BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K08

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011096521.1|  PREDICTED: chlorophyll a-b binding protein 2...    301   1e-99   Sesamum indicum [beniseed]
ref|XP_006361530.1|  PREDICTED: chlorophyll a-b binding protein 3...    300   3e-99   Solanum tuberosum [potatoes]
ref|XP_009795316.1|  PREDICTED: chlorophyll a-b binding protein 4...    299   6e-99   Nicotiana sylvestris
ref|XP_009593856.1|  PREDICTED: chlorophyll a-b binding protein 4...    299   7e-99   Nicotiana tomentosiformis
ref|XP_009782924.1|  PREDICTED: chlorophyll a-b binding protein 5...    299   8e-99   Nicotiana sylvestris
ref|XP_004145734.1|  PREDICTED: chlorophyll a-b binding protein, ...    298   1e-98   Cucumis sativus [cucumbers]
ref|XP_008456347.1|  PREDICTED: chlorophyll a-b binding protein o...    298   1e-98   Cucumis melo [Oriental melon]
ref|XP_009790934.1|  PREDICTED: chlorophyll a-b binding protein 4...    298   1e-98   Nicotiana sylvestris
ref|XP_009795315.1|  PREDICTED: chlorophyll a-b binding protein 4...    298   1e-98   Nicotiana sylvestris
ref|XP_009628754.1|  PREDICTED: chlorophyll a-b binding protein 1...    298   1e-98   Nicotiana tomentosiformis
ref|XP_009790936.1|  PREDICTED: chlorophyll a-b binding protein 4...    298   2e-98   Nicotiana sylvestris
sp|P12470.1|CB25_NICPL  RecName: Full=Chlorophyll a-b binding pro...    298   2e-98   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009618329.1|  PREDICTED: chlorophyll a-b binding protein 4...    298   2e-98   Nicotiana tomentosiformis
ref|XP_009611577.1|  PREDICTED: chlorophyll a-b binding protein 4...    297   2e-98   Nicotiana tomentosiformis
sp|P27492.1|CB21_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    298   2e-98   Nicotiana tabacum [American tobacco]
ref|XP_004170962.1|  PREDICTED: chlorophyll a-b binding protein o...    297   3e-98   
ref|XP_004134608.1|  PREDICTED: chlorophyll a-b binding protein o...    297   4e-98   
ref|XP_004134603.1|  PREDICTED: chlorophyll a-b binding protein o...    297   4e-98   
ref|XP_009782923.1|  PREDICTED: chlorophyll a-b binding protein 5...    297   4e-98   Nicotiana sylvestris
ref|XP_009782922.1|  PREDICTED: chlorophyll a-b binding protein 5...    297   5e-98   Nicotiana sylvestris
ref|XP_009597417.1|  PREDICTED: chlorophyll a-b binding protein 5...    297   5e-98   Nicotiana tomentosiformis
ref|XP_009772885.1|  PREDICTED: chlorophyll a-b binding protein 5...    296   5e-98   Nicotiana sylvestris
ref|XP_006356073.1|  PREDICTED: chlorophyll a-b binding protein 3...    296   7e-98   Solanum tuberosum [potatoes]
sp|P08221.1|CB21_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    295   9e-98   Cucumis sativus [cucumbers]
ref|XP_009628755.1|  PREDICTED: chlorophyll a-b binding protein 4...    296   1e-97   Nicotiana tomentosiformis
ref|XP_009606802.1|  PREDICTED: chlorophyll a-b binding protein 1...    296   1e-97   Nicotiana tomentosiformis
sp|P07369.1|CB2G_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    296   1e-97   Solanum lycopersicum
sp|P27496.1|CB25_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    295   1e-97   Nicotiana tabacum [American tobacco]
ref|XP_010317413.1|  PREDICTED: chlorophyll a-b binding protein 3...    295   2e-97   Solanum lycopersicum
ref|XP_006356077.1|  PREDICTED: chlorophyll a-b binding protein 3...    295   2e-97   Solanum tuberosum [potatoes]
gb|AAA34148.1|  chlorophyll a/b-binding protein Cab-3C                  295   2e-97   Solanum lycopersicum
ref|XP_009795314.1|  PREDICTED: chlorophyll a-b binding protein 1...    295   2e-97   Nicotiana sylvestris
ref|XP_009606800.1|  PREDICTED: chlorophyll a-b binding protein 5...    295   3e-97   Nicotiana tomentosiformis
ref|XP_009782921.1|  PREDICTED: chlorophyll a-b binding protein 5...    295   3e-97   Nicotiana sylvestris
ref|XP_010916097.1|  PREDICTED: chlorophyll a-b binding protein o...    294   5e-97   Elaeis guineensis
ref|XP_006356078.1|  PREDICTED: chlorophyll a-b binding protein 3...    294   5e-97   
ref|XP_008784387.1|  PREDICTED: chlorophyll a-b binding protein o...    294   5e-97   Phoenix dactylifera
ref|XP_009628757.1|  PREDICTED: chlorophyll a-b binding protein 1...    294   6e-97   Nicotiana tomentosiformis
ref|XP_006364025.1|  PREDICTED: chlorophyll a-b binding protein 5...    294   7e-97   Solanum tuberosum [potatoes]
ref|XP_008779641.1|  PREDICTED: chlorophyll a-b binding protein o...    293   9e-97   Phoenix dactylifera
ref|XP_006356075.1|  PREDICTED: chlorophyll a-b binding protein 3...    293   9e-97   Solanum tuberosum [potatoes]
gb|ABF17940.1|  putative chloroplast chlorophyll a/b-binding protein    293   9e-97   Carya cathayensis
ref|XP_008439658.1|  PREDICTED: chlorophyll a-b binding protein o...    293   1e-96   Cucumis melo [Oriental melon]
ref|XP_011096520.1|  PREDICTED: chlorophyll a-b binding protein 2...    293   2e-96   Sesamum indicum [beniseed]
ref|XP_011085268.1|  PREDICTED: chlorophyll a-b binding protein 2...    293   2e-96   Sesamum indicum [beniseed]
gb|ABB55370.1|  chlorophyll a-b binding protein 3C-like                 292   3e-96   Solanum tuberosum [potatoes]
sp|P12469.1|CB23_NICPL  RecName: Full=Chlorophyll a-b binding pro...    292   3e-96   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009421488.1|  PREDICTED: chlorophyll a-b binding protein o...    292   3e-96   Musa acuminata subsp. malaccensis [pisang utan]
sp|P04783.1|CB25_PETSP  RecName: Full=Chlorophyll a-b binding pro...    292   3e-96   Petunia sp.
ref|XP_009782821.1|  PREDICTED: chlorophyll a-b binding protein 7...    292   4e-96   Nicotiana sylvestris
ref|XP_010243713.1|  PREDICTED: chlorophyll a-b binding protein o...    292   4e-96   Nelumbo nucifera [Indian lotus]
ref|XP_009782905.1|  PREDICTED: chlorophyll a-b binding protein 7...    292   4e-96   Nicotiana sylvestris
ref|XP_009775533.1|  PREDICTED: chlorophyll a-b binding protein 7...    292   4e-96   Nicotiana sylvestris
sp|P27491.1|CB27_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    292   4e-96   Nicotiana tabacum [American tobacco]
ref|XP_009396492.1|  PREDICTED: chlorophyll a-b binding protein o...    291   4e-96   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002316737.1|  Chlorophyll a-b binding protein 2                  291   5e-96   Populus trichocarpa [western balsam poplar]
sp|P04780.1|CB22_PETSP  RecName: Full=Chlorophyll a-b binding pro...    291   5e-96   Petunia sp.
ref|XP_006356074.1|  PREDICTED: chlorophyll a-b binding protein 3...    291   8e-96   Solanum tuberosum [potatoes]
ref|XP_009618330.1|  PREDICTED: chlorophyll a-b binding protein 4...    291   9e-96   Nicotiana tomentosiformis
ref|XP_011011531.1|  PREDICTED: chlorophyll a-b binding protein o...    290   1e-95   Populus euphratica
ref|XP_006356076.1|  PREDICTED: chlorophyll a-b binding protein 3...    291   1e-95   
ref|XP_009759685.1|  PREDICTED: chlorophyll a-b binding protein 4...    291   1e-95   Nicotiana sylvestris
ref|XP_010052093.1|  PREDICTED: chlorophyll a-b binding protein o...    290   2e-95   Eucalyptus grandis [rose gum]
ref|XP_006356080.1|  PREDICTED: chlorophyll a-b binding protein 3...    290   2e-95   Solanum tuberosum [potatoes]
emb|CAA78379.1|  chlorophyll a/b-binding protein PS II-Type I           290   2e-95   Solanum tuberosum [potatoes]
gb|KDP37945.1|  hypothetical protein JCGZ_04588                         290   3e-95   Jatropha curcas
ref|XP_010685893.1|  PREDICTED: chlorophyll a-b binding protein, ...    290   3e-95   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002519724.1|  chlorophyll A/B binding protein, putative          290   3e-95   Ricinus communis
ref|XP_004234241.1|  PREDICTED: uncharacterized protein LOC101245729    298   5e-95   
emb|CAJ77390.1|  major chlorophyll a/b binding protein LHCb1.2          289   5e-95   Spinacia oleracea
gb|AAB61238.1|  chlorophyll a/b-binding protein                         289   6e-95   Mesembryanthemum crystallinum
gb|AIR93785.1|  chloroplast light harvesting chlorophyll A/B bind...    289   6e-95   Kalanchoe fedtschenkoi [lavender-scallops]
gb|KCW75952.1|  hypothetical protein EUGRSUZ_D00320                     288   8e-95   Eucalyptus grandis [rose gum]
emb|CAJ77391.1|  major chlorophyll a/b binding protein LHCb1.1          288   8e-95   Spinacia oleracea
ref|XP_010924306.1|  PREDICTED: chlorophyll a-b binding protein o...    288   1e-94   Elaeis guineensis
gb|AAT08651.1|  chloroplast chlorophyll A-B binding protein             287   1e-94   Hyacinthus orientalis [common hyacinth]
gb|AGJ50622.1|  chlorophyll a/b binding protein                         288   1e-94   Salicornia brachiata
sp|P12333.1|CB2A_SPIOL  RecName: Full=Chlorophyll a-b binding pro...    288   1e-94   Spinacia oleracea
gb|ABD38707.1|  chloroplast chlorophyll a/b binding protein             288   2e-94   Pachysandra terminalis
sp|P04781.1|CB23_PETSP  RecName: Full=Chlorophyll a-b binding pro...    288   2e-94   Petunia sp.
ref|XP_010904844.1|  PREDICTED: chlorophyll a-b binding protein o...    287   2e-94   Elaeis guineensis
gb|AAA33396.1|  light-harvesting chlorophyll a/b protein precursor      287   3e-94   Lemna gibba
ref|XP_010056879.1|  PREDICTED: chlorophyll a-b binding protein o...    287   3e-94   Eucalyptus grandis [rose gum]
sp|P04782.1|CB24_PETSP  RecName: Full=Chlorophyll a-b binding pro...    287   3e-94   Petunia sp.
ref|XP_008444193.1|  PREDICTED: chlorophyll a-b binding protein o...    287   3e-94   Cucumis melo [Oriental melon]
emb|CAX64458.1|  major chlorophyll a/b binding protein LHCb1.4 pr...    287   3e-94   Spinacia oleracea
ref|XP_004294267.1|  PREDICTED: chlorophyll a-b binding protein o...    287   3e-94   Fragaria vesca subsp. vesca
ref|XP_008439659.1|  PREDICTED: chlorophyll a-b binding protein o...    289   3e-94   
gb|AFC91647.1|  chloroplast chlorophyll A/B binding protein             286   4e-94   Hevea brasiliensis [jebe]
gb|KCW75953.1|  hypothetical protein EUGRSUZ_D00321                     288   4e-94   Eucalyptus grandis [rose gum]
ref|XP_010247422.1|  PREDICTED: chlorophyll a-b binding protein o...    287   4e-94   Nelumbo nucifera [Indian lotus]
ref|XP_009395692.1|  PREDICTED: chlorophyll a-b binding protein o...    286   5e-94   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002307725.1|  Chlorophyll a-b binding protein 2                  286   5e-94   Populus trichocarpa [western balsam poplar]
ref|XP_004147416.1|  PREDICTED: chlorophyll a-b binding protein 4...    286   5e-94   Cucumis sativus [cucumbers]
ref|XP_002306927.1|  Chlorophyll a-b binding protein 2                  286   5e-94   Populus trichocarpa [western balsam poplar]
ref|XP_010052095.1|  PREDICTED: chlorophyll a-b binding protein o...    286   6e-94   Eucalyptus grandis [rose gum]
ref|XP_008229430.1|  PREDICTED: chlorophyll a-b binding protein o...    286   7e-94   Prunus mume [ume]
ref|XP_008800689.1|  PREDICTED: chlorophyll a-b binding protein o...    286   8e-94   Phoenix dactylifera
ref|XP_009630190.1|  PREDICTED: chlorophyll a-b binding protein 2...    286   1e-93   Nicotiana tomentosiformis
ref|XP_009598574.1|  PREDICTED: chlorophyll a-b binding protein 2...    285   1e-93   Nicotiana tomentosiformis
gb|AHB24929.1|  chloroplast light-harvesting complex II chlorophy...    285   1e-93   Sedum alfredii
ref|XP_002524616.1|  chlorophyll A/B binding protein, putative          285   1e-93   Ricinus communis
gb|AAB61237.1|  chlorophyll a/b-binding protein                         285   1e-93   Mesembryanthemum crystallinum
ref|XP_010275593.1|  PREDICTED: chlorophyll a-b binding protein o...    285   2e-93   Nelumbo nucifera [Indian lotus]
ref|XP_009775649.1|  PREDICTED: chlorophyll a-b binding protein 2...    285   2e-93   Nicotiana sylvestris
gb|EYU28187.1|  hypothetical protein MIMGU_mgv1a009948mg                287   2e-93   Erythranthe guttata [common monkey flower]
ref|XP_008229463.1|  PREDICTED: chlorophyll a-b binding protein, ...    283   2e-93   Prunus mume [ume]
gb|EYU28462.1|  hypothetical protein MIMGU_mgv1a012008mg                284   3e-93   Erythranthe guttata [common monkey flower]
gb|EYU38943.1|  hypothetical protein MIMGU_mgv1a012024mg                284   4e-93   Erythranthe guttata [common monkey flower]
ref|XP_009786355.1|  PREDICTED: chlorophyll a-b binding protein 2...    284   6e-93   Nicotiana sylvestris
gb|ABF70112.1|  chlorophyll A-B binding protein (CAB), putative         284   6e-93   Musa balbisiana [starchy banana]
dbj|BAA25389.1|  light harvesting chlorophyll a/b-binding protein       283   7e-93   Nicotiana sylvestris
ref|XP_007217260.1|  hypothetical protein PRUPE_ppa010015mg             283   7e-93   Prunus persica
ref|XP_009598577.1|  PREDICTED: chlorophyll a-b binding protein 2...    283   7e-93   Nicotiana tomentosiformis
gb|KJB66916.1|  hypothetical protein B456_010G165100                    283   7e-93   Gossypium raimondii
gb|KCW75954.1|  hypothetical protein EUGRSUZ_D00322                     286   9e-93   Eucalyptus grandis [rose gum]
gb|AEQ67395.1|  chloroplast chlorophyll A/B binding protein             283   9e-93   Canarium album [Chinese white-olive]
ref|XP_008229429.1|  PREDICTED: chlorophyll a-b binding protein o...    283   1e-92   Prunus mume [ume]
ref|XP_009775645.1|  PREDICTED: chlorophyll a-b binding protein 2...    283   1e-92   Nicotiana sylvestris
ref|XP_009775650.1|  PREDICTED: chlorophyll a-b binding protein 2...    283   1e-92   Nicotiana sylvestris
ref|XP_002285646.1|  PREDICTED: chlorophyll a-b binding protein o...    283   1e-92   Vitis vinifera
ref|XP_008356026.1|  PREDICTED: chlorophyll a-b binding protein o...    283   2e-92   Malus domestica [apple tree]
ref|XP_008364191.1|  PREDICTED: chlorophyll a-b binding protein o...    283   2e-92   
gb|AAT08668.1|  chloroplast chlorophyll A-B binding protein 40          281   2e-92   Hyacinthus orientalis [common hyacinth]
ref|XP_010052094.1|  PREDICTED: chlorophyll a-b binding protein o...    287   2e-92   
gb|AAA80593.1|  chlorophyll a/b binding protein                         282   2e-92   Solanum tuberosum [potatoes]
ref|XP_007215816.1|  hypothetical protein PRUPE_ppa010034mg             282   2e-92   Prunus persica
ref|XP_011045092.1|  PREDICTED: chlorophyll a-b binding protein o...    282   2e-92   Populus euphratica
ref|XP_009389379.1|  PREDICTED: chlorophyll a-b binding protein o...    282   2e-92   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004302854.1|  PREDICTED: chlorophyll a-b binding protein o...    282   3e-92   Fragaria vesca subsp. vesca
gb|ACN41907.1|  chlorophyll A/B binding protein                         282   3e-92   Gardenia jasminoides
ref|XP_004303878.1|  PREDICTED: chlorophyll a-b binding protein o...    282   3e-92   Fragaria vesca subsp. vesca
gb|KDP37944.1|  hypothetical protein JCGZ_04587                         281   3e-92   Jatropha curcas
gb|EYU28185.1|  hypothetical protein MIMGU_mgv1a012021mg                281   3e-92   Erythranthe guttata [common monkey flower]
dbj|BAF95850.1|  putative chloroplast chlorophyll a/b binding pro...    281   4e-92   Vitis hybrid cultivar
gb|EYU28186.1|  hypothetical protein MIMGU_mgv1a012011mg                281   4e-92   Erythranthe guttata [common monkey flower]
gb|AHB24928.1|  chloroplast chlorophyll a-b binding protein 2/3         281   4e-92   Sedum alfredii
gb|AAA18529.1|  chlorophyll A/B binding protein                         281   5e-92   Gossypium hirsutum [American cotton]
gb|ACO51067.1|  chloroplast chlorophyll A-B binding protein             281   5e-92   Gossypium hirsutum [American cotton]
gb|KJB69716.1|  hypothetical protein B456_011G041600                    281   5e-92   Gossypium raimondii
ref|NP_001266111.1|  chlorophyll a-b binding protein AB80, chloro...    281   6e-92   Cicer arietinum [garbanzo]
gb|KJB57287.1|  hypothetical protein B456_009G156900                    281   8e-92   Gossypium raimondii
gb|AAC25775.1|  chlorophyll a/b binding protein                         281   8e-92   Medicago sativa [alfalfa]
ref|XP_009377335.1|  PREDICTED: chlorophyll a-b binding protein o...    281   8e-92   Pyrus x bretschneideri [bai li]
gb|AAB61236.1|  chlorophyll a/b-binding protein                         281   9e-92   Mesembryanthemum crystallinum
ref|XP_008371581.1|  PREDICTED: chlorophyll a-b binding protein o...    281   1e-91   
ref|XP_008356022.1|  PREDICTED: chlorophyll a-b binding protein o...    281   1e-91   
ref|XP_006365560.1|  PREDICTED: chlorophyll a-b binding protein 1...    281   1e-91   Solanum tuberosum [potatoes]
gb|AHM26643.1|  a-b binding protein                                     280   1e-91   Pyrus x bretschneideri [bai li]
ref|XP_006365573.1|  PREDICTED: chlorophyll a-b binding protein 1...    280   1e-91   
ref|XP_008366007.1|  PREDICTED: chlorophyll a-b binding protein o...    280   1e-91   
ref|XP_008364187.1|  PREDICTED: chlorophyll a-b binding protein o...    280   1e-91   
ref|XP_004961193.1|  PREDICTED: chlorophyll a-b binding protein M...    280   1e-91   Setaria italica
gb|AFK40061.1|  unknown                                                 280   1e-91   Medicago truncatula
ref|XP_009416547.1|  PREDICTED: chlorophyll a-b binding protein o...    280   1e-91   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAA80591.1|  chlorophyll a/b binding protein                         280   1e-91   Solanum tuberosum [potatoes]
gb|ACR08639.1|  chloroplast chlorophyll A/B binding protein             280   1e-91   Mangifera indica
ref|XP_006467509.1|  PREDICTED: chlorophyll a-b binding protein 3...    280   2e-91   Citrus sinensis [apfelsine]
gb|AFI60242.1|  light harvesting chlorophyll a/b binding protein        280   2e-91   Panicum virgatum
gb|AAO45885.1|  chlorophyll a/b-binding protein precursor               278   2e-91   Citrus limon [lemon]
ref|XP_011045093.1|  PREDICTED: chlorophyll a-b binding protein o...    280   2e-91   Populus euphratica
ref|NP_001240146.1|  chlorophyll a-b binding protein 21, chloropl...    280   2e-91   Glycine max [soybeans]
ref|XP_009377344.1|  PREDICTED: chlorophyll a-b binding protein o...    280   2e-91   Pyrus x bretschneideri [bai li]
gb|AAR10886.1|  chlorophyll a/b binding protein                         280   2e-91   Trifolium pratense [peavine clover]
ref|XP_009598575.1|  PREDICTED: chlorophyll a-b binding protein 2...    280   2e-91   Nicotiana tomentosiformis
ref|XP_010926397.1|  PREDICTED: chlorophyll a-b binding protein o...    280   2e-91   Elaeis guineensis
ref|XP_010231410.1|  PREDICTED: chlorophyll a-b binding protein o...    280   3e-91   Brachypodium distachyon [annual false brome]
ref|XP_007025143.1|  Chlorophyll a-b binding protein, chloroplastic     279   3e-91   
ref|XP_004233096.1|  PREDICTED: chlorophyll a-b binding protein 1...    279   3e-91   
ref|XP_006365572.1|  PREDICTED: chlorophyll a-b binding protein 1...    279   3e-91   Solanum tuberosum [potatoes]
gb|AEO51755.1|  chloroplast chlorophyll A/B binding protein             279   3e-91   Dimocarpus longan [longan]
ref|XP_008371583.1|  PREDICTED: chlorophyll a-b binding protein o...    280   3e-91   
emb|CDP06328.1|  unnamed protein product                                279   3e-91   Coffea canephora [robusta coffee]
ref|XP_004303877.1|  PREDICTED: chlorophyll a-b binding protein o...    279   3e-91   Fragaria vesca subsp. vesca
ref|XP_004233101.1|  PREDICTED: chlorophyll a-b binding protein 1...    279   4e-91   
ref|XP_007211864.1|  hypothetical protein PRUPE_ppa010081mg             279   4e-91   Prunus persica
ref|XP_007211869.1|  hypothetical protein PRUPE_ppa010099mg             279   4e-91   Prunus persica
ref|XP_006368026.1|  PREDICTED: chlorophyll a-b binding protein 1...    279   4e-91   Solanum tuberosum [potatoes]
gb|AAA80592.1|  chlorophyll a/b binding protein                         279   5e-91   Solanum tuberosum [potatoes]
ref|XP_006449645.1|  hypothetical protein CICLE_v10016286mg             279   5e-91   
ref|XP_010666512.1|  PREDICTED: chlorophyll a-b binding protein, ...    279   5e-91   Beta vulgaris subsp. vulgaris [field beet]
sp|P04779.1|CB21_PETSP  RecName: Full=Chlorophyll a-b binding pro...    279   5e-91   Petunia sp.
ref|XP_010666522.1|  PREDICTED: uncharacterized protein LOC104883672    290   6e-91   
gb|ABQ32304.1|  chloroplast light-harvesting chlorophyll a/b-bind...    278   7e-91   Artemisia annua [sweet Annie]
gb|EYU28183.1|  hypothetical protein MIMGU_mgv1a012019mg                278   7e-91   Erythranthe guttata [common monkey flower]
prf||1204205B  protein 1B,chlorophyll binding                           278   7e-91
sp|P12329.1|CB21_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    278   7e-91   Zea mays [maize]
gb|EYU29602.1|  hypothetical protein MIMGU_mgv1a019986mg                278   7e-91   Erythranthe guttata [common monkey flower]
ref|XP_006449643.1|  hypothetical protein CICLE_v10016287mg             278   8e-91   Citrus clementina [clementine]
ref|XP_007151992.1|  hypothetical protein PHAVU_004G0927000g            276   8e-91   Phaseolus vulgaris [French bean]
ref|XP_006415534.1|  hypothetical protein EUTSA_v10008479mg             278   9e-91   Eutrema salsugineum [saltwater cress]
ref|XP_006449644.1|  hypothetical protein CICLE_v10016074mg             280   9e-91   
gb|EYU28184.1|  hypothetical protein MIMGU_mgv1a011918mg                278   9e-91   Erythranthe guttata [common monkey flower]
gb|AFK40204.1|  unknown                                                 276   1e-90   Lotus japonicus
gb|ACG30091.1|  chlorophyll a-b binding protein 2                       277   1e-90   Zea mays [maize]
ref|XP_003548106.1|  PREDICTED: chlorophyll a/b-binding protein p...    278   1e-90   
ref|XP_003548104.1|  PREDICTED: chlorophyll a-b binding protein 2...    278   1e-90   
gb|AAA80594.1|  chlorophyll a/b binding protein                         278   1e-90   Solanum tuberosum [potatoes]
ref|XP_010538237.1|  PREDICTED: chlorophyll a-b binding protein 1...    278   1e-90   Tarenaya hassleriana [spider flower]
gb|AAF26741.1|AF220527_1  chlorophyll a/b binding protein precursor     278   2e-90   Euphorbia esula [wolf's milk]
emb|CDP06329.1|  unnamed protein product                                277   2e-90   Coffea canephora [robusta coffee]
gb|EYU29604.1|  hypothetical protein MIMGU_mgv1a023200mg                278   2e-90   Erythranthe guttata [common monkey flower]
gb|ABW70800.1|  chloroplast light harvesting chlorophyll a/b bind...    277   2e-90   Populus euphratica
ref|XP_007025148.1|  Chlorophyll a-b binding protein, chloroplastic     277   2e-90   Theobroma cacao [chocolate]
dbj|BAA24493.1|  chlorophyll a/b-binding protein                        277   2e-90   Fagus crenata
gb|AAW31511.1|  light-harvesting chlorophyll-a/b binding protein ...    277   2e-90   Pisum sativum [garden pea]
gb|ABN49454.2|  chloroplast chlorophyll a/b binding protein             277   2e-90   Pisum sativum [garden pea]
ref|XP_004957570.1|  PREDICTED: chlorophyll a-b binding protein 1...    277   3e-90   Setaria italica
ref|NP_001147639.1|  chlorophyll a-b binding protein 1, chloropla...    277   3e-90   
gb|ADL41158.1|  chloroplast light-harvesting chlorophyll a/b bind...    277   3e-90   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002455902.1|  hypothetical protein SORBIDRAFT_03g027040          277   3e-90   Sorghum bicolor [broomcorn]
gb|AFW90594.1|  chloroplast chlorophyll a/b binding protein             277   3e-90   Solanum tuberosum [potatoes]
gb|AGU28449.1|  chlorophyll A/B binding protein 1                       274   3e-90   Sinapis alba [bai jie]
gb|AAH53854.1|  Unknown (protein for IMAGE:5194336)                     277   3e-90   Homo sapiens [man]
gb|AGV54498.1|  LHCII type I chlorophyll a/b-binding protein            276   4e-90   Phaseolus vulgaris [French bean]
gb|AAF89206.1|AF279249_1  LHCII type I chlorophyll a/b-binding pr...    276   4e-90   Vigna radiata [mung bean]
ref|XP_010316911.1|  PREDICTED: chlorophyll a-b binding protein 1...    276   4e-90   
gb|AES74698.2|  light-harvesting complex I chlorophyll A/B-bindin...    276   4e-90   Medicago truncatula
ref|XP_007158464.1|  hypothetical protein PHAVU_002G154500g             276   5e-90   Phaseolus vulgaris [French bean]
gb|AAZ79657.1|  putative chlorophyll a/b-binding protein                276   5e-90   Fagus sylvatica
gb|AAB87573.1|  chlorophyll a/b binding protein of LHCII type I p...    276   5e-90   Panax ginseng [Asiatic ginseng]
ref|XP_007151979.1|  hypothetical protein PHAVU_004G091600g             276   6e-90   Phaseolus vulgaris [French bean]
ref|NP_001142284.1|  uncharacterized protein LOC100274453               276   6e-90   Zea mays [maize]
gb|ACD64978.1|  chloroplast chlorophyll a/b-binding protein             276   6e-90   Ophiopogon japonicus
gb|AGV54521.1|  LHCII type I chlorophyll a/b-binding protein            276   6e-90   Phaseolus vulgaris [French bean]
ref|XP_009377327.1|  PREDICTED: chlorophyll a-b binding protein o...    276   7e-90   Pyrus x bretschneideri [bai li]
ref|XP_004293579.1|  PREDICTED: chlorophyll a-b binding protein o...    276   7e-90   Fragaria vesca subsp. vesca
ref|XP_002890838.1|  hypothetical protein ARALYDRAFT_473204             276   7e-90   
ref|XP_002283566.1|  PREDICTED: chlorophyll a-b binding protein o...    276   8e-90   Vitis vinifera
gb|ACU23974.1|  unknown                                                 276   9e-90   Glycine max [soybeans]
ref|XP_002455901.1|  hypothetical protein SORBIDRAFT_03g027030          276   1e-89   Sorghum bicolor [broomcorn]
ref|XP_010316912.1|  PREDICTED: chlorophyll a-b binding protein 1...    275   1e-89   
dbj|BAJ08392.1|  light harvesting chlorophyll a/b-binding protein...    275   1e-89   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT29002.1|  Chlorophyll a-b binding protein, chloroplastic          275   1e-89   
ref|XP_004969083.1|  PREDICTED: chlorophyll a-b binding protein 2...    275   1e-89   Setaria italica
ref|XP_010549470.1|  PREDICTED: chlorophyll a-b binding protein 1...    275   1e-89   Tarenaya hassleriana [spider flower]
ref|XP_009794580.1|  PREDICTED: chlorophyll a-b binding protein 7...    271   1e-89   Nicotiana sylvestris
sp|P07371.1|CB22_PEA  RecName: Full=Chlorophyll a-b binding prote...    275   1e-89   Pisum sativum [garden pea]
ref|XP_007151996.1|  hypothetical protein PHAVU_004G093000g             275   1e-89   Phaseolus vulgaris [French bean]
ref|XP_006305533.1|  hypothetical protein CARUB_v10010022mg             275   1e-89   Capsella rubella
gb|AAB18209.1|  chlorophyll a/b-binding protein WCAB precursor          275   2e-89   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006304391.1|  hypothetical protein CARUB_v10010908mg             275   2e-89   Capsella rubella
gb|EYU19613.1|  hypothetical protein MIMGU_mgv1a011885mg                275   2e-89   Erythranthe guttata [common monkey flower]
ref|XP_010237260.1|  PREDICTED: chlorophyll a-b binding protein o...    275   2e-89   Brachypodium distachyon [annual false brome]
emb|CDY66768.1|  BnaAnng22920D                                          275   2e-89   Brassica napus [oilseed rape]
ref|XP_010231015.1|  PREDICTED: chlorophyll a-b binding protein o...    275   2e-89   Brachypodium distachyon [annual false brome]
gb|AAT08694.1|  chloroplast chlorophyll A-B binding protein 40          273   3e-89   Hyacinthus orientalis [common hyacinth]
sp|P09756.1|CB23_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    274   3e-89   Glycine max [soybeans]
ref|NP_001241277.1|  uncharacterized protein LOC100805310               274   3e-89   Glycine max [soybeans]
dbj|BAJ87673.1|  predicted protein                                      275   3e-89   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93064.1|  predicted protein                                      274   3e-89   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002893588.1|  hypothetical protein ARALYDRAFT_473203             274   3e-89   
ref|XP_010097596.1|  Chlorophyll a-b binding protein 40                 274   3e-89   Morus notabilis
ref|XP_009141380.1|  PREDICTED: chlorophyll a-b binding protein 1...    274   4e-89   Brassica rapa
emb|CDP06330.1|  unnamed protein product                                274   4e-89   Coffea canephora [robusta coffee]
ref|XP_006856963.1|  hypothetical protein AMTR_s00189p00032350          274   4e-89   Amborella trichopoda
gb|EYU19649.1|  hypothetical protein MIMGU_mgv1a011927mg                274   4e-89   Erythranthe guttata [common monkey flower]
gb|ABQ81856.1|  chloroplast chlorophyll a/b binding protein             274   4e-89   Phyllostachys edulis [kikko-chiku]
gb|KHN28981.1|  Chlorophyll a-b binding protein 3, chloroplastic        274   4e-89   Glycine soja [wild soybean]
gb|ABQ81857.1|  chloroplast chlorophyll a/b binding protein             274   4e-89   Phyllostachys edulis [kikko-chiku]
ref|XP_010478366.1|  PREDICTED: chlorophyll a-b binding protein 1...    274   5e-89   Camelina sativa [gold-of-pleasure]
ref|XP_002460622.1|  hypothetical protein SORBIDRAFT_02g032040          273   5e-89   Sorghum bicolor [broomcorn]
gb|AAF89207.1|AF279250_1  LHCII type I chlorophyll a/b-binding pr...    274   5e-89   Vigna radiata [mung bean]
ref|XP_010499509.1|  PREDICTED: chlorophyll a-b binding protein 1...    274   5e-89   Camelina sativa [gold-of-pleasure]
ref|NP_174286.1|  chlorophyll A/B binding protein 1                     274   5e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006467511.1|  PREDICTED: chlorophyll a-b binding protein 3...    278   5e-89   
emb|CDY35271.1|  BnaC03g59520D                                          274   5e-89   Brassica napus [oilseed rape]
emb|CDY26306.1|  BnaA09g26570D                                          274   6e-89   Brassica napus [oilseed rape]
ref|XP_010460769.1|  PREDICTED: chlorophyll a-b binding protein 1...    273   6e-89   
ref|XP_007151990.1|  hypothetical protein PHAVU_004G092600g             273   6e-89   Phaseolus vulgaris [French bean]
ref|XP_010460768.1|  PREDICTED: chlorophyll a-b binding protein 2...    273   6e-89   Camelina sativa [gold-of-pleasure]
ref|XP_011460161.1|  PREDICTED: chlorophyll a-b binding protein o...    273   7e-89   Fragaria vesca subsp. vesca
gb|EMS57503.1|  Chlorophyll a-b binding protein, chloroplastic          273   7e-89   Triticum urartu
gb|KEH25006.1|  light-harvesting complex I chlorophyll A/B-bindin...    273   8e-89   Medicago truncatula
ref|XP_004489391.1|  PREDICTED: chlorophyll a-b binding protein 3...    273   9e-89   Cicer arietinum [garbanzo]
gb|EYU43278.1|  hypothetical protein MIMGU_mgv1a011933mg                273   9e-89   Erythranthe guttata [common monkey flower]
gb|AFV34722.1|  light harvesting chlorophyll a/b-binding protein 1-1    273   1e-88   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_009102798.1|  PREDICTED: chlorophyll a-b binding protein 1...    273   1e-88   Brassica rapa
gb|EMT29003.1|  Chlorophyll a-b binding protein, chloroplastic          273   1e-88   
gb|KEH25007.1|  light-harvesting complex I chlorophyll A/B-bindin...    273   1e-88   
gb|ACN31249.1|  unknown                                                 271   1e-88   
gb|KFK44818.1|  hypothetical protein AALP_AA1G306800                    273   1e-88   
ref|XP_006415537.1|  hypothetical protein EUTSA_v10008476mg             273   1e-88   
gb|KEH25005.1|  light-harvesting complex I chlorophyll A/B-bindin...    273   1e-88   
ref|XP_009400578.1|  PREDICTED: chlorophyll a-b binding protein o...    273   1e-88   
gb|ABG29728.1|  chloroplast chlorophyll a/b binding protein             273   1e-88   
sp|P92919.1|CB23_APIGR  RecName: Full=Chlorophyll a-b binding pro...    273   1e-88   
ref|XP_008358195.1|  PREDICTED: chlorophyll a-b binding protein o...    273   1e-88   
ref|XP_010097597.1|  Chlorophyll a-b binding protein 40                 272   2e-88   
gb|EMS51039.1|  Chlorophyll a-b binding protein 3C, chloroplastic       272   2e-88   
gb|EYU43289.1|  hypothetical protein MIMGU_mgv11b019945mg               272   2e-88   
dbj|BAJ89881.1|  predicted protein                                      272   2e-88   
gb|AAL38341.1|  chlorophyll a/b-binding protein                         272   2e-88   
gb|KFK36334.1|  hypothetical protein AALP_AA4G109200                    272   2e-88   
ref|NP_564339.1|  chlorophyll A/B binding protein 3                     272   2e-88   
gb|EMS50796.1|  Chlorophyll a-b binding protein, chloroplastic          272   2e-88   
gb|AFK39586.1|  unknown                                                 272   2e-88   
ref|XP_003578592.1|  PREDICTED: chlorophyll a-b binding protein o...    272   2e-88   
ref|XP_002515206.1|  chlorophyll A/B binding protein, putative          272   3e-88   
ref|XP_010499505.1|  PREDICTED: chlorophyll a-b binding protein 2...    272   3e-88   
dbj|BAJ90643.1|  predicted protein                                      272   3e-88   
gb|EMS50795.1|  Chlorophyll a-b binding protein, chloroplastic          273   3e-88   
emb|CDX99866.1|  BnaC05g22880D                                          272   3e-88   
sp|P27490.1|CB28_PEA  RecName: Full=Chlorophyll a-b binding prote...    272   3e-88   
gb|ABM66819.1|  chloroplast light-harvesting chlorophyll a/b bind...    271   3e-88   
gb|AEV59638.1|  chloroplast photosystem II light harvesting compl...    270   4e-88   
gb|ACU23816.1|  unknown                                                 271   4e-88   
ref|XP_006410587.1|  hypothetical protein EUTSA_v10017088mg             271   4e-88   
gb|ADC35579.1|  chloroplast chlorophyll a/b binding protein             271   4e-88   
dbj|BAA03104.1|  light-harvesting chlorophyll a/b-binding protein...    271   5e-88   
emb|CDX84316.1|  BnaC04g10780D                                          271   5e-88   
ref|XP_008675448.1|  PREDICTED: chlorophyll a-b binding protein o...    271   5e-88   
emb|CDY17247.1|  BnaA05g09410D                                          271   6e-88   
ref|NP_001148439.1|  chlorophyll a-b binding protein 2                  271   6e-88   
gb|EPS64140.1|  chlorophyll a-b binding protein 21, chloroplastic       271   7e-88   
ref|XP_009363087.1|  PREDICTED: chlorophyll a-b binding protein o...    271   7e-88   
ref|XP_009143778.1|  PREDICTED: chlorophyll a-b binding protein 1...    271   8e-88   
gb|AFW90512.1|  chlorophyll a/b-binding protein                         270   8e-88   
gb|AEV59641.1|  chloroplast photosystem II light harvesting compl...    270   8e-88   
tpg|DAA58853.1|  TPA: hypothetical protein ZEAMMB73_924562              270   8e-88   
gb|AFO67219.1|  putative chlorophyll a/b binding protein                266   9e-88   
gb|AEV59640.1|  chloroplast photosystem II light harvesting compl...    270   9e-88   
ref|XP_010509751.1|  PREDICTED: chlorophyll a-b binding protein 1...    270   1e-87   
ref|NP_001062939.1|  Os09g0346500                                       270   1e-87   
gb|EYU35814.1|  hypothetical protein MIMGU_mgv1a011908mg                270   1e-87   
gb|AEV59642.1|  chloroplast photosystem II light harvesting compl...    269   1e-87   
gb|AAD21625.1|  putative chlorophyll a/b-binding protein                271   1e-87   
gb|ACL50948.1|  putative chloroplast chlorophyll a/b binding protein    270   1e-87   
gb|EMT04380.1|  Chlorophyll a-b binding protein, chloroplastic          275   1e-87   
gb|AHA84197.1|  chlorophyll a/b-binding protein                         270   1e-87   
emb|CAG25596.1|  putative chlorophyll a/b binding protein               270   1e-87   
gb|AEV59639.1|  chloroplast photosystem II light harvesting compl...    269   1e-87   
gb|AEY85026.1|  light-harvesting complex II protein                     270   1e-87   
gb|AAA60965.1|  light-harvesting chlorophyll a/b binding protein ...    270   1e-87   
dbj|BAJ85110.1|  predicted protein                                      270   2e-87   
gb|EMS67016.1|  Chlorophyll a-b binding protein, chloroplastic          270   2e-87   
gb|EMT02412.1|  Chlorophyll a-b binding protein, chloroplastic          270   2e-87   
ref|XP_007221496.1|  hypothetical protein PRUPE_ppa010066mg             270   2e-87   
ref|NP_565787.1|  light-harvesting chlorophyll protein complex II...    270   2e-87   
ref|XP_006293384.1|  hypothetical protein CARUB_v10023856mg             270   2e-87   
sp|P08963.1|CB22_HORVU  RecName: Full=Chlorophyll a-b binding pro...    269   2e-87   
ref|NP_001043493.1|  Os01g0600900                                       269   3e-87   
ref|XP_008343203.1|  PREDICTED: chlorophyll a-b binding protein o...    271   3e-87   
ref|XP_009360962.1|  PREDICTED: chlorophyll a-b binding protein o...    270   3e-87   
emb|CDY17248.1|  BnaA05g09400D                                          269   3e-87   
gb|EMS50798.1|  Chlorophyll a-b binding protein, chloroplastic          270   3e-87   
gb|AEV59645.1|  chloroplast photosystem II light harvesting compl...    268   3e-87   
gb|AEV59643.1|  chloroplast photosystem II light harvesting compl...    268   3e-87   
sp|P13851.1|CB21_SINAL  RecName: Full=Chlorophyll a-b binding pro...    269   4e-87   
dbj|BAJ90772.1|  predicted protein                                      269   4e-87   
dbj|BAA00536.1|  type I light-harvesting chlorophyll a/b-binding ...    269   4e-87   
emb|CDX79562.1|  BnaC03g18980D                                          269   4e-87   
ref|XP_002879498.1|  LHB1B1                                             269   4e-87   
gb|AAL67432.1|AF458406_1  chlorophyll a/b binding protein               269   4e-87   
ref|XP_007158961.1|  hypothetical protein PHAVU_002G196400g             269   4e-87   
gb|EMT02225.1|  Chlorophyll a-b binding protein, chloroplastic          269   4e-87   
gb|EMS50797.1|  Chlorophyll a-b binding protein, chloroplastic          269   5e-87   
gb|AHA84168.1|  chlorophyll a/b-binding protein                         268   5e-87   
emb|CDX98158.1|  BnaC07g09400D                                          268   5e-87   
sp|P04784.1|CB21_WHEAT  RecName: Full=Chlorophyll a-b binding pro...    268   6e-87   
dbj|BAK02173.1|  predicted protein                                      268   6e-87   
dbj|BAJ87045.1|  predicted protein                                      268   6e-87   
gb|EMS45686.1|  Chlorophyll a-b binding protein, chloroplastic          268   7e-87   
ref|XP_006365561.1|  PREDICTED: chlorophyll a-b binding protein 1...    268   7e-87   
ref|XP_006368025.1|  PREDICTED: chlorophyll a-b binding protein 1...    268   7e-87   
gb|AFW90565.1|  chlorophyll a-b binding protein 3C-like mRNA            267   8e-87   
gb|AAM64379.1|  putative photosystem II type I chlorophyll a b bi...    268   8e-87   
gb|EMS59660.1|  Chlorophyll a-b binding protein, chloroplastic          270   9e-87   
dbj|BAK03973.1|  predicted protein                                      268   9e-87   
ref|NP_565786.1|  photosystem II light harvesting complex protein...    268   9e-87   
ref|XP_010504897.1|  PREDICTED: chlorophyll a-b binding protein 1...    268   9e-87   
ref|XP_010509756.1|  PREDICTED: chlorophyll a-b binding protein 1...    268   1e-86   
ref|NP_001235283.1|  chlorophyll a/b-binding protein                    268   1e-86   
gb|AGU28448.1|  light-harvesting chlorophyll-protein complex II s...    268   1e-86   
ref|XP_006295385.1|  hypothetical protein CARUB_v10024479mg             268   1e-86   
ref|XP_003633024.1|  PREDICTED: chlorophyll a-b binding protein o...    268   1e-86   
gb|AAP44089.1|  chlorophyll a/b binding protein                         268   1e-86   
dbj|BAJ86427.1|  predicted protein                                      268   1e-86   
ref|XP_009132986.1|  PREDICTED: chlorophyll a-b binding protein 1...    267   2e-86   
ref|XP_010504898.1|  PREDICTED: chlorophyll a-b binding protein 1...    267   2e-86   
gb|AAD27879.2|AF139467_1  LHCII type I chlorophyll a/b binding pr...    267   2e-86   
emb|CAA61432.1|  LHCII type I protein                                   267   2e-86   
gb|EMS51257.1|  Chlorophyll a-b binding protein 1, chloroplastic        268   3e-86   
gb|EMT25652.1|  hypothetical protein F775_43704                         278   3e-86   
emb|CDX84315.1|  BnaC04g10770D                                          269   3e-86   
gb|KFK44817.1|  hypothetical protein AALP_AA1G306700                    266   4e-86   
gb|EMT04379.1|  Chlorophyll a-b binding protein, chloroplastic          266   4e-86   
ref|XP_002273106.2|  PREDICTED: chlorophyll a-b binding protein o...    266   4e-86   
gb|AAG52048.1|AC022455_2  chlorophyll A-B-binding protein 2 precu...    266   4e-86   
ref|XP_002302798.2|  hypothetical protein POPTR_0002s19010g             266   5e-86   
gb|EYU43279.1|  hypothetical protein MIMGU_mgv1a011871mg                266   6e-86   
ref|XP_002275075.1|  PREDICTED: chlorophyll a-b binding protein o...    266   6e-86   
gb|KFK36335.1|  hypothetical protein AALP_AA4G109300                    266   6e-86   
emb|CAN78667.1|  hypothetical protein VITISV_031287                     266   6e-86   
gb|EMT09894.1|  Chlorophyll a-b binding protein, chloroplastic          266   7e-86   
prf||1503276A  chlorophyll a/b binding protein                          265   7e-86
sp|P12471.1|CB21_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    265   8e-86   
ref|XP_006660556.1|  PREDICTED: chlorophyll a-b binding protein 2...    265   8e-86   
dbj|BAD97888.1|  CAB homologue1                                         264   1e-85   
emb|CAA32108.1|  chlorophyll a/b-binding preprotein (AA -31 to 235)     265   1e-85   
dbj|BAJ87240.1|  predicted protein                                      265   1e-85   
pdb|1RWT|A  Chain A, Crystal Structure Of Spinach Major Light-har...    263   2e-85   
ref|XP_009109634.1|  PREDICTED: chlorophyll a-b binding protein 2...    265   2e-85   
gb|KFK42335.1|  hypothetical protein AALP_AA2G243100                    264   3e-85   
emb|CAC38830.1|  chlorophyll a/b binding protein                        264   3e-85   
ref|XP_004148579.1|  PREDICTED: chlorophyll a-b binding protein 3...    263   6e-85   
emb|CAH59405.1|  light harvesting protein 1                             262   6e-85   
ref|XP_009143774.1|  PREDICTED: chlorophyll a-b binding protein 1...    263   6e-85   
gb|ABV26426.1|  light-harvesting chlorophyll a/b-binding protein        259   7e-85   
gb|AAU89255.1|  chloroplast light harvesting chlorophyll a/b bind...    263   8e-85   
gb|AIB04243.1|  chloroplast light harvesting chlorophyll a/b bind...    261   9e-85   
gb|ACI90635.1|  chloroplast light harvesting chlorophyll a/b bind...    262   1e-84   
gb|AAU89265.1|  chloroplast light harvesting chlorophyll a/b bind...    262   1e-84   
emb|CAA47950.1|  chlorophyll a/b binding protein                        263   1e-84   
gb|AAU89263.1|  chloroplast light harvesting chlorophyll a/b bind...    261   2e-84   
gb|AAU89264.1|  chloroplast light harvesting chlorophyll a/b bind...    261   2e-84   
gb|KHN41291.1|  Chlorophyll a-b binding protein of LHCII type I, ...    261   2e-84   
ref|XP_006844081.1|  hypothetical protein AMTR_s00006p00251360          262   2e-84   
ref|XP_002881334.1|  chlorophyll A-B-binding protein 2 precursor        261   3e-84   
ref|XP_010412864.1|  PREDICTED: uncharacterized protein LOC104699228    270   3e-84   
ref|XP_003618482.1|  Chlorophyll a/b-binding protein                    261   3e-84   
gb|AAU89253.1|  chloroplast light harvesting chlorophyll a/b bind...    261   3e-84   
gb|ABK20976.1|  unknown                                                 262   3e-84   
gb|AAU89250.1|  chloroplast light harvesting chlorophyll a/b bind...    261   3e-84   
gb|AAU89251.1|  chloroplast light harvesting chlorophyll a/b bind...    261   3e-84   
emb|CAA57408.1|  light harvesting chlorophyll a /b-binding protei...    261   4e-84   
gb|AIB04244.1|  chloroplast light harvesting chlorophyll a/b bind...    259   5e-84   
gb|ACI90632.1|  chloroplast light harvesting chlorophyll a/b bind...    260   5e-84   
ref|XP_008447450.1|  PREDICTED: chlorophyll a-b binding protein o...    261   6e-84   
ref|XP_006840304.1|  hypothetical protein AMTR_s00045p00069900          260   7e-84   
gb|ABK22510.1|  unknown                                                 261   7e-84   
gb|AAU89257.1|  chloroplast light harvesting chlorophyll a/b bind...    260   7e-84   
emb|CAA57409.1|  light harvesting chlorophyll a /b-binding protei...    261   8e-84   
gb|ACI90636.1|  chloroplast light harvesting chlorophyll a/b bind...    259   8e-84   
gb|AAU89262.1|  chloroplast light harvesting chlorophyll a/b bind...    260   9e-84   
gb|ACI90631.1|  chloroplast light harvesting chlorophyll a/b bind...    259   1e-83   
gb|AAY81729.1|  chloroplast putative light harvesting chlorophyll...    259   1e-83   
gb|AAU89261.1|  chloroplast light harvesting chlorophyll a/b bind...    259   1e-83   
gb|AAU89254.1|  chloroplast light harvesting chlorophyll a/b bind...    259   1e-83   
gb|ACN40194.1|  unknown                                                 260   1e-83   
ref|NP_001105545.1|  chlorophyll a-b binding protein M9, chloropl...    260   1e-83   
ref|XP_009102801.1|  PREDICTED: chlorophyll a-b binding protein 1...    260   1e-83   
sp|P15193.1|CB2A_PINSY  RecName: Full=Chlorophyll a-b binding pro...    260   1e-83   
ref|XP_010091411.1|  Chlorophyll a-b binding protein 16                 259   2e-83   
ref|XP_006840305.1|  hypothetical protein AMTR_s00045p00070890          258   2e-83   
emb|CAA32109.1|  chlorophyll a/b-binding preprotein (AA -28 to 235)     259   2e-83   
gb|AAU89252.1|  chloroplast light harvesting chlorophyll a/b bind...    259   2e-83   
sp|P24006.1|CB2A_PYRPY  RecName: Full=Chlorophyll a-b binding pro...    260   2e-83   
gb|AAC78690.1|  chlorophyll a/b-binding protein                         259   2e-83   
gb|ACY66805.1|  chlorophyll a/b-binding protein                         259   2e-83   
gb|AAY81730.1|  chloroplast putative light harvesting chlorophyll...    258   3e-83   
gb|AIW07979.1|  chloroplast light harvesting chlorophyll a/b bind...    259   3e-83   
gb|AAU89256.1|  chloroplast light harvesting chlorophyll a/b bind...    259   3e-83   
gb|EMS67017.1|  Chlorophyll a-b binding protein, chloroplastic          259   3e-83   
ref|WP_037445947.1|  hypothetical protein                               255   5e-83   
gb|ADV19258.1|  chlorophyll a/b-binding protein-like protein            257   5e-83   
gb|AIW08054.1|  chloroplast light harvesting chlorophyll a/b bind...    258   5e-83   
gb|ACF84273.1|  unknown                                                 258   8e-83   
gb|ACF85694.1|  unknown                                                 258   8e-83   
ref|XP_002440263.1|  hypothetical protein SORBIDRAFT_09g028720          258   9e-83   
ref|XP_010374558.1|  PREDICTED: chlorophyll a-b binding protein o...    256   1e-82   
sp|P15194.1|CB2B_PINSY  RecName: Full=Chlorophyll a-b binding pro...    258   1e-82   
gb|AFW81158.1|  light harvesting chlorophyll a/b binding protein3       259   1e-82   
gb|ABK26463.1|  unknown                                                 256   2e-82   
pdb|1VCR|A  Chain A, An Icosahedral Assembly Of Light-Harvesting ...    256   2e-82   
ref|XP_011003152.1|  PREDICTED: chlorophyll a-b binding protein o...    257   2e-82   
ref|WP_039311774.1|  hypothetical protein                               252   2e-82   
gb|ABK24790.1|  unknown                                                 253   2e-82   
gb|ACN40044.1|  unknown                                                 257   3e-82   
ref|XP_004164941.1|  PREDICTED: chlorophyll a-b binding protein 4...    252   3e-82   
gb|EMT23952.1|  Chlorophyll a-b binding protein 1B, chloroplastic       256   3e-82   
sp|P06671.1|CB22_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    256   5e-82   
gb|AFO67221.1|  putative chlorophyll a/b binding protein                252   5e-82   
emb|CAA57407.1|  light harvesting chlorophyll a /b-binding protei...    256   1e-81   
gb|ABK23263.1|  unknown                                                 255   1e-81   
gb|ABK26071.1|  unknown                                                 255   2e-81   
gb|KDO36894.1|  hypothetical protein CISIN_1g044971mg                   250   2e-81   
gb|ABK23849.1|  unknown                                                 255   2e-81   
pdb|2BHW|A  Chain A, Pea Light-Harvesting Complex Ii At 2.5 Angst...    252   5e-81   
ref|XP_002960494.1|  light-harvesting complex                           253   5e-81   
gb|ABK22330.1|  unknown                                                 253   6e-81   
gb|EMT11232.1|  Chlorophyll a-b binding protein, chloroplastic          254   1e-80   
ref|XP_002967230.1|  light-harvesting complex                           252   1e-80   
emb|CAA27542.1|  chlorophyll a/b binding protein (LHCP AB 180)          251   1e-80   
gb|KCW73782.1|  hypothetical protein EUGRSUZ_E02381                     252   1e-80   
gb|ACN40027.1|  unknown                                                 252   2e-80   
ref|NP_001105427.1|  light harvesting chlorophyll a /b binding pr...    251   2e-80   
gb|EYU28189.1|  hypothetical protein MIMGU_mgv1a020664mg                250   4e-80   
prf||1615137B  chlorophyll a/b binding protein P27                      249   4e-80
sp|Q00827.1|CB48_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    251   4e-80   
sp|P09755.1|CB22_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    250   7e-80   
pdb|4LCZ|A  Chain A, Crystal Structure Of A Multilayer-packed Maj...    248   1e-79   
gb|EMS53958.1|  Chlorophyll a-b binding protein 3C, chloroplastic       249   2e-79   
gb|AAT08647.1|  chloroplast chlorophyll A-B binding protein 3C          247   3e-79   
ref|NP_001044090.1|  Os01g0720500                                       247   1e-78   
gb|EMT02753.1|  Chlorophyll a-b binding protein 3C, chloroplastic       246   4e-78   
ref|XP_004144543.1|  PREDICTED: chlorophyll a-b binding protein 1...    246   4e-78   
sp|P04159.1|CB21_PEA  RecName: Full=Chlorophyll a-b binding prote...    244   6e-78   
ref|XP_008462084.1|  PREDICTED: chlorophyll a-b binding protein 1...    244   1e-77   
ref|XP_011100602.1|  PREDICTED: chlorophyll a-b binding protein 5...    244   2e-77   



>ref|XP_011096521.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=286

 Score =   301 bits (771),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = +3

Query  54   TNMaastmalssssfaGKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVK  233
            T MAASTMALSS SFAG+AVK+SPS PEITGN + +MRKT  KPKP SSGSPWYGPDRVK
Sbjct  18   TTMAASTMALSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPKPASSGSPWYGPDRVK  77

Query  234  YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  413
            YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE
Sbjct  78   YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPE  137

Query  414  LLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            LL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  138  LLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  188



>ref|XP_006361530.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006361531.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   300 bits (768),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN +FTMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRFTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009795316.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   299 bits (765),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009593856.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   299 bits (765),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009782924.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   299 bits (765),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004169747.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46826.1| hypothetical protein Csa_6G139750 [Cucumis sativus]
Length=267

 Score =   298 bits (764),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+  ++ G  + TMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPTASDLLGEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_008456347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Cucumis 
melo]
Length=267

 Score =   298 bits (764),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+  ++ G  + TMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPTASDLLGEGRITMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009790934.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009795315.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009628754.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic 
[Nicotiana tomentosiformis]
Length=266

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>ref|XP_009790936.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   298 bits (763),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>sp|P12470.1|CB25_NICPL RecName: Full=Chlorophyll a-b binding protein E, chloroplastic; 
AltName: Full=LHCII type I CAB-E; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34056.1| chlorophyll a/b-binding protein-E [Nicotiana plumbaginifolia]
Length=266

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ E+TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>ref|XP_009618329.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
 ref|XP_009628756.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009611577.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=262

 Score =   297 bits (761),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  10   GKAVKLSPSSSEITGNGKATMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  69

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  70   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  129

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  130  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  164



>sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; 
AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36955.1| unnamed protein product [Nicotiana tabacum]
Length=266

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ E+TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49375.1| hypothetical protein Csa_6G522690 [Cucumis sativus]
Length=265

 Score =   297 bits (760),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 149/155 (96%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+ PEI GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPTAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>ref|XP_004134608.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
Length=265

 Score =   297 bits (760),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 149/155 (96%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+ PEI GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPNAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>ref|XP_004134603.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 1 [Cucumis sativus]
 ref|XP_004134604.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 2 [Cucumis sativus]
 ref|XP_004134605.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 3 [Cucumis sativus]
 gb|KGN49374.1| hypothetical protein Csa_6G522680 [Cucumis sativus]
Length=265

 Score =   297 bits (760),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 149/155 (96%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+ PEI GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPNAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>ref|XP_009782923.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   297 bits (760),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009782922.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   297 bits (760),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009597417.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana tomentosiformis]
Length=267

 Score =   297 bits (760),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009772885.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   296 bits (759),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_006356073.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   296 bits (758),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRITMRKTAAKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEA+WFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAIWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>sp|P08221.1|CB21_CUCSA RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor, partial 
[Cucumis sativus]
 gb|AAA33124.1| chlorophyll a/b-binding protein, partial [Cucumis sativus]
Length=255

 Score =   295 bits (756),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 144/155 (93%), Positives = 149/155 (96%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP+ PEI GNAKFTMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  5    GQAVKLSPNAPEIQGNAKFTMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  62

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  63   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  122

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  123  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  157



>ref|XP_009628755.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27495.1|CB24_TOBAC RecName: Full=Chlorophyll a-b binding protein 40, chloroplastic; 
AltName: Full=LHCII type I CAB-40; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36958.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009606802.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KP+SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLSPSSSEITGNGKVTMRKTASKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
             G+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  VGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>sp|P07369.1|CB2G_SOLLC RecName: Full=Chlorophyll a-b binding protein 3C, chloroplastic; 
AltName: Full=LHCII type I CAB-3C; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 prf||1204205G protein 3C,chlorophyll binding
Length=267

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>sp|P27496.1|CB25_TOBAC RecName: Full=Chlorophyll a-b binding protein 50, chloroplastic; 
AltName: Full=LHCII type I CAB-50; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36956.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   295 bits (756),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KP+SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_010317413.1| PREDICTED: chlorophyll a-b binding protein 3A, chloroplastic-like 
[Solanum lycopersicum]
Length=267

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ EI+GN + TMRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKTVKLAPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_006356077.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRVTMRKTAAKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>gb|AAA34148.1| chlorophyll a/b-binding protein Cab-3C [Solanum lycopersicum]
Length=267

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009795314.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25393.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=266

 Score =   295 bits (756),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSSGS WYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSGSLWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  168



>ref|XP_009606800.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   295 bits (755),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAML ALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLAALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009782921.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   295 bits (754),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EI GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEIIGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_010916097.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   294 bits (753),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS  EI G  + TMRKT  KPKPV++GSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLSPSASEINGEGRITMRKTVPKPKPVAAGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  134  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  168



>ref|XP_006356078.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   294 bits (753),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ E+TGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEVTGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHGRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_008784387.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   294 bits (753),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  EI G  + TMRKT  +PKPV+SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSASEILGEGRITMRKTFSRPKPVASGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  134  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  168



>ref|XP_009628757.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score =   294 bits (752),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SPS+ EI GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVRLSPSSSEIIGNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   294 bits (752),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K  MRKT  K KP+SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVMMRKTVTKAKPISSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_008779641.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   293 bits (751),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  +I G  + TMRK+ G+PKP++SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSASDIIGEGRITMRKSVGRPKPIASGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  134  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  168



>ref|XP_006356075.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=267

 Score =   293 bits (751),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQ+ILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQNILAIWACQVVL  169



>gb|ABF17940.1| putative chloroplast chlorophyll a/b-binding protein [Carya cathayensis]
Length=267

 Score =   293 bits (751),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 149/155 (96%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PS+ ++ G  + TMRKTAG+PKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAIKLAPSSSDLLGEGRVTMRKTAGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>ref|XP_008439658.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   293 bits (751),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+ PEI G  + TMRKTA   KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPNAPEIQGTGRITMRKTA--TKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>ref|XP_011096520.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Sesamum indicum]
Length=265

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS PEITGN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSAPEITGNGRVSMRKTVAKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  133  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  167



>ref|XP_011085268.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=265

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPST EITGN + +MRKT  KP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSTSEITGNGRVSMRKTVAKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  133  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  167



>gb|ABB55370.1| chlorophyll a-b binding protein 3C-like [Solanum tuberosum]
Length=267

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRK+  K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRITMRKSVAKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>sp|P12469.1|CB23_NICPL RecName: Full=Chlorophyll a-b binding protein C, chloroplastic; 
AltName: Full=LHCII type I CAB-C; Short=LHCP; Flags: Precursor 
[Nicotiana plumbaginifolia]
 gb|AAA34055.1| chlorophyll a/b-binding protein-C [Nicotiana plumbaginifolia]
Length=267

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN K TMRKTA K KPVSS SPWYGP+RVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
             G+QIFS+GGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  GGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009421488.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   292 bits (748),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  +I G  + TMRK+A + KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSASDILGEGRITMRKSAARSKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  134  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  168



>sp|P04783.1|CB25_PETSP RecName: Full=Chlorophyll a-b binding protein 91R, chloroplastic; 
AltName: Full=LHCII type I CAB-91R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26209.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   292 bits (747),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK SPS+ EITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTA LSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009782821.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK+SPS+ EITGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_010243713.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=267

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  E+ G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLAPSASELLGEGRITMRKTVAKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  169



>ref|XP_009782905.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK+SPS+ EITGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009775533.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Nicotiana 
sylvestris]
 dbj|BAA25395.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK+SPS+ EITGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>sp|P27491.1|CB27_TOBAC RecName: Full=Chlorophyll a-b binding protein 7, chloroplastic; 
AltName: Full=LHCII type I CAB-7; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA41187.1| chlorophyll a /b binding protein [Nicotiana tabacum]
Length=267

 Score =   292 bits (747),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK+SPS+ EITGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009396492.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   291 bits (746),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK++PS  ++ G  + TMRKT  KPKPV+SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GQAVKLAPSASDVLGGGRVTMRKTGAKPKPVASGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  134  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  168



>ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   291 bits (746),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 147/155 (95%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+PE+ GN + +MRKT    KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPSSPELMGNGRVSMRKTT---KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVL  166



>sp|P04780.1|CB22_PETSP RecName: Full=Chlorophyll a-b binding protein 22L, chloroplastic; 
AltName: Full=LHCII type I CAB-22L; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26212.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   291 bits (746),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK+SPS+ EITGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKVVKLSPSSSEITGNGKATMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNGVKFGEAVW K
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWLK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVLL  169



>ref|XP_006356074.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   291 bits (745),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK+SPS+ EITGN + TMRKT  K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKTVKLSPSSYEITGNGRVTMRKTTTKAKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_009618330.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   291 bits (744),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 146/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS  E TGN K TMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPS--ETTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>ref|XP_011011531.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
 ref|XP_011016419.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=264

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS+PE+ GN + +MRKT    KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLTPSSPELMGNGRVSMRKTT---KPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVL  166



>ref|XP_006356076.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ E+TGN + TMRK+  K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEVTGNGRVTMRKSVAKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQ+ILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQNILAIWACQVVL  169



>ref|XP_009759685.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25394.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EI GN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSG  PSYLTGE
Sbjct  15   GKAVKLSPSSYEIIGNGKVTMRKTVIKAKPVSSGSPWYGPDRVKYLGPFSGNSPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_010052093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
 gb|KCW75951.1| hypothetical protein EUGRSUZ_D00319 [Eucalyptus grandis]
Length=265

 Score =   290 bits (743),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 147/155 (95%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPSTPE+ GN + +MRKT GKP  VSSGSPWYGPDR KYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSTPELLGNGRVSMRKTVGKP--VSSGSPWYGPDRAKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+L
Sbjct  133  AGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVIL  167



>ref|XP_006356080.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK+SPS+ EITGN + TMRK+A K KP S GSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKTVKLSPSSSEITGNGRVTMRKSAAKAKPASFGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>emb|CAA78379.1| chlorophyll a/b-binding protein PS II-Type I [Solanum tuberosum]
Length=267

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN +FTMRKTA K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEITGNGRFTMRKTAAKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
             PGDYGWDTAGLSADPETFAKNRELEVIH RWA+L  LGCVFPELLSRNGVKFGEAVWFK
Sbjct  75   KPGDYGWDTAGLSADPETFAKNRELEVIHCRWAILERLGCVFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
             G+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  VGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>gb|KDP37945.1| hypothetical protein JCGZ_04588 [Jatropha curcas]
Length=265

 Score =   290 bits (741),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+ PS PE+ GN + TMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLGPSAPELMGNGRVTMRKTASKN--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  133  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  167



>ref|XP_010685893.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=267

 Score =   290 bits (741),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK +K+ P+  EI G  + TMRKTAGKPKP+SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKPIKLGPTPSEILGEGRITMRKTAGKPKPISSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  169



>ref|XP_002519724.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF42697.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   290 bits (741),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 146/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS PE+ GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPSAPELMGNGRVSMRKTAAKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  167



>ref|XP_004234241.1| PREDICTED: uncharacterized protein LOC101245729 [Solanum lycopersicum]
Length=554

 Score =   298 bits (764),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EI+GN + TMRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPSSSEISGNGRITMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169


 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS+ EITGN + TMRKTA K KP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  302  GKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGE  361

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  362  FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  421

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  422  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  456



>emb|CAJ77390.1| major chlorophyll a/b binding protein LHCb1.2 [Spinacia oleracea]
Length=267

 Score =   289 bits (739),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA+K+ P+  EI G  + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAIKLGPTASEILGEGRVTMRKTAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  169



>gb|AAB61238.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   289 bits (739),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++P+T +I G  + TMRKTAGK K VSS SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLNPTTSQILGEGRITMRKTAGKTKNVSSDSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  169



>gb|AIR93785.1| chloroplast light harvesting chlorophyll A/B binding protein 
[Kalanchoe fedtschenkoi]
Length=267

 Score =   289 bits (739),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PS  +I G  + +MRKT  KPKPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLAPSASDILGEGRISMRKTGAKPKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>gb|KCW75952.1| hypothetical protein EUGRSUZ_D00320 [Eucalyptus grandis]
Length=265

 Score =   288 bits (738),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 147/155 (95%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPSTPE+ GN + +MRKT GKP  VSSGSPWYGPDR K+LGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSTPELLGNGRVSMRKTVGKP--VSSGSPWYGPDRAKHLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNG+KFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGIKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+L
Sbjct  133  AGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVIL  167



>emb|CAJ77391.1| major chlorophyll a/b binding protein LHCb1.1 [Spinacia oleracea]
 emb|CAX64457.1| major chlorophyll a/b binding protein LHCb1.1 precursor [Spinacia 
oleracea]
Length=267

 Score =   288 bits (738),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PST ++ G  + +MRK+AGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLNPSTSDMIGEGRISMRKSAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  169



>ref|XP_010924306.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Elaeis 
guineensis]
Length=264

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PST  I G  + TMRKT GKP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSTSPILGEGRVTMRKTVGKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  166



>gb|AAT08651.1| chloroplast chlorophyll A-B binding protein [Hyacinthus orientalis]
Length=239

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK++PS+  ++G+ +FTMRKTAGKPK VSSGSPWYGP+RVKYLGPFSGE PSYLTGE
Sbjct  26   GTAVKLTPSSSVVSGDGRFTMRKTAGKPKTVSSGSPWYGPERVKYLGPFSGEAPSYLTGE  85

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  86   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  145

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  146  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVLL  180



>gb|AGJ50622.1| chlorophyll a/b binding protein [Salicornia brachiata]
Length=267

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK +K+ P+  EI G  + TMRKTAGKPK V+SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKPIKLGPNAAEILGEGRVTMRKTAGKPKQVASGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
             PGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   LPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  135  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  169



>sp|P12333.1|CB2A_SPIOL RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA32526.1| chlorophyll a/b binding protein precursor [Spinacia oleracea]
 emb|CAJ77389.3| major chlorophyll a/b binding protein LHCb1.3 [Spinacia oleracea]
Length=267

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+ P+  EI G  + TMRKTAGKPK V S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  169



>gb|ABD38707.1| chloroplast chlorophyll a/b binding protein [Pachysandra terminalis]
Length=267

 Score =   288 bits (736),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  E+ G  + +MRKT G+PKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLAPSASELLGVGRVSMRKTGGRPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVLL  169



>sp|P04781.1|CB23_PETSP RecName: Full=Chlorophyll a-b binding protein 22R, chloroplastic; 
AltName: Full=LHCII type I CAB-22R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26213.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   288 bits (736),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+S S+ EITGN K TMRKT  K KP SS SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSSSSSEITGNGKVTMRKTVTKAKPASSSSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FP DYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNG+KFGEAVWFK
Sbjct  75   FPSDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGIKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_010904844.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   287 bits (735),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS  +I G  + TMRK+ G+ +PV S SPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSASDIIGEGRITMRKSVGRSRPVVSDSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  134  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  168



>gb|AAA33396.1| light-harvesting chlorophyll a/b protein precursor [Lemna gibba]
Length=266

 Score =   287 bits (735),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++P+  E+ G  + +MRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  14   GKAVKLAPAASEVFGEGRVSMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            F GDYGWDTAGLSADPETFAKNRELEVIH+RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FAGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  168



>ref|XP_010056879.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=265

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SPSTPE+ G  + TMRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVQLSPSTPELFGKGRVTMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  133  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  167



>sp|P04782.1|CB24_PETSP RecName: Full=Chlorophyll a-b binding protein 25, chloroplastic; 
AltName: Full=LHCII type I CAB-25; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26211.1| unnamed protein product [Petunia sp.]
Length=266

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV V PS+ +ITGN K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVNV-PSSSQITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL +RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>ref|XP_008444193.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 147/155 (95%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS+PE+ GN++  MRK+A K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLTPSSPELFGNSRVNMRKSAAKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVL  167



>emb|CAX64458.1| major chlorophyll a/b binding protein LHCb1.4 precursor [Spinacia 
oleracea]
Length=267

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA+K+ P+  EI    + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAIKLGPTASEILSEGRVTMRKTAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  169



>ref|XP_004294267.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPST  + G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSTSTLFGEGRVTMRKTAAKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>ref|XP_008439659.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=338

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/155 (91%), Positives = 146/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+ PEI G  + TMRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  88   GKAVKLSPNAPEIQGTGRITMRKTATKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  145

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  146  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  205

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  206  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  240



>gb|AFC91647.1| chloroplast chlorophyll A/B binding protein [Hevea brasiliensis]
Length=265

 Score =   286 bits (733),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 146/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS P + GNA+ +MRK+ GKP  VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLTPSAPGLMGNARVSMRKSVGKP--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVL
Sbjct  133  AGAQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVL  167



>gb|KCW75953.1| hypothetical protein EUGRSUZ_D00321 [Eucalyptus grandis]
Length=300

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPSTPE+ GN + +MRK     KPVSSGSPWYGPDR KYLGPFSGEPPSYLTGE
Sbjct  50   GQAVKLSPSTPELLGNGRISMRKAV--RKPVSSGSPWYGPDRAKYLGPFSGEPPSYLTGE  107

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  108  FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  167

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+L
Sbjct  168  AGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVIL  202



>ref|XP_010247422.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=268

 Score =   287 bits (734),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 145/156 (93%), Gaps = 1/156 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPE-ITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK++PS  E + G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG
Sbjct  15   GKAVKLAPSASEKLLGEGRVTMRKTVAKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  74

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  458
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  75   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWF  134

Query  459  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            KAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  135  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  170



>ref|XP_009395692.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  PS  ++ G  + TMRKT  KPK   SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKFGPSVADVLGGGRVTMRKTGAKPKSAPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  134  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  168



>ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK94788.1| unknown [Populus trichocarpa]
 gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS+ EI GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPSSSEIMGNGRVSMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVL  166



>ref|XP_004147416.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65549.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 147/155 (95%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+PE+ GN++ TMRK+A   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKVVKLTPSSPELFGNSRVTMRKSA--TKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVL  167



>ref|XP_002306927.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK95787.1| unknown [Populus trichocarpa]
 gb|ABK96559.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96723.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96730.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93923.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   286 bits (732),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS+ EI GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPSSSEIMGNGRVSMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVL  166



>ref|XP_010052095.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Eucalyptus 
grandis]
Length=264

 Score =   286 bits (732),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 144/155 (93%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+TP++ GN + TMRK     KP SSGSPWYGPDR KYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPATPDLLGNGRVTMRKAV---KPASSGSPWYGPDRAKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  166



>ref|XP_008229430.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   286 bits (732),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  S   I G  + TMRKTA KPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSVSNIVGEGRVTMRKTASKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  169



>ref|XP_008800689.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Phoenix 
dactylifera]
Length=264

 Score =   286 bits (731),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PST  I G  + TMRKT GKP P  SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVKLAPSTSTILGEGRVTMRKTIGKPVP--SGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  166



>ref|XP_009630190.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding protein 21, chloroplastic; 
AltName: Full=LHCII type I CAB-21; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36957.1| unnamed protein product [Nicotiana tabacum]
Length=265

 Score =   286 bits (731),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS PEITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  167



>ref|XP_009598574.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS PEITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  167



>gb|AHB24929.1| chloroplast light-harvesting complex II chlorophyll a/b binding 
protein 1 [Sedum alfredii]
Length=267

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK++P+  ++ GN+K TMRKTA K KP  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLTPTVSDLYGNSKVTMRKTAAKSKPTVSSSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>ref|XP_002524616.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF37824.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS PE+ GN + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPSAPELMGNGRVSMRKTAAKN--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVL  167



>gb|AAB61237.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++P+  EI G  + TMRKTAGK K VSS SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKMVKLAPTASEILGEGRITMRKTAGKTKSVSSDSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFTKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  169



>ref|XP_010275593.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Nelumbo 
nucifera]
Length=269

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 145/157 (92%), Gaps = 2/157 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPE--ITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  275
            GKAVK++PS     + G  + TMRKT  KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  15   GKAVKLAPSAASELLLGQGRVTMRKTVVKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  74

Query  276  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH+RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  75   GEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCVFPELLARNGVKFGEAVW  134

Query  456  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  135  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  171



>ref|XP_009775649.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS PEITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSAPEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFS+GGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  133  AGSQIFSDGGLDYLGNPSLIHAQSILAIWACQVIL  167



>gb|EYU28187.1| hypothetical protein MIMGU_mgv1a009948mg [Erythranthe guttata]
Length=326

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 158/171 (92%), Gaps = 3/171 (2%)
 Frame = +3

Query  54   TNMaastmalssssfaGKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVK  233
            T MAAS+MALSS SFAG+AVK   STPE TGN + +MRKTA KPKP SSGSPWYGPDRVK
Sbjct  61   TTMAASSMALSSPSFAGQAVK---STPEFTGNGRVSMRKTAAKPKPASSGSPWYGPDRVK  117

Query  234  YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  413
            YLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE
Sbjct  118  YLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  177

Query  414  LLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            LL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVL
Sbjct  178  LLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVL  228



>ref|XP_008229463.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Prunus mume]
Length=215

 Score =   283 bits (724),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  S   I G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSVSNIVGEGRVTMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>gb|EYU28462.1| hypothetical protein MIMGU_mgv1a012008mg [Erythranthe guttata]
Length=264

 Score =   284 bits (727),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 144/155 (93%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK   STPE TGN + +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVK---STPEFTGNGRISMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVL
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVL  166



>gb|EYU38943.1| hypothetical protein MIMGU_mgv1a012024mg [Erythranthe guttata]
Length=264

 Score =   284 bits (727),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK   STPEITGN + +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVK---STPEITGNGRISMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIW  QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWGFQVLL  166



>ref|XP_009786355.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25388.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   284 bits (726),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + +MRKTA KP  VSS SPWYGPDRVKYLGPFSGE PSYLT E
Sbjct  15   GQAVKLSPSASEITGNGRVSMRKTAAKP--VSSSSPWYGPDRVKYLGPFSGESPSYLTSE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  167



>gb|ABF70112.1| chlorophyll A-B binding protein (CAB), putative [Musa balbisiana]
Length=267

 Score =   284 bits (726),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVS-SGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK++PS  ++ G  + TMRK+  K KP + SGSPWYGPDRVKYLGPFSGEPPSYLTG
Sbjct  14   GKAVKLAPSASDVLGEGRVTMRKSTAKAKPAAASGSPWYGPDRVKYLGPFSGEPPSYLTG  73

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  458
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  74   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWF  133

Query  459  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  134  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  169



>dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   283 bits (725),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  133  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  167



>ref|XP_007217260.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
 gb|AAA50310.1| light-harvesting chlorophyll a/b-binding protein [Prunus persica]
 gb|EMJ18459.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
Length=267

 Score =   283 bits (725),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  S   I G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSVSNIVGEGRITMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>ref|XP_009598577.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   283 bits (725),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  133  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  167



>gb|KJB66916.1| hypothetical protein B456_010G165100 [Gossypium raimondii]
Length=265

 Score =   283 bits (725),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK SPSTP+I GN + +MRKTA   KP +SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKFSPSTPKIQGNGRVSMRKTA--TKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  133  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  167



>gb|KCW75954.1| hypothetical protein EUGRSUZ_D00322 [Eucalyptus grandis]
Length=358

 Score =   286 bits (733),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 144/155 (93%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+TP++ GN + TMRK     KP SSGSPWYGPDR KYLGPFSGEPPSYLTGE
Sbjct  109  GKAVKLSPATPDLLGNGRVTMRKAV---KPASSGSPWYGPDRAKYLGPFSGEPPSYLTGE  165

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  166  FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  225

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  226  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  260



>gb|AEQ67395.1| chloroplast chlorophyll A/B binding protein [Canarium album]
Length=264

 Score =   283 bits (724),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 142/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS PE+ GN +  MRKT  KP    SGSPWYGPDRVKYLGP SGEPPSYLTGE
Sbjct  15   GKAVKLSPSAPELMGNGRVNMRKTFNKPP---SGSPWYGPDRVKYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  166



>ref|XP_008229429.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  S   I G  + TMRKTA K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSVSNIVGEGRVTMRKTASKSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>ref|XP_009775645.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGEAPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  167



>ref|XP_009775650.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  167



>ref|XP_002285646.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN73057.1| hypothetical protein VITISV_007597 [Vitis vinifera]
Length=267

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA+K++PS  ++ G  + TMRKT G+ KPVSSGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKALKLAPSASDLLGEGRVTMRKTGGRAKPVSSGSPWYGTDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVIL  169



>ref|XP_008356026.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
 ref|XP_008364190.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVQLSPGATELFGNGRVSMRKTA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  133  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  167



>ref|XP_008364191.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_009360860.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Pyrus 
x bretschneideri]
Length=264

 Score =   283 bits (723),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVQLSPGATELFGNGRVSMRKTA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  166



>gb|AAT08668.1| chloroplast chlorophyll A-B binding protein 40 [Hyacinthus orientalis]
Length=237

 Score =   281 bits (720),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = +3

Query  108  AVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFP  287
            AVK++PS+  ++G+ +FTMRKT  KPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFP
Sbjct  2    AVKLTPSSSGVSGDGRFTMRKTVAKPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFP  61

Query  288  GDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG  467
            GDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG
Sbjct  62   GDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG  121

Query  468  AQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            +QIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  122  SQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  154



>ref|XP_010052094.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=400

 Score =   287 bits (734),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPSTPE+ GN + +MRK     KPVSSGSPWYGPDR KYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSTPELLGNGRISMRKAV--RKPVSSGSPWYGPDRAKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+L
Sbjct  133  AGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVIL  167


 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 60/109 (55%), Gaps = 20/109 (18%)
 Frame = +3

Query  300  WDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNG----------VKFGEA  449
            +D  GL+ DPE FA+ +  E+ + R AM    G     +++  G                
Sbjct  194  FDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVSNN  253

Query  450  VW----------FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
             W          F AGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+L
Sbjct  254  AWAYATNFVPGNFFAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVIL  302



>gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPST EITGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSTSEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>ref|XP_007215816.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
 gb|EMJ17015.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
Length=267

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  S   I G  + TMRKTA + K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSVSNIVGEGRVTMRKTASRSKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>ref|XP_011045092.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Populus 
euphratica]
Length=263

 Score =   282 bits (721),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 145/155 (94%), Gaps = 4/155 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS+ EI GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPSSSEI-GNGRISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  130

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVL
Sbjct  131  AGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVL  165



>ref|XP_009389379.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=267

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 1/156 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVS-SGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK++PS  ++ G  + TMRK+  K KP + SGSPWYGPDRVKYLGPFSGEPPSYLTG
Sbjct  14   GKAVKLAPSASDVLGEGRVTMRKSTAKAKPAAASGSPWYGPDRVKYLGPFSGEPPSYLTG  73

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  458
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  74   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWF  133

Query  459  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            KAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  134  KAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  169



>ref|XP_004302854.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK++PS+  I G  + TMRKTA K K VSSGS WYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLNPSSSNINGEGRVTMRKTASKSKTVSSGSLWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>gb|ACN41907.1| chlorophyll A/B binding protein [Gardenia jasminoides]
Length=264

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS PE+ GN + +M++T    +PVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAVKLSPSAPELMGNGRISMKRTT---RPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAM GALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMPGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIF EGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  132  AGSQIFQEGGLDYLGNPSLIHAQSILAIWACQVIL  166



>ref|XP_004303878.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   282 bits (721),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AV++SP+   I G  + TMRKT  K K VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVQLSPAASNIFGEGRITMRKTGAKSKAVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>gb|KDP37944.1| hypothetical protein JCGZ_04587 [Jatropha curcas]
Length=260

 Score =   281 bits (720),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+ PS PE+ GN + TMRKTA K   VSSGSPWYGPD VK LGPFSGEPPSYLTGE
Sbjct  10   GKAVKLGPSPPELMGNGRVTMRKTASKN--VSSGSPWYGPDGVKNLGPFSGEPPSYLTGE  67

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  68   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  127

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  128  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  162



>gb|EYU28185.1| hypothetical protein MIMGU_mgv1a012021mg [Erythranthe guttata]
Length=264

 Score =   281 bits (720),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 143/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK   STPE T   +F+MRKTA KPKP +SGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVK---STPEFTTTGRFSMRKTAAKPKPAASGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVL
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVL  166



>dbj|BAF95850.1| putative chloroplast chlorophyll a/b binding protein [Vitis hybrid 
cultivar]
Length=234

 Score =   281 bits (718),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA +++PS  ++ G  + TMRKT G+ KPVSSGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  13   GKAFQLAPSASDLLGEGRVTMRKTGGRAKPVSSGSPWYGTDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+L
Sbjct  133  AGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVIL  167



>gb|EYU28186.1| hypothetical protein MIMGU_mgv1a012011mg [Erythranthe guttata]
Length=264

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 143/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK   STPE T   +F+MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVK---STPEFTTTGRFSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVL
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVL  166



>gb|AHB24928.1| chloroplast chlorophyll a-b binding protein 2/3 [Sedum alfredii]
Length=267

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK + S  E+ G+ + TMRKTA KPKP +S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKTASSASEVFGSGRVTMRKTAAKPKPSASSSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVL
Sbjct  135  AGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVL  169



>gb|AAA18529.1| chlorophyll A/B binding protein [Gossypium hirsutum]
Length=264

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 142/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK SPSTPEI G  + +MRKT    KPV SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKFSPSTPEIQGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  166



>gb|ACO51067.1| chloroplast chlorophyll A-B binding protein [Gossypium hirsutum]
Length=264

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 142/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK SPSTPEI G  + +MRKT    KPV SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKFSPSTPEIQGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  166



>gb|KJB69716.1| hypothetical protein B456_011G041600 [Gossypium raimondii]
Length=264

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 142/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK SPSTPEI G  + +MRKT    KPV SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKFSPSTPEIRGTGRVSMRKTT---KPVPSGSPWYGPDRVLYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  166



>ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloroplastic-like [Cicer 
arietinum]
 emb|CAA10284.1| chlorophyll a/b binding protein [Cicer arietinum]
Length=266

 Score =   281 bits (719),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK+SPS+ E+ G ++FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKPVKLSPSSQEL-GASRFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  168



>gb|KJB57287.1| hypothetical protein B456_009G156900 [Gossypium raimondii]
Length=265

 Score =   281 bits (718),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS P+I GN + +MRKTA K  P  SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKLSPSAPKIQGNGRVSMRKTATKAAP--SGSPWYGPDRVLYLGPLSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  133  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  167



>gb|AAC25775.1| chlorophyll a/b binding protein [Medicago sativa]
Length=266

 Score =   281 bits (718),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ E+ G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKPVKLTPSSQEL-GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  168



>ref|XP_009377335.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   281 bits (718),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK++PS+  + G  + TMRKTA K K VSSGSPWYGPDR KYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLNPSSSNLLGEGRVTMRKTAAKSKKVSSGSPWYGPDRAKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPELLSRNGVKFGEA WFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNGVKFGEATWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFS+GGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSQGGLDYLGNPSLVHAQSILAIWATQVIL  169



>gb|AAB61236.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   281 bits (718),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E  G  + TMRK AGK K  +  SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVKLSPTASETLGEGRITMRKAAGKSKVATIDSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  169



>ref|XP_008371581.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   281 bits (718),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GE
Sbjct  15   GKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  133  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  167



>ref|XP_008356022.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   281 bits (718),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GE
Sbjct  15   GKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  133  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  167



>ref|XP_006365560.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   281 bits (718),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri]
Length=264

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GE
Sbjct  14   GKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  166



>ref|XP_006365573.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006365574.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=265

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>ref|XP_008366007.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRK A   K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVQLSPGATELFGNGRVSMRKXA--TKKVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  133  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  167



>ref|XP_008364187.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GE
Sbjct  15   GKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  133  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  167



>ref|XP_004961193.1| PREDICTED: chlorophyll a-b binding protein M9, chloroplastic-like 
[Setaria italica]
Length=264

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 142/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV V  S   + G A+ TMRKTA KPKP +SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVNVPSS---LFGEARVTMRKTAAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  132  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  166



>gb|AFK40061.1| unknown [Medicago truncatula]
 gb|KEH31368.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=266

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ E+ G A+FTMRK A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKPVKLTPSSQEL-GAARFTMRKAATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  168



>ref|XP_009416547.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
 gb|ABF69952.1| chlorophyll A-B binding protein (CAB), putative [Musa acuminata]
Length=265

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS   + G  + TMRK  GKP   SSGSPWYGPDRVKYLGP SGEPPSYLTGE
Sbjct  14   GKAVKLAPSASGVLGQGRVTMRKAGGKPA-ASSGSPWYGPDRVKYLGPLSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  133  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  167



>gb|AAA80591.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   280 bits (717),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>gb|ACR08639.1| chloroplast chlorophyll A/B binding protein [Mangifera indica]
Length=264

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ GN + +MR+TA   KP  SGSPWYGPDRVKYL PFSGEPPSYLTGE
Sbjct  15   GKAVKLSPAPRELMGNGRVSMRRTA---KPTPSGSPWYGPDRVKYLSPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  166



>ref|XP_006467509.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Citrus sinensis]
Length=264

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV ++PS  E++   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  166



>gb|AFI60242.1| light harvesting chlorophyll a/b binding protein, partial [Panicum 
virgatum]
Length=260

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 142/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV V  S   + G A+ TMRKTA KPKP +SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  11   GKAVNVPSS---LFGEARVTMRKTAAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGE  67

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  68   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  127

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  128  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  162



>gb|AAO45885.1| chlorophyll a/b-binding protein precursor [Citrus limon]
Length=216

 Score =   278 bits (712),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV ++PS  E++   + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVNLAPSGNELSNGGRISMRKTG--SKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  166



>ref|XP_011045093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=263

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 144/155 (93%), Gaps = 4/155 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++P + EI GN + +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPFS-EIMGNGRISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  130

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVL
Sbjct  131  AGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVL  165



>ref|NP_001240146.1| chlorophyll a-b binding protein 21, chloroplastic-like [Glycine 
max]
 gb|AAA50172.1| photosystem II type I chlorophyll a/b-binding protein [Glycine 
max]
 gb|ACU18421.1| unknown [Glycine max]
 gb|KHN41285.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 146/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PSTPE+ G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAIKLAPSTPEL-GVGRVSMRKTASKT--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  166



>ref|XP_009377344.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+S ST  + G  + TMRKTA K K VS GSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSKSTSTLRGEGRITMRKTAAKSKNVSCGSPWYGPDRVKYLGPFSGESPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPELLSRN VKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNRVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>gb|AAR10886.1| chlorophyll a/b binding protein [Trifolium pratense]
Length=266

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ E+ G AKFTMRK A   K  SSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKPVKLTPSSQEL-GVAKFTMRKGATTKKVASSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  168



>ref|XP_009598575.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITG  + +MRKT  KP  V+S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGYGRVSMRKTVAKP--VASSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  167



>ref|XP_010926397.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=264

 Score =   280 bits (715),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS   I GN + TMRKT+ K  P  SGSPWYGPDRVKYLGP SGEPPSYLTGE
Sbjct  14   GKAVKLAPSASPILGNGRVTMRKTSTKRVP--SGSPWYGPDRVKYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+L
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVIL  166



>ref|XP_010231410.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Brachypodium 
distachyon]
Length=266

 Score =   280 bits (715),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  PS+  + G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKNLPSS-ALFGEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELE+IHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELELIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>ref|XP_007025143.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
 gb|EOY27765.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
Length=264

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 142/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP TPEI GN + +MRKT  +P    SGSPWYGPDRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKLSPLTPEIQGNGRVSMRKTGTRPP---SGSPWYGPDRVLYLGPLSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  132  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  166



>ref|XP_004233096.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233099.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233100.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316910.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316913.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 sp|P07370.1|CB2B_SOLLC RecName: Full=Chlorophyll a-b binding protein 1B, chloroplastic; 
AltName: Full=LHCII type I CAB-1B; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34147.1| chlorophyll a/b-binding protein Cab-1B [Solanum lycopersicum]
Length=265

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>ref|XP_006365572.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
 gb|AAA80589.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>gb|AEO51755.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=263

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 143/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV+++P+  ++ GN + TMRKT    + VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVQLAPTGNDLMGNGRVTMRKTG---RQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWD AGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  71   FPGDYGWDAAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  130

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  131  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  165



>ref|XP_008371583.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008356023.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008364186.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=291

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV++SP   E+ GN + +MRKTA   K VSSGSPWYGPDRVKYLGPFSGEPPSYL GE
Sbjct  41   GKAVQLSPGATELFGNGRVSMRKTA--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLKGE  98

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  99   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  158

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  159  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  193



>emb|CDP06328.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS PE+ GN + +M++T+   +P  SGSPWYGPDRVKYLGPFSG+PPSYLTGE
Sbjct  15   GKAVKLNPSAPELMGNGRISMKRTS---RPAPSGSPWYGPDRVKYLGPFSGDPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIF EGGL+YLGNPSLIHAQSILAIWACQVVL
Sbjct  132  AGSQIFQEGGLNYLGNPSLIHAQSILAIWACQVVL  166



>ref|XP_004303877.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+  ST  + G  + TMRKTA K K VSS SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLGSSTSNLLGEGRVTMRKTAAKSKNVSSVSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>ref|XP_004233101.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   279 bits (714),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>ref|XP_007211864.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
 ref|XP_008225346.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ13063.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
Length=265

 Score =   279 bits (714),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV+++P   E+ GN + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVQLAPGATELFGNGRVSMRKTGAKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  133  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  167



>ref|XP_007211869.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
 ref|XP_008225347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Prunus 
mume]
 gb|EMJ13068.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
Length=264

 Score =   279 bits (714),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV+++P   E+ GN + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVQLAPGATELFGNGRVSMRKTGAKQ--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  166



>ref|XP_006368026.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   279 bits (713),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVSKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>gb|AAA80592.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 140/155 (90%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EITGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIF EGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFREGGLDYLGNPSLVHAQSILAIWACQVVL  167



>ref|XP_006449645.1| hypothetical protein CICLE_v10016286mg [Citrus clementina]
 gb|ESR62885.1| hypothetical protein CICLE_v10016286mg [Citrus clementina]
Length=264

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV ++PS  E+    + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVNLAPSGNELGNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  166



>ref|XP_010666512.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=268

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPV-SSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK+ P+  EI G  + TMRKT GK KP  SS SPWYGPDRVKYLGPFSGE PSYLTG
Sbjct  15   GKAVKLGPTAWEILGEGRVTMRKTGGKTKPAASSSSPWYGPDRVKYLGPFSGEAPSYLTG  74

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  458
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  75   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWF  134

Query  459  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            KAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  135  KAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  170



>sp|P04779.1|CB21_PETSP RecName: Full=Chlorophyll a-b binding protein 13, chloroplastic; 
AltName: Full=LHCII type I CAB-13; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26210.1| unnamed protein product [Petunia sp.]
Length=266

 Score =   279 bits (713),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV V PS+ EIT N K TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAVNV-PSSSEITRNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADP TFAKNR+LEVIH RW MLGALGCVFPEL +RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPATFAKNRKLEVIHCRWTMLGALGCVFPELFARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIF EGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFKEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>ref|XP_010666522.1| PREDICTED: uncharacterized protein LOC104883672 [Beta vulgaris 
subsp. vulgaris]
Length=624

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV + P+  EI G  + TMRKTAGKPK VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  372  GKAVNLGPNASEILGEGRITMRKTAGKPKQVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  431

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  432  FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  491

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  492  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  526


 Score =   280 bits (716),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPV-SSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK+ P+  EI G  + TMRKT GK KP  SS SPWYGPDRVKYLGPFSGE PSYLTG
Sbjct  15   GKAVKLGPTAWEILGEGRVTMRKTGGKTKPAASSSSPWYGPDRVKYLGPFSGEAPSYLTG  74

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  458
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  75   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWF  134

Query  459  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            KAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+L
Sbjct  135  KAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVIL  170



>gb|ABQ32304.1| chloroplast light-harvesting chlorophyll a/b-binding protein 
[Artemisia annua]
Length=254

 Score =   278 bits (711),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK +PS  E+ GN + +MRKTA   K   SGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  2    GQAVKAAPSNSELLGNGRVSMRKTAAPKKVAPSGSPWYGPDRVKYLGPFSGEAPSYLTGE  61

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  62   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  121

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  122  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  156



>gb|EYU28183.1| hypothetical protein MIMGU_mgv1a012019mg [Erythranthe guttata]
 gb|EYU28188.1| hypothetical protein MIMGU_mgv1a012022mg [Erythranthe guttata]
Length=264

 Score =   278 bits (712),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 142/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK   STPE T + + +MRKTA KPKP +S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVK---STPEFTSSGRISMRKTAAKPKPAASSSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVL
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVL  166



>prf||1204205B protein 1B,chlorophyll binding
Length=265

 Score =   278 bits (712),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFS+GGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVL  167



>sp|P12329.1|CB21_MAIZE RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=LHCII type I CAB-1; Short=LHCP; Flags: Precursor 
[Zea mays]
 emb|CAA32900.1| unnamed protein product [Zea mays]
 gb|ACF83754.1| unknown [Zea mays]
 gb|ACG25538.1| chlorophyll a-b binding protein 2 [Zea mays]
 gb|ACG28560.1| chlorophyll a-b binding protein 2 [Zea mays]
 tpg|DAA62636.1| TPA: light harvesting chlorophyll a/b binding protein2 [Zea mays]
Length=262

 Score =   278 bits (711),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/141 (94%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  144  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  323
            G  + TMRKT GKPK  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  24   GEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  83

Query  324  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  503
            DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  84   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  143

Query  504  GNPSLIHAQSILAIWACQVVL  566
            GNPSLIHAQSILAIWACQVVL
Sbjct  144  GNPSLIHAQSILAIWACQVVL  164



>gb|EYU29602.1| hypothetical protein MIMGU_mgv1a019986mg [Erythranthe guttata]
Length=260

 Score =   278 bits (711),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 145/156 (93%), Gaps = 4/156 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGN-AKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            G+AVK+SP   EIT N ++ +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTG
Sbjct  10   GQAVKLSP---EITANYSRVSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTG  66

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  458
            EFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  67   EFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWF  126

Query  459  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            KAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVL
Sbjct  127  KAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVL  162



>ref|XP_006449643.1| hypothetical protein CICLE_v10016287mg [Citrus clementina]
 ref|XP_006467513.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006467514.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR62883.1| hypothetical protein CICLE_v10016287mg [Citrus clementina]
 gb|KDO78114.1| hypothetical protein CISIN_1g024654mg [Citrus sinensis]
Length=264

 Score =   278 bits (712),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV ++PS  E++   + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  14   GKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  166



>ref|XP_007151992.1| hypothetical protein PHAVU_004G0927000g, partial [Phaseolus vulgaris]
 gb|ESW23986.1| hypothetical protein PHAVU_004G0927000g, partial [Phaseolus vulgaris]
Length=206

 Score =   276 bits (706),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SP+TP+I+G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTG+
Sbjct  15   GQAIKLSPATPDISGG-RISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGQ  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  166



>ref|XP_006415534.1| hypothetical protein EUTSA_v10008479mg [Eutrema salsugineum]
 ref|XP_006415536.1| hypothetical protein EUTSA_v10008481mg [Eutrema salsugineum]
 gb|ESQ33887.1| hypothetical protein EUTSA_v10008479mg [Eutrema salsugineum]
 gb|ESQ33889.1| hypothetical protein EUTSA_v10008481mg [Eutrema salsugineum]
Length=267

 Score =   278 bits (712),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKISPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  168



>ref|XP_006449644.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
 gb|ESR62884.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
Length=303

 Score =   280 bits (715),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV ++PS  E++   + +MRKT  K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  53   GKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  110

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  111  FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  170

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  171  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  205



>gb|EYU28184.1| hypothetical protein MIMGU_mgv1a011918mg [Erythranthe guttata]
Length=266

 Score =   278 bits (711),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SP     TG  + +MRKT+ KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPEVTG-TGTGRISMRKTSAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVL  168



>gb|AFK40204.1| unknown [Lotus japonicus]
Length=202

 Score =   276 bits (705),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PS   +    + TMRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLAPS---VQDTGRITMRKTTTKSKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  166



>gb|ACG30091.1| chlorophyll a-b binding protein 2 [Zea mays]
Length=241

 Score =   277 bits (709),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  114  KVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGD  293
            K + ST ++ G  + TMRKTAGKPKP +SGSPWYG DRV YLGP SG+PPSYLTGEFPGD
Sbjct  16   KPATSTRDVFGEGRITMRKTAGKPKPAASGSPWYGADRVLYLGPLSGQPPSYLTGEFPGD  75

Query  294  YGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQ  473
            YGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+Q
Sbjct  76   YGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQ  135

Query  474  IFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            IFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  136  IFSEGGLDYLGNPSLIHAQSILAIWACQVVL  166



>ref|XP_003548106.1| PREDICTED: chlorophyll a/b-binding protein precursor isoform 
1 [Glycine max]
 gb|KHN41288.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PSTP++ G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAIKLAPSTPQL-GVGRVSMRKTASKT--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  166



>ref|XP_003548104.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Glycine max]
Length=264

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PSTP++ G  + +MRKTA K   V+SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GQAIKLAPSTPQL-GVGRVSMRKTASKT--VTSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  166



>gb|AAA80594.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 140/155 (90%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGE VWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEVVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>ref|XP_010538237.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=267

 Score =   278 bits (710),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  EI G A+ TMRK+  KP    SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPTASEILGTARVTMRKSTAKPTG-PSGSPWYGPDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  134  AGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  168



>gb|AAF26741.1|AF220527_1 chlorophyll a/b binding protein precursor [Euphorbia esula]
Length=268

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 145/156 (93%), Gaps = 2/156 (1%)
 Frame = +3

Query  102  GKAVKVSPSTP-EITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            G+AVK+SPS+  E+ GN + +MRK A K K   SGSPWYGPDRVKYLGPFSGEPPSYLTG
Sbjct  16   GQAVKLSPSSASELMGNGRVSMRKAATK-KVAPSGSPWYGPDRVKYLGPFSGEPPSYLTG  74

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  458
            EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  75   EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWF  134

Query  459  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            KAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  135  KAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  170



>emb|CDP06329.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PS PE+ GN + +M++T+   +P  SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPSAPELMGNGRISMKRTS---RPSPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGV+FGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVQFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIF EGGL+YLGNP+LIHAQSILAIWACQVVL
Sbjct  132  AGSQIFQEGGLNYLGNPNLIHAQSILAIWACQVVL  166



>gb|EYU29604.1| hypothetical protein MIMGU_mgv1a023200mg [Erythranthe guttata]
 gb|EYU30287.1| hypothetical protein MIMGU_mgv1a011913mg [Erythranthe guttata]
 gb|EYU30288.1| hypothetical protein MIMGU_mgv1a020332mg [Erythranthe guttata]
Length=267

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 145/156 (93%), Gaps = 4/156 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGN-AKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            G+AVK+SP   EIT N ++ +MRKTA KPKP SSGSPWYGPDRVKYLGPFSGE PSYLTG
Sbjct  17   GQAVKLSP---EITANYSRVSMRKTAAKPKPASSGSPWYGPDRVKYLGPFSGEAPSYLTG  73

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  458
            EFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  74   EFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWF  133

Query  459  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            KAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVL
Sbjct  134  KAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVL  169



>gb|ABW70800.1| chloroplast light harvesting chlorophyll a/b binding protein 
[Populus euphratica]
Length=263

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 143/155 (92%), Gaps = 4/155 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++P + EI GN   +MRKT    KPV SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLNPFS-EIMGNGCISMRKTT---KPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  130

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVL
Sbjct  131  AGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVL  165



>ref|XP_007025148.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
 gb|EOY27770.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
Length=264

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 142/155 (92%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA+K SPSTPEI G+ + +MRKT  KP    SGSPWYGPDRV YLGP SG+PPSYLTGE
Sbjct  15   GKALKFSPSTPEIQGSGRVSMRKTGTKPP---SGSPWYGPDRVLYLGPLSGDPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  132  AGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  166



>dbj|BAA24493.1| chlorophyll a/b-binding protein [Fagus crenata]
Length=264

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PSTPE+    + +MRK+A +   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLAPSTPELN-VGRVSMRKSASRN--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  132  AGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  166



>gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein Lhcb1 [Pisum 
sativum]
Length=266

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ E+ G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKPVKLNPSSQEL-GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  168



>gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisum sativum]
Length=266

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK VK++PS+ E+ G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKPVKLNPSSQEL-GGARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  168



>ref|XP_004957570.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  144  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  323
            G  + TMRKTA KPK  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  23   GEGRITMRKTAAKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  82

Query  324  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  503
            DPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  83   DPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL  142

Query  504  GNPSLIHAQSILAIWACQVVL  566
            GNPSLIHAQSILAIWACQVVL
Sbjct  143  GNPSLIHAQSILAIWACQVVL  163



>ref|NP_001147639.1| chlorophyll a-b binding protein 1, chloroplastic precursor [Zea 
mays]
 gb|ACG28217.1| chlorophyll a-b binding protein 2 [Zea mays]
Length=262

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/141 (93%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  144  GNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  323
            G  + TMRKT GKPK  +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA
Sbjct  24   GEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSA  83

Query  324  DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  503
            DP+TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYL
Sbjct  84   DPKTFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYL  143

Query  504  GNPSLIHAQSILAIWACQVVL  566
            GNPSLIHAQSILAIWACQVVL
Sbjct  144  GNPSLIHAQSILAIWACQVVL  164



>gb|ADL41158.1| chloroplast light-harvesting chlorophyll a/b binding protein 
[Triticum aestivum]
Length=266

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  PS+  + G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SG+PPSYLTGE
Sbjct  15   GKAVKDLPSS-ALFGEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGDPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>ref|XP_002455902.1| hypothetical protein SORBIDRAFT_03g027040 [Sorghum bicolor]
 gb|EES01022.1| hypothetical protein SORBIDRAFT_03g027040 [Sorghum bicolor]
Length=265

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  SPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYG  299
            + ST ++ G  + TMRKTA KPKP +SGSPWYG DRV YLGPFSGEPPSYLTGEFPGDYG
Sbjct  19   TTSTRDVFGEGRITMRKTAAKPKPAASGSPWYGADRVLYLGPFSGEPPSYLTGEFPGDYG  78

Query  300  WDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIF  479
            WDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIF
Sbjct  79   WDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIF  138

Query  480  SEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            SEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  139  SEGGLDYLGNPSLIHAQSILAIWACQVVL  167



>gb|AFW90594.1| chloroplast chlorophyll a/b binding protein [Solanum tuberosum]
Length=276

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 140/155 (90%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  EI+GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASEISGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGC FPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCDFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>gb|AGU28449.1| chlorophyll A/B binding protein 1, partial [Sinapis alba]
Length=193

 Score =   274 bits (701),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG +RVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKISPAASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSERVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  168



>gb|AAH53854.1| Unknown (protein for IMAGE:5194336), partial [Homo sapiens]
 gb|AAI11385.1| Unknown (protein for IMAGE:5198300), partial [Homo sapiens]
Length=287

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  PS+  + G A+ TMRKTA K KPVSSGSPWYG DRV YLGP SG+PPSYLTGE
Sbjct  36   GKAVKDLPSS-ALFGEARVTMRKTAAKAKPVSSGSPWYGSDRVLYLGPLSGDPPSYLTGE  94

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  95   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  154

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  155  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  189



>gb|AGV54498.1| LHCII type I chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=264

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SPSTP+++   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLL  166



>gb|AAF89206.1|AF279249_1 LHCII type I chlorophyll a/b-binding protein [Vigna radiata]
Length=264

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SPSTPE++G  + +MRK A K   VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLSPSTPELSG-GRISMRKAASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  166



>ref|XP_010316911.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 139/155 (90%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+ PS  EITGN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYL GE
Sbjct  15   GQAVKLLPSASEITGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLNGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>gb|AES74698.2| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=265

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 143/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKA+K+SPSTP++    + TMRKT  K K V SGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GKAIKLSPSTPDLV-MGRITMRKTTNK-KNVPSGSPWYGPDRVKYLGPFSGEAPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWAVQVIL  167



>ref|XP_007158464.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 ref|XP_007158466.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
 gb|ESW30458.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 gb|ESW30460.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
Length=264

 Score =   276 bits (706),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SPSTP+++   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLL  166



>gb|AAZ79657.1| putative chlorophyll a/b-binding protein [Fagus sylvatica]
Length=260

 Score =   276 bits (706),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK++PSTPE+    + +MRK+A +   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  12   GKAVKLAPSTPELN-VGRVSMRKSASRN--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  68

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  69   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  128

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  129  AGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVLL  163



>gb|AAB87573.1| chlorophyll a/b binding protein of LHCII type I precursor [Panax 
ginseng]
Length=266

 Score =   276 bits (706),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVKV+PS+ E+ G+ + +MRKT  KP   SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GMAVKVAPSSSELFGSGRISMRKTGKKPA-ASSGSPWYGPDRVKYLGPFSGEAPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  168



>ref|XP_007151979.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
 gb|ESW23973.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
Length=264

 Score =   276 bits (706),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SP+TP+I+G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTG+
Sbjct  15   GQAIKLSPATPDISG-GRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGQ  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  166



>ref|NP_001142284.1| uncharacterized protein LOC100274453 [Zea mays]
 gb|ACF88086.1| unknown [Zea mays]
 gb|ACG28627.1| chlorophyll a-b binding protein 2 [Zea mays]
 gb|AFW83181.1| light harvesting chlorophyll a/b binding protein1 isoform 1 [Zea 
mays]
 gb|AFW83182.1| light harvesting chlorophyll a/b binding protein1 isoform 2 [Zea 
mays]
Length=264

 Score =   276 bits (706),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  114  KVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGD  293
            K + ST ++ G  + TMRKTAGKPKP +SGSPWYG DRV YLGP SG+PPSYLTGEFPGD
Sbjct  16   KPATSTRDVFGEGRITMRKTAGKPKPAASGSPWYGADRVLYLGPLSGQPPSYLTGEFPGD  75

Query  294  YGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQ  473
            YGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+Q
Sbjct  76   YGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQ  135

Query  474  IFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            IFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  136  IFSEGGLDYLGNPSLIHAQSILAIWACQVVL  166



>gb|ACD64978.1| chloroplast chlorophyll a/b-binding protein [Ophiopogon japonicus]
Length=264

 Score =   276 bits (706),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 4/156 (3%)
 Frame = +3

Query  102  GKAVKVSPS-TPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            GKAVK++PS   E+ GN + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTG
Sbjct  14   GKAVKLAPSPASELMGNGRISMRKTG---KSVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  70

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  458
            EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  71   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWF  130

Query  459  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            KAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  131  KAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVVL  166



>gb|AGV54521.1| LHCII type I chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=264

 Score =   276 bits (705),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SPSTP+++   + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAIKLSPSTPDLS-TGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLL  166



>ref|XP_009377327.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=267

 Score =   276 bits (706),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+S ST  + G  + TM KTA K K VS+G  WYGPDRV+YLGPFSG+ PSYLTGE
Sbjct  15   GQAVKLSQSTSTLLGEGRITMHKTAAKSKNVSAGREWYGPDRVRYLGPFSGQSPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPELLSRNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSRNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>ref|XP_004293579.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Fragaria 
vesca subsp. vesca]
Length=263

 Score =   276 bits (705),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 4/155 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV+++P+  E+ G  + +MRKT GK   VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVQLAPT--EVFGTGRISMRKTVGKA--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  130

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVL
Sbjct  131  AGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  165



>ref|XP_002890838.1| hypothetical protein ARALYDRAFT_473204 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67097.1| hypothetical protein ARALYDRAFT_473204 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   276 bits (705),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  10   GKAVKLSPAASEVLGSGRVTMRKTTAKPKG-PSGSPWYGSDRVKYLGPFSGEPPSYLTGE  68

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  69   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  128

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFS+GGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  129  AGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVIL  163



>ref|XP_002283566.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN74831.1| hypothetical protein VITISV_023674 [Vitis vinifera]
Length=270

 Score =   276 bits (705),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITG--NAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  275
            G+AVK++P+  E+      + TMRK+  K K VSSGSPWYGPDRVKYLGPFSGEPPSYLT
Sbjct  16   GQAVKLAPNVTELLAGDQGRVTMRKSVAKSKAVSSGSPWYGPDRVKYLGPFSGEPPSYLT  75

Query  276  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            GEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLSRNGVKFGEAVW
Sbjct  76   GEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLSRNGVKFGEAVW  135

Query  456  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            FKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+L
Sbjct  136  FKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVIL  172



>gb|ACU23974.1| unknown [Glycine max]
Length=264

 Score =   276 bits (705),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K++PSTP++ G  + +MRKTA K   V+SGSPWYGPDRVKYLGPFSGEPPSY TGE
Sbjct  15   GQAIKLAPSTPQL-GVGRVSMRKTASKT--VTSGSPWYGPDRVKYLGPFSGEPPSYRTGE  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  166



>ref|XP_002455901.1| hypothetical protein SORBIDRAFT_03g027030 [Sorghum bicolor]
 gb|EES01021.1| hypothetical protein SORBIDRAFT_03g027030 [Sorghum bicolor]
Length=266

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +3

Query  126  STPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWD  305
            ST ++ G  + TMRKTA KPKP +SGSPWYG DRV YLGPFSGEPPSYLTGEFPGDYGWD
Sbjct  22   STRDVFGEGRITMRKTAAKPKPAASGSPWYGADRVLYLGPFSGEPPSYLTGEFPGDYGWD  81

Query  306  TAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSE  485
            TAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSE
Sbjct  82   TAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSE  141

Query  486  GGLDYLGNPSLIHAQSILAIWACQVVL  566
            GGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  142  GGLDYLGNPSLIHAQSILAIWACQVVL  168



>ref|XP_010316912.1| PREDICTED: chlorophyll a-b binding protein 1A, chloroplastic 
[Solanum lycopersicum]
Length=265

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 140/155 (90%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+AVK+SPS  E +GN + TMRK   K  P  S SPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GQAVKLSPSASENSGNGRITMRKAVAKSAP--SSSPWYGPDRVKYLGPFSGESPSYLTGE  72

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  73   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  132

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  133  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  167



>dbj|BAJ08392.1| light harvesting chlorophyll a/b-binding protein Lhcb1 [Hordeum 
vulgare subsp. vulgare]
Length=266

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  PS+  + G A+ TMRKTA K KPVSS SPWYG DRV YLGP SG+PPSYLTGE
Sbjct  15   GKAVKDLPSS-ALFGEARVTMRKTAAKAKPVSSSSPWYGSDRVLYLGPLSGDPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>gb|EMT29002.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=266

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  PS+  + G A+ TMRKTA K K V+SGSPWYG DRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKNLPSS-SVFGEARVTMRKTAAKAKQVASGSPWYGSDRVLYLGPLSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>ref|XP_004969083.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like 
[Setaria italica]
Length=265

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 140/152 (92%), Gaps = 1/152 (1%)
 Frame = +3

Query  114  KVSPSTPEITGNAKFTMRKTAG-KPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPG  290
            K + ST ++ G  + TMRKT G KPKP +SGSPWYGPDRV YLGP SGEPPSYLTGEFPG
Sbjct  16   KPAASTRDVFGEGRITMRKTGGAKPKPAASGSPWYGPDRVLYLGPLSGEPPSYLTGEFPG  75

Query  291  DYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGA  470
            DYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+
Sbjct  76   DYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGS  135

Query  471  QIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            QIFSEGGLDYLGNPSLIHAQSILAIWACQVVL
Sbjct  136  QIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  167



>ref|XP_010549470.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010549471.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=268

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP+  EI G A+ TMRK A    P  SGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  17   GKAVKLSPAASEILGTARVTMRKAAKPSGP--SGSPWYGPDRVKYLGPFSGEPPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  169



>ref|XP_009794580.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like, 
partial [Nicotiana sylvestris]
Length=159

 Score =   271 bits (694),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G AVK+SPS+ EITGN K  MRKT  K KPVSSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  15   GNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGE  74

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  134

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSI  536
            AG+QIFSEGGLDYLGNPSL+HAQSI
Sbjct  135  AGSQIFSEGGLDYLGNPSLVHAQSI  159



>sp|P07371.1|CB22_PEA RecName: Full=Chlorophyll a-b binding protein AB80, chloroplastic; 
AltName: Full=LHCII type I CAB-AB80; Short=LHCP; Flags: 
Precursor [Pisum sativum]
 gb|AAA63413.1| cab precursor [Pisum sativum]
 gb|AAA33651.1| polypeptide 15 precursor [Pisum sativum]
 prf||1006296A protein,chlorophyll a/b binding
Length=269

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GK +K++PS+ E+ G A+FTMRK+A   K  SSGSPWYGPDRVKYLGPFSGE PSYLTGE
Sbjct  18   GKQLKLNPSSQEL-GAARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGE  76

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  77   FPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  136

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  137  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  171



>ref|XP_007151996.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
 gb|ESW23990.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
Length=264

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 146/155 (94%), Gaps = 3/155 (2%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            G+A+K+SP+TP+++G  + +MRKTA K   VSSGSPWYGPDRVKYLGPFSGE PSYLTG+
Sbjct  15   GQAIKLSPATPDLSG-GRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEAPSYLTGQ  71

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  72   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  131

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  132  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  166



>ref|XP_006305533.1| hypothetical protein CARUB_v10010022mg [Capsella rubella]
 ref|XP_006305913.1| hypothetical protein CARUB_v10011129mg [Capsella rubella]
 gb|EOA38431.1| hypothetical protein CARUB_v10010022mg [Capsella rubella]
 gb|EOA38811.1| hypothetical protein CARUB_v10011129mg [Capsella rubella]
Length=267

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAV +SP++ E+ G+ + TMRKT  KPK   SGSPWYG DRVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVNLSPASSEVLGSGRVTMRKTVAKPKG-PSGSPWYGSDRVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFS+GGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  AGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVIL  168



>gb|AAB18209.1| chlorophyll a/b-binding protein WCAB precursor [Triticum aestivum]
Length=266

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  PS   + G A+ TMRKTA K K VSSGSPWYG DRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKNVPSL-ALLGEARVTMRKTAAKAKQVSSGSPWYGADRVLYLGPLSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>ref|XP_006304391.1| hypothetical protein CARUB_v10010908mg [Capsella rubella]
 gb|EOA37289.1| hypothetical protein CARUB_v10010908mg [Capsella rubella]
Length=267

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SP++ E+ G+ + TMRKT  KPK   SGSPWYG +RVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPASSEVLGSGRVTMRKTVAKPKG-PSGSPWYGSERVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFS+GGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  AGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVIL  168



>gb|EYU19613.1| hypothetical protein MIMGU_mgv1a011885mg [Erythranthe guttata]
Length=267

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 144/157 (92%), Gaps = 5/157 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNA--KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLT  275
            G+AVK++P   EIT N+  + +MRKTA KPK VSS SPWYGPDRVKYLGPFSGE PSYLT
Sbjct  16   GQAVKIAP---EITANSVGRVSMRKTAAKPKQVSSSSPWYGPDRVKYLGPFSGEAPSYLT  72

Query  276  GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW  455
            GEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct  73   GEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVW  132

Query  456  FKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            FKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVL
Sbjct  133  FKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVL  169



>ref|XP_010237260.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Brachypodium distachyon]
Length=266

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  PS+  + G A+ TMRKTA K KPV SGSPWYG DRV YLGP SG+PPSYLTGE
Sbjct  15   GKAVKNLPSS-ALFGEARVTMRKTAAKAKPVPSGSPWYGADRVLYLGPLSGQPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  168



>emb|CDY66768.1| BnaAnng22920D [Brassica napus]
 emb|CDY43676.1| BnaA04g20150D [Brassica napus]
Length=267

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+SPS  E+ G+ + TMRKT  KPK   SGSPWYG +RVKYLGPFSGEPPSYLTGE
Sbjct  15   GKAVKLSPSASEVLGSGRVTMRKTVAKPKG-PSGSPWYGSERVKYLGPFSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  AGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVIL  168



>ref|XP_010231015.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Brachypodium distachyon]
Length=263

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 139/155 (90%), Gaps = 4/155 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  P+     G A+ TMRKT  K KPVSSGSPWYG DRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKNLPAL----GEARITMRKTVAKAKPVSSGSPWYGSDRVLYLGPLSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  130

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVL
Sbjct  131  AGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVL  165



>gb|AAT08694.1| chloroplast chlorophyll A-B binding protein 40 [Hyacinthus orientalis]
Length=211

 Score =   273 bits (697),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 142/156 (91%), Gaps = 1/156 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNA-KFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTG  278
            G AVK++PS+        +FTMRKTA KPK VSSGSPWYGPDRVKYLGPFSGE PSYLTG
Sbjct  14   GTAVKLTPSSSSGVSGDGRFTMRKTAAKPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTG  73

Query  279  EFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWF  458
            EFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWF
Sbjct  74   EFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWF  133

Query  459  KAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            KAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+L
Sbjct  134  KAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVLL  169



>sp|P09756.1|CB23_SOYBN RecName: Full=Chlorophyll a-b binding protein 3, chloroplastic; 
AltName: Full=LHCII type I CAB-3; Short=LHCP; Flags: Precursor 
[Glycine max]
 emb|CAA31419.1| chlorophyll a/b binding preprotein (AA - 32 to 231) [Glycine 
max]
Length=263

 Score =   274 bits (701),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 142/155 (92%), Gaps = 5/155 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+ PS PE+    + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  16   GKAVKLGPSAPEV---GRVSMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  130

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  131  AGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  165



>ref|NP_001241277.1| uncharacterized protein LOC100805310 [Glycine max]
 gb|ACU24438.1| unknown [Glycine max]
Length=263

 Score =   274 bits (701),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 142/155 (92%), Gaps = 5/155 (3%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK+ PS PE+    + +MRKT    K VSSGSPWYGPDRVKYLGPFSGEPPSYLTGE
Sbjct  16   GKAVKLGPSAPEV---GRVSMRKTV--TKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  70

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK
Sbjct  71   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  130

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+L
Sbjct  131  AGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVIL  165



>dbj|BAJ87673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   275 bits (702),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +3

Query  102  GKAVKVSPSTPEITGNAKFTMRKTAGKPKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGE  281
            GKAVK  PS P   G A+ TMRKTA K K VSSGSPWYG DRV YLGP SGEPPSYLTGE
Sbjct  15   GKAVKNLPS-PAHIGEARVTMRKTAVKAKQVSSGSPWYGSDRVLYLGPLSGEPPSYLTGE  73

Query  282  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFK  461
            FPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFK
Sbjct  74   FPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK  133

Query  462  AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVL  566
            AG+QIFSEGGLDYLGNP+L+HAQSILAIWACQVVL
Sbjct  134  AGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVL  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960