BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K12

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AIY35292.1|  fasciclin-like arabinogalactan 12                       171   2e-47   Gossypium hirsutum [American cotton]
gb|KJB49352.1|  hypothetical protein B456_008G114900                    169   7e-47   Gossypium raimondii
ref|XP_007052018.1|  FASCICLIN-like arabinogalactan protein 8           169   8e-47   Theobroma cacao [chocolate]
gb|ABV27483.1|  fasciclin-like arabinogalactan protein 12               168   1e-46   Gossypium hirsutum [American cotton]
gb|ABV27484.1|  fasciclin-like arabinogalactan protein 13               167   4e-46   Gossypium hirsutum [American cotton]
ref|XP_011090995.1|  PREDICTED: fasciclin-like arabinogalactan pr...    167   5e-46   Sesamum indicum [beniseed]
gb|KJB41114.1|  hypothetical protein B456_007G092300                    167   5e-46   Gossypium raimondii
dbj|BAP11162.1|  putative Fasciclin-like Arabinogalactan-protein 10     160   1e-45   Zanthoxylum ailanthoides
ref|XP_006402530.1|  hypothetical protein EUTSA_v10005998mg             164   3e-45   Eutrema salsugineum [saltwater cress]
ref|XP_008232692.1|  PREDICTED: fasciclin-like arabinogalactan pr...    164   4e-45   Prunus mume [ume]
ref|XP_006397729.1|  hypothetical protein EUTSA_v10001463mg             164   4e-45   Eutrema salsugineum [saltwater cress]
dbj|BAP11161.1|  putative Fasciclin-like Arabinogalactan-protein 10     158   5e-45   Zanthoxylum ailanthoides
dbj|BAP11158.1|  putative Fasciclin-like Arabinogalactan-protein 10     158   6e-45   Zanthoxylum ailanthoides
gb|EYU32014.1|  hypothetical protein MIMGU_mgv1a007039mg                164   7e-45   Erythranthe guttata [common monkey flower]
dbj|BAP11159.1|  putative Fasciclin-like Arabinogalactan-protein 10     157   8e-45   Zanthoxylum ailanthoides
ref|XP_002511740.1|  conserved hypothetical protein                     164   8e-45   Ricinus communis
ref|XP_009605451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    164   9e-45   Nicotiana tomentosiformis
ref|XP_002320736.1|  Fasciclin-like arabinogalactan protein 8 pre...    163   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_004229828.1|  PREDICTED: fasciclin-like arabinogalactan pr...    163   1e-44   Solanum lycopersicum
ref|XP_004306902.1|  PREDICTED: fasciclin-like arabinogalactan pr...    163   1e-44   Fragaria vesca subsp. vesca
ref|XP_011034618.1|  PREDICTED: fasciclin-like arabinogalactan pr...    163   1e-44   Populus euphratica
gb|KFK37339.1|  hypothetical protein AALP_AA4G243700                    163   1e-44   Arabis alpina [alpine rockcress]
ref|XP_006339448.1|  PREDICTED: fasciclin-like arabinogalactan pr...    162   4e-44   Solanum tuberosum [potatoes]
emb|CDY18927.1|  BnaC04g04230D                                          161   6e-44   Brassica napus [oilseed rape]
ref|XP_010056276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    161   7e-44   Eucalyptus grandis [rose gum]
ref|XP_007218052.1|  hypothetical protein PRUPE_ppa006158mg             161   8e-44   Prunus persica
emb|CDX74743.1|  BnaA05g04890D                                          160   1e-43   
ref|XP_009143146.1|  PREDICTED: fasciclin-like arabinogalactan pr...    160   1e-43   Brassica rapa
ref|XP_002878353.1|  AT3g60900/T4C21_310                                160   1e-43   
ref|NP_566043.1|  FASCICLIN-like arabinogalactan protein 8              160   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAM66074.1|  endosperm-specific protein-like protein                 160   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006445226.1|  hypothetical protein CICLE_v10020328mg             160   1e-43   Citrus clementina [clementine]
emb|CDX71771.1|  BnaC08g31030D                                          160   2e-43   
dbj|BAJ34929.1|  fasciclin-like arabinogalactan protein                 160   2e-43   Vitis hybrid cultivar
ref|XP_006491459.1|  PREDICTED: fasciclin-like arabinogalactan pr...    160   2e-43   
gb|KDP28734.1|  hypothetical protein JCGZ_14505                         160   2e-43   Jatropha curcas
ref|XP_010518164.1|  PREDICTED: fasciclin-like arabinogalactan pr...    159   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_002882015.1|  hypothetical protein ARALYDRAFT_483684             159   4e-43   
ref|XP_010277448.1|  PREDICTED: fasciclin-like arabinogalactan pr...    159   4e-43   Nelumbo nucifera [Indian lotus]
emb|CAN65447.1|  hypothetical protein VITISV_011425                     158   7e-43   Vitis vinifera
ref|XP_002270426.2|  PREDICTED: fasciclin-like arabinogalactan pr...    158   7e-43   Vitis vinifera
ref|XP_009785088.1|  PREDICTED: fasciclin-like arabinogalactan pr...    158   7e-43   Nicotiana sylvestris
emb|CDP17792.1|  unnamed protein product                                159   9e-43   Coffea canephora [robusta coffee]
ref|XP_010508167.1|  PREDICTED: fasciclin-like arabinogalactan pr...    158   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006296250.1|  hypothetical protein CARUB_v10025417mg             158   1e-42   Capsella rubella
ref|XP_010506492.1|  PREDICTED: fasciclin-like arabinogalactan pr...    158   1e-42   
emb|CDY52341.1|  BnaA09g38900D                                          157   2e-42   Brassica napus [oilseed rape]
ref|XP_004144998.1|  PREDICTED: fasciclin-like arabinogalactan pr...    157   2e-42   
ref|XP_010525235.1|  PREDICTED: fasciclin-like arabinogalactan pr...    159   2e-42   
ref|XP_009116767.1|  PREDICTED: fasciclin-like arabinogalactan pr...    157   2e-42   Brassica rapa
ref|NP_191649.1|  fasciclin-like arabinogalactan protein 10             157   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|AAK55685.1|AF378882_1  AT3g60900/T4C21_310                           156   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008460132.1|  PREDICTED: fasciclin-like arabinogalactan pr...    154   2e-41   Cucumis melo [Oriental melon]
ref|XP_010512424.1|  PREDICTED: fasciclin-like arabinogalactan pr...    154   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_008343059.1|  PREDICTED: fasciclin-like arabinogalactan pr...    154   3e-41   
ref|XP_006292436.1|  hypothetical protein CARUB_v10018654mg             154   3e-41   Capsella rubella
ref|XP_010469133.1|  PREDICTED: fasciclin-like arabinogalactan pr...    154   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009379279.1|  PREDICTED: fasciclin-like arabinogalactan pr...    154   5e-41   Pyrus x bretschneideri [bai li]
ref|XP_010092859.1|  hypothetical protein L484_022454                   153   8e-41   Morus notabilis
ref|XP_004492650.1|  PREDICTED: fasciclin-like arabinogalactan pr...    151   5e-40   Cicer arietinum [garbanzo]
ref|XP_007139983.1|  hypothetical protein PHAVU_008G075000g             149   2e-39   Phaseolus vulgaris [French bean]
ref|XP_009104281.1|  PREDICTED: fasciclin-like arabinogalactan pr...    149   3e-39   Brassica rapa
gb|AFK41095.1|  unknown                                                 149   3e-39   Lotus japonicus
gb|EPS62290.1|  fasciclin-like arabinogalactan protein 13               148   4e-39   Genlisea aurea
ref|XP_003534603.1|  PREDICTED: fasciclin-like arabinogalactan pr...    147   9e-39   Glycine max [soybeans]
ref|XP_006858016.1|  hypothetical protein AMTR_s00069p00195790          145   5e-38   Amborella trichopoda
ref|XP_003552347.1|  PREDICTED: fasciclin-like arabinogalactan pr...    145   7e-38   Glycine max [soybeans]
emb|CDY66159.1|  BnaCnng49680D                                          143   3e-37   Brassica napus [oilseed rape]
ref|XP_010545153.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   7e-37   
emb|CDX67846.1|  BnaA07g18860D                                          142   1e-36   
emb|CDX86346.1|  BnaA06g30630D                                          141   2e-36   
gb|AGN92424.2|  putative fasciclin-like arabinogalactan protein 4       139   4e-36   Centaurium erythraea
ref|XP_009382277.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH23329.1|  fasciclin-like arabinogalactan protein                  134   7e-34   Medicago truncatula
ref|XP_003623747.1|  Fasciclin-like arabinogalactan protein             134   8e-34   
ref|XP_008780048.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   1e-33   Phoenix dactylifera
ref|XP_010933921.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   2e-33   Elaeis guineensis
ref|XP_008803297.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   2e-33   Phoenix dactylifera
ref|XP_006652672.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   1e-32   Oryza brachyantha
ref|XP_010919185.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   2e-32   Elaeis guineensis
ref|NP_001053617.1|  Os04g0574200                                       130   3e-32   
ref|XP_010418601.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   3e-32   
emb|CDY37043.1|  BnaA04g26210D                                          127   3e-31   Brassica napus [oilseed rape]
ref|XP_009142340.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   3e-31   Brassica rapa
gb|KDO59100.1|  hypothetical protein CISIN_1g015356mg                   126   5e-31   Citrus sinensis [apfelsine]
ref|XP_006474892.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   5e-31   Citrus sinensis [apfelsine]
ref|XP_006452590.1|  hypothetical protein CICLE_v10008218mg             126   8e-31   
gb|ABR16344.1|  unknown                                                 124   3e-30   Picea sitchensis
ref|XP_003580362.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   1e-29   Brachypodium distachyon [annual false brome]
ref|XP_002448368.1|  hypothetical protein SORBIDRAFT_06g026030          122   1e-29   Sorghum bicolor [broomcorn]
gb|ABK24724.1|  unknown                                                 122   1e-29   Picea sitchensis
ref|XP_006603146.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   2e-29   Glycine max [soybeans]
tpg|DAA36388.1|  TPA: fasciclin-like arabinogalactan protein 10         121   3e-29   
ref|XP_004516114.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   3e-29   Cicer arietinum [garbanzo]
ref|NP_001151356.1|  fasciclin-like arabinogalactan protein 10 pr...    121   3e-29   
gb|ABI95395.1|  fasciclin-like protein FLA5                             120   5e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010088447.1|  hypothetical protein L484_018219                   120   7e-29   Morus notabilis
gb|ABR16637.1|  unknown                                                 120   7e-29   Picea sitchensis
ref|XP_004976555.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   1e-28   Setaria italica
dbj|BAE75863.1|  putative fasciclin-like arabinogalactan protein        118   4e-28   Salicornia europaea [chicken-claws]
gb|AGV54413.1|  fasciclin-like arabinogalactan protein 1-like pro...    117   7e-28   Phaseolus vulgaris [French bean]
ref|XP_007146643.1|  hypothetical protein PHAVU_006G057400g             117   7e-28   Phaseolus vulgaris [French bean]
ref|XP_010243936.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   4e-27   Nelumbo nucifera [Indian lotus]
ref|XP_003532178.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   4e-27   Glycine max [soybeans]
gb|KEH34088.1|  fasciclin-like arabinogalactan protein                  115   5e-27   Medicago truncatula
gb|ABI95391.1|  fasciclin-like protein FLA1                             115   6e-27   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010497131.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   7e-27   Camelina sativa [gold-of-pleasure]
ref|XP_008462050.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   8e-27   Cucumis melo [Oriental melon]
ref|XP_004144548.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   9e-27   Cucumis sativus [cucumbers]
ref|XP_009120095.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   1e-26   Brassica rapa
ref|XP_010479980.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_002866110.1|  hypothetical protein ARALYDRAFT_495659             114   1e-26   
ref|XP_011038795.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   1e-26   Populus euphratica
emb|CDY28643.1|  BnaC09g32320D                                          114   1e-26   Brassica napus [oilseed rape]
ref|XP_010061458.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   1e-26   Eucalyptus grandis [rose gum]
ref|XP_007049368.1|  FASCICLIN-like arabinogalactan 2                   113   2e-26   
ref|XP_006286070.1|  hypothetical protein CARUB_v10007603mg             113   2e-26   Capsella rubella
ref|XP_010063266.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   2e-26   Eucalyptus grandis [rose gum]
gb|KJB81625.1|  hypothetical protein B456_013G152900                    113   2e-26   Gossypium raimondii
gb|ABV27481.1|  fasciclin-like arabinogalactan protein 10               113   2e-26   Gossypium hirsutum [American cotton]
ref|XP_011095539.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   2e-26   
gb|KJB13883.1|  hypothetical protein B456_002G100100                    113   3e-26   Gossypium raimondii
ref|XP_006844054.1|  hypothetical protein AMTR_s00006p00245830          112   3e-26   Amborella trichopoda
ref|XP_002298869.2|  hypothetical protein POPTR_0001s37650g             112   3e-26   
ref|XP_002522745.1|  conserved hypothetical protein                     112   3e-26   Ricinus communis
ref|XP_010435371.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_004291803.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   4e-26   Fragaria vesca subsp. vesca
ref|NP_200384.1|  fasciclin-like arabinogalactan protein 1              112   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485145.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   5e-26   Camelina sativa [gold-of-pleasure]
gb|KFK32403.1|  hypothetical protein AALP_AA6G237100                    112   5e-26   Arabis alpina [alpine rockcress]
gb|EYU33706.1|  hypothetical protein MIMGU_mgv1a007367mg                112   5e-26   Erythranthe guttata [common monkey flower]
ref|XP_011010616.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   5e-26   Populus euphratica
ref|XP_006352538.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   5e-26   Solanum tuberosum [potatoes]
emb|CDY37904.1|  BnaA06g19130D                                          112   6e-26   Brassica napus [oilseed rape]
ref|XP_007212310.1|  hypothetical protein PRUPE_ppa006726mg             112   6e-26   
ref|XP_009150168.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   6e-26   Brassica rapa
ref|XP_008227156.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   7e-26   Prunus mume [ume]
ref|XP_002863317.1|  hypothetical protein ARALYDRAFT_497154             112   7e-26   
ref|XP_010545276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   7e-26   Tarenaya hassleriana [spider flower]
ref|XP_010675939.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   7e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG09433.1|  Fasciclin-like arabinogalactan protein 1                112   8e-26   Gossypium arboreum [tree cotton]
ref|XP_008463001.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   8e-26   Cucumis melo [Oriental melon]
ref|XP_004148925.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   8e-26   Cucumis sativus [cucumbers]
ref|XP_006415013.1|  hypothetical protein EUTSA_v10025352mg             111   8e-26   Eutrema salsugineum [saltwater cress]
ref|XP_010496525.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   9e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009394682.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   1e-25   
ref|XP_002316776.2|  hypothetical protein POPTR_0011s09590g             111   1e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010536730.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_004248342.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-25   Solanum lycopersicum
emb|CDX68507.1|  BnaC01g25850D                                          110   2e-25   
gb|EYU27439.1|  hypothetical protein MIMGU_mgv1a007268mg                110   2e-25   Erythranthe guttata [common monkey flower]
ref|XP_006447810.1|  hypothetical protein CICLE_v10015469mg             110   2e-25   Citrus clementina [clementine]
ref|XP_006469451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-25   Citrus sinensis [apfelsine]
gb|EPS66997.1|  hypothetical protein M569_07779                         110   2e-25   Genlisea aurea
gb|KDO38095.1|  hypothetical protein CISIN_1g013841mg                   110   2e-25   Citrus sinensis [apfelsine]
emb|CDX87001.1|  BnaC03g52710D                                          110   2e-25   
ref|XP_006401420.1|  hypothetical protein EUTSA_v10013639mg             110   2e-25   Eutrema salsugineum [saltwater cress]
ref|XP_010542030.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-25   Tarenaya hassleriana [spider flower]
gb|KDP39270.1|  hypothetical protein JCGZ_01027                         110   2e-25   Jatropha curcas
ref|XP_009615606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-25   Nicotiana tomentosiformis
ref|XP_006357643.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   3e-25   Solanum tuberosum [potatoes]
gb|KFK27162.1|  hypothetical protein AALP_AA8G343200                    110   3e-25   Arabis alpina [alpine rockcress]
ref|XP_009151619.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   3e-25   Brassica rapa
ref|XP_011097758.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   3e-25   Sesamum indicum [beniseed]
emb|CDP13717.1|  unnamed protein product                                110   3e-25   Coffea canephora [robusta coffee]
ref|XP_010323900.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   4e-25   Solanum lycopersicum
ref|XP_007142534.1|  hypothetical protein PHAVU_008G288800g             109   5e-25   Phaseolus vulgaris [French bean]
ref|XP_003618047.1|  Fasciclin-like arabinogalactan protein             109   5e-25   Medicago truncatula
emb|CDP18905.1|  unnamed protein product                                109   5e-25   Coffea canephora [robusta coffee]
ref|XP_004491619.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   7e-25   Cicer arietinum [garbanzo]
gb|KHG10798.1|  Fasciclin-like arabinogalactan protein 2                108   8e-25   Gossypium arboreum [tree cotton]
ref|XP_007020499.1|  Fasciclin-like arabinogalactan protein 1           108   9e-25   
ref|XP_009767783.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   9e-25   Nicotiana sylvestris
ref|XP_006346133.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   1e-24   Solanum tuberosum [potatoes]
gb|AAK20858.1|AF333971_1  fasciclin-like arabinogalactan-protein 2      108   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009606546.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   1e-24   Nicotiana tomentosiformis
gb|AAM65777.1|  putative pollen surface protein                         108   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193009.1|  fasciclin-like arabinogalactan protein 2              108   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229928.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   2e-24   Prunus mume [ume]
ref|XP_010557720.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   2e-24   Tarenaya hassleriana [spider flower]
gb|AIY35291.1|  fasciclin-like arabinogalactan 11                       107   2e-24   Gossypium hirsutum [American cotton]
gb|ABV27482.1|  fasciclin-like arabinogalactan protein 11               107   2e-24   Gossypium hirsutum [American cotton]
ref|XP_010252769.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-24   Nelumbo nucifera [Indian lotus]
ref|XP_011100491.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-24   Sesamum indicum [beniseed]
ref|XP_011011127.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   4e-24   Populus euphratica
gb|KJB42730.1|  hypothetical protein B456_007G165800                    106   4e-24   Gossypium raimondii
emb|CBI39739.3|  unnamed protein product                                106   5e-24   Vitis vinifera
ref|XP_008380005.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   5e-24   
dbj|BAE71278.1|  putative fasciclin-like arabinogalactan protein ...    106   5e-24   Trifolium pratense [peavine clover]
ref|XP_008342240.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   5e-24   Malus domestica [apple tree]
ref|XP_009799147.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   6e-24   Nicotiana sylvestris
emb|CDY36762.1|  BnaA03g11240D                                          103   7e-24   Brassica napus [oilseed rape]
gb|KDP29933.1|  hypothetical protein JCGZ_18502                         106   7e-24   Jatropha curcas
ref|XP_007215592.1|  hypothetical protein PRUPE_ppa007675mg             105   7e-24   
emb|CDY20747.1|  BnaA02g08870D                                          105   9e-24   Brassica napus [oilseed rape]
ref|XP_009375067.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   9e-24   Pyrus x bretschneideri [bai li]
ref|XP_010692313.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-23   
ref|XP_002267946.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   2e-23   Vitis vinifera
ref|XP_002320524.2|  hypothetical protein POPTR_0014s16610g             104   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_009351261.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   2e-23   Pyrus x bretschneideri [bai li]
emb|CAN61077.1|  hypothetical protein VITISV_012919                     104   3e-23   Vitis vinifera
gb|AEI98736.1|  fasciclin-like arabinogalactan 2                        104   3e-23   Pisum sativum [garden pea]
ref|NP_187872.1|  fasciclin-like arabinogalactan protein 14             102   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003545484.2|  PREDICTED: fasciclin-like arabinogalactan pr...    104   3e-23   Glycine max [soybeans]
gb|EPS69372.1|  fasciclin-like arabinogalactan protein 19               103   3e-23   Genlisea aurea
ref|XP_003519683.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   3e-23   Glycine max [soybeans]
gb|ADP88924.1|  fasciclin-like AGP                                      104   4e-23   Gunnera manicata
ref|XP_004251538.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   4e-23   Solanum lycopersicum
gb|ABK28554.1|  unknown                                                 102   4e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006352015.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   5e-23   
ref|XP_009126981.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   6e-23   Brassica rapa
emb|CBI28444.3|  unnamed protein product                                104   7e-23   Vitis vinifera
ref|XP_010689281.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   7e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW58153.1|  hypothetical protein EUGRSUZ_H00875                     103   8e-23   Eucalyptus grandis [rose gum]
gb|ABV27490.1|  fasciclin-like arabinogalactan protein 19               103   9e-23   Gossypium hirsutum [American cotton]
ref|XP_009625162.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   1e-22   Nicotiana tomentosiformis
ref|XP_009802278.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-22   Nicotiana sylvestris
ref|XP_009418107.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU43168.1|  hypothetical protein MIMGU_mgv1a011668mg                101   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_004244059.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   2e-22   Solanum lycopersicum
ref|XP_010942271.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   2e-22   Elaeis guineensis
ref|XP_010909123.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   2e-22   Elaeis guineensis
gb|KHN13519.1|  Fasciclin-like arabinogalactan protein 1              98.2    3e-22   Glycine soja [wild soybean]
ref|XP_010069727.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   3e-22   Eucalyptus grandis [rose gum]
ref|XP_010265495.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   3e-22   
ref|NP_001061532.1|  Os08g0321000                                       100   5e-22   
ref|XP_009396684.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   6e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ42295.1|  hypothetical protein OsJ_26868                          100   7e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ACL36352.1|  fascilin-like arabinogalactan protein                   100   8e-22   Gossypium hirsutum [American cotton]
ref|XP_008788906.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   1e-21   
ref|XP_008809683.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   1e-21   Phoenix dactylifera
ref|XP_006660446.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.8    1e-21   Oryza brachyantha
ref|XP_009132640.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.1    2e-21   Brassica rapa
ref|NP_001062666.1|  Os09g0248100                                     99.4    2e-21   
ref|XP_009616556.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    2e-21   
ref|XP_008797603.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    2e-21   Phoenix dactylifera
ref|XP_009385381.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABI95393.1|  fasciclin-like protein FLA3                           98.6    4e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011085650.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...  97.8    6e-21   Sesamum indicum [beniseed]
ref|XP_006659292.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.8    6e-21   Oryza brachyantha
gb|EPS65223.1|  hypothetical protein M569_09558                       97.1    7e-21   Genlisea aurea
ref|XP_010943291.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.8    7e-21   Elaeis guineensis
ref|XP_004303568.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.8    8e-21   Fragaria vesca subsp. vesca
gb|KFK38614.1|  hypothetical protein AALP_AA3G137100                  96.3    8e-21   Arabis alpina [alpine rockcress]
ref|XP_011034724.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    1e-20   Populus euphratica
ref|XP_006280472.1|  hypothetical protein CARUB_v10026407mg           97.1    2e-20   
ref|XP_010928138.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    2e-20   Elaeis guineensis
ref|XP_009792211.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.3    3e-20   Nicotiana sylvestris
ref|XP_009396657.1|  PREDICTED: serine/threonine-protein phosphat...  98.6    3e-20   
ref|XP_009398985.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.3    3e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009379991.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.9    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU42817.1|  hypothetical protein MIMGU_mgv1a007557mg              95.9    4e-20   Erythranthe guttata [common monkey flower]
ref|XP_003576707.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.9    4e-20   Brachypodium distachyon [annual false brome]
ref|XP_002282846.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    7e-20   Vitis vinifera
ref|XP_009388359.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    8e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT07250.1|  hypothetical protein F775_26198                       95.1    8e-20   
gb|EMT17229.1|  hypothetical protein F775_11240                       93.2    1e-19   
gb|EMS62729.1|  hypothetical protein TRIUR3_26693                     93.2    1e-19   Triticum urartu
ref|XP_006368661.1|  hypothetical protein POPTR_0001s07490g           93.6    1e-19   
ref|XP_002267825.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.6    2e-19   Vitis vinifera
ref|XP_010102851.1|  hypothetical protein L484_004423                 92.8    2e-19   Morus notabilis
gb|ABI95418.1|  fasciclin-like protein FLA28                          93.6    2e-19   Triticum aestivum [Canadian hard winter wheat]
gb|EMS65354.1|  hypothetical protein TRIUR3_14037                     93.2    3e-19   Triticum urartu
ref|XP_010914304.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.4    3e-19   Elaeis guineensis
gb|EMT28749.1|  hypothetical protein F775_29839                       93.2    3e-19   
emb|CAN66163.1|  hypothetical protein VITISV_008126                   92.4    4e-19   Vitis vinifera
dbj|BAK00054.1|  predicted protein                                    92.8    5e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006845641.1|  hypothetical protein AMTR_s00019p00223190        92.4    5e-19   
ref|XP_002882785.1|  hypothetical protein ARALYDRAFT_478625           90.9    7e-19   Arabidopsis lyrata subsp. lyrata
dbj|BAJ90388.1|  predicted protein                                    92.4    8e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009418876.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.9    9e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007011569.1|  Fasciclin-like arabinogalactan protein 17, p...  90.1    2e-18   
ref|XP_010048457.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.1    2e-18   Eucalyptus grandis [rose gum]
ref|XP_002527970.1|  conserved hypothetical protein                   89.7    2e-18   
ref|XP_006649316.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.5    2e-18   
gb|KCW80704.1|  hypothetical protein EUGRSUZ_C02101                   89.7    3e-18   Eucalyptus grandis [rose gum]
ref|XP_006298989.1|  hypothetical protein CARUB_v10015115mg           89.4    3e-18   Capsella rubella
dbj|BAK07384.1|  predicted protein                                    89.4    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004136457.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.0    4e-18   Cucumis sativus [cucumbers]
ref|XP_008781934.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.4    4e-18   
dbj|BAK06740.1|  predicted protein                                    89.0    5e-18   
gb|ABI95423.1|  fasciclin-like protein FLA33                          88.6    5e-18   
ref|XP_009417795.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.6    6e-18   
gb|EMT00417.1|  hypothetical protein F775_14876                       88.2    7e-18   
ref|XP_010913663.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.2    1e-17   
ref|XP_008466329.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.4    1e-17   
ref|XP_011082708.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.4    2e-17   
ref|XP_007224727.1|  hypothetical protein PRUPE_ppa024912mg           86.7    3e-17   
ref|XP_008786366.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.7    3e-17   
ref|XP_009381782.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.7    3e-17   
ref|XP_008799981.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.3    3e-17   
ref|XP_004952427.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.3    4e-17   
ref|XP_008361057.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    5e-17   
ref|XP_008219801.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    5e-17   
ref|XP_010499304.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    5e-17   
ref|XP_010486992.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.9    5e-17   
gb|AAM19119.1|AC104427_17  Putative endosperm specific protein        87.0    6e-17   
ref|XP_008799982.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.5    7e-17   
gb|EAZ25443.1|  hypothetical protein OsJ_09260                        86.3    7e-17   
gb|ACU21313.1|  unknown                                               84.0    1e-16   
ref|XP_006382179.1|  putative surface family protein                  84.3    2e-16   
ref|XP_009363599.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.0    2e-16   
ref|XP_008651121.1|  PREDICTED: uncharacterized protein LOC100274...  85.5    2e-16   
ref|XP_004956400.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    4e-16   
dbj|BAK07804.1|  predicted protein                                    83.2    5e-16   
ref|XP_010465042.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.8    6e-16   
ref|XP_006607004.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.9    6e-16   
dbj|BAJ90216.1|  predicted protein                                    84.3    7e-16   
emb|CAN62804.1|  hypothetical protein VITISV_011795                   82.8    1e-15   
ref|XP_004244694.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.3    2e-15   
ref|XP_009402000.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.3    2e-15   
ref|XP_008679063.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.4    3e-15   
ref|XP_002271150.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.3    3e-15   
ref|XP_006664971.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.3    3e-15   
gb|KCW53929.1|  hypothetical protein EUGRSUZ_J03138                   80.9    3e-15   
ref|XP_006371803.1|  putative surface family protein                  80.9    3e-15   
ref|XP_002462113.1|  hypothetical protein SORBIDRAFT_02g019380        81.6    4e-15   
ref|NP_001130104.1|  hypothetical protein precursor                   80.5    5e-15   
ref|XP_003572987.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.6    5e-15   
gb|EMS55677.1|  hypothetical protein TRIUR3_04850                     80.5    7e-15   
ref|XP_003545530.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.7    1e-14   
ref|XP_002452625.1|  hypothetical protein SORBIDRAFT_04g029330        80.9    1e-14   
ref|XP_007161299.1|  hypothetical protein PHAVU_001G058300g           79.3    1e-14   
ref|XP_004953764.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.5    1e-14   
ref|XP_004973191.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.9    1e-14   
ref|XP_010229273.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.5    1e-14   
ref|XP_010034870.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.7    1e-14   
gb|KDP41920.1|  hypothetical protein JCGZ_26938                       78.6    1e-14   
ref|XP_011045030.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.0    1e-14   
ref|XP_006357096.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.6    1e-14   
ref|XP_003523715.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.6    2e-14   
ref|XP_008777689.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.6    2e-14   
ref|XP_002440657.1|  hypothetical protein SORBIDRAFT_09g004700        80.1    2e-14   
ref|XP_002512774.1|  Glycoprotein X precursor, putative               79.0    2e-14   
gb|EPS61284.1|  hypothetical protein M569_13515                       78.2    2e-14   
ref|XP_009377364.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.6    2e-14   
ref|XP_011015272.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.8    3e-14   
ref|XP_009615226.1|  PREDICTED: fasciclin-like arabinogalactan pr...  78.2    3e-14   
gb|ABI95392.1|  fasciclin-like protein FLA2                           79.3    3e-14   
ref|XP_010104070.1|  hypothetical protein L484_014256                 79.0    4e-14   
ref|XP_006647825.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    4e-14   
ref|XP_008228867.1|  PREDICTED: mucin-17-like                         80.5    4e-14   
ref|XP_008378295.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    4e-14   
ref|XP_010938482.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    4e-14   
ref|NP_001047988.1|  Os02g0726000                                     77.4    4e-14   
ref|NP_001141906.1|  uncharacterized protein LOC100274054 precursor   79.0    4e-14   
ref|XP_002452018.1|  hypothetical protein SORBIDRAFT_04g015850        77.4    5e-14   
ref|XP_009784353.1|  PREDICTED: fasciclin-like arabinogalactan pr...  77.4    5e-14   
gb|EAY87366.1|  hypothetical protein OsI_08770                        77.0    5e-14   
gb|KHN16466.1|  Fasciclin-like arabinogalactan protein 14             76.6    6e-14   
gb|KEH39774.1|  fasciclin domain protein                              77.0    6e-14   
emb|CDY42162.1|  BnaC05g40570D                                        76.6    7e-14   
ref|XP_003526450.1|  PREDICTED: fasciclin-like arabinogalactan pr...  76.3    8e-14   
gb|KDP33435.1|  hypothetical protein JCGZ_07006                       76.6    9e-14   
ref|XP_009338843.1|  PREDICTED: fasciclin-like arabinogalactan pr...  76.3    1e-13   
ref|XP_010102850.1|  hypothetical protein L484_004422                 76.3    1e-13   
ref|XP_008445580.1|  PREDICTED: fasciclin-like arabinogalactan pr...  76.3    1e-13   
emb|CDY08417.1|  BnaA05g26530D                                        75.9    1e-13   
ref|XP_009593249.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.9    2e-13   
gb|ACN30673.1|  unknown                                               77.0    2e-13   
ref|XP_009135245.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.5    2e-13   
gb|EMS64953.1|  hypothetical protein TRIUR3_19371                     75.9    2e-13   
gb|AAG24276.1|AF195889_1  fasciclin-like arabinogalactan protein ...  75.9    2e-13   
emb|CDX73808.1|  BnaA03g32390D                                        75.1    2e-13   
ref|NP_001147121.1|  rat frizzled homolog1                            77.0    3e-13   
ref|XP_004138878.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.1    3e-13   
gb|KJB66000.1|  hypothetical protein B456_010G123500                  75.1    3e-13   
ref|XP_009146602.1|  PREDICTED: fasciclin-like arabinogalactan pr...  74.3    4e-13   
ref|XP_009370988.1|  PREDICTED: fasciclin-like arabinogalactan pr...  75.5    4e-13   
ref|XP_009612463.1|  PREDICTED: fasciclin-like arabinogalactan pr...  74.3    5e-13   
gb|EMT18770.1|  hypothetical protein F775_29041                       75.5    5e-13   
ref|NP_001169235.1|  uncharacterized protein LOC100383093 precursor   75.9    5e-13   
ref|XP_011467218.1|  PREDICTED: fasciclin-like arabinogalactan pr...  74.3    5e-13   
gb|ABV27488.1|  fasciclin-like arabinogalactan protein 17             74.3    5e-13   
ref|XP_008219800.1|  PREDICTED: fasciclin-like arabinogalactan pr...  73.9    7e-13   
gb|KFK32632.1|  hypothetical protein AALP_AA6G268600                  73.6    1e-12   
ref|XP_010526275.1|  PREDICTED: fasciclin-like arabinogalactan pr...  73.6    1e-12   
ref|XP_004987197.1|  PREDICTED: fasciclin-like arabinogalactan pr...  74.7    1e-12   
ref|NP_180021.1|  fasciclin-like arabinogalactan protein 3            73.2    1e-12   
gb|KHN10392.1|  Fasciclin-like arabinogalactan protein 3              73.6    1e-12   
ref|XP_010324668.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.8    1e-12   
ref|XP_011082038.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.8    1e-12   
ref|XP_010938483.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.8    2e-12   
ref|XP_009787705.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.4    2e-12   
ref|XP_006653238.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.4    2e-12   
gb|KEH39773.1|  fasciclin domain protein                              72.4    3e-12   
ref|XP_009120424.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.0    3e-12   
ref|XP_006450136.1|  hypothetical protein CICLE_v10010765mg           72.4    3e-12   
ref|XP_006483738.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.0    3e-12   
ref|XP_006357108.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.8    3e-12   
ref|XP_002880584.1|  hypothetical protein ARALYDRAFT_481301           72.0    3e-12   
ref|XP_004965239.1|  PREDICTED: fasciclin-like arabinogalactan pr...  73.9    4e-12   
ref|XP_004486594.1|  PREDICTED: fasciclin-like arabinogalactan pr...  72.8    5e-12   
ref|XP_009781936.1|  PREDICTED: fasciclin-like arabinogalactan pr...  71.6    5e-12   
ref|XP_009117125.1|  PREDICTED: fasciclin-like arabinogalactan pr...  71.6    5e-12   
emb|CDX76814.1|  BnaC08g34000D                                        71.6    5e-12   
emb|CDY34771.1|  BnaA09g41380D                                        71.6    5e-12   
ref|XP_003581094.1|  PREDICTED: fasciclin-like arabinogalactan pr...  71.6    5e-12   
ref|XP_004305606.1|  PREDICTED: fasciclin-like arabinogalactan pr...  71.6    5e-12   
ref|XP_002488894.1|  hypothetical protein SORBIDRAFT_2276s002020      72.8    6e-12   
gb|AFK40899.1|  unknown                                               71.2    6e-12   
ref|NP_001046792.1|  Os02g0461500                                     71.6    7e-12   
gb|EYU22059.1|  hypothetical protein MIMGU_mgv1a011491mg              70.9    9e-12   
emb|CDY20316.1|  BnaC04g36400D                                        70.9    1e-11   
ref|XP_006296192.1|  hypothetical protein CARUB_v10025354mg           70.5    1e-11   
gb|KEH39771.1|  fasciclin-like arabinogalactan protein                70.5    1e-11   
ref|XP_007221854.1|  hypothetical protein PRUPE_ppa021523mg           70.5    1e-11   
emb|CDY00793.1|  BnaC03g37770D                                        69.7    2e-11   
gb|AFK47920.1|  unknown                                               70.1    2e-11   
ref|XP_009140554.1|  PREDICTED: fasciclin-like arabinogalactan pr...  69.3    3e-11   
gb|EEC74435.1|  hypothetical protein OsI_09823                        68.2    4e-11   
ref|XP_006404978.1|  hypothetical protein EUTSA_v10000470mg           68.9    4e-11   
ref|NP_001048836.2|  Os03g0128000                                     67.8    5e-11   
gb|KEH39772.1|  fasciclin domain protein                              67.8    7e-11   
ref|XP_010447580.1|  PREDICTED: fasciclin-like arabinogalactan pr...  68.6    7e-11   
ref|XP_010527113.1|  PREDICTED: fasciclin-like arabinogalactan pr...  68.6    7e-11   
ref|XP_010438048.1|  PREDICTED: fasciclin-like arabinogalactan pr...  68.6    8e-11   
ref|XP_010417204.1|  PREDICTED: fasciclin-like arabinogalactan pr...  67.8    1e-10   
ref|XP_010472452.1|  PREDICTED: fasciclin-like arabinogalactan pr...  67.8    1e-10   
ref|XP_010429425.1|  PREDICTED: fasciclin-like arabinogalactan pr...  67.8    1e-10   
gb|KHN08266.1|  Fasciclin-like arabinogalactan protein 2              65.9    1e-10   
ref|XP_007024813.1|  FASCICLIN-like arabinogalactan protein 14 pr...  68.2    1e-10   
ref|XP_009365292.1|  PREDICTED: fasciclin-like arabinogalactan pr...  68.2    2e-10   
ref|XP_004498590.1|  PREDICTED: fasciclin-like arabinogalactan pr...  67.8    2e-10   
gb|AAA91129.1|  putative surface protein                              67.0    2e-10   
ref|XP_010432871.1|  PREDICTED: fasciclin-like arabinogalactan pr...  67.0    2e-10   
ref|XP_004965683.1|  PREDICTED: fasciclin-like arabinogalactan pr...  67.0    2e-10   
ref|XP_004305604.1|  PREDICTED: fasciclin-like arabinogalactan pr...  67.0    2e-10   
dbj|BAJ88864.1|  predicted protein                                    67.8    3e-10   
ref|XP_009133982.1|  PREDICTED: fasciclin-like arabinogalactan pr...  66.6    3e-10   
ref|XP_011468509.1|  PREDICTED: fasciclin-like arabinogalactan pr...  65.9    4e-10   
gb|KJB67004.1|  hypothetical protein B456_010G169900                  65.9    5e-10   
ref|XP_011082039.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...  65.9    5e-10   
ref|XP_008352034.1|  PREDICTED: fasciclin-like arabinogalactan pr...  65.9    6e-10   
ref|XP_006412600.1|  hypothetical protein EUTSA_v10027390mg           65.9    7e-10   
emb|CDY23293.1|  BnaA08g12530D                                        65.5    8e-10   
emb|CDY11984.1|  BnaC03g14100D                                        63.2    9e-10   
ref|NP_001105408.1|  endosperm specific protein1 precursor            66.2    9e-10   
ref|XP_008228897.1|  PREDICTED: fasciclin-like arabinogalactan pr...  67.0    9e-10   
ref|XP_007216704.1|  hypothetical protein PRUPE_ppa026501mg           67.0    1e-09   
ref|XP_009354314.1|  PREDICTED: fasciclin-like arabinogalactan pr...  66.6    1e-09   
ref|XP_009370989.1|  PREDICTED: fasciclin-like arabinogalactan pr...  66.2    1e-09   
ref|XP_002534396.1|  conserved hypothetical protein                   65.9    1e-09   
ref|NP_001149463.1|  fasciclin-like arabinogalactan protein 8 pre...  65.1    1e-09   
ref|NP_001131728.1|  endosperm specific protein precursor             66.2    1e-09   
ref|XP_006286247.1|  hypothetical protein CARUB_v10007817mg           64.7    2e-09   
emb|CDY36445.1|  BnaC03g67650D                                        64.7    2e-09   
ref|XP_008362415.1|  PREDICTED: fasciclin-like arabinogalactan pr...  63.5    2e-09   
gb|KHM99327.1|  Fasciclin-like arabinogalactan protein 3              63.5    5e-09   
ref|XP_010669451.1|  PREDICTED: fasciclin-like arabinogalactan pr...  63.5    5e-09   
ref|XP_003603528.1|  Fasciclin-like arabinogalactan protein           62.8    6e-09   
ref|XP_008342795.1|  PREDICTED: fasciclin-like arabinogalactan pr...  62.0    8e-09   
emb|CDY52668.1|  BnaC01g38580D                                        62.4    9e-09   
ref|NP_194865.1|  FASCICLIN-like arabinogalactan protein 5            62.4    1e-08   
ref|XP_002436882.1|  hypothetical protein SORBIDRAFT_10g010500        63.5    1e-08   
ref|XP_009108932.1|  PREDICTED: fasciclin-like arabinogalactan pr...  62.4    1e-08   
ref|XP_008342793.1|  PREDICTED: uncharacterized protein LOC103405558  63.2    1e-08   
ref|XP_004501250.1|  PREDICTED: fasciclin-like arabinogalactan pr...  61.2    1e-08   
emb|CAH66152.1|  OSIGBa0097I11.4                                      61.6    2e-08   
ref|XP_008649024.1|  PREDICTED: fasciclin-like arabinogalactan pr...  61.2    2e-08   
ref|XP_006838924.1|  hypothetical protein AMTR_s00002p00270100        62.4    2e-08   
gb|EAY93407.1|  hypothetical protein OsI_15204                        60.8    4e-08   
emb|CAD40213.2|  OSJNBa0019J05.11                                     60.8    4e-08   
emb|CDY50538.1|  BnaA01g30420D                                        60.1    5e-08   
ref|NP_001150349.1|  fasciclin-like arabinogalactan protein 8 pre...  60.1    8e-08   
ref|XP_002867304.1|  hypothetical protein ARALYDRAFT_491605           59.3    1e-07   
ref|XP_002438784.1|  hypothetical protein SORBIDRAFT_10g026140        59.3    1e-07   
ref|XP_010040489.1|  PREDICTED: fasciclin-like arabinogalactan pr...  58.2    2e-07   
ref|XP_006601616.1|  PREDICTED: fasciclin-like arabinogalactan pr...  59.3    2e-07   
ref|XP_009363600.1|  PREDICTED: fasciclin-like arabinogalactan pr...  58.9    2e-07   
ref|XP_006657210.1|  PREDICTED: fasciclin-like arabinogalactan pr...  58.2    3e-07   
ref|XP_009354315.1|  PREDICTED: fasciclin-like arabinogalactan pr...  58.2    4e-07   
emb|CDP12467.1|  unnamed protein product                              57.4    6e-07   
gb|EMS60835.1|  hypothetical protein TRIUR3_26630                     57.4    8e-07   
ref|XP_003560388.1|  PREDICTED: fasciclin-like arabinogalactan pr...  56.2    2e-06   
ref|XP_008342794.1|  PREDICTED: fasciclin-like arabinogalactan pr...  56.6    2e-06   
ref|XP_008803592.1|  PREDICTED: fasciclin-like arabinogalactan pr...  55.5    3e-06   
ref|NP_001058255.1|  Os06g0656800                                     55.5    3e-06   
gb|EAZ01938.1|  hypothetical protein OsI_23966                        55.1    4e-06   
ref|XP_003560811.1|  PREDICTED: fasciclin-like arabinogalactan pr...  55.1    4e-06   
ref|XP_007137111.1|  hypothetical protein PHAVU_009G1004000g          53.5    5e-06   
ref|XP_002982557.1|  hypothetical protein SELMODRAFT_58104            53.5    5e-06   
ref|XP_003571006.2|  PREDICTED: fasciclin-like arabinogalactan pr...  55.1    5e-06   
emb|CDX72305.1|  BnaC07g43270D                                        54.7    6e-06   
ref|XP_010253181.1|  PREDICTED: fasciclin-like arabinogalactan pr...  54.3    9e-06   
ref|XP_009138006.1|  PREDICTED: fasciclin-like arabinogalactan pr...  53.9    9e-06   
ref|XP_009416691.1|  PREDICTED: fasciclin-like arabinogalactan pr...  54.3    1e-05   
gb|EEE60667.1|  hypothetical protein OsJ_14125                        53.1    1e-05   
emb|CDY13425.1|  BnaA03g51430D                                        53.5    1e-05   
gb|KJB67058.1|  hypothetical protein B456_010G172200                  53.1    1e-05   
ref|XP_002992353.1|  hypothetical protein SELMODRAFT_45227            53.5    2e-05   
ref|XP_010043558.1|  PREDICTED: fasciclin-like arabinogalactan pr...  53.5    2e-05   
gb|KHN31865.1|  Fasciclin-like arabinogalactan protein 3              53.1    2e-05   
ref|XP_002979355.1|  hypothetical protein SELMODRAFT_55277            53.5    2e-05   
ref|XP_010034413.1|  PREDICTED: fasciclin-like arabinogalactan pr...  52.8    2e-05   
gb|ABI95421.1|  fasciclin-like protein FLA31                          53.1    2e-05   
ref|XP_007150828.1|  hypothetical protein PHAVU_005G184100g           53.1    2e-05   
ref|XP_006595480.1|  PREDICTED: fasciclin-like arabinogalactan pr...  52.4    4e-05   
emb|CDY06556.1|  BnaC02g12800D                                        52.0    4e-05   
gb|EMT30625.1|  hypothetical protein F775_08816                       50.1    4e-05   



>gb|AIY35292.1| fasciclin-like arabinogalactan 12 [Gossypium hirsutum]
Length=415

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAILEG P+YS +ND+L++TKLADEINTR T+T LVL NGA S++T KHPLSVVKN+
Sbjct  26   HNITAILEGFPDYSVYNDFLTKTKLADEINTRQTITCLVLNNGAMSALTAKHPLSVVKNI  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH IS GTTL+TTLYQTTGNAPGNLGFVNITD +GGKVGFGSA+PG
Sbjct  86   LSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAVPG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>gb|KJB49352.1| hypothetical protein B456_008G114900 [Gossypium raimondii]
Length=415

 Score =   169 bits (428),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNI+AILEG P+YS +ND+L++TKLADEINTR T+T LVL NGA S++T KHPLSVVKN+
Sbjct  26   HNISAILEGFPDYSVYNDFLTKTKLADEINTRQTITCLVLNNGAMSALTAKHPLSVVKNI  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH IS GTTL+TTLYQTTGNAPGNLGFVNITD +GGKVGFGSA+PG
Sbjct  86   LSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAVPG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_007052018.1| FASCICLIN-like arabinogalactan protein 8 [Theobroma cacao]
 gb|EOX96175.1| FASCICLIN-like arabinogalactan protein 8 [Theobroma cacao]
Length=425

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAILEG P+YS +N +LS+TKLADEIN+R T+T LVL+NGA S++T KHPLSV+KN+
Sbjct  24   HNITAILEGFPDYSVYNSFLSQTKLADEINSRETITCLVLSNGAMSALTAKHPLSVIKNI  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH ISKGTTL+TTLYQTTGNAPGNLGFVNITD +GGKV FGSA+PG
Sbjct  84   LSLHVLLDYYDPQKLHQISKGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKVAFGSAIPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  144  SKLDSSYTKSV  154



>gb|ABV27483.1| fasciclin-like arabinogalactan protein 12 [Gossypium hirsutum]
Length=415

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            H+ITAILEG P+YS +ND+L++TKLADEINTR T+T LVL NGA S++T KHPLSVVKN+
Sbjct  26   HSITAILEGFPDYSVYNDFLTKTKLADEINTRQTITCLVLNNGAMSALTAKHPLSVVKNI  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH IS GTTL+TTLYQTTGNAPGNLGFVNITD +GGKVGFGSA+PG
Sbjct  86   LSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAVPG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>gb|ABV27484.1| fasciclin-like arabinogalactan protein 13 [Gossypium hirsutum]
Length=425

 Score =   167 bits (423),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAILEG P+YS +N +L++TKLADEINTR T+T LVL NGA S++T KHPLSVVKN+
Sbjct  24   HNITAILEGFPDYSVYNSFLTQTKLADEINTRETITCLVLNNGAMSALTSKHPLSVVKNI  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH IS GTTL+TTLYQTTGNAPGNLGFVNITD +GGKVGFGSA+PG
Sbjct  84   LSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAIPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  144  SKLDSSYTKSV  154



>ref|XP_011090995.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Sesamum 
indicum]
Length=426

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
             NIT IL G PEYS+FND LS+TKLADEIN+R  VTV VL NGA SS TGK+PLSV+KN+
Sbjct  24   SNITEILSGFPEYSEFNDLLSQTKLADEINSREPVTVCVLPNGALSSFTGKYPLSVIKNI  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH IS+G+ LSTTLYQTTGNA GNLGFVNITD +GGKVGFGS +PG
Sbjct  84   LALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNAAGNLGFVNITDLRGGKVGFGSGVPG  143

Query  496  SPLASQYTKSV  528
            SPL S +TKSV
Sbjct  144  SPLDSTFTKSV  154



>gb|KJB41114.1| hypothetical protein B456_007G092300 [Gossypium raimondii]
Length=425

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAILEG P+YS +N +L++TKLADEINTR T+T LVL NGA S++T KHPLSVVKN+
Sbjct  24   HNITAILEGFPDYSVYNSFLTQTKLADEINTRETITCLVLNNGAMSALTSKHPLSVVKNI  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH IS GTTL+TTLYQTTGNAPGNLGFVNITD +GGKVGFGSA+PG
Sbjct  84   LSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAIPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  144  SKLDSSYTKSV  154



>dbj|BAP11162.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
 dbj|BAP11163.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL+  PEYSQFN YLS+TKLADEIN+R T+TVL L NGA S +  KHPLSV+KN 
Sbjct  13   HNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDL-AKHPLSVIKNA  71

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD +GGKVGFGSA PG
Sbjct  72   LSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAAPG  131

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  132  SKLDSSYTKSV  142



>ref|XP_006402530.1| hypothetical protein EUTSA_v10005998mg [Eutrema salsugineum]
 gb|ESQ43983.1| hypothetical protein EUTSA_v10005998mg [Eutrema salsugineum]
Length=421

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN YLS+TKLADEIN+RTT+T+LVL NGA SS+ GKHPLSV+KN 
Sbjct  26   HNITQILADSPEYSSFNSYLSQTKLADEINSRTTITLLVLNNGAMSSLAGKHPLSVIKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTL+TTLYQTTGNAPGNLGFVN+TD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPQKLHKISKGTTLTTTLYQTTGNAPGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_008232692.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
 ref|XP_008232693.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
Length=425

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAIL   PEYSQ+N +L++T+LADEINTR T+T+LVL N A S++  KHPLSVVKN 
Sbjct  24   HNITAILSAFPEYSQYNSFLTQTRLADEINTRQTITILVLNNAAISALAAKHPLSVVKNA  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH ISKG+TLSTTLYQTTG+APGNLGFVNITD +GGKVGFGSA PG
Sbjct  84   LSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  144  SKLDSSYTKSV  154



>ref|XP_006397729.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
 gb|ESQ39182.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
Length=418

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN YLS+TKLADEIN+RTT+T+LVL NGA SS+ GKHPLSV+KN 
Sbjct  26   HNITQILADSPEYSSFNSYLSQTKLADEINSRTTITLLVLNNGAMSSLAGKHPLSVIKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD KGGKVGFGSA  G
Sbjct  86   LSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>dbj|BAP11161.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   158 bits (399),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL+  PEYSQFN YLS+TKLADEIN+R T+TVL L NGA S +  KHPLSV+K+ 
Sbjct  13   HNITDILKDFPEYSQFNSYLSQTKLADEINSRQTLTVLALPNGAMSDL-AKHPLSVIKSA  71

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD +GGKVGFGSA PG
Sbjct  72   LSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAAPG  131

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  132  SKLDSSYTKSV  142



>dbj|BAP11158.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
 dbj|BAP11160.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL+  PEYSQFN YLS+TKLADEIN+R T+TVL L NGA S +  KHPLSV+K+ 
Sbjct  13   HNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDL-AKHPLSVIKSA  71

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD +GGKVGFGSA PG
Sbjct  72   LSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAAPG  131

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  132  SKLDSSYTKSV  142



>gb|EYU32014.1| hypothetical protein MIMGU_mgv1a007039mg [Erythranthe guttata]
Length=422

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            NIT IL+G+PEYS+FN  LS+TKLADEIN+R  VTV VL NGA SS TGK+PLSVV+N+L
Sbjct  25   NITEILDGYPEYSEFNTLLSQTKLADEINSREPVTVCVLPNGALSSFTGKYPLSVVENIL  84

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
             LHVLLDY+D  KLH IS+G+ LSTTLYQTTGNA GNLGFVNITD KGGKVGFGS + GS
Sbjct  85   ALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNADGNLGFVNITDLKGGKVGFGSGVAGS  144

Query  499  PLASQYTKSV  528
            PL S YTKSV
Sbjct  145  PLDSTYTKSV  154



>dbj|BAP11159.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL+  PEYSQFN YLS+TKLADEIN+R T+TVL L NGA S +  KHPLSV+K+ 
Sbjct  13   HNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDL-AKHPLSVIKSA  71

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L +LLDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD +GGKVGFGSA PG
Sbjct  72   LSLLILLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAAPG  131

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  132  SKLDSSYTKSV  142



>ref|XP_002511740.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50409.1| conserved hypothetical protein [Ricinus communis]
Length=425

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL G P+YS+FN YL++TKLADEIN+R T+TVL L+NGA S++  KHPLSV+KN 
Sbjct  24   HNITDILSGFPDYSEFNKYLTQTKLADEINSRETITVLALSNGAMSALASKHPLSVIKNA  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD +GGKVGFGSA PG
Sbjct  84   LSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  144  SKLDSSYTKSV  154



>ref|XP_009605451.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana 
tomentosiformis]
Length=422

 Score =   164 bits (414),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = +1

Query  64   MGSVRHLLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtrttvt  243
            MG++ H+ LFT   I +S      HNIT IL   PEYS+FN YL++TKLADEIN+R T+T
Sbjct  1    MGAL-HIFLFTLMSITISIHA---HNITEILSKFPEYSEFNSYLTQTKLADEINSRQTIT  56

Query  244  vlvltNGAFSSITGKHPLSVVKNVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAP  423
            VL LTNGA S + GKHPLSV+KNVL LH+LLDY+D  KLH IS GTTLSTTLYQTTGNA 
Sbjct  57   VLALTNGAMSDVVGKHPLSVIKNVLSLHILLDYFDSTKLHKISDGTTLSTTLYQTTGNAN  116

Query  424  GNLGFVNITDQKGGKVGFGSALPGSPLASQYTKSV  528
            GNLG VNITD KGGKVGFGSA+  SPLAS YTKSV
Sbjct  117  GNLGSVNITDLKGGKVGFGSAVSHSPLASTYTKSV  151



>ref|XP_002320736.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
 gb|EEE99051.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
Length=421

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL G PEYS+FN YL++TKLADEINTR T+TVL L NGA +++  KHPLSV+KN 
Sbjct  24   HNITDILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNNGAMTALAAKHPLSVIKNA  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L V+LDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD +GGKVGFGSA PG
Sbjct  84   LSLLVVLDYYDPTKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  144  SKLDSSYTKSV  154



>ref|XP_004229828.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Solanum 
lycopersicum]
Length=414

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN YLS+TKLADEIN+R T+TVL L NGA S+I  KHPLSV+KNV
Sbjct  19   HNITEILNKFPEYSVFNSYLSQTKLADEINSRETITVLALPNGAMSAIVDKHPLSVIKNV  78

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+DG KLH IS GTT STTLYQTTGNA GN+G VNITD KGGKVGFGSA+P 
Sbjct  79   LSLHVLLDYFDGTKLHKISDGTTTSTTLYQTTGNAHGNIGSVNITDLKGGKVGFGSAIPN  138

Query  496  SPLASQYTKSV  528
            SPLAS YTKSV
Sbjct  139  SPLASTYTKSV  149



>ref|XP_004306902.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Fragaria 
vesca subsp. vesca]
Length=421

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAILE  PEYSQ+N +L++T+LADEINTRTTVTVLVLTNG  SS+  KHPLSV+KN 
Sbjct  23   HNITAILEATPEYSQYNSFLTQTRLADEINTRTTVTVLVLTNGVMSSLAAKHPLSVIKNA  82

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LH+LLDY+D  KLH IS G+ L+TTLYQTTG+APGNLGFVNITD  GGKVGFGSA PG
Sbjct  83   LSLHILLDYYDPAKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLSGGKVGFGSAAPG  142

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  143  SKLDSSYTKSV  153



>ref|XP_011034618.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Populus 
euphratica]
Length=421

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL G PEYS+FN YL++TKLADEINTR T+TVL L NGA +++  KHPLSV+KN 
Sbjct  24   HNITDILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNNGAMTALAAKHPLSVIKNA  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L V+LDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD +GGKVGFGSA PG
Sbjct  84   LSLLVVLDYYDPTKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  144  SKLDSSYTKSV  154



>gb|KFK37339.1| hypothetical protein AALP_AA4G243700 [Arabis alpina]
Length=415

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS FN YL++TKLADEIN+RTT+T+LVL NGA SS+ GKHPLSV+KN 
Sbjct  26   HNITQILADSPDYSSFNSYLTQTKLADEINSRTTITLLVLNNGAMSSLAGKHPLSVIKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH +SKGTTLSTTLYQTTGNAPGNLGFVNITD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L S YT+SV
Sbjct  146  SKLESSYTRSV  156



>ref|XP_006339448.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Solanum 
tuberosum]
Length=415

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN YLS+TKLADEIN+R T+TVL L NGA S++  KHPLSV+KNV
Sbjct  19   HNITEILNQFPEYSVFNSYLSQTKLADEINSRETITVLALPNGAMSAVVDKHPLSVIKNV  78

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+DG KLH IS GTT STTLYQTTGNA GN+G VNITD KGGKVGFGSA+P 
Sbjct  79   LSLHVLLDYFDGTKLHKISDGTTTSTTLYQTTGNAHGNVGSVNITDLKGGKVGFGSAIPN  138

Query  496  SPLASQYTKSV  528
            SPLAS YTKSV
Sbjct  139  SPLASTYTKSV  149



>emb|CDY18927.1| BnaC04g04230D [Brassica napus]
Length=416

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL  +PEYS FN YLS+TKLADEIN+R+T+T+LVL NGA +S+ GKHPLSV+KN 
Sbjct  26   HNITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLNNGAMASLAGKHPLSVIKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH IS GT L+TTLYQTTGNAPGNLGFVNITD KGGKVGFGSA  G
Sbjct  86   LSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_010056276.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Eucalyptus 
grandis]
Length=425

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAILEG PEYS F+ YLS+TKLADEIN+R T+TVL L NGA S++ GK PLSV+KN 
Sbjct  25   HNITAILEGFPEYSLFSSYLSQTKLADEINSRQTITVLALDNGAMSALAGKKPLSVIKNE  84

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L +HV+LDY+D  KLH I KG+TLSTTLYQTTGNAPGN GFVNITD +GGKVGFG+A PG
Sbjct  85   LAVHVVLDYFDPQKLHQIPKGSTLSTTLYQTTGNAPGNTGFVNITDLQGGKVGFGAAAPG  144

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  145  SKLDSSYTKSV  155



>ref|XP_007218052.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
 gb|EMJ19251.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
Length=425

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YSQ+N +L++TKLADEINTR T+T+LVL N A S++  KHPLSVVKN 
Sbjct  24   HNITEILSAFPDYSQYNSFLTQTKLADEINTRQTITILVLNNAAISALAAKHPLSVVKNA  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH ISKG+TLSTTLYQTTG+APGNLGFVNITD +GGKVGFGSA PG
Sbjct  84   LSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  144  SKLDSSYTKSV  154



>emb|CDX74743.1| BnaA05g04890D [Brassica napus]
Length=416

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL  +PEYS FN YLS+TKLADEIN+R+T+T+LVL NGA +S+ GKHPLSV+KN 
Sbjct  26   HNITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLNNGAMASLAGKHPLSVIKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH IS GT L+TTLYQTTGNAPGNLGFVNITD KGGKVGFGSA  G
Sbjct  86   LSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_009143146.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Brassica 
rapa]
Length=416

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL  +PEYS FN YLS+TKLADEIN+R+T+T+LVL NGA +S+ GKHPLSV+KN 
Sbjct  26   HNITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLNNGAMASLAGKHPLSVIKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH IS GT L+TTLYQTTGNAPGNLGFVNITD KGGKVGFGSA  G
Sbjct  86   LSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_002878353.1| AT3g60900/T4C21_310 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54612.1| AT3g60900/T4C21_310 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN+YLS+TKLADEIN+RTT+TVLVL NGA SS+ GKHPLSVVKN 
Sbjct  26   HNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNGAMSSLAGKHPLSVVKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ++KG+TL+TTLYQTTG+APGNLGFVN+TD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPLKLHQLAKGSTLTTTLYQTTGHAPGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|NP_566043.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
 sp|O22126.1|FLA8_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 8; Short=AtAGP8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB82617.1| expressed protein [Arabidopsis thaliana]
 gb|AAM19815.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AAN31110.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AEC10559.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
Length=420

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS FN YLS+TKLADEIN+RTT+TVLVL NGA S++ GKHPLSV+K+ 
Sbjct  26   HNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLNNGAMSALAGKHPLSVIKSA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD KGGKVGFGSA  G
Sbjct  86   LSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>gb|AAM66074.1| endosperm-specific protein-like protein [Arabidopsis thaliana]
Length=420

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS FN YLS+TKLADEIN+RTT+TVLVL NGA S++ GKHPLSV+K+ 
Sbjct  26   HNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLNNGAMSALAGKHPLSVIKSA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD KGGKVGFGSA  G
Sbjct  86   LSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_006445226.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|ESR58466.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|KDO85869.1| hypothetical protein CISIN_1g035767mg [Citrus sinensis]
Length=418

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL+  PEYSQFN YL++TKLADEIN+R T+TVLVL NGA S +T KHPLSV+K+ 
Sbjct  21   HNITDILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNGAMSDLTAKHPLSVIKSA  80

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD +GGKVGFGSA  G
Sbjct  81   LSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAASG  140

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  141  SKLDSTYTKSV  151



>emb|CDX71771.1| BnaC08g31030D [Brassica napus]
Length=422

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN YLS+TKLADEIN+RTT+T+LVL NGA SS+ GKHPLSVVKN 
Sbjct  27   HNITQILSESPEYSSFNSYLSQTKLADEINSRTTITLLVLNNGAMSSLAGKHPLSVVKNA  86

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH IS+GTTL+TTLYQTTGNAPGNLGFVN+TD KGGKVGFGSA PG
Sbjct  87   LSLLVLLDYYDPVKLHKISQGTTLTTTLYQTTGNAPGNLGFVNVTDLKGGKVGFGSAAPG  146

Query  496  SPLASQYTKSV  528
            S LAS YTKSV
Sbjct  147  SKLASSYTKSV  157



>dbj|BAJ34929.1| fasciclin-like arabinogalactan protein [Vitis hybrid cultivar]
Length=416

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 120/155 (77%), Gaps = 4/155 (3%)
 Frame = +1

Query  64   MGSVRHLLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtrttvt  243
            MG++ HLL+F    ++       AHNIT +L   PEYS +N YLS+TKLADEIN+R T+T
Sbjct  1    MGAL-HLLVF---ALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLT  56

Query  244  vlvltNGAFSSITGKHPLSVVKNVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAP  423
             LVL N A S++ GKHPLSV+K  L L V+LDY+DG KLH+IS GTTLSTTLYQTTGNAP
Sbjct  57   CLVLNNAAMSALAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAP  116

Query  424  GNLGFVNITDQKGGKVGFGSALPGSPLASQYTKSV  528
            GNLGFVNITD KGGKVGFGSA PGS L S YTKSV
Sbjct  117  GNLGFVNITDLKGGKVGFGSAAPGSKLDSSYTKSV  151



>ref|XP_006491459.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like, partial 
[Citrus sinensis]
Length=459

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL+  PEYSQFN YL++TKLADEIN+R T+TVLVL NGA S +T KHPLSV+K+ 
Sbjct  62   HNITDILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNGAMSDLTAKHPLSVIKSA  121

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD +GGKVGFGSA  G
Sbjct  122  LSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAASG  181

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  182  SKLDSTYTKSV  192



>gb|KDP28734.1| hypothetical protein JCGZ_14505 [Jatropha curcas]
Length=423

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL G P+YS+FN YL++TKLADEIN+R T+TVL L NGA SSI  KHPL V+KN+
Sbjct  22   HNITDILSGFPDYSEFNKYLTQTKLADEINSRETITVLALNNGAISSI-AKHPLPVIKNI  80

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTLSTTLYQTTG+APGNLGFVNITD +GGKVGFGSA PG
Sbjct  81   LSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGSAPGNLGFVNITDLQGGKVGFGSAAPG  140

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  141  SKLESSYTKSV  151



>ref|XP_010518164.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = +1

Query  52   LTCTMGSVRHLLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtr  231
            +  +      LL F    I    +  ++HNIT IL   P+YS FN YL++TKLADEIN+R
Sbjct  1    MAASQSQTLSLLAFVTFSILAFASTVSSHNITQILADSPDYSSFNSYLTQTKLADEINSR  60

Query  232  ttvtvlvltNGAFSSITGKHPLSVVKNVLELHVLLDYWDGDKLHDISKGttlsttlyqtt  411
            TT+TVLVL NGA SS+ GKHPLSV+K+ L L VLLDY+D  KLH +SKGTTLSTTLYQTT
Sbjct  61   TTITVLVLNNGAMSSLAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTT  120

Query  412  GNAPGNLGFVNITDQKGGKVGFGSALPGSPLASQYTKSV  528
            GNAPGNLGFVNITD KGGKVGFGSA+ GS L S YTKSV
Sbjct  121  GNAPGNLGFVNITDLKGGKVGFGSAVSGSKLDSSYTKSV  159



>ref|XP_002882015.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58274.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS FN YLS+TKLADEIN+RTT+TVLVL NGA S++ GKHPLSV+K+ 
Sbjct  26   HNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLNNGAMSALAGKHPLSVIKSA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTLSTTLYQTTGNAPGNLGFVNITD KGGKVGFGSA  G
Sbjct  86   LSLLVLLDYYDPLKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_010277448.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Nelumbo 
nucifera]
Length=427

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL G PEYS  NDYL+RTKLADEINTR T+T LVL N A S++    PLSVVKNV
Sbjct  26   HNITEILSGFPEYSAMNDYLTRTKLADEINTRETITCLVLPNSAMSALAANKPLSVVKNV  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+DG KLH ISKGTTL+TTLYQ TG+A GNLGFVNITD KGGKVGFGSA PG
Sbjct  86   LRLLVLLDYYDGAKLHQISKGTTLTTTLYQVTGDAHGNLGFVNITDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSTYTKSV  156



>emb|CAN65447.1| hypothetical protein VITISV_011425 [Vitis vinifera]
Length=416

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT +L   PEYS +N YLS+TKLADEIN+R T+T LVL N A S++ GKHPLSV+K  
Sbjct  21   HNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNAAMSALAGKHPLSVIKKA  80

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L V+LDY+DG KLH+IS GTTLSTTLYQTTGNAPGNLGFVNITD KGGKVGFGSA PG
Sbjct  81   LMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAAPG  140

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  141  SKLDSSYTKSV  151



>ref|XP_002270426.2| PREDICTED: fasciclin-like arabinogalactan protein 10 [Vitis vinifera]
Length=416

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT +L   PEYS +N YLS+TKLADEIN+R T+T LVL N A S++ GKHPLSV+K  
Sbjct  21   HNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNAAMSALAGKHPLSVIKKA  80

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L V+LDY+DG KLH+IS GTTLSTTLYQTTGNAPGNLGFVNITD KGGKVGFGSA PG
Sbjct  81   LMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAAPG  140

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  141  SKLDSSYTKSV  151



>ref|XP_009785088.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana 
sylvestris]
Length=422

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS+FN YL++TKLADEIN+RTT+T+L LTNGA + + GKHPLSV+KNV
Sbjct  21   HNITEILSKFPEYSEFNSYLTQTKLADEINSRTTITILALTNGAMADVVGKHPLSVIKNV  80

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LH+LLDY+D  KLH IS GTTL+TTLYQTTGNA GNLG VNITD KGGKVGFGSA+  
Sbjct  81   LSLHILLDYFDNTKLHKISDGTTLTTTLYQTTGNANGNLGSVNITDLKGGKVGFGSAVSH  140

Query  496  SPLASQYTKSV  528
            SPLAS YTKSV
Sbjct  141  SPLASTYTKSV  151



>emb|CDP17792.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS++N +L+ TKLADEIN+R T+TVLVLTN A  S+  KHPLSVVK  
Sbjct  63   HNITEILSAFPEYSEYNKFLTDTKLADEINSRETITVLVLTNSAMDSLAAKHPLSVVKKA  122

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHV+LDY+D  KLHDIS GTTLSTTLYQTTGNAPGN GFVNITD KGGKVGFGSA+PG
Sbjct  123  LSLHVVLDYYDAGKLHDISNGTTLSTTLYQTTGNAPGNQGFVNITDLKGGKVGFGSAVPG  182

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  183  SKLDSTYTKSV  193



>ref|XP_010508167.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS FN+YL++TKLADEIN+RTT+TVLVL NGA SS+ GKHPLSV+K+ 
Sbjct  29   HNITQILADSPDYSSFNNYLTQTKLADEINSRTTITVLVLNNGAMSSLAGKHPLSVIKSA  88

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH +SKGTTLSTTLYQTTGNAPGNLGFVNITD KGGKVGFGSA  G
Sbjct  89   LSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  148

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  149  SKLDSSYTKSV  159



>ref|XP_006296250.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
 gb|EOA29148.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
Length=420

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS FN YL++TKLADEIN+RTT+TVLVL NGA SS+ GKHPLSV+K  
Sbjct  26   HNITQILADSPDYSSFNSYLTQTKLADEINSRTTITVLVLNNGAMSSLAGKHPLSVIKGA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH +SKGTTLSTTLYQTTGNAPGNLGFVNITD KGGKVGFGSA  G
Sbjct  86   LSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_010506492.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X1 
[Camelina sativa]
 ref|XP_010506494.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X2 
[Camelina sativa]
 ref|XP_010506495.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X3 
[Camelina sativa]
Length=423

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  82   LLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltN  261
            LL F    I    +  ++HNIT IL   P+YS FN YL++TKLADEIN+RTT+TVLVL N
Sbjct  11   LLAFFTFSILACASTVSSHNITQILTDSPDYSSFNSYLTQTKLADEINSRTTITVLVLNN  70

Query  262  GAFSSITGKHPLSVVKNVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFV  441
            GA SS+ GKHPLSV+K+ L L VLLDY+D  KLH +SKGTTLSTTLYQTTGNAPGNLGFV
Sbjct  71   GAMSSLAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFV  130

Query  442  NITDQKGGKVGFGSALPGSPLASQYTKSV  528
            NITD KGGKVGFGSA  GS L S YTKSV
Sbjct  131  NITDLKGGKVGFGSAASGSKLDSSYTKSV  159



>emb|CDY52341.1| BnaA09g38900D [Brassica napus]
Length=424

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN YLS+TKLADEIN+RTT+T+LVL NGA SS+ GKHPLSVVKN 
Sbjct  28   HNITQILSESPEYSSFNSYLSQTKLADEINSRTTITLLVLNNGAMSSLAGKHPLSVVKNA  87

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH IS+GTTL+TTLYQTTGNAPGNLGFVNITD KGGKVGFGSA PG
Sbjct  88   LSLLVLLDYYDPVKLHKISQGTTLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAAPG  147

Query  496  SPLASQYTKSV  528
            S LAS YTK V
Sbjct  148  SKLASTYTKLV  158



>ref|XP_004144998.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004153890.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004160662.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 gb|KGN46232.1| hypothetical protein Csa_6G076800 [Cucumis sativus]
Length=423

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 125/155 (81%), Gaps = 2/155 (1%)
 Frame = +1

Query  64   MGSVRHLLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtrttvt  243
            M + + LLLF    IA + A+ +AHNIT +L+  P+YS F++YL +T+LADEIN+R T+T
Sbjct  1    MAASKSLLLF--LAIAATAAIVSAHNITDMLKDFPQYSVFSNYLQQTRLADEINSRQTIT  58

Query  244  vlvltNGAFSSITGKHPLSVVKNVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAP  423
            VLV+ NGA S I  KHPLSV+KN+L LH++LDY+D  KLH IS GTTLSTTLYQTTG+AP
Sbjct  59   VLVVANGALSPILDKHPLSVIKNLLSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAP  118

Query  424  GNLGFVNITDQKGGKVGFGSALPGSPLASQYTKSV  528
            GNLGFVNITD +GGKVGFGSA+PGS L S YTKSV
Sbjct  119  GNLGFVNITDLQGGKVGFGSAVPGSKLESSYTKSV  153



>ref|XP_010525235.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Tarenaya 
hassleriana]
Length=525

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL G  +YSQFN YL++TKLADEIN+RTT+TVLVL NGA S++ GKHPLSV+KN 
Sbjct  26   HNITDILAGSSDYSQFNSYLTQTKLADEINSRTTITVLVLNNGAMSALAGKHPLSVIKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH ISKGTTL+TTLYQTTGNAPGNLGFVN+TD KGGKVGFGSA  G
Sbjct  86   LSLLVLLDYYDPQKLHQISKGTTLTTTLYQTTGNAPGNLGFVNVTDLKGGKVGFGSAASG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_009116767.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Brassica 
rapa]
Length=423

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN YLS+TKLADEIN+RTT+T+LVL NGA SS+ GKHPLSVVKN 
Sbjct  27   HNITQILSESPEYSSFNSYLSQTKLADEINSRTTITLLVLNNGAMSSLAGKHPLSVVKNA  86

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH IS+GTTL+TTLYQTTGNAPGNLGFVNITD KGGKVGFGSA PG
Sbjct  87   LSLLVLLDYYDPVKLHKISQGTTLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAAPG  146

Query  496  SPLASQYTKSV  528
            S LAS YTK V
Sbjct  147  SKLASTYTKLV  157



>ref|NP_191649.1| fasciclin-like arabinogalactan protein 10 [Arabidopsis thaliana]
 sp|Q9LZX4.1|FLA10_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 10; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB82694.1| endosperm specific protein-like [Arabidopsis thaliana]
 gb|AAM65173.1| endosperm specific protein-like [Arabidopsis thaliana]
 gb|AEE80125.1| fasciclin-like arabinogalactan protein 10 [Arabidopsis thaliana]
Length=422

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN+YLS+TKLADEIN+RTT+TVLVL NGA SS+ GKHPLSVVKN 
Sbjct  26   HNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNGAMSSLAGKHPLSVVKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH +SKGTTL+TTLYQTTG+A GNLGFVN+TD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHALGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>gb|AAK55685.1|AF378882_1 AT3g60900/T4C21_310 [Arabidopsis thaliana]
Length=410

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN+YLS+TKLADEIN+RTT+TVLVL NGA SS+ GKHPLSVVKN 
Sbjct  26   HNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNGAMSSLAGKHPLSVVKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH +SKGTTL+TTLYQTTG+A GNLGFVN+TD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHALGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_008460132.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Cucumis 
melo]
Length=423

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT +L+ +P+YS F++YL +T+LADEIN+R T+TVLV++NGA S I  KHPLSV+KN+
Sbjct  23   HNITDMLKDYPQYSVFSNYLQQTRLADEINSRQTITVLVVSNGALSPILDKHPLSVIKNI  82

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LH++LDY+D  KLH IS GTTLSTTLYQTTG+APGNLGFVNITD +GGKV FGSA+PG
Sbjct  83   LSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAPGNLGFVNITDLQGGKVAFGSAVPG  142

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  143  SKLESSYTKSV  153



>ref|XP_010512424.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Camelina 
sativa]
Length=422

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS FN YLS+TKL DEIN+RTT+TVLVL N A SS+ GKHPLSVVKN 
Sbjct  26   HNITQILSDTPDYSSFNSYLSQTKLDDEINSRTTITVLVLNNAAMSSLAGKHPLSVVKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH +SKGTTL+TTLYQTTG+APGNLGFVN+TD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHAPGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_008343059.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Malus domestica]
Length=425

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS +N YL++T+LADEINT  T+TVLV  N A S++  KHPLSV+KN 
Sbjct  24   HNITDILSAFPDYSLYNSYLTQTRLADEINTHQTITVLVFNNAAISALAAKHPLSVIKNA  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH IS G+ L+TTLYQTTG+APGNLGFVNITD +GGKVGFGSA PG
Sbjct  84   LSLHVLLDYYDAPKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  144  SKLDSSYTKSV  154



>ref|XP_006292436.1| hypothetical protein CARUB_v10018654mg [Capsella rubella]
 gb|EOA25334.1| hypothetical protein CARUB_v10018654mg [Capsella rubella]
Length=427

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS FN YLS+TKLADEIN+RTT+TVLVL NGA SS+ GKHPLSVVKN 
Sbjct  26   HNITQILSDTPDYSSFNSYLSQTKLADEINSRTTITVLVLKNGAMSSLAGKHPLSVVKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH +S+GTTL+TTLYQTTGNAPGNLGFVN+TD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPLKLHQLSQGTTLTTTLYQTTGNAPGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_010469133.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Camelina 
sativa]
Length=422

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS FN YLS+TKL DEIN+RTT+TVLVL N A SS+ GKHPLSVVKN 
Sbjct  26   HNITQILSDTPDYSSFNSYLSQTKLDDEINSRTTITVLVLNNAAMSSLAGKHPLSVVKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH +SKGTTL+TTLYQTTG+APGNLGFVN+TD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHAPGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  146  SKLDSSYTKSV  156



>ref|XP_009379279.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Pyrus x 
bretschneideri]
Length=425

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS +N YL++T+LADEINT  T+TVLVL N A S++  KHPL+V+KN 
Sbjct  24   HNITDILSAFPDYSLYNSYLTQTRLADEINTHQTITVLVLNNAAISALAAKHPLAVIKNA  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH IS G+ L+TTLYQTTG+APGNLGFVNITD +GGKVGFGSA PG
Sbjct  84   LSLHVLLDYYDAPKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  144  SKLDSSYTKSV  154



>ref|XP_010092859.1| hypothetical protein L484_022454 [Morus notabilis]
 gb|EXB52677.1| hypothetical protein L484_022454 [Morus notabilis]
Length=424

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +1

Query  64   MGSVRHLLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtrttvt  243
            MG++   L+F    I    AV +AHNITAIL   P+YS +N YL++TKLADEIN+RTTVT
Sbjct  1    MGALNQSLVFLCLSILALNAVVSAHNITAILSEFPDYSDYNKYLTQTKLADEINSRTTVT  60

Query  244  vlvltNGAFSSITGKHPLSVVKNVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAP  423
            VLVL NGAFS++  KHP SV+K VL LH++LDY+D  KLH +  G+TLSTTLYQTTGNAP
Sbjct  61   VLVLNNGAFSALASKHPASVLKKVLSLHIVLDYFDAQKLHKLPDGSTLSTTLYQTTGNAP  120

Query  424  GNLGFVNITDQKGGKVGFGSALPGSPLASQYTKSV  528
            GNLG +NITD KGGKVGFGSA  GS L S YTK+V
Sbjct  121  GNLGSINITDLKGGKVGFGSAAQGSKLDSTYTKTV  155



>ref|XP_004492650.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Cicer 
arietinum]
Length=423

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL  +P+YSQ+N++LS+TKLADEIN+R T+TVLVL N AFSSIT KHPLSVVKNV
Sbjct  24   HNITEILSDNPDYSQYNNFLSQTKLADEINSRQTITVLVLNNAAFSSITSKHPLSVVKNV  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L +LLDY+D  KLH I+ GTT+STTL+QTTGNA  ++G VNITD KGGKV FGSA PG
Sbjct  84   LSLLILLDYFDNTKLHQITNGTTISTTLFQTTGNAQNSVGSVNITDIKGGKVAFGSAAPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKS+
Sbjct  144  SKLDSTYTKSI  154



>ref|XP_007139983.1| hypothetical protein PHAVU_008G075000g [Phaseolus vulgaris]
 gb|ESW11977.1| hypothetical protein PHAVU_008G075000g [Phaseolus vulgaris]
Length=419

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS FN++LS+T+LADEINTR T+TVLVL N AFS++  KHPLSVVKN+
Sbjct  22   HNITDILAADPQYSDFNNFLSQTRLADEINTRQTITVLVLNNAAFSAVADKHPLSVVKNL  81

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LH+LLDY+D +KLH I+ GTTLSTTLYQTTG A GN+G VNITD KGGKVGFGSA  G
Sbjct  82   LSLHILLDYFDNNKLHQITNGTTLSTTLYQTTGTANGNVGSVNITDLKGGKVGFGSAASG  141

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  142  SKLDSTYTKSV  152



>ref|XP_009104281.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Brassica 
rapa]
Length=424

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN YLS+TKL DEIN+RTT+T+LVL N   SS+ GKHPLSVVK  
Sbjct  26   HNITQILSESPEYSSFNSYLSQTKLNDEINSRTTITILVLNNDVMSSLAGKHPLSVVKTA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH IS+GTTL TTLYQTTG A GNLGFVN+TD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPLKLHKISQGTTLPTTLYQTTGRAAGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L + YTKSV
Sbjct  146  SKLGANYTKSV  156



>gb|AFK41095.1| unknown [Lotus japonicus]
Length=423

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL  +P+YS +N +LS+TKLADEIN+R T+TVLV+ N AFS+IT  HPL VVKNV
Sbjct  24   HNITEILAANPDYSSYNSFLSQTKLADEINSRQTITVLVIPNSAFSAITASHPLPVVKNV  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L +LLDY+D  KLH ++ GTTLSTTL+QTTG A GN+G VNITD KGGKV FGSA PG
Sbjct  84   LSLLILLDYFDNTKLHQLTDGTTLSTTLFQTTGTATGNVGSVNITDLKGGKVAFGSAAPG  143

Query  496  SPLASQYTKSV  528
            S LAS YTKSV
Sbjct  144  SKLASTYTKSV  154



>gb|EPS62290.1| fasciclin-like arabinogalactan protein 13, partial [Genlisea 
aurea]
Length=400

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            NIT IL+ +PEYS FN  L++TKLADEI++R  VTVL L N   SSI+GK+PL VVK+VL
Sbjct  3    NITKILDAYPEYSDFNALLTQTKLADEIDSREPVTVLALPNSELSSISGKYPLGVVKSVL  62

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
             LHVLLDY+D  KLH IS G+ LSTTL QTTGNA GN+GFVNITD +GGKVGFGS + GS
Sbjct  63   SLHVLLDYFDAAKLHKISDGSVLSTTLLQTTGNAAGNVGFVNITDLRGGKVGFGSGIAGS  122

Query  499  PLASQYTKSV  528
            PL S +TKSV
Sbjct  123  PLDSTFTKSV  132



>ref|XP_003534603.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=416

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL  +P+YS FND+LS+T LA +INTR T+TVLVL N AFS++  KHPLSVVKN+
Sbjct  20   HNITDILAANPDYSDFNDFLSQTGLAGDINTRQTITVLVLNNAAFSAVAAKHPLSVVKNL  79

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LH+LLDY+D  KLH I+ GTTLSTTLYQTTGNA GN+G VNITD KGGKVGFGSA PG
Sbjct  80   LSLHILLDYFDNTKLHQITNGTTLSTTLYQTTGNANGNVGSVNITDLKGGKVGFGSAAPG  139

Query  496  SPLASQYTKSV  528
            S L S Y KSV
Sbjct  140  SKLDSSYIKSV  150



>ref|XP_006858016.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
 gb|ERN19483.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
Length=421

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 104/131 (79%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT +L   P+YS +N YL++TKL DEINTR T+TV VL N A S++  KHPLSVVKNV
Sbjct  25   HNITEMLSAFPDYSLYNSYLTQTKLCDEINTRQTLTVFVLNNAAMSAL-AKHPLSVVKNV  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L ++LDY+D  KLH I+ G+ LSTTLYQTTG+A GN GFVNITD KGGKVGFGSA PG
Sbjct  84   LSLLIVLDYFDNQKLHSITDGSMLSTTLYQTTGDAKGNFGFVNITDLKGGKVGFGSAAPG  143

Query  496  SPLASQYTKSV  528
            SPL S YTKSV
Sbjct  144  SPLDSTYTKSV  154



>ref|XP_003552347.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=416

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL  +P+YS FN +LS+T LA EINTR T+TVLVL N A S++  KHPLSVVKN+
Sbjct  20   HNITDILAANPDYSDFNGFLSQTGLAGEINTRQTITVLVLNNAALSAVAAKHPLSVVKNL  79

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LH+LLDY+D  KLH I  GTTLSTTLYQTTGNA GN+G VNITD KGGKVGFGSA PG
Sbjct  80   LSLHILLDYFDNTKLHQIPNGTTLSTTLYQTTGNANGNVGSVNITDLKGGKVGFGSAAPG  139

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  140  SKLDSSYTKSV  150



>emb|CDY66159.1| BnaCnng49680D [Brassica napus]
Length=417

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN YLS+TKL DEIN+RTT+TVLVL N A SS+ GKHPLSVVK  
Sbjct  26   HNITQILSQSPEYSSFNSYLSQTKLNDEINSRTTITVLVLNNDAMSSLAGKHPLSVVKTA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH IS+GTTL+TTLYQTTG A GNLGFVN+TD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPLKLHKISQGTTLTTTLYQTTGRAAGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L + YTKSV
Sbjct  146  SKLDANYTKSV  156



>ref|XP_010545153.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Tarenaya 
hassleriana]
Length=445

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 113/175 (65%), Gaps = 44/175 (25%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKN-  312
            HNIT IL G P+YSQFN YL++T+LADEIN+RTT+TVLVL+NGA S++ GKHPLSVVKN 
Sbjct  26   HNITEILSGSPDYSQFNSYLTQTRLADEINSRTTITVLVLSNGAMSALAGKHPLSVVKNF  85

Query  313  -------------------------------------------VLELHVLLDYWDGDKLH  363
                                                        L L VLLDY+D  KLH
Sbjct  86   NSYLPQTRLADEITSRTTITVLVLSNGAMSALAGKHPLSVVKNALSLLVLLDYYDTQKLH  145

Query  364  DISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGSPLASQYTKSV  528
             ISKGTTL+TTLYQTTGNAPGNLGFVNITD KGGKVGFGSA  GS L S YTKS+
Sbjct  146  QISKGTTLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASGSKLDSSYTKSI  200



>emb|CDX67846.1| BnaA07g18860D [Brassica napus]
Length=413

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN YLS+TKL DEIN+RTT+T+LVL N   SS+ GKHPLSVVK  
Sbjct  26   HNITQILSESPEYSSFNSYLSQTKLNDEINSRTTITILVLNNDVMSSLAGKHPLSVVKTA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH IS+GTTL+TTLYQTTG A GNLGFVN+TD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPLKLHKISQGTTLTTTLYQTTGRAAGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L + YTKSV
Sbjct  146  SKLGANYTKSV  156



>emb|CDX86346.1| BnaA06g30630D [Brassica napus]
Length=413

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   PEYS FN YLS+TKL DEIN+RTT+T+LVL N   SS+ GKHPLSVVK  
Sbjct  26   HNITQILSESPEYSSFNSYLSQTKLNDEINSRTTITILVLNNDVMSSLAGKHPLSVVKTA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH IS+GTTL+TTLYQTTG A GNLGFVN+TD KGGKVGFGSA PG
Sbjct  86   LSLLVLLDYYDPLKLHKISQGTTLTTTLYQTTGRAAGNLGFVNVTDLKGGKVGFGSAAPG  145

Query  496  SPLASQYTKSV  528
            S L + YTKSV
Sbjct  146  SKLDANYTKSV  156



>gb|AGN92424.2| putative fasciclin-like arabinogalactan protein 4, partial [Centaurium 
erythraea]
Length=328

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL  + +YS+FN YLS TKL  EIN+R T+TVLVL NGA  S+ GKHPLSV+K  
Sbjct  20   HNITDILSKYSDYSEFNKYLSETKLDGEINSRQTITVLVLNNGAMDSLAGKHPLSVIKKA  79

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+DG KLH +S GTTL+TTLYQTTGNA G+LG VNITD KGGKVG GSA PG
Sbjct  80   LSLLVLLDYFDGAKLHQLSDGTTLTTTLYQTTGNADGDLGHVNITDLKGGKVGLGSAAPG  139

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  140  SKLDSTYTKSV  150



>ref|XP_009382277.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Musa acuminata 
subsp. malaccensis]
Length=427

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAILE +PEY+ +N YL+RTK+ DEIN   TVT LVL +GA S++  K PL+ +KN 
Sbjct  29   HNITAILERYPEYTLYNSYLTRTKVCDEINAHETVTCLVLDDGAMSTLAAKRPLAAIKNA  88

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLH +S GTTL+TTL QTTGN  GNLGFVNIT+ +GG+VGF S  PG
Sbjct  89   LRLLALLDYFDPPKLHALSSGTTLTTTLLQTTGNEAGNLGFVNITNLRGGRVGFASTAPG  148

Query  496  SPLASQYTKSV  528
            S   S YTKS+
Sbjct  149  SKFDSTYTKSI  159



>gb|KEH23329.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=418

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL  +P+YSQ+N++LS+TKLADEIN+R T+TVLVL N AFSSIT  HPLSVVK +
Sbjct  22   HNITEILSSNPDYSQYNNFLSQTKLADEINSRQTITVLVLNNAAFSSITSSHPLSVVKKI  81

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L +LLDY+D  KLH ++ GTTLSTTL+QTTGNA  N+G VNITD KGGKVGFGSA PG
Sbjct  82   LSLLILLDYFDNTKLHQLTNGTTLSTTLFQTTGNAVNNIGSVNITDLKGGKVGFGSAAPG  141

Query  496  SPLASQYTKSV  528
            S L S Y+KSV
Sbjct  142  SKLDSSYSKSV  152



>ref|XP_003623747.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=414

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL  +P+YSQ+N++LS+TKLADEIN+R T+TVLVL N AFSSIT  HPLSVVK +
Sbjct  22   HNITEILSSNPDYSQYNNFLSQTKLADEINSRQTITVLVLNNAAFSSITSSHPLSVVKKI  81

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L +LLDY+D  KLH ++ GTTLSTTL+QTTGNA  N+G VNITD KGGKVGFGSA PG
Sbjct  82   LSLLILLDYFDNTKLHQLTNGTTLSTTLFQTTGNAVNNIGSVNITDLKGGKVGFGSAAPG  141

Query  496  SPLASQYTKSV  528
            S L S Y+KSV
Sbjct  142  SKLDSSYSKSV  152



>ref|XP_008780048.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Phoenix 
dactylifera]
Length=419

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAIL+G PEYS +N YLS+TK+ DEIN+R TVT LVL N A S++  K  L+ +KN 
Sbjct  22   HNITAILDGFPEYSLYNSYLSQTKVCDEINSRETVTCLVLPNAAMSALAAKQSLAGIKNA  81

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLHD+  G+ L+TTLYQTTGNA GN GFVNIT+ +GG+V F +A PG
Sbjct  82   LRLLTLLDYFDPQKLHDLPHGSALTTTLYQTTGNALGNSGFVNITNLRGGRVAFAAAAPG  141

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  142  SKLDSSYTKSV  152



>ref|XP_010933921.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Elaeis guineensis]
Length=421

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAIL+G PEYS +N YLSRTK+ DEIN+R TVT LVL N A S++  K  L+ +KN 
Sbjct  22   HNITAILDGFPEYSVYNSYLSRTKVCDEINSRETVTCLVLPNAAMSALAAKQSLAGIKNA  81

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLHDI +GTTL+TTLYQTTGNAPGN GFVNIT+ +GG+V F +A PG
Sbjct  82   LRLLTLLDYFDPQKLHDIPQGTTLTTTLYQTTGNAPGNSGFVNITNLRGGRVAFAAAAPG  141

Query  496  SPLASQYTKSV  528
            S L S YTK+V
Sbjct  142  SKLDSSYTKTV  152



>ref|XP_008803297.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Phoenix 
dactylifera]
Length=421

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAIL+G PEYS +N YLSRTK+ DEIN+R TVT LVL N A S++  K  L+ +KN 
Sbjct  22   HNITAILDGFPEYSVYNSYLSRTKVCDEINSRETVTSLVLPNAAMSALAAKQSLAGIKNA  81

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLHDI  G+TL+TTLYQTTGNAPGN GFVNIT+ +GG+V F +A  G
Sbjct  82   LRLLTLLDYFDPQKLHDIPHGSTLTTTLYQTTGNAPGNSGFVNITNLRGGRVAFSAAAHG  141

Query  496  SPLASQYTKSV  528
            S L S YTK+V
Sbjct  142  SKLDSSYTKTV  152



>ref|XP_006652672.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Oryza 
brachyantha]
Length=431

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL+G+PEYS +N YLS+TK+ DEIN+R+TVT LVLTNGA SS+     L+ +KN 
Sbjct  24   HNITDILDGYPEYSLYNSYLSQTKVCDEINSRSTVTCLVLTNGAMSSLVSNLSLADIKNA  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLH +S G+ L+TTLYQTTG+A GN+G VNIT+ +GGKVGF SA PG
Sbjct  84   LRLLTLLDYYDTKKLHSLSDGSELTTTLYQTTGDASGNMGHVNITNLRGGKVGFASAAPG  143

Query  496  SPLASQYTKSV  528
            S   + YTKSV
Sbjct  144  SKFQATYTKSV  154



>ref|XP_010919185.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Elaeis guineensis]
Length=429

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAIL+G PEYS +N YLS+TK+ DEIN+R TVT LVL N A S++  K  L+ +KN 
Sbjct  22   HNITAILDGFPEYSLYNSYLSQTKVCDEINSRETVTCLVLPNAAMSALAAKQSLAGIKNA  81

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLHD+  G+ L+TTLYQTTG+A GN GFVNIT+ +GG+V F +A PG
Sbjct  82   LRLLTLLDYFDPQKLHDLPHGSALTTTLYQTTGDATGNSGFVNITNLRGGRVAFAAATPG  141

Query  496  SPLASQYTKSV  528
            S   S YTKSV
Sbjct  142  SKFDSSYTKSV  152



>ref|NP_001053617.1| Os04g0574200 [Oryza sativa Japonica Group]
 emb|CAD41669.3| OSJNBa0019K04.16 [Oryza sativa Japonica Group]
 dbj|BAF15531.1| Os04g0574200 [Oryza sativa Japonica Group]
 gb|EAY95238.1| hypothetical protein OsI_17056 [Oryza sativa Indica Group]
 gb|EAZ31705.1| hypothetical protein OsJ_15854 [Oryza sativa Japonica Group]
Length=431

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL+G+PEYS +N YLS+TK+ DEIN+R+TVT LVLTNGA SS+     L+ +KN 
Sbjct  24   HNITDILDGYPEYSLYNSYLSQTKVCDEINSRSTVTCLVLTNGAMSSLVSNLSLADIKNA  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLH +S G+ L+TTLYQTTG+A GN+G VNIT+ +GGKVGF SA PG
Sbjct  84   LRLLTLLDYYDTKKLHSLSDGSELTTTLYQTTGDASGNMGHVNITNLRGGKVGFASAAPG  143

Query  496  SPLASQYTKSV  528
            S   + YTKSV
Sbjct  144  SKFQATYTKSV  154



>ref|XP_010418601.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Camelina 
sativa]
Length=413

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 100/131 (76%), Gaps = 11/131 (8%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P+YS FN YLS+TKL DEIN+RTT+TVLVL N A SS+ GKHPLSVVKN 
Sbjct  26   HNITQILSDTPDYSSFNSYLSQTKLDDEINSRTTITVLVLNNAAMSSLAGKHPLSVVKNA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L VLLDY+D  KLH +SKGTTL+TTLYQTTG+APGNLGFVN+TD KGGK         
Sbjct  86   LSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHAPGNLGFVNVTDLKGGK---------  136

Query  496  SPLASQYTKSV  528
              L S YTKSV
Sbjct  137  --LDSSYTKSV  145



>emb|CDY37043.1| BnaA04g26210D [Brassica napus]
Length=409

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            +NIT IL  +P+YS FN YLS+TKLA+EINT  T+T+L L N A +S  GK PLSVVK  
Sbjct  26   YNITKILASYPDYSSFNSYLSQTKLAEEINTYPTITLLALNNDAMASFAGKRPLSVVKKA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttly-qttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            L L  LLDY+D + LH IS+GTTLS TLY  T GNAP  LG+VNITD  GG+V FGSA+ 
Sbjct  86   LSLLTLLDYYDPESLHQISEGTTLSVTLYNNTAGNAPEYLGYVNITDLYGGQVAFGSAVS  145

Query  493  GSPLASQYTKSV  528
            GS L S +TKS+
Sbjct  146  GSKLDSYFTKSI  157



>ref|XP_009142340.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Brassica 
rapa]
Length=409

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            +NIT IL  +P+YS FN YLS+TKLA+EINT  T+T+L L N A +S  GK PLSVVK  
Sbjct  26   YNITKILASYPDYSSFNSYLSQTKLAEEINTYPTITLLALNNDAMASFAGKRPLSVVKKA  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttl-yqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            L L  LLDY+D + LH IS+GTTLS TL   T GNAP  LG+VNITD  GG+V FGSA+ 
Sbjct  86   LSLLTLLDYYDPESLHQISEGTTLSVTLYNNTAGNAPEYLGYVNITDLYGGQVAFGSAVS  145

Query  493  GSPLASQYTKSV  528
            GS L S +TKS+
Sbjct  146  GSKLDSYFTKSI  157



>gb|KDO59100.1| hypothetical protein CISIN_1g015356mg [Citrus sinensis]
Length=408

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT IL GHP +S FN YLS T LADEIN +TT+TV  + N   S +  KHP ++ VKN
Sbjct  23   HNITRILAGHPSFSTFNHYLSVTHLADEINRKTTITVCAIDNAGMSELLSKHPSITTVKN  82

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LH+LLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGFG+   
Sbjct  83   VLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVGFGAKDN  142

Query  493  GSPLASQYTKSV  528
            G  L + + KSV
Sbjct  143  GGKLDALFVKSV  154



>ref|XP_006474892.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Citrus 
sinensis]
Length=408

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT IL GHP +S FN YLS T LADEIN +TT+TV  + N   S +  KHP ++ VKN
Sbjct  23   HNITRILAGHPSFSTFNHYLSVTHLADEINRKTTITVCAIDNAGMSELLSKHPSITTVKN  82

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LH+LLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGFG+   
Sbjct  83   VLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVGFGAKDN  142

Query  493  GSPLASQYTKSV  528
            G  L + + KSV
Sbjct  143  GGKLDALFVKSV  154



>ref|XP_006452590.1| hypothetical protein CICLE_v10008218mg [Citrus clementina]
 gb|ESR65830.1| hypothetical protein CICLE_v10008218mg [Citrus clementina]
Length=460

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT IL GHP +S FN YLS T LADEIN +TT+TV  + N   S +  KHP ++ VKN
Sbjct  75   HNITRILAGHPSFSTFNHYLSVTHLADEINRKTTITVCAIDNAGMSELLSKHPSITTVKN  134

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LH+LLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGFG+   
Sbjct  135  VLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVGFGAKDN  194

Query  493  GSPLASQYTKSV  528
            G  L + + KSV
Sbjct  195  GGKLDALFVKSV  206



>gb|ABR16344.1| unknown [Picea sitchensis]
Length=387

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 103/130 (79%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            NIT IL+ +P+YS FND L+RTKLADEIN+R T+TVLV+ NGA +S++G   L+ VK  L
Sbjct  20   NITKILDAYPDYSIFNDDLTRTKLADEINSRKTITVLVVNNGAMASLSGLD-LASVKRAL  78

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
             LHV+LD++D +KLH ++ GTTLSTTLYQTTG+A GN GF+NITD KGGKVGFG +  G+
Sbjct  79   SLHVVLDFFDAEKLHQVTNGTTLSTTLYQTTGSAAGNAGFINITDLKGGKVGFGLSGRGA  138

Query  499  PLASQYTKSV  528
             L S Y KSV
Sbjct  139  KLDSTYVKSV  148



>ref|XP_003580362.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Brachypodium 
distachyon]
Length=428

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL+G  EYS +N YLS+TK+ DEIN+R+TVT LVLTNGA SS+     L+ +KN 
Sbjct  24   HNITGILDGFSEYSLYNSYLSQTKVCDEINSRSTVTCLVLTNGAMSSLVSNLSLADIKNA  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLH +  G+ L+TTLYQTTG+A G++G VNIT+ +GGKVGF SA PG
Sbjct  84   LRLLTLLDYYDPKKLHSLHGGSELTTTLYQTTGDASGDMGHVNITNLRGGKVGFASAAPG  143

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  144  SKLQSTYTKSV  154



>ref|XP_002448368.1| hypothetical protein SORBIDRAFT_06g026030 [Sorghum bicolor]
 gb|EES12696.1| hypothetical protein SORBIDRAFT_06g026030 [Sorghum bicolor]
Length=429

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 106/155 (68%), Gaps = 3/155 (2%)
 Frame = +1

Query  64   MGSVRHLLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtrttvt  243
            M +  HL+L    + A + +    HNITAIL+G  EY+ +N YLS+TK+ DEIN+R++VT
Sbjct  1    MAASHHLILLVLCLTAAAASA---HNITAILDGRSEYTLYNSYLSQTKVCDEINSRSSVT  57

Query  244  vlvltNGAFSSITGKHPLSVVKNVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAP  423
            VLVLTNGA SS+     L+ +KN L L  LLDY+D  KLH I   + L+T+LYQTTG A 
Sbjct  58   VLVLTNGAMSSLVANLSLADIKNALRLLTLLDYFDEKKLHSIGSSSQLTTSLYQTTGQAA  117

Query  424  GNLGFVNITDQKGGKVGFGSALPGSPLASQYTKSV  528
            G++G VNITD +GGKV F SA PG+   S YTK V
Sbjct  118  GDMGHVNITDLRGGKVAFASAAPGAKFQSTYTKRV  152



>gb|ABK24724.1| unknown [Picea sitchensis]
 gb|ACN41086.1| unknown [Picea sitchensis]
Length=409

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 101/130 (78%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            NIT IL  +PEYS+FN  LS+TKLADEIN+R T+TVL L+N   +S++G   L+ +K VL
Sbjct  24   NITKILAKYPEYSKFNHDLSQTKLADEINSRQTITVLALSNSQMASLSGLD-LASLKRVL  82

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
             LHV+LD++D  KLH+I+ GTTLSTTLYQTTGNAPGN GF+NITD K GKVGFG A  G+
Sbjct  83   SLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAAHGA  142

Query  499  PLASQYTKSV  528
             L + Y KSV
Sbjct  143  KLDATYVKSV  152



>ref|XP_006603146.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like, partial 
[Glycine max]
Length=309

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN +TT+TV  + N A S +  KHP +  +KN
Sbjct  22   HNITTILSKHPEFSTFNHYLTLTHLAPEINGKTTITVCAVDNAAMSDLLSKHPSIYTIKN  81

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I+ GT L+ T+YQ TG+APG+ GFVNITD  GGKVGFG+   
Sbjct  82   ILSLHVLLDYFGAKKLHQITNGTALAATMYQATGSAPGSAGFVNITDLHGGKVGFGAENN  141

Query  493  GSPLASQYTKSV  528
               L+S + KSV
Sbjct  142  DGTLSSTFVKSV  153



>tpg|DAA36388.1| TPA: fasciclin-like arabinogalactan protein 10 [Zea mays]
Length=429

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAIL+G  EY+ +N YLS TK+ DEIN+R++VTVLVLTNGA SS+     L+ +KN 
Sbjct  22   HNITAILDGRSEYTLYNSYLSETKVCDEINSRSSVTVLVLTNGAMSSLVANLSLADIKNA  81

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLH I   + L+T+LYQTTG A G++G VNITD +GGKV F SA PG
Sbjct  82   LRLLTLLDYFDEKKLHSIGSSSQLTTSLYQTTGQAAGDMGHVNITDLRGGKVAFASAAPG  141

Query  496  SPLASQYTKSV  528
            +   S YTK V
Sbjct  142  AKFQSTYTKRV  152



>ref|XP_004516114.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like, partial 
[Cicer arietinum]
Length=478

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
             NIT ILE HPE+S FN YL+ T LA EINTRTT+TV  + N A +++  KHP +S +KN
Sbjct  93   QNITRILEKHPEFSTFNHYLTLTHLALEINTRTTITVCAVDNSAMTNLLAKHPSISTIKN  152

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I+ GT L+ TLYQ TG+APG+ GFVNITD +GGKVGFG+   
Sbjct  153  ILSLHVLLDYFGAKKLHQITNGTALAATLYQATGSAPGSSGFVNITDLRGGKVGFGAEDN  212

Query  493  GSPLASQYTKSV  528
               L + Y KSV
Sbjct  213  NGALPALYVKSV  224



>ref|NP_001151356.1| fasciclin-like arabinogalactan protein 10 precursor [Zea mays]
 gb|ACG42498.1| fasciclin-like arabinogalactan protein 10 precursor [Zea mays]
Length=429

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNITAIL+G  EY+ +N YLS TK+ DEIN+R++VTVLVLTNGA SS+     L+ +KN 
Sbjct  22   HNITAILDGRSEYTLYNSYLSETKVCDEINSRSSVTVLVLTNGAMSSLVANLSLADIKNA  81

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLH I   + L+T+LYQTTG A G++G VNITD +GGKV F SA PG
Sbjct  82   LRLLTLLDYFDEKKLHSIGSSSQLTTSLYQTTGQAAGDMGHVNITDLRGGKVAFASAAPG  141

Query  496  SPLASQYTKSV  528
            +   S YTK V
Sbjct  142  AKFQSTYTKRV  152



>gb|ABI95395.1| fasciclin-like protein FLA5 [Triticum aestivum]
Length=429

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 99/131 (76%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL+G+ EYS +N+YLS+TK+ DEIN R+TVT LVLTNGA SS+     L+ VKN 
Sbjct  25   HNITDILDGYSEYSLYNNYLSQTKVCDEINGRSTVTCLVLTNGAMSSLVANLSLADVKNA  84

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLH +  G+ L+TTLYQTTG+A G++G VNIT+ +GGKVGF SA PG
Sbjct  85   LRLLTLLDYYDPKKLHSLHGGSELTTTLYQTTGDASGDMGHVNITNLRGGKVGFASAEPG  144

Query  496  SPLASQYTKSV  528
            S   + YTKSV
Sbjct  145  SKFQATYTKSV  155



>ref|XP_010088447.1| hypothetical protein L484_018219 [Morus notabilis]
 gb|EXB36062.1| hypothetical protein L484_018219 [Morus notabilis]
Length=417

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN RTT+TVL + N A S I GK+P +  VKN
Sbjct  25   HNITKILAKHPEFSTFNHYLTLTHLAPEINRRTTITVLAIDNAAMSDILGKNPSIYTVKN  84

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I+ GT LS T++Q TG+APG+ GFVNITDQ+GGKVGF     
Sbjct  85   ILSLHVLLDYFGAKKLHQITNGTALSATMFQATGSAPGSTGFVNITDQRGGKVGFAPEDN  144

Query  493  GSPLASQYTKSV  528
                +S + KSV
Sbjct  145  DGTFSSHFLKSV  156



>gb|ABR16637.1| unknown [Picea sitchensis]
Length=409

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            NIT IL  +PEYS+FN  LS+TKLADEIN+R T+TVL L+N   + ++G   L+ +K VL
Sbjct  24   NITKILAKYPEYSKFNHDLSQTKLADEINSRQTITVLALSNSEMALLSGLD-LASLKRVL  82

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
             LHV+LD++D  KLH+I+ GTTLSTTLYQTTGNAPGN GF+NITD K GKVGFG A  G+
Sbjct  83   SLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAAHGA  142

Query  499  PLASQYTKSV  528
             L + Y KSV
Sbjct  143  KLDATYVKSV  152



>ref|XP_004976555.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Setaria 
italica]
Length=438

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT +L+G  EY+ +N YLS TK+ DEIN+  TVTVLVLTNGA SS+     L+ +KN 
Sbjct  32   HNITTVLDGRSEYTLYNSYLSETKVCDEINSEHTVTVLVLTNGAMSSLVANLSLADIKNA  91

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLH +  G+ L+T+LYQ TG A GN+G VNITD +GGKVGF  A PG
Sbjct  92   LRLLTLLDYFDEKKLHSLDSGSELTTSLYQKTGQAAGNMGHVNITDLRGGKVGFAPAAPG  151

Query  496  SPLASQYTKSV  528
            +   S YTK V
Sbjct  152  AKFQSTYTKRV  162



>dbj|BAE75863.1| putative fasciclin-like arabinogalactan protein [Salicornia europaea]
Length=427

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 1/122 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL   P++S FN YL+ T LA EINTR T+TVL + N A +S+T KH P+S +KN
Sbjct  26   HNITKILAKFPDFSSFNHYLTTTHLAPEINTRQTITVLAIDNAAMASLTSKHLPISTLKN  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I+ G+ L+ T+YQ TG+APG  GFVNITD KGGKVGF +  P
Sbjct  86   ILSLHVLLDYFGAKKLHQITDGSALAATMYQATGSAPGTAGFVNITDLKGGKVGFAATNP  145

Query  493  GS  498
             S
Sbjct  146  AS  147



>gb|AGV54413.1| fasciclin-like arabinogalactan protein 1-like protein [Phaseolus 
vulgaris]
Length=420

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN RTT+TV  + N A   +  KHP +  +KN
Sbjct  27   HNITRILAQHPEFSTFNHYLTLTHLAPEINGRTTITVCAVDNAAMDELLSKHPSIYTIKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I+ GT L+ T+YQ TG APG+ GFVNITD  GGKVGFG+   
Sbjct  87   ILSLHVLLDYFGAKKLHQITNGTALAATMYQATGTAPGSAGFVNITDLHGGKVGFGAENN  146

Query  493  GSPLASQYTKSV  528
               L S + KSV
Sbjct  147  DGTLTSTFVKSV  158



>ref|XP_007146643.1| hypothetical protein PHAVU_006G057400g [Phaseolus vulgaris]
 gb|ESW18637.1| hypothetical protein PHAVU_006G057400g [Phaseolus vulgaris]
Length=420

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN RTT+TV  + N A   +  KHP +  +KN
Sbjct  27   HNITRILAQHPEFSTFNHYLTLTHLAPEINGRTTITVCAVDNAAMDELLSKHPSIYTIKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I+ GT L+ T+YQ TG APG+ GFVNITD  GGKVGFG+   
Sbjct  87   ILSLHVLLDYFGAKKLHQITNGTALAATMYQATGTAPGSAGFVNITDLHGGKVGFGAENN  146

Query  493  GSPLASQYTKSV  528
               L S + KSV
Sbjct  147  DGTLTSTFVKSV  158



>ref|XP_010243936.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nelumbo 
nucifera]
Length=408

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TV  + N   S +  KH  +  +KN
Sbjct  27   HNITRILAKHPEFSTFNHYLTVTHLAAEINRRETITVCAVDNAGMSELLSKHLSIYAIKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LH+LLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGFG+   
Sbjct  87   VLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFGAEAN  146

Query  493  GSPLASQYTKSV  528
               + S + KS+
Sbjct  147  DGKIDSTFVKSI  158



>ref|XP_003532178.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Glycine 
max]
Length=415

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT+IL  HPE S FN YL+ T LA EIN +TT+TV  + N A S +  KHP +  VKN
Sbjct  22   HNITSILAKHPELSTFNHYLTLTHLAPEINGKTTITVCAVDNAAMSDLLSKHPSIYTVKN  81

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVLLDY+   KLH I+ GT L+ T+YQ TG APG+ GFVNITD  GGKV F     
Sbjct  82   VLSLHVLLDYFGAKKLHQITNGTALAATMYQATGTAPGSAGFVNITDLHGGKVAFAPENN  141

Query  493  GSPLASQYTKSV  528
               L+S + KSV
Sbjct  142  DGTLSSTFVKSV  153



>gb|KEH34088.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=421

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE S FN YLS T LA +I++RTT+TV  + N A   +  KH  ++ +KN
Sbjct  30   HNITRILAKHPELSTFNHYLSLTHLASQIDSRTTITVCAVDNAAMEDLLSKHLSINTIKN  89

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I+ GT L+ T+YQ TG APG+ GFVNITD +GGKVGFG+   
Sbjct  90   ILSLHVLLDYFGAKKLHQITNGTALAATMYQATGTAPGSSGFVNITDLRGGKVGFGAENN  149

Query  493  GSPLASQYTKSV  528
               L + Y KSV
Sbjct  150  DGALTASYVKSV  161



>gb|ABI95391.1| fasciclin-like protein FLA1 [Triticum aestivum]
Length=430

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNI  IL+G+ EYS +N YLS+TK+ DEIN+R+TVT LVLTNGA SS+     L+ +KN 
Sbjct  25   HNILDILDGYSEYSLYNSYLSQTKVCDEINSRSTVTCLVLTNGAMSSLVSNLSLADIKNA  84

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L L  LLDY+D  KLH +  G+ L+TTLYQTTG+A G++G VNIT+ +GG+VGF SA PG
Sbjct  85   LRLLTLLDYYDPKKLHSLHGGSELTTTLYQTTGDASGDMGHVNITNLRGGEVGFASAEPG  144

Query  496  SPLASQYTKSV  528
            S   + YTKS+
Sbjct  145  SKFQATYTKSI  155



>ref|XP_010497131.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Camelina 
sativa]
Length=327

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S F+ YL++T LADEIN RTT+TV  + N A +++T K + +S +KN
Sbjct  24   HNVTRLLANHPSFSSFSHYLTQTHLADEINRRTTITVCAVDNAAMAALTSKGYTISTLKN  83

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I  G+ L+ T++Q TG APG  GFVNITD +GGKVGFG    
Sbjct  84   ILSLHVLLDYFGTKKLHQIRDGSALAATMFQATGAAPGTTGFVNITDLRGGKVGFGP--D  141

Query  493  GSPLASQYTKSV  528
            G  L+S + KS+
Sbjct  142  GGDLSSFFVKSI  153



>ref|XP_008462050.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Cucumis 
melo]
Length=421

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TVL L N A S++  KH  +  +KN
Sbjct  31   HNITRILAKHPEFSTFNHYLTITHLAGEINRRLTITVLALDNSAMSALLDKHFSVGTIKN  90

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH +SKGTTLS+TL+Q TG+A G  G+VNIT+ +GGKVGFGS   
Sbjct  91   VLSLHVLVDYYGAKKLHQLSKGTTLSSTLFQATGSATGTSGYVNITNMRGGKVGFGSEDN  150

Query  493  GSPLASQYTKSV  528
            G  L S Y KSV
Sbjct  151  GGDLNSFYVKSV  162



>ref|XP_004144548.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis 
sativus]
 ref|XP_004167979.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis 
sativus]
 gb|KGN43405.1| hypothetical protein Csa_7G031660 [Cucumis sativus]
Length=418

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TVL L N A S++  KH  +  +KN
Sbjct  28   HNITRILAKHPEFSTFNHYLTITHLAGEINRRLTITVLALDNSAMSALLDKHFSVGTIKN  87

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH +SKGTTLS+TL+Q TG+A G  G+VNIT+ +GGKVGFGS   
Sbjct  88   VLSLHVLVDYYGAKKLHQLSKGTTLSSTLFQATGSATGTSGYVNITNMRGGKVGFGSEDN  147

Query  493  GSPLASQYTKSV  528
            G  L S Y KSV
Sbjct  148  GGDLNSFYVKSV  159



>ref|XP_009120095.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Brassica 
rapa]
 emb|CDY17354.1| BnaA10g09880D [Brassica napus]
Length=426

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S FN +L++T LA EIN RTT+TVL + N A S++T K +P+S VKN
Sbjct  28   HNVTRLLASHPSFSSFNHFLTQTHLAGEINRRTTITVLAVDNAAMSALTSKGYPISTVKN  87

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   K+H I  G+ L+ TL+Q TG APG  GFVNITD +GGKVG G    
Sbjct  88   ILSLHVLLDYFGAKKIHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGLGP--D  145

Query  493  GSPLASQYTKSV  528
            G  L+S + KSV
Sbjct  146  GGDLSSFFVKSV  157



>ref|XP_010479980.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   PE+S FN YLS T LADEIN R T+TVL + N A SSI  K + L  ++N
Sbjct  47   HNITRILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSKGYSLYTIRN  106

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  107  ILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQED  166

Query  493  GSPLASQYTKSV  528
             S L + Y KS+
Sbjct  167  DSKLTAHYVKSI  178



>ref|XP_002866110.1| hypothetical protein ARALYDRAFT_495659 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42369.1| hypothetical protein ARALYDRAFT_495659 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S F+ +L++T LADEIN RTT+TV  + N A S++T K + +S +KN
Sbjct  25   HNVTRLLANHPSFSSFSHFLTQTHLADEINRRTTITVCAVDNAAMSALTSKGYTISTLKN  84

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I  G+ L+ TL+Q TG APG  GFVNITD +GGKVGFG    
Sbjct  85   ILSLHVLLDYFGAKKLHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGFGP--D  142

Query  493  GSPLASQYTKSV  528
            G  L+S + KS+
Sbjct  143  GGDLSSFFVKSI  154



>ref|XP_011038795.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Populus 
euphratica]
Length=406

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT+IL  HP  S FN YL+ T LA EIN RTT+TV  + N A S I  K P +S +KN
Sbjct  23   HNITSILGKHPSLSTFNHYLTLTHLAGEINRRTTITVCAVDNAAMSEILSKKPSISTIKN  82

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I  G+ L+ T++Q TG+APG+ GFVNITD KGGKV FG    
Sbjct  83   ILSLHVLLDYFGTKKLHQIRDGSALAATMFQATGSAPGSTGFVNITDVKGGKVAFGPKDN  142

Query  493  GSPLASQYTKSV  528
            G  L   Y KSV
Sbjct  143  GGSLDVFYVKSV  154



>emb|CDY28643.1| BnaC09g32320D [Brassica napus]
Length=423

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S FN +L++T LA EIN RTT+TVL + N A S++T K +P+S +KN
Sbjct  27   HNVTRLLASHPSFSSFNHFLTQTHLAGEINRRTTITVLAVDNAAMSALTSKGYPISTIKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   K+H I  G+ L+ TL+Q TG APG  GFVNITD +GGKVG G    
Sbjct  87   ILSLHVLLDYFGAKKIHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGLGPD--  144

Query  493  GSPLASQYTKSV  528
            G  L+S + KSV
Sbjct  145  GGDLSSFFVKSV  156



>ref|XP_010061458.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Eucalyptus 
grandis]
 gb|KCW68396.1| hypothetical protein EUGRSUZ_F02049 [Eucalyptus grandis]
Length=416

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV-VKN  312
            HNIT++L GHP++S FN YLS T LA EIN+RTT+TVL ++N A + +  +HP +  +KN
Sbjct  29   HNITSLLAGHPDFSTFNHYLSATHLAAEINSRTTITVLAVSNAAMNDLLAEHPTTTTLKN  88

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH ++ G+ L+ TL+Q+TG+APG+ GFVNITD KGGKVGF     
Sbjct  89   ILSLHVLLDYFGSKKLHQLTDGSALAATLFQSTGSAPGSSGFVNITDLKGGKVGFAPEEG  148

Query  493  GSPLASQY  516
            GS  A  Y
Sbjct  149  GSSDAGAY  156



>ref|XP_007049368.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
 gb|EOX93525.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
Length=399

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TVL L N A S++  K   L  VKN
Sbjct  29   HNITRILAKHPEFSTFNHYLTTTHLASEINRRQTITVLALDNAAMSALLDKQLSLYTVKN  88

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GT L++T++Q TG APG+ G++NITD KGGKVGFG+   
Sbjct  89   VLSLHVLVDYFGSKKLHQITNGTALTSTMFQATGAAPGSSGYINITDLKGGKVGFGAEDN  148

Query  493  GSPLASQYTKSV  528
               L + Y KSV
Sbjct  149  NGKLDAVYVKSV  160



>ref|XP_006286070.1| hypothetical protein CARUB_v10007603mg [Capsella rubella]
 gb|EOA18968.1| hypothetical protein CARUB_v10007603mg [Capsella rubella]
Length=402

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL  +P++S FN YLS T LADEIN R T+TVL + N A SSI  K + L  ++N
Sbjct  27   HNITRILAKNPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSKGYSLYTIRN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  87   ILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQED  146

Query  493  GSPLASQYTKSV  528
             S L + Y KS+
Sbjct  147  DSKLTAHYVKSI  158



>ref|XP_010063266.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Eucalyptus 
grandis]
 gb|KCW70477.1| hypothetical protein EUGRSUZ_F03689 [Eucalyptus grandis]
Length=409

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT +L  HPE+S FN YL+ T LA EIN+RTT+TV+ L N A S +   HP ++ +KN
Sbjct  27   HNITRLLAKHPEFSTFNHYLTETHLAAEINSRTTITVMALDNAAMSRLLAPHPTIATLKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFG  480
            VL LHVLLDY+   KLH I+ GT L+ TL+Q TG+APG+ GFVNITD KGGKVGF 
Sbjct  87   VLSLHVLLDYFGPKKLHQITNGTALAATLFQATGSAPGSTGFVNITDLKGGKVGFA  142



>gb|KJB81625.1| hypothetical protein B456_013G152900 [Gossypium raimondii]
Length=412

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT +L  HP  S FN YL+ T LA EIN RTT+TVL L N A SS+  K+P +  +KN
Sbjct  25   HNITRLLAKHPSLSTFNHYLTLTHLAQEINRRTTITVLALDNAAMSSLLNKNPSIYTMKN  84

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVLLDY+   KLH I+ GT L+ T++Q TG APG  GFVNITD KGGKVGFG+   
Sbjct  85   VLSLHVLLDYFGAKKLHQITNGTALAATMFQATGVAPGVSGFVNITDFKGGKVGFGAEDN  144

Query  493  GSPLASQYTKSV  528
            G  L S + KSV
Sbjct  145  GGDLDSFFVKSV  156



>gb|ABV27481.1| fasciclin-like arabinogalactan protein 10 [Gossypium hirsutum]
Length=414

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT +L  HP  S FN YL+ T LA EIN RTT+TVL L N A SS+  K+P +  +KN
Sbjct  25   HNITRLLAKHPSLSTFNHYLTLTHLAQEINRRTTITVLALDNAAMSSLLNKNPSIYTMKN  84

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVLLDY+   KLH I+ GT L+ T++Q TG APG  GFVNITD KGGKVGFG+   
Sbjct  85   VLSLHVLLDYFGAKKLHQITNGTALAATMFQATGVAPGVSGFVNITDFKGGKVGFGAEDN  144

Query  493  GSPLASQYTKSV  528
            G  L S + KSV
Sbjct  145  GGDLDSFFVKSV  156



>ref|XP_011095539.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=415

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL+ +P++S FN YL+ T+LA EIN R T+TV  + N   S +  KH  +  +KN
Sbjct  29   HNITRILDKYPDFSTFNHYLTLTQLAPEINRRETITVCAVDNARMSDLLSKHLNIGAIKN  88

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVLLDY+D  KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGF     
Sbjct  89   VLSLHVLLDYFDSKKLHQITDGTALAATMFQATGSAPGSAGFVNITDLKGGKVGFAPQDN  148

Query  493  GSPLASQYTKSV  528
            G  +++ + K V
Sbjct  149  GGVVSATFVKPV  160



>gb|KJB13883.1| hypothetical protein B456_002G100100 [Gossypium raimondii]
 gb|KJB13884.1| hypothetical protein B456_002G100100 [Gossypium raimondii]
Length=417

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +1

Query  64   MGSVRHLLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtrttvt  243
            MG  +H+LL   +   +    +A HNIT +L  HP  S FN YL+ T LA EIN RTT+T
Sbjct  2    MGQRQHVLLLIFSAFLLFQTSNA-HNITRLLAKHPSLSTFNHYLTLTHLAPEINRRTTIT  60

Query  244  vlvltNGAFSSITGKHP-LSVVKNVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNA  420
            VL L N A SS+  K+P +  +KN+L LHVLLDY+   KLH I  GT L+ T++Q TG A
Sbjct  61   VLALDNAAMSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVA  120

Query  421  PGNLGFVNITDQKGGKVGFGSALPGSPLASQYTKSV  528
            PG  GFVNITD KGGKVGFG+   G  L S + KSV
Sbjct  121  PGVSGFVNITDFKGGKVGFGAEDNGGSLNSFFVKSV  156



>ref|XP_006844054.1| hypothetical protein AMTR_s00006p00245830 [Amborella trichopoda]
 gb|ERN05729.1| hypothetical protein AMTR_s00006p00245830 [Amborella trichopoda]
Length=392

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL    E+S+FNDYLSRT LA EIN RTT+TVL + N A   I  K + +  +KN
Sbjct  21   HNITKILAQFHEFSKFNDYLSRTHLASEINRRTTITVLAVDNAAMDDILAKNYGIYEIKN  80

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LH+LLDY+   KLH I+ GT L+ TLYQTTG+APG  GFVNITD+KGGKV  G+   
Sbjct  81   ILSLHILLDYFGAKKLHQITNGTALAATLYQTTGSAPGTSGFVNITDEKGGKVSIGADDN  140

Query  493  GSPLASQYTKSV  528
            G  L + Y KSV
Sbjct  141  GGVLDASYVKSV  152



>ref|XP_002298869.2| hypothetical protein POPTR_0001s37650g [Populus trichocarpa]
 gb|EEE83674.2| hypothetical protein POPTR_0001s37650g [Populus trichocarpa]
Length=406

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT+IL  HP  S FN YL+ T LA EIN RTT+TV  + N A S I  K P +S +KN
Sbjct  23   HNITSILGQHPSLSTFNHYLTLTHLAGEINRRTTITVCAVDNAAMSEILSKKPSISTIKN  82

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I  GT L+ T++Q TG+APG+ GFVNITD KGGKV FG    
Sbjct  83   ILSLHVLLDYFGTKKLHQIRDGTALAATMFQATGSAPGSTGFVNITDVKGGKVAFGPKDN  142

Query  493  GSPLASQYTKSV  528
            G  L   Y KSV
Sbjct  143  GGNLDVFYVKSV  154



>ref|XP_002522745.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39596.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT +L  HP +S FN YL+ T LADEIN RTT+TV  + N A S++  KHP +  +KN
Sbjct  27   HNITRLLSHHPSFSTFNHYLTITHLADEINRRTTITVCAIDNTAMSALLSKHPSIYTIKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFG  480
            +L LHVLLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKV FG
Sbjct  87   MLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDIKGGKVAFG  142



>ref|XP_010435371.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   P++S FN YLS T LADEIN R T+TVL + N A SSI  K + L  ++N
Sbjct  47   HNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSKGYSLYTIRN  106

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  107  ILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDTKGGKVAFGVQDD  166

Query  493  GSPLASQYTKSV  528
             S L + Y KS+
Sbjct  167  DSKLTAHYVKSI  178



>ref|XP_004291803.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Fragaria 
vesca subsp. vesca]
Length=407

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT +L  HPE+S FN YLS T LA +IN RTT+TV  + N A S++  KH LS+  +K
Sbjct  26   HNITHLLAKHPEFSTFNRYLSLTHLAADINDRTTITVCAVDNSAMSALLAKH-LSIYSIK  84

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            N+L LHVLLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGF    
Sbjct  85   NILSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVGFTPED  144

Query  490  PGSPLASQYTKSV  528
                 A+ + KSV
Sbjct  145  NDGSFAAHFVKSV  157



>ref|NP_200384.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
 ref|NP_001190550.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
 sp|Q9FM65.1|FLA1_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK20857.1|AF333970_1 fasciclin-like arabinogalactan-protein 1 [Arabidopsis thaliana]
 dbj|BAB09240.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO00897.1| putative protein [Arabidopsis thaliana]
 gb|AAP37869.1| At5g55730 [Arabidopsis thaliana]
 gb|AED96673.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
 gb|AED96674.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
Length=424

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S F+ +L++T LADEIN R T+TV  + N A S++T K + LS +KN
Sbjct  25   HNVTRLLANHPSFSSFSHFLTQTHLADEINRRRTITVCAVDNAAMSALTSKGYTLSTLKN  84

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I  G+ L+ TL+Q TG APG  GFVNITD +GGKVGFG    
Sbjct  85   ILSLHVLLDYFGTKKLHQIRDGSALAATLFQATGAAPGTSGFVNITDLRGGKVGFGP--D  142

Query  493  GSPLASQYTKSV  528
            G  L+S + KS+
Sbjct  143  GGDLSSFFVKSI  154



>ref|XP_010485145.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Camelina 
sativa]
Length=386

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S F+ YL++T LADEIN RTT+TV  + N A +++T K + ++ +KN
Sbjct  24   HNVTRLLANHPSFSSFSHYLTQTHLADEINRRTTITVCAVDNAAMAALTSKGYTITTLKN  83

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I  G+ L+ T++Q TG APG  GFVNITD +GGKVGFG    
Sbjct  84   ILSLHVLLDYFGTKKLHQIRDGSALAATMFQATGAAPGTTGFVNITDLRGGKVGFGP--D  141

Query  493  GSPLASQYTKSV  528
            G  L+S + KS+
Sbjct  142  GGDLSSFFVKSI  153



>gb|KFK32403.1| hypothetical protein AALP_AA6G237100 [Arabis alpina]
Length=397

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   PE+S FN YL+ T LADEIN R T+TVL + N A SSI  K + L  ++N
Sbjct  23   HNITKILAKDPEFSTFNHYLTATHLADEINRRQTITVLAVDNSAMSSILSKGYSLYTIRN  82

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  83   ILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQDD  142

Query  493  GSPLASQYTKSV  528
             S L ++Y KS+
Sbjct  143  DSELTARYVKSI  154



>gb|EYU33706.1| hypothetical protein MIMGU_mgv1a007367mg [Erythranthe guttata]
Length=410

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  +PE S FN YL+ T+LA EIN R T+TV  + NG    +  K   +  ++N
Sbjct  31   HNITRILAKYPELSTFNHYLTVTQLAPEINRRETITVCAVDNGGMGDLLSKRLTIGAIRN  90

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VLELHVLLDY+D  KLH I+ GT L+ T++Q TG+APG+ GFVNIT+ KGGKVGF     
Sbjct  91   VLELHVLLDYFDAKKLHQITDGTALAATMFQATGSAPGSSGFVNITELKGGKVGFSPEEN  150

Query  493  GSPLASQYTKSV  528
            G  +++ + KS+
Sbjct  151  GGVISAYFVKSI  162



>ref|XP_011010616.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Populus 
euphratica]
Length=407

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT IL  HP +S FN YL+ T LA EIN++TT+TV  + N A S +  KHP ++ +KN
Sbjct  24   HNITRILGKHPSFSTFNHYLTLTHLAGEINSKTTITVCAVDNAAMSELLSKHPSIATIKN  83

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFG  480
            +L LHVLLDY+   KLH I +GT L+ T++Q TG+APG+ GFVNITD KGGKV FG
Sbjct  84   ILSLHVLLDYFGTKKLHQIREGTALAATMFQATGSAPGSAGFVNITDVKGGKVAFG  139



>ref|XP_006352538.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Solanum 
tuberosum]
Length=415

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  +P++S FN YL+ T LA EIN+R T+TV  + N   + +  KH LS+  +K
Sbjct  28   HNITHILAKYPQFSTFNHYLTETHLAAEINSRETITVCAVDNAGMAELLSKH-LSIYTIK  86

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NV+ LHVLLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGFG A 
Sbjct  87   NVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFGPAE  146

Query  490  PGSPLASQYTKSV  528
                L + + KSV
Sbjct  147  NHGTLPATFVKSV  159



>emb|CDY37904.1| BnaA06g19130D [Brassica napus]
Length=398

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   PE+S FN YLS T LADEIN R T+TVL + N A +SI  K + L  ++N
Sbjct  24   HNITKILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIRN  83

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  84   ILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQED  143

Query  493  GSPLASQYTKSV  528
             S L + Y KS+
Sbjct  144  DSRLTAHYVKSI  155



>ref|XP_007212310.1| hypothetical protein PRUPE_ppa006726mg [Prunus persica]
 gb|EMJ13509.1| hypothetical protein PRUPE_ppa006726mg [Prunus persica]
Length=398

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN  TT+TV  + N A S++  K P +  +KN
Sbjct  26   HNITRILAKHPEFSTFNHYLTLTHLAAEINQHTTITVCAVDNSAMSALLAKKPSIYTIKN  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LH+LLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGF     
Sbjct  86   ILSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSAGFVNITDLKGGKVGFTPQDN  145

Query  493  GSPLASQYTKSV  528
                 + + KSV
Sbjct  146  DGTFPAHFVKSV  157



>ref|XP_009150168.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Brassica 
rapa]
Length=399

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   PE+S FN YLS T LADEIN R T+TVL + N A +SI  K + L  ++N
Sbjct  24   HNITKILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIRN  83

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  84   ILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQED  143

Query  493  GSPLASQYTKSV  528
             S L + Y KS+
Sbjct  144  DSRLTAHYVKSI  155



>ref|XP_008227156.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Prunus mume]
Length=412

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN  TT+TV  + N A S++  K P +  +KN
Sbjct  26   HNITRILAKHPEFSTFNHYLTLTHLAAEINQHTTITVCAVDNSAMSALLAKKPSIYTIKN  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LH+LLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGF     
Sbjct  86   ILSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSAGFVNITDLKGGKVGFTPQDN  145

Query  493  GSPLASQYTKSV  528
                 + + KSV
Sbjct  146  DGTFPAHFVKSV  157



>ref|XP_002863317.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39576.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. 
lyrata]
Length=403

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   P++S FN YLS T LADEIN R T+TVL + N A SSI  K + L  ++N
Sbjct  27   HNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSKGYSLYTIRN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  87   ILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQDD  146

Query  493  GSPLASQYTKSV  528
             S L + Y KS+
Sbjct  147  DSKLTAHYVKSI  158



>ref|XP_010545276.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Tarenaya 
hassleriana]
Length=421

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S F+ YL++T LADEIN RTT+T+  + N A S I  K + +S +KN
Sbjct  27   HNVTRLLAKHPSFSTFSHYLTQTHLADEINRRTTITICAVENSAMSDIISKGYTISTIKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I  G+ L+ TL+Q TG+APG  GFVNITD +GGKVGFG    
Sbjct  87   ILSLHVLLDYFGAKKLHQIRDGSALAATLFQATGSAPGTTGFVNITDLRGGKVGFGP--D  144

Query  493  GSPLASQYTKSV  528
            G  L++ + KS+
Sbjct  145  GGDLSAFFVKSL  156



>ref|XP_010675939.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Beta vulgaris 
subsp. vulgaris]
Length=414

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL   PE+S FN YL+ T LA EINTR T+TVL + N A +++  KH P+S +KN
Sbjct  22   HNITKILAKSPEFSTFNHYLTTTHLAAEINTRLTITVLAVDNAAMNALIAKHLPISSLKN  81

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGS  483
            VL LHVLLDY+   KLH I+ GT L+ T+YQ TG+APG  GFVNITD KGGKV F +
Sbjct  82   VLSLHVLLDYFGAKKLHQITDGTALAATMYQATGSAPGTSGFVNITDLKGGKVAFAA  138



>gb|KHG09433.1| Fasciclin-like arabinogalactan protein 1 [Gossypium arboreum]
Length=417

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +1

Query  64   MGSVRHLLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtrttvt  243
            MG  +H++L   +   +    +A HNIT +L  HP  S FN YL+ T LA EIN RTT+T
Sbjct  2    MGQRQHVVLLIFSAFLLFQTSNA-HNITRLLAKHPSLSTFNHYLTLTHLAPEINRRTTIT  60

Query  244  vlvltNGAFSSITGKHP-LSVVKNVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNA  420
            VL L N A SS+  K+P +  +KN+L LHVLLDY+   KLH I  GT L+ T++Q TG A
Sbjct  61   VLALDNAAMSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVA  120

Query  421  PGNLGFVNITDQKGGKVGFGSALPGSPLASQYTKSV  528
            PG  GFVNITD KGGKVGFG+   G  L S + KSV
Sbjct  121  PGVSGFVNITDFKGGKVGFGAEDNGGSLNSFFVKSV  156



>ref|XP_008463001.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Cucumis 
melo]
Length=414

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 86/117 (74%), Gaps = 3/117 (3%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT +LE HPE+S FN YL+ T LA EIN RTT+TV V+ N A S +  K  LS+  +K
Sbjct  29   HNITKLLEKHPEFSTFNHYLTTTHLAPEINRRTTITVCVVDNSAMSDLLAKQ-LSIYSIK  87

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFG  480
            N L LHVLLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGFG
Sbjct  88   NTLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVGFG  144



>ref|XP_004148925.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Cucumis 
sativus]
 ref|XP_004170859.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Cucumis 
sativus]
 gb|KGN44020.1| Fasciclin-like arabinogalactan protein 11 [Cucumis sativus]
Length=415

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 86/117 (74%), Gaps = 3/117 (3%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT +LE HPE+S FN YL+ T LA EIN RTT+TV V+ N A S +  K  LS+  +K
Sbjct  29   HNITKLLEKHPEFSTFNHYLTTTHLAPEINRRTTITVCVVDNSAMSDLLAKQ-LSIYSIK  87

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFG  480
            N L LHVLLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGFG
Sbjct  88   NTLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVGFG  144



>ref|XP_006415013.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum]
 gb|ESQ56466.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum]
Length=405

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   P++S FN YL+ T LADEIN R T+TVL + N A +SI  K + L  ++N
Sbjct  27   HNITKILAKDPDFSTFNHYLTATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIRN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ GTT + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  87   ILSLHVLVDYFGAKKLHQITDGTTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQDD  146

Query  493  GSPLASQYTKSV  528
             S L +QY KS+
Sbjct  147  DSKLTAQYVKSI  158



>ref|XP_010496525.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   P++S FN YLS T LADEIN R T+TVL + N A SSI  + + L  ++N
Sbjct  47   HNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSRGYSLYTIRN  106

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  107  ILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQDD  166

Query  493  GSPLASQYTKSV  528
             S L + Y KS+
Sbjct  167  DSKLTAHYVKSI  178



>ref|XP_009394682.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=267

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P++S F+D L+RT+LA +IN+R T+TVL + NGA SS +G+ P  V+K +
Sbjct  19   HNITTILAKFPDFSTFSDLLTRTQLASDINSRKTITVLAVNNGAISSASGQ-PTDVLKKI  77

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHV+LDY+DGDK H +   + + TTL+Q++G A G  GF+N+TD   G+V FGSA+PG
Sbjct  78   LSLHVVLDYYDGDKFHKLRNRSAILTTLFQSSGVASGRSGFLNVTDMDNGQVSFGSAVPG  137

Query  496  SPLASQY  516
            S L + +
Sbjct  138  SSLDANF  144



>ref|XP_002316776.2| hypothetical protein POPTR_0011s09590g [Populus trichocarpa]
 gb|EEE97388.2| hypothetical protein POPTR_0011s09590g [Populus trichocarpa]
Length=408

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 84/116 (72%), Gaps = 1/116 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNIT IL  HP +S FN YL+ T LA EIN+R T+TV  + N A S +  KHP ++ +KN
Sbjct  24   HNITHILGKHPSFSTFNHYLTLTHLAGEINSRNTITVCAVDNAAMSELLSKHPSIATIKN  83

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFG  480
            +L LHVLLDY+   KLH I +GT L+ T++Q TG+APG+ GFVNITD KGGKV FG
Sbjct  84   ILSLHVLLDYFGTKKLHQIREGTALAATMFQATGSAPGSTGFVNITDVKGGKVAFG  139



>ref|XP_010536730.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Tarenaya 
hassleriana]
Length=427

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S FN YLS T LA+EIN RTT+TV  + N A S I  K + +S VKN
Sbjct  30   HNVTRLLAKHPSFSTFNHYLSETHLANEINRRTTITVCAVDNAAMSDIISKGYTISTVKN  89

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LH+LLDY+   KLH I  G+ +   L+Q TG+APG  GFVNITD +GGKVGFG    
Sbjct  90   ILSLHILLDYFGAKKLHQIRDGSGVCXXLFQATGSAPGTSGFVNITDLRGGKVGFGP--D  147

Query  493  GSPLASQYTKSV  528
            G  L++ + KS+
Sbjct  148  GGDLSAFFVKSL  159



>ref|XP_004248342.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Solanum 
lycopersicum]
Length=415

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  +P++S FN YL+ T LA EIN+R T+TV  + N     +  KH LS+  +K
Sbjct  28   HNITHILAKYPQFSTFNHYLTETHLAAEINSRETITVCAVDNAGMEELLSKH-LSIYTIK  86

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NV+ LHVLLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGFG A 
Sbjct  87   NVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFGPAE  146

Query  490  PGSPLASQYTKSV  528
                L + + KSV
Sbjct  147  NHGNLPATFVKSV  159



>emb|CDX68507.1| BnaC01g25850D [Brassica napus]
Length=401

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL  +P++S FN YLS T LADEIN R T+TVL + N A +SI  K + L  ++N
Sbjct  25   HNITKILAKNPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIRN  84

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  85   ILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQDD  144

Query  493  GSPLASQYTKSV  528
             S L ++Y KS+
Sbjct  145  DSQLTARYIKSI  156



>gb|EYU27439.1| hypothetical protein MIMGU_mgv1a007268mg [Erythranthe guttata]
Length=413

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT ILE +PE+S F+ YL+ T+LA EIN R T+TV  + N   S +  KH LS+  ++
Sbjct  31   HNITHILEKNPEFSTFSHYLTVTQLAPEINRRETITVCAVDNAGMSDLLAKH-LSIGGIR  89

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVLLDY+D  KLH I+ GT L+ T+YQ TG A G+ GFVNITD KGGKVGF    
Sbjct  90   NVLSLHVLLDYFDAKKLHQITDGTALAATMYQATGEATGSAGFVNITDLKGGKVGFSPQD  149

Query  490  PGSPLASQYTKSV  528
             G  +++ + K+V
Sbjct  150  SGGGVSATFVKTV  162



>ref|XP_006447810.1| hypothetical protein CICLE_v10015469mg [Citrus clementina]
 gb|ESR61050.1| hypothetical protein CICLE_v10015469mg [Citrus clementina]
Length=403

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TVL L N A SS+  K  LSV  ++
Sbjct  29   HNITRILAKHPEFSTFNHYLTVTHLAAEINRRQTITVLALDNSAMSSLLSKQ-LSVYTLR  87

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVL DY+   KLH ++ GT L+++++Q TG+APG+ G+VNITD KGGKVGFG+  
Sbjct  88   NVLSLHVLTDYFGSKKLHQVTNGTALTSSMFQATGSAPGSSGYVNITDLKGGKVGFGAED  147

Query  490  PGSPLASQYTKSV  528
                L + Y KSV
Sbjct  148  NDGKLDATYVKSV  160



>ref|XP_006469451.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Citrus 
sinensis]
Length=403

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TVL L N A SS+  K  LSV  ++
Sbjct  29   HNITRILAKHPEFSTFNHYLTVTHLAAEINRRQTITVLALDNSAMSSLLSKQ-LSVYTLR  87

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVL DY+   KLH ++ GT L+++++Q TG+APG+ G+VNITD KGGKVGFG+  
Sbjct  88   NVLSLHVLTDYFGSKKLHQVTNGTALTSSMFQATGSAPGSSGYVNITDLKGGKVGFGAED  147

Query  490  PGSPLASQYTKSV  528
                L + Y KSV
Sbjct  148  NDGKLDATYVKSV  160



>gb|EPS66997.1| hypothetical protein M569_07779, partial [Genlisea aurea]
Length=401

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL+ +PE S FN YL+ T+LA EIN R T+TV  + N   S +  KH  +  +KN
Sbjct  22   HNITTILDKYPELSTFNHYLTVTQLAPEINHRETITVCAVDNAGMSDLLSKHLTIGAIKN  81

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVLLDY+D  KLH I+ GT LS T++Q TG+A G+ GFVNITD  GGKVGF     
Sbjct  82   VLALHVLLDYFDAKKLHQITDGTALSATMFQATGSATGSSGFVNITDLAGGKVGFSPQDN  141

Query  493  GSPLASQYTKSV  528
            G  +A+ + KSV
Sbjct  142  GGDVAATFVKSV  153



>gb|KDO38095.1| hypothetical protein CISIN_1g013841mg [Citrus sinensis]
Length=435

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TVL L N A SS+  K  LSV  ++
Sbjct  61   HNITRILAKHPEFSTFNHYLTVTHLAAEINRRQTITVLALDNSAMSSLLSKQ-LSVYTLR  119

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVL DY+   KLH I+ GT L+++++Q TG+APG+ G+VN+TD KGGKVGFG+  
Sbjct  120  NVLSLHVLTDYFGSKKLHQITNGTALTSSMFQATGSAPGSSGYVNVTDLKGGKVGFGAED  179

Query  490  PGSPLASQYTKSV  528
                L + Y KSV
Sbjct  180  NDGKLDATYVKSV  192



>emb|CDX87001.1| BnaC03g52710D [Brassica napus]
Length=402

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   P++S FN YLS T LADEIN R T+TVL + N A +SI  K + L  ++N
Sbjct  24   HNITKILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIRN  83

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  84   ILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQED  143

Query  493  GSPLASQYTKSV  528
             S L + Y KS+
Sbjct  144  DSRLTAHYVKSI  155



>ref|XP_006401420.1| hypothetical protein EUTSA_v10013639mg [Eutrema salsugineum]
 gb|ESQ42873.1| hypothetical protein EUTSA_v10013639mg [Eutrema salsugineum]
Length=424

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S FN +L++T LADEIN RTTVTV  + N A S++T K + ++ +KN
Sbjct  27   HNVTRLLANHPSFSSFNHFLTQTHLADEINRRTTVTVCAVDNAAMSALTSKGYTITTLKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I  G+ L+ TL+Q TG A G  GFVNITD +GGKVGFG    
Sbjct  87   ILSLHVLLDYFGAKKLHQIRDGSALAATLFQATGAAQGMTGFVNITDLRGGKVGFGP--D  144

Query  493  GSPLASQYTKSV  528
            G  L+S + KS+
Sbjct  145  GGDLSSFFVKSI  156



>ref|XP_010542030.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
Length=397

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   P++S FN YL+ T LAD+IN R T+TVL + N   SSI  K + L  ++N
Sbjct  28   HNITRILAKDPDFSTFNHYLTATHLADDINRRQTITVLAVDNAGMSSILSKGYSLYTIRN  87

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ GTT ++T++Q TG+APG  G+VNITD KGGKV FG    
Sbjct  88   ILSLHVLVDYFGAKKLHQITHGTTSTSTMFQATGSAPGTSGYVNITDLKGGKVAFGVQDD  147

Query  493  GSPLASQYTKSV  528
             + L S Y KSV
Sbjct  148  DNKLTSHYVKSV  159



>gb|KDP39270.1| hypothetical protein JCGZ_01027 [Jatropha curcas]
Length=404

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HN+T +L  HP  S FN YL+ T LA EIN RTT+TV  + N A S +  KHP +  +KN
Sbjct  23   HNVTRLLAKHPSLSTFNHYLTITHLAGEINRRTTITVCAVDNAAMSELLSKHPSIYTIKN  82

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKV FG    
Sbjct  83   ILSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDIKGGKVAFGPEDN  142

Query  493  GSPLASQYTKSV  528
               L   + KSV
Sbjct  143  DGKLGVYFVKSV  154



>ref|XP_009615606.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=416

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  +P++S FN YL+ T LA EIN R T+TV  + N   + +  KH LS+  +K
Sbjct  28   HNITKILAKYPQFSTFNHYLTETHLAAEINNRETITVCAVDNAGMAELLSKH-LSIYTIK  86

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NV+ LHVLLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGFG A 
Sbjct  87   NVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFGPAE  146

Query  490  PGSPLASQYTKSV  528
                L + + K+V
Sbjct  147  NHGNLPATFVKAV  159



>ref|XP_006357643.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Solanum 
tuberosum]
Length=409

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TV  + N A +++  KH P   +KN
Sbjct  26   HNITKILAKHPEFSTFNHYLTVTHLAAEINRRQTITVCAIDNAAMNALLEKHLPTYTLKN  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHV  DY+   KLH I+KG+TL+ T++Q TG APG  G++NIT+ KGGKVGF +   
Sbjct  86   VLSLHVFADYFGAKKLHQITKGSTLTATMFQATGEAPGTSGYINITNMKGGKVGFANEDN  145

Query  493  GSPLASQYTKSV  528
                A+ + KSV
Sbjct  146  DGHFAATFVKSV  157



>gb|KFK27162.1| hypothetical protein AALP_AA8G343200 [Arabis alpina]
Length=425

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 91/132 (69%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S FN +L++T LADEIN RTT+TV  + N   S +T K + +S +KN
Sbjct  29   HNVTRLLANHPSFSSFNHFLTQTHLADEINRRTTITVCAVDNSVMSFLTSKGYSISTLKN  88

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            ++ LHVLLDY+   KLH I  G+ L+ TL+Q TG APG  GFVNITD +GGKVGFG    
Sbjct  89   IISLHVLLDYFGTKKLHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGFGP--D  146

Query  493  GSPLASQYTKSV  528
            G  L+S + KS+
Sbjct  147  GGDLSSFFVKSI  158



>ref|XP_009151619.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Brassica 
rapa]
 emb|CDX83056.1| BnaA01g20560D [Brassica napus]
Length=401

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   P++S FN YLS T LADEIN R T+TVL + N A +SI  K + L  ++N
Sbjct  25   HNITKILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYSLYTIRN  84

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G+VNITD KGGKV FG    
Sbjct  85   ILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQDD  144

Query  493  GSPLASQYTKSV  528
             S L ++Y KS+
Sbjct  145  DSQLTARYIKSI  156



>ref|XP_011097758.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=416

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL   PE+S FN YL+ T+LA EIN R T+TV  + N   + +  KH  L  +KN
Sbjct  28   HNITRILAKFPEFSTFNHYLTVTQLAPEINRRETITVCAVDNAGMADLLSKHLTLGALKN  87

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVLLDY+D  KLH+I+ GT L+ T++Q TG+A G+ GFVNITD KGGKVGF     
Sbjct  88   VLSLHVLLDYFDAKKLHEITDGTALAATMFQATGSATGSSGFVNITDLKGGKVGFSPEDN  147

Query  493  GSPLASQYTKSV  528
            G  +++ + K+V
Sbjct  148  GGVVSATFVKTV  159



>emb|CDP13717.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 94/133 (71%), Gaps = 4/133 (3%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL   PE+S FN +L+ T LA++IN R T+TV  + N   + + GKH LS+  +K
Sbjct  30   HNITKILAEFPEFSTFNHFLTTTHLANDINNRETITVCAVDNAGMADLLGKH-LSIFALK  88

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVLLDY+   KLHDI+ GT L+ T+YQ TG+APG+ GFVNITD KGGKVGFG+  
Sbjct  89   NVLSLHVLLDYFGAKKLHDITNGTALAATMYQATGSAPGSSGFVNITDLKGGKVGFGAVD  148

Query  490  PGSPLASQYTKSV  528
             G  + + + KSV
Sbjct  149  NGG-IDATFVKSV  160



>ref|XP_010323900.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Solanum 
lycopersicum]
Length=409

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TV  + N A + +  KH P   +KN
Sbjct  26   HNITKILAKHPEFSTFNHYLTVTHLAAEINRRQTITVCAIDNAAMNVLLEKHLPTYTLKN  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHV  DY+   KLH I+KG+TL+ T++Q TG APG  G++NIT+ KGGKVGF +   
Sbjct  86   VLSLHVFADYFGAKKLHQITKGSTLTATMFQATGEAPGTSGYINITNMKGGKVGFANEDN  145

Query  493  GSPLASQYTKSV  528
                A+ + KSV
Sbjct  146  DGHFAATFVKSV  157



>ref|XP_007142534.1| hypothetical protein PHAVU_008G288800g [Phaseolus vulgaris]
 gb|ESW14528.1| hypothetical protein PHAVU_008G288800g [Phaseolus vulgaris]
Length=403

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT ILE HP +S FN YLS T LADEIN R T+TVL + NGA +S+  KH  L  +KN
Sbjct  23   HNITRILEKHPGFSTFNHYLSATHLADEINRRQTITVLAIDNGAMNSLLDKHLSLPTLKN  82

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+  TTL ++++Q TG A G  G+VNIT+ KGGKVGF +   
Sbjct  83   VLSLHVLVDYFGAKKLHQINNSTTLVSSMFQATGAAAGTSGYVNITNLKGGKVGFAAEDN  142

Query  493  GSPLASQYTKSV  528
               L S Y KSV
Sbjct  143  DGSLHSFYVKSV  154



>ref|XP_003618047.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
 gb|AET01006.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=421

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HP +S FN YL+ T LADEIN R T+T+L + N A SS+  KH  ++ +KN
Sbjct  34   HNITRILAKHPGFSTFNHYLTITHLADEINRRQTITILAIDNAAMSSLLDKHLSITTLKN  93

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GTTL ++++Q TG+A G  G+VNIT+ KGGKVGFG A  
Sbjct  94   VLSLHVLVDYFGAKKLHQITDGTTLVSSMFQATGSAAGTAGYVNITNLKGGKVGFG-AED  152

Query  493  GSPLASQYTKSV  528
               L S Y KSV
Sbjct  153  NDGLHSYYVKSV  164



>emb|CDP18905.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 81/117 (69%), Gaps = 1/117 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LADEIN R T+TV V+ N   S +  KH  L  +KN
Sbjct  28   HNITRILAKHPEFSTFNHYLTTTHLADEINRRRTITVCVVDNAGMSDLLAKHLSLPSLKN  87

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGS  483
            VL LHV  DY+   KLH ISKG+T ++TL+Q TG A G  G+VNITD KGGKVGF +
Sbjct  88   VLSLHVFADYFGARKLHQISKGSTTTSTLFQATGEAAGTAGYVNITDMKGGKVGFAT  144



>ref|XP_004491619.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cicer 
arietinum]
Length=413

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HP++S FN YL+ T LADEIN R T+T+L + N A SS+  KH  +S +KN
Sbjct  32   HNITRILAKHPDFSTFNHYLTVTHLADEINRRQTITILAIDNAAMSSLLDKHLSVSTLKN  91

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GTTL ++++Q TG+A G  G+VN+T+ KGGKVGF +A  
Sbjct  92   VLSLHVLVDYFGAKKLHQITNGTTLVSSMFQATGSAAGTAGYVNVTNLKGGKVGF-AAED  150

Query  493  GSPLASQYTKSV  528
               L S Y KSV
Sbjct  151  NDGLHSFYVKSV  162



>gb|KHG10798.1| Fasciclin-like arabinogalactan protein 2 [Gossypium arboreum]
Length=417

 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT +L  +P++S FN YL+ T LA +IN R T+TVL L N A SS+  KH  L  +KN
Sbjct  59   HNITRLLAKYPQFSTFNHYLTTTHLASQINRRQTITVLALDNTAMSSLLAKHYSLYTLKN  118

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH ISKG+TL++T++Q TG APG  G+VNIT+ KGGKVGFG+   
Sbjct  119  ILSLHVLVDYFGSKKLHRISKGSTLTSTMFQATGAAPGTSGYVNITNLKGGKVGFGAEDN  178

Query  493  GSPLASQYTKSV  528
               L + + KS+
Sbjct  179  EGKLDATFVKSI  190



>ref|XP_007020499.1| Fasciclin-like arabinogalactan protein 1 [Theobroma cacao]
 gb|EOY12024.1| Fasciclin-like arabinogalactan protein 1 [Theobroma cacao]
Length=411

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HN+T +L  HP  S FN YL+ T LA EIN RTT+TVL L N A SS+   +P +  +KN
Sbjct  26   HNVTRLLAKHPSLSTFNHYLTLTHLASEINRRTTITVLALDNAAMSSLLATNPSIYTLKN  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I  GT L+ T++Q TG APG  GFVNITD KGGKVGFG+   
Sbjct  86   ILSLHVLLDYFGTKKLHQIRNGTALAATMFQATGVAPGVAGFVNITDFKGGKVGFGAEDN  145

Query  493  GSPLASQYTKSV  528
            G  L S + KSV
Sbjct  146  GGKLDSFFVKSV  157



>ref|XP_009767783.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=416

 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  +P++S FN YL+ T LA EIN R T+TV  + N   + +  KH  +  +KN
Sbjct  28   HNITKILAKYPQFSTFNHYLTETHLAAEINNRETITVCAVDNAGMAELLSKHLSIYTIKN  87

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            V+ LHVLLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKV FG A  
Sbjct  88   VISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVAFGPAEN  147

Query  493  GSPLASQYTKSV  528
               L + + K+V
Sbjct  148  HGNLPATFVKAV  159



>ref|XP_006346133.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Solanum 
tuberosum]
Length=409

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  H ++S FN YL+ T LA EIN R T+TV V+ N   S +  KH  ++ +KN
Sbjct  26   HNITHILANHTQFSTFNHYLTTTHLATEINRRQTITVCVVDNAGMSDLLSKHLSINTIKN  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL  HVLLDY+D  KLH I+ GT L+ T++Q TG+A G+ GFVNITD KGGKVGF  A  
Sbjct  86   VLSFHVLLDYFDAKKLHQITNGTALAATIFQATGSATGSSGFVNITDLKGGKVGFSPADY  145

Query  493  GSPLASQYTKSV  528
              P  +++ KS+
Sbjct  146  NGPPPAKFVKSI  157



>gb|AAK20858.1|AF333971_1 fasciclin-like arabinogalactan-protein 2 [Arabidopsis thaliana]
Length=403

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSI-TGKHPLSVVKN  312
            HNIT IL   P++S FN YLS T LADEIN R T+TVL + N A SSI +  + L  ++N
Sbjct  27   HNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYSLYQIRN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G++NITD KGGKV FG    
Sbjct  87   ILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVAFGVQDD  146

Query  493  GSPLASQYTKSV  528
             S L + Y KSV
Sbjct  147  DSKLTAHYVKSV  158



>ref|XP_009606546.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana 
tomentosiformis]
Length=407

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TV  + N A + +  KH P   +KN
Sbjct  26   HNITKILAKHPEFSTFNHYLTVTHLAAEINRRQTITVCAIDNAAMNELLEKHLPTYTLKN  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHV  DY+   KLH I+KG+TL+ T++Q TG APG  G++NIT+ KGGKVGF +   
Sbjct  86   VLSLHVFADYFGAKKLHQITKGSTLTATMFQATGEAPGTSGYINITNMKGGKVGFANEDN  145

Query  493  GSPLASQYTKSV  528
                A+ + K+V
Sbjct  146  DGHFAATFVKTV  157



>gb|AAM65777.1| putative pollen surface protein [Arabidopsis thaliana]
Length=403

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSI-TGKHPLSVVKN  312
            HNIT IL   P++S FN YLS T LADEIN R T+TVL + N A SSI +  + L  ++N
Sbjct  27   HNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYSLYQIRN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G++NITD KGGKV FG    
Sbjct  87   ILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVAFGVQDD  146

Query  493  GSPLASQYTKSV  528
             S L + Y KSV
Sbjct  147  DSKLTAHYVKSV  158



>ref|NP_193009.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana]
 sp|Q9SU13.1|FLA2_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB40990.1| putative pollen surface protein [Arabidopsis thaliana]
 emb|CAB78315.1| putative pollen surface protein [Arabidopsis thaliana]
 gb|AAL31207.1| AT4g12730/T20K18_80 [Arabidopsis thaliana]
 gb|AAM98329.1| At4g12730/T20K18_80 [Arabidopsis thaliana]
 dbj|BAF02161.1| fasciclin-like arabinogalactan protein FLA2 [Arabidopsis thaliana]
 gb|AEE83171.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana]
Length=403

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSI-TGKHPLSVVKN  312
            HNIT IL   P++S FN YLS T LADEIN R T+TVL + N A SSI +  + L  ++N
Sbjct  27   HNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYSLYQIRN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ G+T + +++Q+TG+A G  G++NITD KGGKV FG    
Sbjct  87   ILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVAFGVQDD  146

Query  493  GSPLASQYTKSV  528
             S L + Y KSV
Sbjct  147  DSKLTAHYVKSV  158



>ref|XP_008229928.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Prunus mume]
Length=394

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL  HPE S FN YL+ T LA EIN R T+TVL + N A SS+  K  P+  +KN
Sbjct  28   HNITRILAKHPELSSFNHYLTLTHLATEINRRQTITVLAIDNAAMSSLLSKGLPVYTIKN  87

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GTTL+++++Q TG A G  G+VNIT+ KGGKVGFG+   
Sbjct  88   VLSLHVLVDYFGAKKLHQITHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGFGAQDN  147

Query  493  GSPLASQYTKSV  528
               L S Y KSV
Sbjct  148  DGKLNSFYVKSV  159



>ref|XP_010557720.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
 ref|XP_010557721.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
Length=409

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL   P +S FN YLS T LAD+IN R T+TVL + N   SSI  K + L  ++N
Sbjct  27   HNITRILAKDPSFSTFNHYLSATHLADDINRRQTITVLAVDNAGMSSILSKGYSLYTIRN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH I+ GTT ++T++Q TG+A G  G+VNITD KGGKV FG    
Sbjct  87   ILSLHVLVDYFGAKKLHQITDGTTSTSTMFQATGSATGTSGYVNITDLKGGKVAFGVQDD  146

Query  493  GSPLASQYTKSV  528
             S L + Y KSV
Sbjct  147  DSKLTAHYIKSV  158



>gb|AIY35291.1| fasciclin-like arabinogalactan 11 [Gossypium hirsutum]
Length=417

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 100/156 (64%), Gaps = 2/156 (1%)
 Frame = +1

Query  64   MGSVRHLLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtrttvt  243
            MG  +H++L   +   +    +A HN+T +L  HP  S FN YL+ T LA EIN RTT+T
Sbjct  2    MGQRQHVVLLIFSAFLLFQTSNA-HNVTRLLAKHPSLSTFNHYLTLTHLAPEINRRTTIT  60

Query  244  vlvltNGAFSSITGKHP-LSVVKNVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNA  420
            VL L N A SS+  K+P +  +KN+L LHVLLDY+   KLH I  GT L+ T++Q TG A
Sbjct  61   VLALDNAAMSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVA  120

Query  421  PGNLGFVNITDQKGGKVGFGSALPGSPLASQYTKSV  528
             G  GFVNITD KGGKVGFG+   G  L S + KSV
Sbjct  121  TGVSGFVNITDFKGGKVGFGAEDNGGSLNSFFVKSV  156



>gb|ABV27482.1| fasciclin-like arabinogalactan protein 11 [Gossypium hirsutum]
Length=417

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 100/156 (64%), Gaps = 2/156 (1%)
 Frame = +1

Query  64   MGSVRHLLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtrttvt  243
            MG  +H++L   +   +    +A HN+T +L  HP  S FN YL+ T LA EIN RTT+T
Sbjct  2    MGQRQHVVLLIFSAFLLFQTSNA-HNVTRLLAKHPSLSTFNHYLTLTHLAPEINRRTTIT  60

Query  244  vlvltNGAFSSITGKHP-LSVVKNVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNA  420
            VL L N A SS+  K+P +  +KN+L LHVLLDY+   KLH I  GT L+ T++Q TG A
Sbjct  61   VLALDNAAMSSLLDKNPSIYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVA  120

Query  421  PGNLGFVNITDQKGGKVGFGSALPGSPLASQYTKSV  528
             G  GFVNITD KGGKVGFG+   G  L S + KSV
Sbjct  121  TGVSGFVNITDFKGGKVGFGAEDNGGSLNSFFVKSV  156



>ref|XP_010252769.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nelumbo 
nucifera]
Length=412

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT+IL  +P++S FN +L+ T LA EIN R T+T+  + NG  S +  K  LS+  +K
Sbjct  26   HNITSILAKNPDFSIFNQFLTLTHLAVEINQRETITICTVDNGGMSDLLSKQ-LSIYTIK  84

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVLLDY+   KLH I+ GT L+ T++Q TG+APG+ GFVNITD KGGKVGFG+  
Sbjct  85   NVLSLHVLLDYFGAQKLHQITNGTALTATMFQATGSAPGSSGFVNITDLKGGKVGFGAES  144

Query  490  PGSPLASQYTKSV  528
                L + + KSV
Sbjct  145  NHGNLDATFVKSV  157



>ref|XP_011100491.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Sesamum 
indicum]
Length=409

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 88/135 (65%), Gaps = 5/135 (4%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YLS T LA EIN R T+TV  + N A + +  KH  L  +KN
Sbjct  31   HNITRILAKHPEFSTFNHYLSTTHLAAEINRRRTITVCAVDNAAMNELLAKHYSLPTIKN  90

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LH+  DY+   KLH I+KG+T +++L+Q TG A G  G+VNITD KGGKVGF     
Sbjct  91   ILSLHIFADYFGAKKLHQITKGSTTTSSLFQATGEAAGTSGYVNITDIKGGKVGFSPVDN  150

Query  493  ---GSPLASQYTKSV  528
               G P+A+ Y KS+
Sbjct  151  DGGGRPMAT-YVKSI  164



>ref|XP_011011127.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Populus 
euphratica]
Length=397

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  HP++S FN YL+ T LA EIN R T+TVL L N A SS+  K  LSV  ++
Sbjct  26   HNITRILAKHPQFSTFNHYLTVTHLAAEINRRQTITVLALDNAAMSSLISKQ-LSVYTLR  84

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVL+DY+   KLH I+ GT L+ T++Q TG+APG  G+VNITD KGGKV FG+  
Sbjct  85   NVLSLHVLVDYFGTRKLHQITNGTELTATMFQATGSAPGASGYVNITDLKGGKVAFGAED  144

Query  490  PGSPLASQYTKSV  528
                L + Y KS+
Sbjct  145  NDGKLDAVYVKSL  157



>gb|KJB42730.1| hypothetical protein B456_007G165800 [Gossypium raimondii]
Length=385

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT +L  +P++S FN YL+ T LA +IN R T+TVL L N A SS+  KH  L  +KN
Sbjct  27   HNITRLLAKYPQFSTFNHYLTTTHLASQINRRQTITVLALDNTAMSSLLAKHYSLYTLKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVL+DY+   KLH ISK +TL++T++Q TG APG  G+VNIT+ KGGKVGFG+   
Sbjct  87   ILSLHVLVDYFGSKKLHRISKRSTLTSTMFQATGAAPGTSGYVNITNLKGGKVGFGAEDN  146

Query  493  GSPLASQYTKSV  528
               L + + KS+
Sbjct  147  EGKLDATFVKSI  158



>emb|CBI39739.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 100/146 (68%), Gaps = 3/146 (2%)
 Frame = +1

Query  67   GSVRHLLLFTaaviavscavsaaHNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtv  246
            GS R L+L  +A++ + C  + AHNIT+IL  +PE+S FN YL+ T LA+EIN R T+TV
Sbjct  63   GSARTLMLSLSALLLLLCCATEAHNITSILAKNPEFSTFNHYLTVTHLANEINLRETITV  122

Query  247  lvltNGAFSSITGKHPLSV--VKNVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNA  420
              + N   S +  K  LS+  +KNVL LH+LLDY+   KLH I+ GT L+ T+YQ TG+A
Sbjct  123  CAVDNPGMSDLLAKG-LSIYAIKNVLSLHILLDYFGAKKLHQITNGTALAATMYQATGSA  181

Query  421  PGNLGFVNITDQKGGKVGFGSALPGS  498
            PG+ GFVNITD KGGKVGF    P +
Sbjct  182  PGSSGFVNITDLKGGKVGFDQQDPAT  207



>ref|XP_008380005.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Malus domestica]
Length=448

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HNIT IL+ HP  + FN YLS T LA EIN R T+TVL L N A SS+  K  P+  +KN
Sbjct  87   HNITRILDKHPSLTTFNHYLSLTHLATEINRRQTITVLALDNAAMSSLISKGLPIYTIKN  146

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GTTL+++++Q TG A G  G+VNIT+ KGGKVGFG+   
Sbjct  147  VLSLHVLVDYFGSKKLHQITHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGFGAEDN  206

Query  493  GSPLASQYTKSV  528
               L S Y KSV
Sbjct  207  DGKLNSFYVKSV  218



>dbj|BAE71278.1| putative fasciclin-like arabinogalactan protein FLA2 [Trifolium 
pratense]
Length=418

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HP +S FN YL+ T LADEIN R T+T+L + N A SS+  KH  +S +KN
Sbjct  33   HNITRILAKHPGFSTFNHYLTITHLADEINRRQTITILAIDNAAMSSLLDKHLSVSTLKN  92

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GTTL ++++Q TG+A G  G+VN+T+ KGGKVGF +A  
Sbjct  93   VLSLHVLVDYFGAKKLHQITNGTTLVSSMFQATGSAAGTAGYVNVTNLKGGKVGF-AAED  151

Query  493  GSPLASQYTKSV  528
               L S Y KS+
Sbjct  152  NDGLHSFYVKSI  163



>ref|XP_008342240.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Malus domestica]
Length=391

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 92/133 (69%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL+ HP  S FN YLS T LA EIN R T+TVL L N A SS+  K  LSV  +K
Sbjct  28   HNITRILDQHPSLSTFNHYLSLTHLATEINRRQTITVLTLDNAAMSSLISKG-LSVYTIK  86

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVL+DY+   KLH ++ GTTL+++++Q TG A G  G+VNIT+ KGGKVGFG+  
Sbjct  87   NVLSLHVLVDYFGAKKLHQLTHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGFGAED  146

Query  490  PGSPLASQYTKSV  528
             G  L S Y KSV
Sbjct  147  NGGTLNSFYVKSV  159



>ref|XP_009799147.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana 
sylvestris]
Length=407

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 86/132 (65%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TV  + N A + +  KH P   +KN
Sbjct  26   HNITKILAKHPEFSTFNHYLTVTHLAAEINRRQTITVCAIDNAAMNELLEKHLPTYTLKN  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHV  DY+   KLH I+KG+TL+ T++Q TG APG  G++NIT+ KGGKVGF +   
Sbjct  86   VLSLHVFADYFGAKKLHQITKGSTLTATMFQATGEAPGTSGYINITNMKGGKVGFANEDN  145

Query  493  GSPLASQYTKSV  528
                 + + K+V
Sbjct  146  DGHFTATFVKTV  157



>emb|CDY36762.1| BnaA03g11240D [Brassica napus]
Length=196

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP  S FN YL++T LADEIN R T+TV  + +GA  ++T K + +S +KN
Sbjct  23   HNVTLLLANHPSLSSFNHYLTQTHLADEINQRNTITVCAVDDGAMYNLTSKGYTISTLKN  82

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+D  KLH +  G+ L+ TL+Q TG AP N GFV IT+++GG + FG    
Sbjct  83   ILSLHVLLDYFDARKLHQLPDGSALAATLFQATGAAPENTGFVKITNKRGGNIRFGLNGA  142

Query  493  GSPLASQYTKSV  528
            G  ++S + KS+
Sbjct  143  GD-VSSSFIKSI  153



>gb|KDP29933.1| hypothetical protein JCGZ_18502 [Jatropha curcas]
Length=408

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  HP +S FN YL+ T LA EIN R T+TVL L N A SS+  K  LSV  ++
Sbjct  27   HNITRILAKHPAFSTFNHYLTVTHLAAEINRRQTITVLALDNAAMSSLLAKQ-LSVYTLR  85

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVL+DY+   KLH I+ GTTL++T++Q TG+A G  G+VNITD KGGKV FGS  
Sbjct  86   NVLSLHVLVDYFGAKKLHQITDGTTLTSTMFQATGSATGTSGYVNITDLKGGKVAFGSED  145

Query  490  PGSPLASQYTKSV  528
                L + Y KS+
Sbjct  146  NNGKLDAVYVKSL  158



>ref|XP_007215592.1| hypothetical protein PRUPE_ppa007675mg [Prunus persica]
 gb|EMJ16791.1| hypothetical protein PRUPE_ppa007675mg [Prunus persica]
Length=359

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  HPE S FN YL+ T LA EIN R T+TVL + N A SS+  K  LSV  +K
Sbjct  28   HNITRILAKHPELSSFNHYLTLTHLATEINRRQTITVLAIDNAAMSSLLSKG-LSVYTIK  86

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVL+DY+   KLH I+ GTTL+++++Q TG A G  G+VNIT+ KGGKVGFG+  
Sbjct  87   NVLSLHVLVDYFGAKKLHQITHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGFGAQD  146

Query  490  PGSPLASQYTKSV  528
                L S Y KSV
Sbjct  147  NDGKLNSFYVKSV  159



>emb|CDY20747.1| BnaA02g08870D [Brassica napus]
Length=430

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S FN  L++T LADEIN RTT+TV  + N A S++T K + +S +KN
Sbjct  28   HNVTRLLANHPSFSSFNHLLTKTHLADEINRRTTITVCAVNNAAMSALTSKGYTISTLKN  87

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I  G+ L+ TL+Q TG APG  GFVNIT  +GGKVGF     
Sbjct  88   ILSLHVLLDYFGAKKLHQIGGGSALAATLFQATGAAPGTTGFVNITMLRGGKVGFRP--D  145

Query  493  GSPLASQYTKSV  528
            G  ++S + KS+
Sbjct  146  GGDMSSFFVKSL  157



>ref|XP_009375067.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Pyrus x 
bretschneideri]
Length=411

 Score =   105 bits (263),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 89/133 (67%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT +L  HPE+S FN YL+ T LA +IN RTT+TV  + N A S +  KH LS+  +K
Sbjct  26   HNITRLLAKHPEFSTFNHYLTLTHLAADINDRTTITVCAVDNSAMSVLLSKH-LSIYSIK  84

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            N+L LHVLLDY+   KLH I+ GT L+ T++Q TG+A G+ GFVNITD KGGKVGF    
Sbjct  85   NILSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAAGSSGFVNITDLKGGKVGFSPED  144

Query  490  PGSPLASQYTKSV  528
                  S + KSV
Sbjct  145  NDGNFPSHFVKSV  157



>ref|XP_010692313.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Beta vulgaris 
subsp. vulgaris]
Length=408

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 95/131 (73%), Gaps = 0/131 (0%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT IL   P  SQFN YL++TKL DEIN+R T+TVL L N A SS+T  H LSV+KN+
Sbjct  21   HNITEILSSDPNLSQFNSYLTQTKLDDEINSRQTITVLALDNSAMSSLTSNHSLSVIKNL  80

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHVLLDY+D  KLH +  GT  +TTLYQTTG+A  + G VNITD  GG VGFGS  PG
Sbjct  81   LSLHVLLDYYDPKKLHSLENGTVKTTTLYQTTGSATSDEGSVNITDLHGGSVGFGSGSPG  140

Query  496  SPLASQYTKSV  528
            S L S YTKSV
Sbjct  141  SKLDSTYTKSV  151



>ref|XP_002267946.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Vitis vinifera]
Length=407

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  +PE+S F+ YL+ T LA EIN R T+TVL ++N   + +  KH  + V+KN
Sbjct  27   HNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMADLLSKHLSVYVIKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GT  S TL+Q+TG+APG  GFVNITD K GKVGFG+   
Sbjct  87   VLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITDLKHGKVGFGAQDS  146

Query  493  GSPLASQYTKSV  528
            G  L + + KSV
Sbjct  147  GH-LNAYFVKSV  157



>ref|XP_002320524.2| hypothetical protein POPTR_0014s16610g [Populus trichocarpa]
 gb|EEE98839.2| hypothetical protein POPTR_0014s16610g [Populus trichocarpa]
Length=397

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 90/133 (68%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  HP++S FN YL+ T LA EIN R T+TVL L N A SS+  K  LSV  ++
Sbjct  26   HNITRILAKHPQFSTFNHYLTVTHLAAEINRRQTITVLALDNAAMSSLISKQ-LSVYTLR  84

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVL+DY+   KLH I+ GT L+ T++Q TG+APG  G+VNITD  GGKV FG+  
Sbjct  85   NVLSLHVLVDYFGTRKLHQITNGTELTATMFQATGSAPGASGYVNITDLNGGKVAFGAED  144

Query  490  PGSPLASQYTKSV  528
                L + Y KS+
Sbjct  145  NDGKLNAVYVKSL  157



>ref|XP_009351261.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Pyrus x 
bretschneideri]
Length=391

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL+ HP  S FN YL  T LA EIN R T+TVL L N A SS+  K  LSV  +K
Sbjct  28   HNITRILDQHPSLSTFNHYLGLTHLATEINRRQTITVLALDNAAMSSLISKG-LSVYTIK  86

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVL+DY+   KLH ++ GTTL+++++Q TG A G  G+VNIT+ KGGKVGFG+  
Sbjct  87   NVLSLHVLVDYFGAKKLHQLTHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGFGAED  146

Query  490  PGSPLASQYTKSV  528
             G  L S Y KSV
Sbjct  147  NGGTLNSFYVKSV  159



>emb|CAN61077.1| hypothetical protein VITISV_012919 [Vitis vinifera]
Length=407

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  +PE+S F+ YL+ T LA EIN R T+TVL ++N   + +  KH  + V+KN
Sbjct  27   HNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMADLLSKHLSVYVIKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GT  S TL+Q+TG+APG  GFVNITD K GKVGFG+   
Sbjct  87   VLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITDLKHGKVGFGAQDS  146

Query  493  GSPLASQYTKSV  528
            G  L + + KSV
Sbjct  147  GH-LNAYFVKSV  157



>gb|AEI98736.1| fasciclin-like arabinogalactan 2 [Pisum sativum]
Length=433

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT +L  HP +S FN YLS T LA+EIN R T+TVL L N A SS+  KH  L  +KN
Sbjct  25   HNITRMLAAHPGFSTFNHYLSVTHLAEEINRRQTITVLALDNAAMSSLLDKHLSLPTIKN  84

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LH+L+DY+   KLH I+  TTL ++++Q TG+A G  G+VNIT+ K GKVGF +   
Sbjct  85   VLSLHILVDYFGAKKLHQINNSTTLVSSMFQATGSASGTAGYVNITNLKAGKVGFAAEDN  144

Query  493  GSPLASQYTKSV  528
               L S Y KSV
Sbjct  145  DGSLHSFYVKSV  156



>ref|NP_187872.1| fasciclin-like arabinogalactan protein 14 [Arabidopsis thaliana]
 sp|Q9LTW9.1|FLA14_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 14; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51033.1|AC069474_32 hypothetical protein; 8734-7967 [Arabidopsis thaliana]
 dbj|BAB02409.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE65936.1| fasciclin-like arabinogalactan family protein [Arabidopsis thaliana]
 gb|AEE75229.1| fasciclin-like arabinogalactan protein 14 [Arabidopsis thaliana]
Length=255

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            NIT IL  H ++S FN  LS T+LA  IN R T+TVLV++NGA SS++G+ P SV+K +L
Sbjct  25   NITNILNEHDDFSNFNQLLSETQLASTINKRQTITVLVVSNGALSSLSGQ-PTSVIKKIL  83

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
             LH++LDY+D  KL ++SK T L TTL+Q++G A G  GF+N T  K G V FGSA+PGS
Sbjct  84   SLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGDVAFGSAVPGS  143

Query  499  PLASQYTKSV  528
             L +Q   +V
Sbjct  144  SLDAQLQDTV  153



>ref|XP_003545484.2| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Glycine 
max]
Length=443

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT +L  HP +S FN YLS T LA+EIN R T+TVL L N A SS+  KH  L  +KN
Sbjct  61   HNITRMLAAHPGFSTFNHYLSVTHLAEEINRRQTITVLALDNAAMSSLLDKHLSLPTIKN  120

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LH+L+DY+   KLH I+  TTL ++++Q TG+A G  G+VNIT+ K GKVGF +   
Sbjct  121  VLSLHILVDYFGAKKLHQINNSTTLVSSMFQATGSASGTAGYVNITNLKAGKVGFAAEDN  180

Query  493  GSPLASQYTKSV  528
               L S Y KSV
Sbjct  181  DGSLHSFYVKSV  192



>gb|EPS69372.1| fasciclin-like arabinogalactan protein 19, partial [Genlisea 
aurea]
Length=327

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HP  S FN YL+ T LA EI+ R T+TV V+ N A   +  KH PL  +KN
Sbjct  18   HNITRILADHPSLSTFNHYLTITHLAGEIDRRRTITVCVVDNAAMDDLLSKHFPLPTIKN  77

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHV  DY++  KLH +++G+T +++L+Q TG A G  G+VNITD KGGKVGF     
Sbjct  78   ILSLHVFADYFNAKKLHQVTQGSTTTSSLFQATGEAAGTSGYVNITDMKGGKVGFSPVDS  137

Query  493  GS--PLASQYTKSV  528
             S  P+A+ Y KS+
Sbjct  138  SSQGPVAT-YVKSI  150



>ref|XP_003519683.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Glycine 
max]
Length=406

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT +L  HP +S FN YLS T LA+EIN R T+TVL L N A SS+  KH  L  +KN
Sbjct  23   HNITRMLAKHPGFSTFNHYLSLTHLAEEINRRQTITVLALDNAAMSSLLDKHLSLPTIKN  82

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+  TTL ++++Q TG+A G  G+VNIT+ K GKVGF +   
Sbjct  83   VLSLHVLVDYFGAKKLHQINNSTTLVSSMFQATGSASGTAGYVNITNLKAGKVGFAAEDN  142

Query  493  GSPLASQYTKSV  528
               L S Y KSV
Sbjct  143  DGSLHSFYVKSV  154



>gb|ADP88924.1| fasciclin-like AGP [Gunnera manicata]
Length=393

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 88/133 (66%), Gaps = 4/133 (3%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT +L  HPE+S FN YLS T LADEIN R T+TV  + N   + +  KH LS+  +K
Sbjct  16   HNITQMLAKHPEFSTFNHYLSVTHLADEINRRRTITVCAVDNSGMADLLAKH-LSIYSIK  74

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL  H++ DY+   KLH I+ G+ L+ T++Q TG A G  GFVNITD KGGKVGFG   
Sbjct  75   NVLSAHIIADYFGSKKLHQITDGSVLAATVFQATGAASGISGFVNITDLKGGKVGFGVVD  134

Query  490  PGSPLASQYTKSV  528
             G+ L + Y KS+
Sbjct  135  SGT-LDATYVKSL  146



>ref|XP_004251538.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Solanum 
lycopersicum]
Length=387

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TV  + N A   +  KH  +  +KN
Sbjct  23   HNITLILTKHPEFSTFNRYLTLTHLASEINRRQTITVCAVNNAAMDDLLDKHLSIYTLKN  82

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHV  DY+   +LH I+KGTTL+ TL+Q TG APG  G+VNIT+ KG KVGF +   
Sbjct  83   VLSLHVFADYFGSKQLHRITKGTTLTATLFQATGEAPGTSGYVNITNMKGKKVGFATEDN  142

Query  493  GSPLASQYTKSV  528
                +S + KS+
Sbjct  143  DGHFSSNFVKSI  154



>gb|ABK28554.1| unknown [Arabidopsis thaliana]
Length=256

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            NIT IL  H ++S FN  LS T+LA  IN R T+TVLV++NGA SS++G+ P SV+K +L
Sbjct  25   NITNILNEHDDFSNFNQLLSETQLASTINKRQTITVLVVSNGALSSLSGQ-PTSVIKKIL  83

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
             LH++LDY+D  KL ++SK T L TTL+Q++G A G  GF+N T  K G V FGSA+PGS
Sbjct  84   SLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGDVAFGSAVPGS  143

Query  499  PLASQYTKSV  528
             L +Q   +V
Sbjct  144  SLDAQLQDTV  153



>ref|XP_006352015.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Solanum 
tuberosum]
Length=393

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TV  + N A   +  KH  +  +KN
Sbjct  27   HNITLILAKHPEFSTFNRYLTLTHLASEINRRQTITVCAVNNAAMGDLLDKHMSIYTLKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHV  DY+   +LH I+KGTTL+ TL+Q TG APG  G+VNIT+ KG KVGF +   
Sbjct  87   VLSLHVFADYFGSKQLHRITKGTTLTATLFQATGEAPGTSGYVNITNMKGKKVGFATEDN  146

Query  493  GSPLASQYTKSV  528
                +S + KS+
Sbjct  147  DGHFSSNFVKSI  158



>ref|XP_009126981.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Brassica 
rapa]
Length=433

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 89/132 (67%), Gaps = 3/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S FN  L++T LADEIN RTT+T+  + N A S++T K + +S +KN
Sbjct  28   HNVTRLLANHPSFSSFNHLLTKTHLADEINRRTTITICAVNNAAMSALTSKGYTISTLKN  87

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+   KLH I  G+ L+ TL+Q T  APG  GFVNIT  +GGKVGF     
Sbjct  88   ILSLHVLLDYFGAKKLHQIGGGSALAATLFQATRAAPGTTGFVNITMLRGGKVGFRP--D  145

Query  493  GSPLASQYTKSV  528
            G  ++S + KS+
Sbjct  146  GGDMSSFFVKSI  157



>emb|CBI28444.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 2/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  +PE+S F+ YL+ T LA EIN R T+TVL ++N   + +  KH  + V+KN
Sbjct  140  HNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMADLLSKHLSVYVIKN  199

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GT  S TL+Q+TG+APG  GFVNITD K GKVGFG+   
Sbjct  200  VLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITDLKHGKVGFGAQDS  259

Query  493  GSPLASQYTKSV  528
            G  L + + KSV
Sbjct  260  GH-LNAYFVKSV  270



>ref|XP_010689281.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=402

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKNV  315
            NIT IL+ HPE+S FN+YL++T LA+EIN R T+T+L L N A SS+  K   L  ++NV
Sbjct  26   NITKILKKHPEFSTFNEYLTQTHLANEINHRQTITILALDNSAMSSLLSKGLTLFTLRNV  85

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSA  486
            L LHVL+DY+   KLH I+ GTT++ +L+Q++G+A GN G+VNITD  GGKV F  A
Sbjct  86   LSLHVLVDYYGAKKLHQITDGTTVTASLFQSSGDADGNSGYVNITDMHGGKVAFAPA  142



>gb|KCW58153.1| hypothetical protein EUGRSUZ_H00875 [Eucalyptus grandis]
Length=391

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TVL + N A ++I  KH LSV  +K
Sbjct  31   HNITRILAKHPEFSTFNHYLTITHLAAEINRRLTITVLAVDNAAMNAILDKH-LSVGTLK  89

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVL+DY+   KLH IS GTTL++T++Q TG A G  G+VNITD KGGKVGFG+  
Sbjct  90   NVLSLHVLVDYFGTKKLHQISNGTTLTSTMFQATGAAAGTAGYVNITDLKGGKVGFGAED  149

Query  490  PGSPLASQYTKSV  528
             GS L + + KSV
Sbjct  150  NGSDLNAVFVKSV  162



>gb|ABV27490.1| fasciclin-like arabinogalactan protein 19 [Gossypium hirsutum]
 gb|KJB10758.1| hypothetical protein B456_001G222400 [Gossypium raimondii]
Length=398

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLS-VVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TVL L N A SS+  K      +KN
Sbjct  22   HNITRILAKHPEFSTFNHYLTLTHLASEINRRETITVLALNNAAMSSLLSKQLSLYTLKN  81

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GT L++T++Q +G APG+ G++NITD KGGKVGFG+   
Sbjct  82   VLSLHVLVDYFGSKKLHQITNGTALTSTMFQASGAAPGSSGYINITDLKGGKVGFGAENN  141

Query  493  GSPLASQYTKSV  528
               L + Y KSV
Sbjct  142  DGNLDAVYVKSV  153



>ref|XP_009625162.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=415

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 88/133 (66%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  HP++S FN YL+ T LA EIN R T+T+  + N   S +  KH LS+  +K
Sbjct  26   HNITRILAKHPQFSTFNHYLTTTHLAYEINRRQTITICAVDNAGMSDLLSKH-LSIYAMK  84

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL  HVLLDY+   KLH I+ GT L+ T++Q TG+A G+ GFVNIT+ KGGKV F  A 
Sbjct  85   NVLSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITNLKGGKVVFSPAD  144

Query  490  PGSPLASQYTKSV  528
               P  +++ KSV
Sbjct  145  YDGPPPAKFVKSV  157



>ref|XP_009802278.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=415

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 89/133 (67%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            H+IT IL  HP++S FN YL+ T LA+EIN R T+TV  + N   S +  KH LS+  +K
Sbjct  26   HDITRILAKHPQFSTFNHYLTTTHLANEINRRQTITVFAVDNAGMSDLLSKH-LSIYAMK  84

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL  HVLLDY+   KLH I+ GT L+ T++Q TG+A G+ GFVNIT+ KGGKV F  A 
Sbjct  85   NVLSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITNVKGGKVVFSPAD  144

Query  490  PGSPLASQYTKSV  528
               P  +++ KSV
Sbjct  145  YDGPPPAKFVKSV  157



>ref|XP_009418107.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Musa acuminata 
subsp. malaccensis]
Length=483

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YLS T LA+EIN R T+TVL + N   S +  KH  L  ++N
Sbjct  111  HNITKILAQHPEFSTFNHYLSATHLANEINRRLTITVLAVDNAGMSDLLAKHLSLLTLRN  170

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGF  477
            VL LH+L DY+   KLH +S+G+T+S++++Q++G+APG  G++NITD + GKV F
Sbjct  171  VLSLHILSDYYSSRKLHQLSRGSTISSSVFQSSGHAPGTTGYINITDHRRGKVTF  225



>gb|EYU43168.1| hypothetical protein MIMGU_mgv1a011668mg [Erythranthe guttata]
Length=274

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 90/138 (65%), Gaps = 8/138 (6%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSI-TGKHPLSVVKN  312
            HNIT IL  +PE+S FN YL+ T LA EIN R T+TV  + N   S + +G + L  +KN
Sbjct  27   HNITHILAKYPEFSTFNHYLTTTHLAAEINRRRTITVCAVDNSGMSELLSGHYSLYTIKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL-  489
            +L LH+  DY+   KLH I+KG+T +++L+Q TG+A G  G+VNIT+ KGGK+GF   + 
Sbjct  87   ILRLHIFADYFGSKKLHHITKGSTTTSSLFQATGDASGTFGYVNITNMKGGKIGFTPVVV  146

Query  490  -----PGSPLASQYTKSV  528
                  G P+A+ + KSV
Sbjct  147  SDTRPDGQPMAT-FVKSV  163



>ref|XP_004244059.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Solanum 
lycopersicum]
Length=411

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 87/133 (65%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  H ++S FN YL+ T LA EIN R T+TV  + N   S +  K  LS+  +K
Sbjct  26   HNITHILADHKQFSTFNHYLTTTHLAAEINRRQTITVCAVDNAGMSDLLSKQ-LSIYTIK  84

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL  HVLLDY+D  KLH I+ GT L+ T++Q TG+A G+ GFVNITD +GGKVG   A 
Sbjct  85   NVLSFHVLLDYFDAKKLHQITNGTALAATMFQATGSATGSSGFVNITDLRGGKVGLSPAD  144

Query  490  PGSPLASQYTKSV  528
               P  +++ KS+
Sbjct  145  YNGPPPAKFVKSI  157



>ref|XP_010942271.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Elaeis guineensis]
Length=410

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            +NIT IL  HPE+S FN YLS T+LA EIN R T+TVL + N A + +  KH  L  ++N
Sbjct  31   YNITKILADHPEFSTFNHYLSATRLAGEINRRRTITVLAVDNSAMAPLLAKHLTLESLRN  90

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LH+L DY+   KLH ++ G+ ++++++Q TG+APG  G+VNITD + GKV F +   
Sbjct  91   VLRLHILADYYGAKKLHQLTGGSAVASSMFQATGDAPGTSGYVNITDHRAGKVTFIAQDA  150

Query  493  GSPLA-SQYTKSV  528
            G   A + + KSV
Sbjct  151  GDSTAPASFVKSV  163



>ref|XP_010909123.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Elaeis 
guineensis]
Length=259

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            NIT ILE +  YS FN+YL++TKLA+EIN R T+T+LV+ N   S++  K P+ ++KN++
Sbjct  22   NITHILESYSSYSTFNNYLTQTKLAEEINHRQTITILVVDNSKMSAVFSK-PIEILKNIM  80

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
             +H++LDY+D +KL  I   + L TTL+QT+G A   LGF+N+T+     V FGSA P +
Sbjct  81   AIHIILDYYDTNKLSHIPHKSALLTTLFQTSGIANNKLGFLNVTNMPNDDVVFGSATPEA  140

Query  499  PLASQYTKSV  528
            PL+S +TK V
Sbjct  141  PLSSTFTKMV  150



>gb|KHN13519.1| Fasciclin-like arabinogalactan protein 1, partial [Glycine soja]
Length=156

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHP-LSVVKN  312
            HNI++IL  H E+  FN YL+ T LA EIN +T + V  + N A S++  KHP + VVKN
Sbjct  9    HNISSILAKHHEFFTFNHYLTLTHLALEINGKTAIIVCAVDNAAMSNLLLKHPSIYVVKN  68

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLL+Y+   KLH I+ GTTL+ T+YQ TG  P ++GFVNI D  G KV F     
Sbjct  69   ILSLHVLLNYFGAKKLHQITNGTTLTITMYQATGTDPESVGFVNIIDLHGKKVTFAPENN  128

Query  493  GSPLASQYTKSV  528
               L+S + KS+
Sbjct  129  DDTLSSTFVKSI  140



>ref|XP_010069727.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Eucalyptus 
grandis]
Length=468

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 95/133 (71%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TVL + N A ++I  KH LSV  +K
Sbjct  92   HNITRILAKHPEFSTFNHYLTITHLAAEINRRLTITVLAVDNAAMNAILDKH-LSVGTLK  150

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LHVL+DY+   KLH IS GTTL++T++Q TG A G  G+VNITD KGGKVGFG+  
Sbjct  151  NVLSLHVLVDYFGTKKLHQISNGTTLTSTMFQATGAAAGTAGYVNITDLKGGKVGFGAED  210

Query  490  PGSPLASQYTKSV  528
             GS L + + KSV
Sbjct  211  NGSDLNAVFVKSV  223



>ref|XP_010265495.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nelumbo 
nucifera]
Length=295

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            NIT +L  + ++S FNDYL++TKLAD IN R T+TVL + NGA SS++GK P  ++K VL
Sbjct  40   NITRLLSQYSDFSNFNDYLTQTKLADSINRRQTITVLAVDNGAVSSLSGKSP-DLIKKVL  98

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
             LHV+LDY+D DK+  +S  +T+ TTL+Q+TG A    GF+N+T    G+V FGSA+ GS
Sbjct  99   SLHVILDYYDIDKIKKLSNKSTILTTLFQSTGVAVNKQGFLNVTRFASGEVRFGSAVKGS  158

Query  499  PLASQYTKSV  528
             L +Q  K V
Sbjct  159  SLDAQLIKKV  168



>ref|NP_001061532.1| Os08g0321000 [Oryza sativa Japonica Group]
 dbj|BAD01728.1| putative fasciclin-like arabinogalactan-protein [Oryza sativa 
Japonica Group]
 dbj|BAD03337.1| putative fasciclin-like arabinogalactan-protein [Oryza sativa 
Japonica Group]
 dbj|BAF23446.1| Os08g0321000 [Oryza sativa Japonica Group]
 gb|EAZ06523.1| hypothetical protein OsI_28769 [Oryza sativa Indica Group]
 dbj|BAG90756.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96652.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99705.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99706.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI39894.1| fasciclin-like arabinogalactan-protein-like [Oryza sativa Indica 
Group]
Length=415

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            +NIT IL  HPEYSQFN  L+ T+LA +IN R T+TVLV+ NG   +++G H  L  +++
Sbjct  26   YNITKILGDHPEYSQFNKLLTETRLAGDINRRRTITVLVVANGDMGALSGGHYTLPTLRH  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSA-L  489
            +LE+H+L+DY+   KLH +++G T S++++Q +G+APG  G+VNIT  +GG+V F +   
Sbjct  86   ILEMHILVDYYGAKKLHQLARGDTASSSMFQESGSAPGTTGYVNITQHRGGRVSFTAEDA  145

Query  490  PGSPLASQYTKSV  528
              S   S + KSV
Sbjct  146  ADSATPSSFVKSV  158



>ref|XP_009396684.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            HNIT +L   P++S FND L++T LA +IN+R+T+T+L ++NGA SS++   P+  +K +
Sbjct  25   HNITKMLAQLPDFSTFNDLLTQTHLAADINSRSTITILAVSNGAVSSVS-DEPIDTIKKI  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L LHV+LDY+D +K+H IS  T + TTL+Q +G A G  GF+N+T+ + G++ FGSA+ G
Sbjct  84   LSLHVILDYYDDNKIHKISNHTAILTTLFQASGGAAGQNGFLNVTNMENGQIAFGSAVAG  143

Query  496  SPLASQYTK  522
            S L + + K
Sbjct  144  SSLTANFVK  152



>gb|EAZ42295.1| hypothetical protein OsJ_26868 [Oryza sativa Japonica Group]
Length=392

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            +NIT IL  HPEYSQFN  L+ T+LA +IN R T+TVLV+ NG   +++G H  L  +++
Sbjct  26   YNITKILGDHPEYSQFNKLLTETRLAGDINRRRTITVLVVANGDMGALSGGHYTLPTLRH  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSA-L  489
            +LE+H+L+DY+   KLH +++G T S++++Q +G+APG  G+VNIT  +GG+V F +   
Sbjct  86   ILEMHILVDYYGAKKLHQLARGDTASSSMFQESGSAPGTTGYVNITQHRGGRVSFTAEDA  145

Query  490  PGSPLASQYTKSV  528
              S   S + KSV
Sbjct  146  ADSATPSSFVKSV  158



>gb|ACL36352.1| fascilin-like arabinogalactan protein [Gossypium hirsutum]
Length=397

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLS-VVKN  312
            HNIT IL  +PE+S FN YL+ T LA EIN R T+TVL L N A SS+  K      +KN
Sbjct  21   HNITRILAKNPEFSTFNHYLTLTHLASEINRRETITVLALNNAAMSSLLSKQLSLYTLKN  80

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GT L++T++Q +G APG+ G++NITD KGGKVGFG+   
Sbjct  81   VLSLHVLVDYFGSKKLHQITNGTALTSTMFQASGAAPGSSGYINITDLKGGKVGFGAENN  140

Query  493  GSPLASQYTKSV  528
               L + Y KSV
Sbjct  141  DGNLDAVYVKSV  152



>ref|XP_008788906.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix 
dactylifera]
Length=481

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TVL ++N   + +  KH PL  +KN
Sbjct  96   HNITKILAEHPEFSTFNHYLTATHLAGEINRRKTITVLAVSNTGMAPLLAKHLPLYTLKN  155

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH I+ GT  S+TL+Q TG A G  GFVNIT+ + G+V F +   
Sbjct  156  VLSLHVLVDYFGAKKLHQINGGTAASSTLFQATGAASGTAGFVNITNHRAGRVSFAAEDV  215

Query  493  GSPLASQYTKSV  528
            G      + KS+
Sbjct  216  GDAPPVNFVKSI  227



>ref|XP_008809683.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix 
dactylifera]
Length=410

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN+YL+ T LA EIN R T+TVL ++N   + +  KH  +S +KN
Sbjct  26   HNITEILADHPEFSTFNNYLTATHLAGEINRRKTITVLAVSNAGMAPLLAKHLTVSALKN  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+    LH ++ GT  S++L+Q TG APG  GFVNIT+ + G+V F +   
Sbjct  86   VLSLHVLVDYFGAKNLHQLNGGTAASSSLFQATGTAPGTTGFVNITNHRAGRVSFSAEDV  145

Query  493  GSPLASQYTKSV  528
                   + KS+
Sbjct  146  ADSAPVNFVKSI  157



>ref|XP_006660446.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Oryza 
brachyantha]
Length=395

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            +NIT IL  HPE+S+FND LS+T+LA +IN R T+TVL + N A +S+     L  ++++
Sbjct  24   YNITKILAAHPEFSKFNDMLSKTRLAYDINRRQTITVLAVDNSAMASL-DHFTLPTIRHI  82

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSA-LP  492
            L LH+L+DY+   KLH +S G T S++++Q TG+APG  G+VNIT  KGGK+ F S    
Sbjct  83   LSLHILVDYYGAKKLHALSHGATASSSMFQATGSAPGTTGYVNITSHKGGKIDFISEDAD  142

Query  493  GSPLASQYTKSV  528
             S   S++ KSV
Sbjct  143  ESAKPSRFVKSV  154



>ref|XP_009132640.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Brassica 
rapa]
Length=201

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 87/132 (66%), Gaps = 2/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP  S FN YL++T LADEIN R T+TV  + +GA   +T K + +S +KN
Sbjct  28   HNVTLLLANHPSLSSFNHYLAQTHLADEINQRNTITVCAVDDGAMYDLTSKGYTISTLKN  87

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LHVLLDY+D  K   +  G+ L+ T++Q TG AP N GFV IT+++GG + FG    
Sbjct  88   ILSLHVLLDYFDARKRPQLPDGSALAATIFQATGAAPENTGFVKITNKRGGNIRFGLNGA  147

Query  493  GSPLASQYTKSV  528
            G  ++S + KS+
Sbjct  148  GD-VSSSFIKSI  158



>ref|NP_001062666.1| Os09g0248100 [Oryza sativa Japonica Group]
 dbj|BAD19896.1| putative endosperm specific protein SC3 [Oryza sativa Japonica 
Group]
 dbj|BAD26000.1| putative endosperm specific protein SC3 [Oryza sativa Japonica 
Group]
 dbj|BAF24580.1| Os09g0248100 [Oryza sativa Japonica Group]
 gb|EAZ08273.1| hypothetical protein OsI_30524 [Oryza sativa Indica Group]
 gb|EAZ43889.1| hypothetical protein OsJ_28509 [Oryza sativa Japonica Group]
 dbj|BAG90947.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87887.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
            +NIT IL  HPE+S+FN+ LS+T+LA +IN R T+TVL + N A +S+     L  ++++
Sbjct  29   YNITKILAAHPEFSKFNEMLSKTRLAYDINRRQTITVLAVDNSAMASL-DHFTLPTIRHI  87

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSA-LP  492
            L LH+L+DY+   KLH +S G T S++++Q TG+APG  G+VNIT  KGGK+ F S    
Sbjct  88   LSLHILVDYYGSKKLHALSHGATASSSMFQATGSAPGTTGYVNITSHKGGKIDFISEDAD  147

Query  493  GSPLASQYTKSV  528
             S   S+Y KSV
Sbjct  148  ESAKPSRYVKSV  159



>ref|XP_009616556.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana 
tomentosiformis]
Length=389

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 83/132 (63%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  H E+S FN YL+ T LA EIN R T+TV  + N A   +  KH  +  +KN
Sbjct  27   HNITQILAKHREFSTFNRYLTLTHLASEINRRQTITVCAVDNAAMDDLLDKHLSIYTLKN  86

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHV  DY+   KLH I+ GTTL+ TL+Q TG APG  G++NIT+ KG KVGF +   
Sbjct  87   VLSLHVFADYFSSKKLHKITNGTTLTATLFQATGEAPGTTGYINITNTKGKKVGFTTEDN  146

Query  493  GSPLASQYTKSV  528
                ++ + KSV
Sbjct  147  NGHFSASFVKSV  158



>ref|XP_008797603.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix 
dactylifera]
Length=414

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            +NIT IL  HPE+S F+ YLS T+LA EIN R T+TVL + N   +SI  KH  L  ++N
Sbjct  31   YNITKILAEHPEFSTFSHYLSVTRLAGEINRRRTITVLAVDNAGMASILAKHLTLESLRN  90

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGF  477
            VL LH+L DY+   KLH ++ G+ L+++++Q TG+APG  G+VNITD + GKV F
Sbjct  91   VLRLHILADYFGAKKLHQLTGGSALASSMFQATGDAPGTSGYVNITDHRAGKVTF  145



>ref|XP_009385381.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 90/133 (68%), Gaps = 3/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVV--K  309
            HNIT IL  HPE+S FN YLS T LA+EIN R T+TVL + N     +  KH LS++  +
Sbjct  27   HNITKILAQHPEFSTFNHYLSVTHLANEINRRLTITVLAVDNSGMGDLLAKH-LSILTLR  85

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSAL  489
            NVL LH+L DY+   KLH ++ G+T+S++++Q++G+APG  G++NITD + GKV F +  
Sbjct  86   NVLALHILTDYYGAKKLHQLTGGSTISSSVFQSSGHAPGTTGYINITDHRRGKVTFITED  145

Query  490  PGSPLASQYTKSV  528
             G    + + KSV
Sbjct  146  AGGAAPAVFVKSV  158



>gb|ABI95393.1| fasciclin-like protein FLA3 [Triticum aestivum]
Length=416

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 92/134 (69%), Gaps = 4/134 (3%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            +NIT IL  +PEYSQFN  L++T+LA +IN R T+TVLV+ NG   S+ G    L  +++
Sbjct  24   YNITKILAAYPEYSQFNKLLTQTRLAQDINKRRTITVLVVANGDMGSLAGGGRTLQTIRH  83

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGS--A  486
            +L++HVL+DY+ G KLH ++ G T  ++++Q +G APG  G+VNIT  +GGKV F +  A
Sbjct  84   MLQIHVLVDYYGGKKLHQLAHGVTACSSMFQESGAAPGMSGYVNITQHRGGKVTFTAEDA  143

Query  487  LPGSPLASQYTKSV  528
               +P +S + KSV
Sbjct  144  EDSAP-SSAFVKSV  156



>ref|XP_011085650.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 2 [Sesamum indicum]
Length=390

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 86/134 (64%), Gaps = 6/134 (4%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HP++S FN YL+ T LA EIN   T+ V+   N A +++  KH  L  +KN
Sbjct  21   HNITRILAQHPDFSTFNHYLTTTHLAAEINRHRTMXVVD--NAAMNNLLSKHFSLYTIKN  78

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            +L LH+  DY+   KLH I+KG+T +++L+Q TG A G  G+VNITD KGGK GF     
Sbjct  79   ILSLHIFADYFGSKKLHQITKGSTTTSSLFQATGEAAGTSGYVNITDMKGGKXGFSPVDS  138

Query  493  GS--PLASQYTKSV  528
             S  P+A+ Y KS+
Sbjct  139  DSDQPMAT-YVKSI  151



>ref|XP_006659292.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Oryza 
brachyantha]
Length=392

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 91/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSIT-GKHPLSVVKN  312
            +NI  IL  HPEYSQFN  L+ T+LA +IN R T+TVLV+ NG   +++ G + L  +++
Sbjct  26   YNIAKILADHPEYSQFNKLLTDTRLAGDINRRRTITVLVVANGDMGALSAGHYTLPTLRH  85

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSA-L  489
            +LE+H+L+DY+   KLH +++G T S++++Q +G+APG  G+VNIT  +GG+V F +   
Sbjct  86   ILEMHILVDYYGAKKLHQLARGDTASSSMFQESGSAPGTTGYVNITQHRGGRVSFTAEDA  145

Query  490  PGSPLASQYTKSV  528
              S   S + KSV
Sbjct  146  ADSATPSSFVKSV  158



>gb|EPS65223.1| hypothetical protein M569_09558, partial [Genlisea aurea]
Length=276

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            NIT ILE +P++  FN++L++ KLA +IN+R T+TVL + NG  SS++G      +KNVL
Sbjct  24   NITHILEQYPDFDSFNNFLTQAKLASQINSRQTITVLAVDNGGVSSLSGMS-SDAMKNVL  82

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
              HV+LDY+D  KLH +S  + + TTL+Q++G   G  GF+N+T   GGKV FGSA+ G+
Sbjct  83   SAHVVLDYYDEAKLHKLSNKSAILTTLFQSSGLGRGQQGFLNVTILSGGKVAFGSAVAGA  142

Query  499  PLASQYTKSV  528
            PL +   KSV
Sbjct  143  PLGANLVKSV  152



>ref|XP_010943291.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Elaeis guineensis]
Length=412

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HPE+S FN YL+ T LA EIN R T+T+LV++N   + +  KH  L  +KN
Sbjct  25   HNITKILAEHPEFSTFNHYLTATHLAGEINRRKTITILVVSNADMAPLLAKHLSLYTLKN  84

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH ++ G   S+TL+Q TG+A G  GFVNIT+ + G+V F +   
Sbjct  85   VLSLHVLVDYFGAKKLHQLNGGAAASSTLFQATGSAQGTAGFVNITNHRAGRVSFAAVDA  144

Query  493  GSPLASQYTKSV  528
            G      + KS+
Sbjct  145  GGAPPVNFVKSI  156



>ref|XP_004303568.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Fragaria 
vesca subsp. vesca]
Length=406

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  HP  S FN YL+ T LA EIN R T+TVL + N A  +I  KH  +  +KN
Sbjct  30   HNITRILAKHPSLSTFNHYLTLTHLAAEINRRQTITVLAIDNAAMDAILAKHFSIPTLKN  89

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHVL+DY+   KLH ++ GTTL+ T++Q+TG A G  G+VNIT+ KGGKVGFG+   
Sbjct  90   VLSLHVLVDYFGAKKLHQLTGGTTLTATMFQSTGTADGTSGYVNITNLKGGKVGFGTEDN  149

Query  493  GSPLASQYTKSV  528
               L S Y KSV
Sbjct  150  DGKLNSFYEKSV  161



>gb|KFK38614.1| hypothetical protein AALP_AA3G137100 [Arabis alpina]
Length=256

 Score = 96.3 bits (238),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            NIT IL+ H ++S FND L++T+LA  IN+R T+TVL ++NGA SS++ K P +++KN+L
Sbjct  26   NITNILDQHHDFSTFNDLLTQTQLASAINSRQTITVLAVSNGALSSLSDK-PKAMLKNIL  84

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
             LH++LDY+D  KL +++K + + TTL+Q++G A G  GF+N T  K G V FGSA+PGS
Sbjct  85   SLHIVLDYYDEKKLKNLNKKSVILTTLFQSSGLARGQQGFLNATVTKDGDVSFGSAVPGS  144

Query  499  PLASQYTKSV  528
            PL +Q  +SV
Sbjct  145  PLNAQLEESV  154



>ref|XP_011034724.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Populus 
euphratica]
Length=314

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNV  315
             NIT IL  +P++S F+ YL++T+LA EIN+R T+TVLV+ NG  S ++GK P   +KNV
Sbjct  25   SNITQILSQYPDFSTFSSYLTQTQLAGEINSRQTITVLVVENGNMSPLSGK-PNGEIKNV  83

Query  316  LELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPG  495
            L  HV+LDY+D  KL  + K T + TTL+Q++G A G  GF+N+T      V FGSA+PG
Sbjct  84   LSEHVILDYYDVAKLQKLQKKTAMLTTLFQSSGQAKGQQGFLNVTVLGSNSVAFGSAVPG  143

Query  496  SPLASQYTKSV  528
            S L+S   KSV
Sbjct  144  SSLSSNLVKSV  154



>ref|XP_006280472.1| hypothetical protein CARUB_v10026407mg, partial [Capsella rubella]
 gb|EOA13370.1| hypothetical protein CARUB_v10026407mg, partial [Capsella rubella]
Length=443

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGK-HPLSVVKN  312
            HN+T +L  HP +S F+ YL++T LADEIN RTT+TV  + N A +++T K + +S +KN
Sbjct  44   HNVTRLLASHPSFSSFSHYLTQTHLADEINRRTTITVCAVDNAAMAALTSKGYTISTLKN  103

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFG  480
            +L LHVLLDY+   KLH I  G+ L+ T++Q TG APG  GFVNITD +GGKVGFG
Sbjct  104  ILSLHVLLDYFGTKKLHQIRDGSALAATMFQATGAAPGTTGFVNITDLRGGKVGFG  159



>ref|XP_010928138.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Elaeis guineensis]
Length=399

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 3/118 (3%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSV--VK  309
            HNIT IL  HPE+S FN YL+ T LA EIN R T+TVL ++N   + +  KH L+V  +K
Sbjct  26   HNITEILAEHPEFSTFNHYLTATHLAGEINRRKTITVLAVSNAGMAPLLAKH-LNVYALK  84

Query  310  NVLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGS  483
            N L LHVL+DY+   KLH ++ GT  S++L+Q TG APG  GFVNIT+ + G+V F +
Sbjct  85   NALSLHVLVDYFGAQKLHQLNGGTAASSSLFQATGAAPGTTGFVNITNHRAGRVSFAA  142



>ref|XP_009792211.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana 
sylvestris]
Length=414

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 82/132 (62%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  H E+S FN YL+ T LA EIN R T+TV  + N A   +  KH  +  +KN
Sbjct  49   HNITQILAKHHEFSTFNRYLTLTHLASEINRRQTITVCAVDNAAMDDLLDKHLSIYTLKN  108

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LHV  DY+   KLH I+ GTTL+ TL+Q TG APG  G++NIT+ KG  VGF +   
Sbjct  109  VLSLHVFADYFSSKKLHKITNGTTLTATLFQATGEAPGTSGYINITNTKGKNVGFTTEEN  168

Query  493  GSPLASQYTKSV  528
                ++ + KSV
Sbjct  169  DGHFSASFVKSV  180



>ref|XP_009396657.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=992

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 60/132 (45%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = +1

Query  136  HNITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKH-PLSVVKN  312
            HNIT IL  H E+S FN YL+ T LA EIN R T+TVLV+ N   + +  +H  L  ++N
Sbjct  616  HNITKILAEHLEFSTFNHYLTVTHLAAEINRRLTITVLVVGNSGMADLLARHLSLLTLRN  675

Query  313  VLELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALP  492
            VL LH+L DY+   KLH ++ G+TL+++++Q++G+APG  G++NITD + GKV F +   
Sbjct  676  VLSLHILTDYYGAKKLHQLTGGSTLASSVFQSSGHAPGTTGYINITDHRAGKVTFSAGDD  735

Query  493  GSPLASQYTKSV  528
            G      + KSV
Sbjct  736  GGAPPVDFVKSV  747



>ref|XP_009398985.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=441

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +1

Query  139  NITAILEGHPEYSQFNDYLSRTKLADEINtrttvtvlvltNGAFSSITGKHPLSVVKNVL  318
            ++T +L    ++S FND L RT+L+ +I+TR +VT+L + NGA SS +G+ P  V+K ++
Sbjct  27   DVTRLLAQFSDFSTFNDLLIRTQLSADISTRKSVTILAVQNGALSSESGQ-PDEVIKKII  85

Query  319  ELHVLLDYWDGDKLHDISKGttlsttlyqttGNAPGNLGFVNITDQKGGKVGFGSALPGS  498
             LHV+LDY D +KLH +S  T + TT+ Q +G A G  GF+N+TD K G+V FGSA+PGS
Sbjct  86   ALHVVLDYLDSEKLHQLSSHTAILTTMLQASGRASGLSGFLNVTDLKNGQVAFGSAVPGS  145

Query  499  PLASQYTK  522
            PL+S + +
Sbjct  146  PLSSYFVR  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400