPYVIIQYKGQERKSSAARGDGSSPSWNEKFTFKV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS-------IPQQSYNVVKD  395
                S G  +L +KIMD D   SDD VG+A I ++ + + G+        P +   V  +
Sbjct  61   EYPGSGGDYKLVLKIMDKDTFSSDDFVGQATIFVKDLLAVGADEGSAELHPTKHSVVNAE  120

Query  396  ENFCGEIRVTLIFRPEMSRGF--EPEEESYGGWK  491
            + +CGEI V L F  ++   F  E E  S+ G +
Sbjct  121  QRYCGEIVVGLTFTKKVFNFFFMEIEHTSHQGQR  154



>ref|XP_002311172.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE88539.1| C2 domain-containing family protein [Populus trichocarpa]
Length=154

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 89/155 (57%), Gaps = 13/155 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV L +AKGL +TDF  +MDPY ++  ++QE+KSSVA G+G +P W+E   F V
Sbjct  1    MAVGILEVQLVNAKGLRDTDFFGDMDPYVLVQYKSQERKSSVARGQGGHPVWNERLTFKV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS-------IPQQSYNVVKD  395
                  G  +L +KIMD D   SDD +G A I ++ + + G         P +   V   
Sbjct  61   EYPGQGGEYKLSLKIMDKDTFSSDDFIGGATIYVKDLLTSGVQNGTAELHPSKYREVDAS  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            +++ GEI+V + F  +  + ++ EE  YGGW ESS
Sbjct  121  QSYVGEIQVGVTFTLKEEQIYDGEE--YGGWNESS  153



>ref|XP_007009306.1| Calcium-dependent lipid-binding family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18116.1| Calcium-dependent lipid-binding family protein isoform 1 [Theobroma 
cacao]
Length=157

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 94/161 (58%), Gaps = 22/161 (14%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGS------NPEWDE  230
            M  G LEV+L SAKGLE+TDFL  MDPY  +  + QE+KSSVA G         +  W+E
Sbjct  1    MAVGILEVLLVSAKGLEDTDFLGGMDPYVRIQYKGQERKSSVARGIAHGAGGGSSSSWNE  60

Query  231  TFLFNV----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS------IPQQSY  380
             F F V    S    +L +KIMD D   +DD VG+A I +E + + G+      +    Y
Sbjct  61   RFTFKVEYPGSGDDYKLILKIMDKDTFSADDFVGQATIYVEDLLAIGAENGNAELHPGKY  120

Query  381  NVVK-DENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            +VV+ D ++CGEI+V + F    +R  E EEE YGGWKESS
Sbjct  121  SVVQADLSYCGEIQVGVTF----TRKVEDEEE-YGGWKESS  156



>ref|XP_009420099.1| PREDICTED: elicitor-responsive protein 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=161

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 90/161 (56%), Gaps = 21/161 (13%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVA-----SGKGSNPEWDET  233
            M +G LEV L  AKGL++TD +  +DPY ++  R QE+KS  A     +G+GSNP W+ET
Sbjct  1    MAKGILEVQLIDAKGLKDTDLIGKIDPYVVIQYRGQERKSKTARDSGGAGQGSNPSWNET  60

Query  234  FLFNVSDGVS------ELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS-------IPQQ  374
            F F V+   +      ++ +++MD D   SDD +GE+ I +  + ++G         P +
Sbjct  61   FKFLVNSAAAGNHQQHKITMRVMDHDTFTSDDFLGESTIHVGDLITQGMENGTGELRPTK  120

Query  375  SYNVVKDENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
               V+ D ++CGEIRV + F  +M    E   E +GGW  S
Sbjct  121  YSVVLSDRSYCGEIRVGVTFTAKME---EENTEEFGGWSHS  158



>ref|XP_006366176.1| PREDICTED: elicitor-responsive protein 3-like [Solanum tuberosum]
Length=107

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP G LEV +  A+GL++ ++L +M+PY ++TCRT+EKKSS ASG+G +PEW+E+FLF V
Sbjct  1    MPNGQLEVYVGHARGLDDQNWLTDMNPYVVVTCRTEEKKSSTASGEGEDPEWNESFLFTV  60

Query  249  SDGVSELKIKIMDSDNIGSDDVVGEAVI  332
            S G  E+ IKIMD +    DD +GE  +
Sbjct  61   SRGCDEVHIKIMDENTFQDDDFIGETTL  88



>ref|XP_002456619.1| hypothetical protein SORBIDRAFT_03g039490 [Sorghum bicolor]
 gb|EES01739.1| hypothetical protein SORBIDRAFT_03g039490 [Sorghum bicolor]
Length=155

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 88/155 (57%), Gaps = 14/155 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL  +DFL  +DPY I+  R+QE+KSSVA  +G NP W+E F F +
Sbjct  1    MGKGVLEVHLVDAKGLSGSDFLGKLDPYVIVQYRSQERKSSVARDQGRNPCWNEVFKFQI  60

Query  249  SDGVS----ELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS------IPQQSYNVV-KD  395
            +   +    +L ++IMD DN  SDD +GEA I +  +   G+      +    +NVV  D
Sbjct  61   NSAAANAQHKLILRIMDHDNFSSDDFLGEATIDVTDIVGLGTERGTYHLNAAKHNVVLPD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            + + GEI+V + F        + +  + GGW+ SS
Sbjct  121  KTYHGEIKVGITFTATQ---VQEDGGAIGGWRHSS  152



>ref|XP_007218541.1| hypothetical protein PRUPE_ppa012756mg [Prunus persica]
 gb|EMJ19740.1| hypothetical protein PRUPE_ppa012756mg [Prunus persica]
Length=156

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 88/154 (57%), Gaps = 13/154 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G LEV+L SAKGL +TD    MDPY ++  + QE+KSSVA  +GS+P W+E F F  
Sbjct  1    MAVGILEVMLVSAKGLGDTDLFSRMDPYVLIQYKGQERKSSVAREQGSSPVWNERFTFRA  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVK-D  395
                S    ++ +KIMD D   +DD +GEA I ++ + + G       +    Y+VV+ D
Sbjct  61   EYPGSGEQYKVTLKIMDKDTFTADDYIGEATIYVKDLLALGVEKGTAQLHPLKYSVVRAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
              + GEI+V L F P   +  E +E  +GGWK S
Sbjct  121  GTYRGEIQVGLTFTPRAEQQHEGQE--FGGWKHS  152



>ref|NP_001235151.1| uncharacterized protein LOC100500493 [Glycine max]
 gb|ACU15593.1| unknown [Glycine max]
 gb|KHN41095.1| Elicitor-responsive protein 1 [Glycine soja]
Length=153

 Score =   108 bits (269),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G +EV L  AKGL+ TD   +MDPY +L  + QE+KSSV    G NP W+E F+F V
Sbjct  1    MAIGFMEVQLVKAKGLQETDIFAHMDPYVLLQYKGQERKSSVIHEGGRNPIWNEKFVFRV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS------IPQQSYNVVK-D  395
                S    +L ++IMD D   +DD VG+A I ++ + +EG+      +    Y+VV+ D
Sbjct  61   EYPGSGDQYKLNLRIMDKDVFSADDFVGQATIYVKDLLAEGAENGSAELRPHKYSVVRAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
            +++CGEI V + F  +     E  E+  GGWKES
Sbjct  121  QSYCGEIEVGITFTRKEE---EYIEDDVGGWKES  151



>ref|XP_008370566.1| PREDICTED: elicitor-responsive protein 1-like isoform X1 [Malus 
domestica]
Length=157

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 93/156 (60%), Gaps = 14/156 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTD-FLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            M  G LEV L SAKGL  T  F   MDPY ++  + QE+KSSVA  +GS+PEW+E F F 
Sbjct  1    MAVGLLEVNLVSAKGLGETHLFTGRMDPYVVIEYKGQERKSSVAREQGSSPEWNEKFTFR  60

Query  246  V----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG---SIPQQS---YNVVKD  395
                 S G  ++ +KIMD D   SDD +G+A I ++ + + G      +Q    Y+VV+ 
Sbjct  61   AEYPGSGGEYKITLKIMDQDTFTSDDFIGQATIYVKELLAXGVQNGTAEQHPLYYSVVRA  120

Query  396  EN-FCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
             N + GEI+V L F P++ +  +  E+S+GGWK S+
Sbjct  121  NNTYHGEIKVGLTFTPQVEQ--DDGEQSFGGWKNSA  154



>ref|XP_003518383.1| PREDICTED: elicitor-responsive protein 1-like [Glycine max]
 gb|KHN41096.1| Elicitor-responsive protein 1 [Glycine soja]
Length=156

 Score =   108 bits (269),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 91/156 (58%), Gaps = 14/156 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G ++V L  AKGL  TD    MDPY ++  + QEK+S+VA+G+G NP W+E F+F V
Sbjct  1    MAIGFMKVQLVKAKGLRGTDIFGKMDPYVLIQYKNQEKRSTVANGQGKNPVWNEKFIFKV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVK-D  395
                S    +L +KIMD D + +DD VGEA+I +  + ++G       +P   Y VV+ +
Sbjct  61   EYPGSINQHKLILKIMDKD-LYTDDFVGEAIIHVGDLLAQGVENGGAELPTLKYRVVRAN  119

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSR  503
            +++CGEI + + F  ++   F   E   GGWKES  
Sbjct  120  KSYCGEIDIGVTFTRKVEDKF--VEGDIGGWKESDH  153



>ref|XP_004970539.1| PREDICTED: elicitor-responsive protein 1-like [Setaria italica]
Length=155

 Score =   107 bits (267),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 85/155 (55%), Gaps = 14/155 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL   DFL  +DP+ I+  R+QE+KSSVA  +G NP W+E F F +
Sbjct  1    MGKGVLEVHLVDAKGLYGNDFLGKLDPFVIVQYRSQERKSSVARDQGRNPRWNEVFKFQI  60

Query  249  SDGVS----ELKIKIMDSDNIGSDDVVGEAVIPLESVFS----EGSIPQQSYN---VVKD  395
            +   S    +L ++I+D D+  SDD +GEA I +  + S     G+  Q +     V+ D
Sbjct  61   NSAASNAQHKLILRILDHDHFSSDDSLGEATIDVTGIISLGAERGTYTQSAAKHSVVLAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
              F GEI+V   F        + + E  GGW+ SS
Sbjct  121  NTFHGEIKVGFTFTATQ---VQEDGEEIGGWRYSS  152



>gb|AAC04628.1| Os-FIERG2 gene product [Oryza sativa]
 dbj|BAC06446.1| RPP17-2 [Oryza sativa Japonica Group]
 dbj|BAH01449.1| unnamed protein product [Oryza sativa Japonica Group]
Length=156

 Score =   107 bits (267),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 83/153 (54%), Gaps = 13/153 (8%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV---  248
            G LEV L  AKGL   DFL  +DPY ++  R+QE+KSSVA  +G NP W+E F F +   
Sbjct  5    GVLEVHLVDAKGLTGNDFLGKIDPYVVVQYRSQERKSSVARDQGKNPSWNEVFKFQINST  64

Query  249  -SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KDENF  404
             + G  +L +++MD D    DD +GEA I +  + S G       + +  + VV  D+ +
Sbjct  65   AATGQHKLFLRLMDHDTFSRDDFLGEATINVTDLISLGMEHGTWEMSESKHRVVLADKTY  124

Query  405  CGEIRVTLIFRPEMSRGFEPEEESYGGWKESSR  503
             GEIRV+L F    S   +   E  GGW  S R
Sbjct  125  HGEIRVSLTFTA--SAKAQDHAEQVGGWAHSFR  155



>ref|XP_009794955.1| PREDICTED: elicitor-responsive protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=154

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 97/153 (63%), Gaps = 16/153 (10%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV--  248
            GT+EV L +A+GL+N +FL   +DPY ++  R QE+KS+ A+G+GS PEW+E F F V  
Sbjct  6    GTMEVNLVNARGLKNNEFLGGGIDPYVLIQYRGQERKSTTATGQGSKPEWNERFTFRVEY  65

Query  249  --SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KDEN  401
              +D   +L +K+MD D+  SDD +GEA I L+ +   G       I  + Y+VV  D++
Sbjct  66   PSADKQYKLILKLMDHDSFSSDDSLGEATIYLKELIELGLENGRAEIHPRKYSVVGSDQS  125

Query  402  FCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            +CGEI+V L F P+ +      EE YGGWKES+
Sbjct  126  YCGEIQVGLTFTPKKA----AAEEEYGGWKESA  154



>ref|XP_004490894.1| PREDICTED: elicitor-responsive protein 1-like [Cicer arietinum]
Length=158

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 88/156 (56%), Gaps = 14/156 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNM-DPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            M  G +EV L  AKGL +T F   M DPY ++    QEK+S+VA  +G N  WDE F+F 
Sbjct  1    MAIGLMEVHLVKAKGLNSTCFFGGMEDPYVLIQYEGQEKRSNVAKSRGRNHVWDEKFVFK  60

Query  246  V----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSE------GSIPQQSYNVVK-  392
            V    S    +L  KIMD D   +DD +G+A+I ++ +  E        +P   Y VV+ 
Sbjct  61   VEKHGSSDKHKLIFKIMDKDTFSADDFIGQAIIYVKDLLGESVQNGVAKLPPLKYRVVRA  120

Query  393  DENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            D+++ GEI V + F P++  GF   EE  GGWK+SS
Sbjct  121  DQSYRGEIDVAITFTPKVEDGF--IEEDIGGWKQSS  154



>ref|XP_009794959.1| PREDICTED: elicitor-responsive protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=153

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 97/153 (63%), Gaps = 17/153 (11%)
 Frame = +3

Query  78   GTLEVVLASAKGLENTDFLCN-MDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV--  248
            GT+EV L +A+GL+N +FL   +DPY ++  R QE+KS+ A+G+GS PEW+E F F V  
Sbjct  6    GTMEVNLVNARGLKNNEFLGGGIDPYVLIQYRGQERKSTTATGQGSKPEWNERFTFRVEY  65

Query  249  --SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KDEN  401
              +D   +L +K+MD D+  SDD +GEA I L+ +   G       I  + Y+VV  D++
Sbjct  66   PSADKQYKLILKLMDHDSFSSDDSLGEATIYLKELIELGLENGRAEIHPRKYSVVGSDQS  125

Query  402  FCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
            +CGEI+V L F P+ +      EE YGGWKES+
Sbjct  126  YCGEIQVGLTFTPKAA-----AEEEYGGWKESA  153



>gb|AES99366.2| elicitor-responsive-like protein [Medicago truncatula]
Length=159

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 92/157 (59%), Gaps = 15/157 (10%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNM-DPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            M  G +EV L  AKGL +T F   M DPY ++  + QE +S VA G+G N  WDE F+F 
Sbjct  1    MAIGIMEVHLVKAKGLNSTCFFGGMEDPYVLIQYQGQEHRSRVAKGRGRNHVWDEIFMFK  60

Query  246  VSDGV-----SELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVK  392
            V + +     +++ +KIMD D+  +DD +G+A I  + + ++G       +P   Y VV+
Sbjct  61   VENNIGSNDKNKVILKIMDKDSFSADDFIGQATIYCKDLLAQGVQNGVAKLPPLKYRVVR  120

Query  393  -DENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
             D+++ GEI V++ F P++    E  EE  GGWKESS
Sbjct  121  ADQSYRGEIDVSITFTPKVEE--ELIEEDIGGWKESS  155



>ref|XP_003616407.1| Elicitor-responsive protein [Medicago truncatula]
 gb|AES99365.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=153

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 91/154 (59%), Gaps = 14/154 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G +EV+L  AKGL+ TD    MDPY +L  + QE KSSV    GS+P W+E F+F V
Sbjct  1    MTIGFMEVLLVKAKGLQETDIFARMDPYVLLQYKRQEHKSSVVHEGGSSPVWNEKFVFRV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS------IPQQSYNVVK-D  395
                S    +L +KIMD D   SDD VG+AVI ++ + +EG+      +  + Y+VV+ D
Sbjct  61   EYPGSGDQYKLNLKIMDKDVFSSDDFVGQAVIYVKDLLAEGAENGSAELRPRKYSVVRAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
             ++CGE+ V + +  + +   E  ++  GGW++S
Sbjct  121  NSYCGELEVGITYTRKEN---EYTDDDIGGWRDS  151



>ref|XP_010256915.1| PREDICTED: elicitor-responsive protein 1-like [Nelumbo nucifera]
Length=152

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 86/155 (55%), Gaps = 17/155 (11%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G L+V+L  A  L NT+   NMDPY ++    +E+KSSVA G+G NP W+E F F  
Sbjct  1    MGSGILQVLLLDAHRLRNTELFGNMDPYVVIKYGNEERKSSVARGQGRNPVWNEKFTFKA  60

Query  249  SD-----GVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNV-VK  392
                   G  +L +K+MD D   +DD VGE  I ++ V S G       +P + Y + + 
Sbjct  61   EYPGKIVGAHKLNLKVMDKDTYTADDFVGETTIYIKDVLSLGIDVGKAELPPRKYRLELA  120

Query  393  DENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
            D+ + GEIRV + F  ++     PE++  GGWK+S
Sbjct  121  DKTYKGEIRVGVSFTMKV-----PEDDDIGGWKQS  150



>ref|XP_009793672.1| PREDICTED: elicitor-responsive protein 3-like [Nicotiana sylvestris]
Length=82

 Score =   103 bits (257),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            MP G LEV +A+A+GL++T++L +M+PY ++TCRT+EKKSS ASG+GS+PEW+E+FLF +
Sbjct  1    MPYGQLEVYVANARGLDDTNWLTDMNPYVVVTCRTEEKKSSTASGEGSDPEWNESFLFTI  60

Query  249  SDGVSELKIKIMD  287
            + G +EL IK+MD
Sbjct  61   TRGCNELHIKLMD  73



>ref|XP_008776962.1| PREDICTED: elicitor-responsive protein 1 isoform X1 [Phoenix 
dactylifera]
Length=158

 Score =   105 bits (262),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 91/159 (57%), Gaps = 16/159 (10%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLC-NMDPYAILTCRTQEKKSSV--ASGKGSNPEWDETFL  239
            M +G LEV L  AKGL +TDFL  + DPY ++  R+QE+KSS+   +G+GSNP W+ETF 
Sbjct  1    MGKGILEVQLIDAKGLASTDFLGGDTDPYVLIQYRSQERKSSICRGAGQGSNPSWNETFK  60

Query  240  FNVSDGVSE----LKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS-------IPQQSYNV  386
            F V     E    L +K+MD D   +DD +GEA I +  V + G         P +   V
Sbjct  61   FVVHSPSGEHQHKLILKLMDHDTFTADDFMGEATINVMDVIALGMENGIGELRPCKHRVV  120

Query  387  VKDENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSR  503
            + D  +CGEIRV + F  EM    E EEE  GGWK S R
Sbjct  121  LADGTYCGEIRVGVKFTTEMKE--EEEEEELGGWKHSFR  157



>ref|XP_008458867.1| PREDICTED: elicitor-responsive protein 1-like isoform X1 [Cucumis 
melo]
Length=153

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 90/155 (58%), Gaps = 14/155 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  GTLEV LA+AKGL  TDFL  +DPY ++  + QE KSSVA  +G +P W+E F+F  
Sbjct  1    MAIGTLEVKLANAKGLRGTDFLGRIDPYVLIQYKGQEHKSSVARNEGGSPVWNEKFIFKA  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVKDE  398
                +    ++ +KIMD D   +DD +G+A I ++ + + G       +  Q Y VV D 
Sbjct  61   EYPGTGDNFKIILKIMDHDTFSADDFIGQASIYVKDLLALGVENGVSELGPQKYRVVGDN  120

Query  399  -NFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESS  500
             N+ GEI+V + F  +++   E + E  GGWK+S 
Sbjct  121  LNYNGEIQVGVTFTQKVT---EYDGEEVGGWKQSG  152



>ref|XP_010232545.1| PREDICTED: elicitor-responsive protein 1 isoform X2 [Brachypodium 
distachyon]
Length=154

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 85/157 (54%), Gaps = 14/157 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL  +DFL  +DPY I+  R+QE+KSS A  +G NP W+E F F +
Sbjct  1    MGRGVLEVHLVDAKGLSGSDFLGKIDPYVIVQYRSQERKSSTARDQGRNPAWNEVFRFQI  60

Query  249  SDGVS----ELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KD  395
            +   +    +L  +IMD DN  SDD +GEA + +  + S G       +    Y+VV  D
Sbjct  61   NSSAANVQHKLFFRIMDHDNFSSDDFLGEASVNVTDLISIGMERGTSQLNAAKYSVVTAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSRD  506
             ++ GEIR  + F        E +  + GGW  S R+
Sbjct  121  NSYHGEIRFGITFTAAK---VEEDGGAVGGWTNSYRE  154



>gb|EMT23935.1| hypothetical protein F775_03303 [Aegilops tauschii]
Length=157

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 86/156 (55%), Gaps = 14/156 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL  TDFL  +DPY ++  R+QE+KS+ A   G NP W+E F F +
Sbjct  1    MARGLLEVHLVHAKGLSGTDFLGKVDPYVVVQYRSQERKSTTARDAGRNPSWNEVFRFQI  60

Query  249  SDGVS----ELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KD  395
            +   +    +L ++IMD DN+ SDD +G+A I +  + S G       +    Y VV  D
Sbjct  61   NSSAANVQEKLFLRIMDRDNLSSDDFLGQATINVTDLISMGMESGTSRLNPAKYRVVTAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSR  503
             ++ GEI++ + F    +   E +    GGW +S R
Sbjct  121  YSYHGEIKIGITF---TAAKVEEDGAQVGGWVQSFR  153



>ref|XP_007220086.1| hypothetical protein PRUPE_ppa024243mg [Prunus persica]
 gb|EMJ21285.1| hypothetical protein PRUPE_ppa024243mg [Prunus persica]
Length=141

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 71/101 (70%), Gaps = 2/101 (2%)
 Frame = +3

Query  183  KSSVASGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS  362
            K  V +G+GS PEW+ETF+F VSD VSEL +KIM+ DN  +DD VGEA I LE +F+EGS
Sbjct  5    KEIVHAGQGSAPEWNETFVFTVSDDVSELHLKIMEKDNFSADDFVGEATISLEPIFTEGS  64

Query  363  IPQQSYNVV-KDENFCGEIRVTLIFRPEMSRGFEPEEESYG  482
            IP  +YNVV +D+ + GEI+V L F PE  +   P  E YG
Sbjct  65   IPPTAYNVVNQDKEYRGEIKVGLRFTPEPQQNDGPSGE-YG  104



>gb|EMS48714.1| Elicitor-responsive protein 1 [Triticum urartu]
Length=163

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 87/160 (54%), Gaps = 14/160 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL  TDFL  +DPY ++  R+QE+KSS A   G NP W+E   F +
Sbjct  1    MARGLLEVHLVHAKGLSGTDFLGKIDPYVVVQYRSQERKSSTARDAGRNPSWNEVLRFQI  60

Query  249  SDGVS----ELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQS------YNVV-KD  395
            +   +    +L ++IMD DN  SDD +G+A I +  + S G    +S      Y VV  D
Sbjct  61   NSSAANVQEKLVLRIMDHDNFSSDDFLGQATINVTDLISMGMESGKSRLNPAKYRVVTAD  120

Query  396  ENFCGEIRVTLIF---RPEMSRGFEPEEESYGGWKESSRD  506
             ++ GEI++ + F   + +     E +    GGW ++ R+
Sbjct  121  NSYHGEIKIGITFTAAKVDAHSQVEQDGAHVGGWMQTFRE  160



>gb|EMT23934.1| hypothetical protein F775_17616 [Aegilops tauschii]
Length=163

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 85/160 (53%), Gaps = 14/160 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL  TDFL  +DPY ++  R+QE+KSS A   G NP W+E   F +
Sbjct  1    MARGLLEVHLVDAKGLSGTDFLGKIDPYVVVQYRSQERKSSTARDAGRNPSWNEVLRFQI  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KD  395
                ++G  +L  +IMD D    DD +G+A I +  + S G       +    Y VV  D
Sbjct  61   NSSAANGQDKLVFRIMDHDTFSRDDFLGQATINVTDLISIGMESGTSRLNPAKYRVVTAD  120

Query  396  ENFCGEIRVTLIF---RPEMSRGFEPEEESYGGWKESSRD  506
             ++ GEI+V + F   + +     E +   +GGW+ S R+
Sbjct  121  NSYHGEIKVGITFTAAKVDAHSQVEEDGAQFGGWRHSFRE  160



>ref|XP_007141871.1| hypothetical protein PHAVU_008G232800g [Phaseolus vulgaris]
 gb|ESW13865.1| hypothetical protein PHAVU_008G232800g [Phaseolus vulgaris]
Length=154

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 91/154 (59%), Gaps = 13/154 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G +EV L  AKGL  TD   +MDPY +L  + QE+KS V    G NPEW+E F+F V
Sbjct  1    MAFGFMEVQLVKAKGLHETDVFAHMDPYVLLQYKGQERKSRVIHEGGRNPEWNEKFVFRV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGS------IPQQSYNVVK-D  395
                S    +L + IMD D   +DD VG+A + ++ + +EG+      +    Y+VV+ D
Sbjct  61   EYPGSGDQYKLNLVIMDKDVFSADDFVGQAAVYVKDLLAEGTEKGSAELRPHKYSVVRGD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
            +++CGEI V + F  +  + ++ ++++ GGWK+S
Sbjct  121  QSYCGEIEVGITFTLK-EQEYDDDDDA-GGWKQS  152



>ref|XP_004960028.1| PREDICTED: C2 domain-containing protein At1g63220-like isoform 
X1 [Setaria italica]
Length=164

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query  198  SGKGSNPEWDETFLFNVSDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEGSIPQQS  377
            SG GS PEW+ETF+F VSD   +L +KIMDSD +  DD VGEA IPLE++F EGS+P   
Sbjct  61   SGAGSEPEWNETFIFTVSDDTPQLHLKIMDSD-VTDDDFVGEATIPLEALFQEGSLPPTV  119

Query  378  YNVVKDENFCGEIRVTLIFRP  440
            + VVK+E +CGEI++ L F P
Sbjct  120  HPVVKEEKYCGEIKIALTFTP  140



>emb|CDM84975.1| unnamed protein product [Triticum aestivum]
Length=163

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 85/160 (53%), Gaps = 14/160 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M +G LEV L  AKGL  TDFL  +DPY I+  R+QE+KSS A   G NP W+E   F +
Sbjct  1    MARGLLEVHLVQAKGLSGTDFLGKIDPYVIVQYRSQERKSSTARDAGRNPSWNEVLRFQI  60

Query  249  SDGVS----ELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KD  395
            +   +    +L ++IMD DN  SDD +G+A I +  + S G       +    Y VV  D
Sbjct  61   NSSAANVQDKLVLRIMDHDNFSSDDFLGQATINVTDLISMGMESGTSRLNPAKYRVVTAD  120

Query  396  ENFCGEIRVTLIF---RPEMSRGFEPEEESYGGWKESSRD  506
             ++ GEI++ + F   + +     E +    GGW  S R+
Sbjct  121  NSYHGEIKIGITFTAAKVDAPSQVEEDGGQVGGWMHSVRE  160



>ref|XP_003616408.1| Elicitor-responsive protein [Medicago truncatula]
Length=260

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 93/160 (58%), Gaps = 15/160 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNM-DPYAILTCRTQEKKSSVASGKGSNPEWDETFLFN  245
            M  G +EV L  AKGL +T F   M DPY ++  + QE +S VA G+G N  WDE F+F 
Sbjct  1    MAIGIMEVHLVKAKGLNSTCFFGGMEDPYVLIQYQGQEHRSRVAKGRGRNHVWDEIFMFK  60

Query  246  VSDGV-----SELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVK  392
            V + +     +++ +KIMD D+  +DD +G+A I  + + ++G       +P   Y VV+
Sbjct  61   VENNIGSNDKNKVILKIMDKDSFSADDFIGQATIYCKDLLAQGVQNGVAKLPPLKYRVVR  120

Query  393  -DENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKESSRDF  509
             D+++ GEI V++ F P++    E  EE  GGWKES  ++
Sbjct  121  ADQSYRGEIDVSITFTPKVEE--ELIEEDIGGWKESIWNY  158



>ref|XP_004307500.1| PREDICTED: elicitor-responsive protein 1 [Fragaria vesca subsp. 
vesca]
Length=156

 Score =   102 bits (254),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 89/154 (58%), Gaps = 13/154 (8%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  G +EV+L +A+GL +TD +  MDPY ++  ++QE ++SVA G+G NP W+E  +F V
Sbjct  1    MAVGLMEVLLVNARGLGDTDIIGRMDPYVVVKYKSQEHRTSVARGQGGNPVWNERLIFRV  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVV-KD  395
                S    +L  KIMD D    DD +GEA I ++ +   G       I  + Y+VV  D
Sbjct  61   EYPGSGEQYKLTFKIMDKDTFTPDDTIGEATIYVKELLELGVEKGSAEIHPKKYSVVAAD  120

Query  396  ENFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
            ++F G+I+V + F  +  + +  +E  +GGWK S
Sbjct  121  KSFRGDIQVGVTFTKKAEQEYGGQE--FGGWKHS  152



>ref|XP_004142762.1| PREDICTED: elicitor-responsive protein 1-like [Cucumis sativus]
 gb|KGN51319.1| hypothetical protein Csa_5G517170 [Cucumis sativus]
Length=153

 Score =   102 bits (254),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  GTLEV LA+AKGL   DFL  +DPY ++  + QE KSSVA  +G +P W+E F F  
Sbjct  1    MAIGTLEVKLANAKGLRGADFLGRIDPYVLIQYKGQEHKSSVAKNEGGSPVWNEKFTFRA  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVKDE  398
                S    ++ ++IMD D   +DD +G+A I ++ + + G       +  Q Y VV D+
Sbjct  61   EYPGSGDNFKIILRIMDHDTFSADDFIGQASIYVKDLLALGVENGVSELWPQKYRVVGDD  120

Query  399  -NFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
             N+ GEI+V + F  +++   E + E  GGWK+S
Sbjct  121  LNYNGEIQVGVTFTQKVT---EYDGEELGGWKQS  151



>ref|XP_004170950.1| PREDICTED: elicitor-responsive protein 1-like [Cucumis sativus]
Length=153

 Score =   102 bits (254),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = +3

Query  69   MPQGTLEVVLASAKGLENTDFLCNMDPYAILTCRTQEKKSSVASGKGSNPEWDETFLFNV  248
            M  GTLEV LA+AKGL   DFL  +DPY ++  + QE KSSVA  +G +P W+E F F  
Sbjct  1    MAIGTLEVKLANAKGLRGADFLGRIDPYVLIQYKGQEHKSSVAKNEGGSPVWNEKFTFRA  60

Query  249  ----SDGVSELKIKIMDSDNIGSDDVVGEAVIPLESVFSEG------SIPQQSYNVVKDE  398
                S    ++ ++IMD D   +DD +G+A I ++ + + G       +  Q Y VV D+
Sbjct  61   EYPGSGDNFKIILRIMDHDTFSADDFIGQASIYVKDLLALGVEKGVSELWPQKYRVVGDD  120

Query  399  -NFCGEIRVTLIFRPEMSRGFEPEEESYGGWKES  497
             N+ GEI+V + F  +++   E + E  GGWK+S
Sbjct  121  LNYNGEIQVGVTFTQKVT---EYDGEELGGWKQS  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325