BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K07

Length=485
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009627990.1|  PREDICTED: uncharacterized protein LOC104118460    119   9e-28   Nicotiana tomentosiformis
ref|XP_006345055.1|  PREDICTED: kinesin light chain-like                119   1e-27   Solanum tuberosum [potatoes]
ref|XP_009795408.1|  PREDICTED: uncharacterized protein LOC104242106    118   2e-27   Nicotiana sylvestris
ref|XP_010318909.1|  PREDICTED: uncharacterized protein LOC104646605    115   3e-26   Solanum lycopersicum
emb|CDP12398.1|  unnamed protein product                                112   1e-25   Coffea canephora [robusta coffee]
ref|XP_004155014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    104   2e-22   
ref|XP_004138111.1|  PREDICTED: uncharacterized protein LOC101208453    103   2e-22   Cucumis sativus [cucumbers]
emb|CBI15036.3|  unnamed protein product                                102   4e-22   Vitis vinifera
ref|XP_010663184.1|  PREDICTED: uncharacterized protein LOC100255253    102   4e-22   Vitis vinifera
ref|XP_003601279.1|  Kinesin light chain                                101   2e-21   Medicago truncatula
ref|XP_008453093.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.8    5e-21   
ref|XP_008360812.1|  PREDICTED: uncharacterized protein LOC103424510  99.8    6e-21   
ref|XP_003601278.1|  Kinesin light chain                              99.4    9e-21   Medicago truncatula
ref|XP_006476770.1|  PREDICTED: uncharacterized protein LOC102617...  99.0    1e-20   
ref|XP_011101334.1|  PREDICTED: nephrocystin-3 isoform X2             97.4    4e-20   
ref|XP_011101333.1|  PREDICTED: uncharacterized protein LOC105179...  97.4    4e-20   Sesamum indicum [beniseed]
ref|XP_009363029.1|  PREDICTED: uncharacterized protein LOC103953033  97.1    4e-20   Pyrus x bretschneideri [bai li]
gb|KDO69676.1|  hypothetical protein CISIN_1g004812mg                 96.7    6e-20   Citrus sinensis [apfelsine]
gb|KDO69678.1|  hypothetical protein CISIN_1g004812mg                 96.7    7e-20   Citrus sinensis [apfelsine]
gb|KDO69674.1|  hypothetical protein CISIN_1g004812mg                 96.7    7e-20   Citrus sinensis [apfelsine]
ref|XP_006439809.1|  hypothetical protein CICLE_v10019037mg           94.4    4e-19   
ref|XP_008374441.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  94.0    6e-19   
gb|KHN19310.1|  Nephrocystin-3                                        93.6    8e-19   Glycine soja [wild soybean]
ref|XP_006578627.1|  PREDICTED: nephrocystin-3-like                   93.6    9e-19   
ref|XP_004298939.1|  PREDICTED: kinesin light chain 1                 93.2    1e-18   Fragaria vesca subsp. vesca
ref|XP_003528151.1|  PREDICTED: nephrocystin-3-like                   93.2    1e-18   Glycine max [soybeans]
ref|XP_004501933.1|  PREDICTED: uncharacterized protein LOC101499391  92.8    1e-18   Cicer arietinum [garbanzo]
ref|XP_006446488.1|  hypothetical protein CICLE_v10014403mg           92.0    2e-18   Citrus clementina [clementine]
ref|XP_010101208.1|  hypothetical protein L484_015012                 92.0    3e-18   Morus notabilis
gb|KDO66204.1|  hypothetical protein CISIN_1g004829mg                 91.7    3e-18   Citrus sinensis [apfelsine]
ref|XP_006470340.1|  PREDICTED: uncharacterized protein LOC102619851  91.7    3e-18   Citrus sinensis [apfelsine]
ref|XP_010243016.1|  PREDICTED: uncharacterized protein LOC104587203  89.7    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010108770.1|  hypothetical protein L484_020503                 89.7    2e-17   Morus notabilis
ref|XP_009334071.1|  PREDICTED: uncharacterized protein LOC103926921  89.4    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_010251264.1|  PREDICTED: uncharacterized protein LOC104593203  89.0    3e-17   Nelumbo nucifera [Indian lotus]
gb|EYU17664.1|  hypothetical protein MIMGU_mgv1a002285mg              88.6    5e-17   Erythranthe guttata [common monkey flower]
ref|XP_008239759.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  88.6    5e-17   
ref|XP_007211296.1|  hypothetical protein PRUPE_ppa001986mg           88.6    5e-17   Prunus persica
ref|XP_007217015.1|  hypothetical protein PRUPE_ppa002085mg           87.4    1e-16   Prunus persica
ref|XP_007138082.1|  hypothetical protein PHAVU_009G179000g           86.3    3e-16   Phaseolus vulgaris [French bean]
ref|XP_004304619.1|  PREDICTED: uncharacterized protein LOC101294682  85.5    5e-16   Fragaria vesca subsp. vesca
ref|XP_007036200.1|  Tetratricopeptide repeat-like superfamily pr...  85.5    5e-16   
ref|XP_002318043.2|  hypothetical protein POPTR_0012s08160g           85.1    7e-16   
gb|KDP31106.1|  hypothetical protein JCGZ_11482                       85.1    7e-16   Jatropha curcas
ref|XP_011028570.1|  PREDICTED: nephrocystin-3-like                   83.2    3e-15   Populus euphratica
ref|XP_002321593.2|  hypothetical protein POPTR_0015s08660g           83.2    3e-15   
ref|XP_008379249.1|  PREDICTED: tetratricopeptide repeat protein ...  82.8    4e-15   
ref|XP_002511407.1|  kinesin light chain, putative                    82.4    6e-15   Ricinus communis
ref|XP_011044307.1|  PREDICTED: tetratricopeptide repeat protein ...  82.4    6e-15   Populus euphratica
ref|XP_007031462.1|  Tetratricopeptide repeat-like superfamily pr...  82.0    9e-15   
ref|XP_008341468.1|  PREDICTED: tetratricopeptide repeat protein 28   81.6    1e-14   
emb|CBI34925.3|  unnamed protein product                              80.9    1e-14   Vitis vinifera
ref|XP_010660916.1|  PREDICTED: uncharacterized protein LOC100254332  80.9    2e-14   Vitis vinifera
gb|KJB07850.1|  hypothetical protein B456_001G047800                  80.5    3e-14   Gossypium raimondii
gb|KJB07849.1|  hypothetical protein B456_001G047800                  80.1    3e-14   Gossypium raimondii
ref|XP_008230606.1|  PREDICTED: nephrocystin-3                        80.1    4e-14   Prunus mume [ume]
ref|XP_009614635.1|  PREDICTED: tetratricopeptide repeat protein ...  80.1    4e-14   Nicotiana tomentosiformis
emb|CDP02116.1|  unnamed protein product                              79.7    5e-14   Coffea canephora [robusta coffee]
ref|XP_010678757.1|  PREDICTED: uncharacterized protein LOC104894269  79.3    6e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009375110.1|  PREDICTED: uncharacterized protein LOC103963955  78.6    1e-13   Pyrus x bretschneideri [bai li]
ref|XP_009769549.1|  PREDICTED: tetratricopeptide repeat protein 28   78.6    1e-13   Nicotiana sylvestris
ref|XP_010555482.1|  PREDICTED: kinesin light chain 1-like isofor...  77.8    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_010555483.1|  PREDICTED: kinesin light chain 1-like isofor...  77.8    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_010555489.1|  PREDICTED: kinesin light chain 1 isoform X1      77.8    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_010555484.1|  PREDICTED: kinesin light chain 1-like isofor...  77.8    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_010555491.1|  PREDICTED: kinesin light chain 1 isoform X3      77.8    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_010555490.1|  PREDICTED: kinesin light chain 1 isoform X2      77.8    2e-13   Tarenaya hassleriana [spider flower]
gb|KHG27307.1|  Nephrocystin-3                                        77.0    4e-13   Gossypium arboreum [tree cotton]
ref|XP_007151047.1|  hypothetical protein PHAVU_004G014000g           76.6    4e-13   Phaseolus vulgaris [French bean]
ref|XP_003524541.1|  PREDICTED: kinesin light chain-like isoform X1   76.3    7e-13   Glycine max [soybeans]
gb|KHN27426.1|  Nephrocystin-3                                        76.3    7e-13   Glycine soja [wild soybean]
ref|XP_010555485.1|  PREDICTED: kinesin light chain 1-like isofor...  75.9    7e-13   Tarenaya hassleriana [spider flower]
ref|XP_010555492.1|  PREDICTED: kinesin light chain 1 isoform X4      75.9    7e-13   Tarenaya hassleriana [spider flower]
gb|KJB30306.1|  hypothetical protein B456_005G136800                  75.5    1e-12   Gossypium raimondii
ref|XP_003553842.1|  PREDICTED: uncharacterized protein LOC100786...  75.5    1e-12   Glycine max [soybeans]
ref|XP_008782452.1|  PREDICTED: uncharacterized protein LOC103701984  75.1    2e-12   Phoenix dactylifera
ref|XP_010936735.1|  PREDICTED: uncharacterized protein LOC105056290  74.7    3e-12   Elaeis guineensis
ref|XP_010028340.1|  PREDICTED: tetratricopeptide repeat protein 28   73.9    4e-12   Eucalyptus grandis [rose gum]
gb|EPS70530.1|  hypothetical protein M569_04228                       72.8    9e-12   Genlisea aurea
ref|XP_010029186.1|  PREDICTED: kinesin light chain                   72.8    1e-11   Eucalyptus grandis [rose gum]
ref|XP_006579755.1|  PREDICTED: kinesin light chain-like isoform X2   71.2    3e-11   Glycine max [soybeans]
gb|KDP45346.1|  hypothetical protein JCGZ_09595                       71.2    4e-11   Jatropha curcas
ref|NP_001047883.1|  Os02g0708400                                     70.9    4e-11   
ref|XP_006647776.1|  PREDICTED: uncharacterized protein LOC102714889  70.5    7e-11   Oryza brachyantha
ref|XP_006338558.1|  PREDICTED: uncharacterized protein LOC102590808  70.1    7e-11   Solanum tuberosum [potatoes]
ref|XP_004232294.1|  PREDICTED: tetratricopeptide repeat protein ...  70.1    8e-11   Solanum lycopersicum
gb|EYU44745.1|  hypothetical protein MIMGU_mgv1a002492mg              68.6    2e-10   Erythranthe guttata [common monkey flower]
gb|KEH24837.1|  kinesin light chain                                   68.6    2e-10   Medicago truncatula
gb|KEH24836.1|  kinesin light chain                                   68.6    2e-10   Medicago truncatula
ref|XP_011098764.1|  PREDICTED: tetratricopeptide repeat protein ...  67.8    5e-10   
ref|XP_004489282.1|  PREDICTED: uncharacterized protein LOC101501435  67.0    8e-10   Cicer arietinum [garbanzo]
ref|XP_011018373.1|  PREDICTED: uncharacterized protein LOC105121433  66.6    1e-09   Populus euphratica
ref|XP_002312280.2|  kinesin light chain-related family protein       65.9    2e-09   
ref|XP_002893474.1|  predicted protein                                62.4    2e-09   
ref|XP_006844980.1|  hypothetical protein AMTR_s00058p00186720        65.1    4e-09   Amborella trichopoda
ref|XP_009380347.1|  PREDICTED: uncharacterized protein LOC103968764  65.1    4e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003570205.1|  PREDICTED: uncharacterized protein LOC100826447  64.7    4e-09   Brachypodium distachyon [annual false brome]
gb|KJB75858.1|  hypothetical protein B456_012G061500                  63.5    1e-08   Gossypium raimondii
gb|AFW73048.1|  hypothetical protein ZEAMMB73_781821                  63.2    2e-08   
gb|AFW73049.1|  kinesin light chain                                   63.2    2e-08   
gb|AAF99740.1|AC004557_19  F17L21.29                                  62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893471.1|  hypothetical protein ARALYDRAFT_472955           62.8    2e-08   
dbj|BAC42575.1|  unknown protein                                      62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174070.1|  tetratricopeptide repeat domain-containing protein  62.8    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303924.1|  hypothetical protein CARUB_v10008543mg           62.8    2e-08   Capsella rubella
ref|XP_010499233.1|  PREDICTED: uncharacterized protein LOC104776...  62.4    2e-08   
ref|XP_010499229.1|  PREDICTED: uncharacterized protein LOC104776...  62.4    2e-08   
ref|XP_010478089.1|  PREDICTED: uncharacterized protein LOC104757077  62.4    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010499231.1|  PREDICTED: uncharacterized protein LOC104776...  62.4    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010460507.1|  PREDICTED: uncharacterized protein LOC104741359  62.4    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010940045.1|  PREDICTED: tetratricopeptide repeat protein ...  62.4    3e-08   Elaeis guineensis
ref|XP_010502803.1|  PREDICTED: nephrocystin-3-like                   62.0    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_009151903.1|  PREDICTED: nephrocystin-3                        62.0    3e-08   Brassica rapa
ref|XP_010514504.1|  PREDICTED: nephrocystin-3-like                   62.0    4e-08   Camelina sativa [gold-of-pleasure]
ref|NP_189435.1|  tetratricopeptide repeat domain-containing protein  62.0    4e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KJB33765.1|  hypothetical protein B456_006G030200                  61.6    4e-08   Gossypium raimondii
emb|CDY58518.1|  BnaCnng33310D                                        61.6    4e-08   Brassica napus [oilseed rape]
gb|AAQ22597.1|  At3g27960                                             61.6    5e-08   Arabidopsis thaliana [mouse-ear cress]
gb|ABF70051.1|  kinesin light chain-related                           61.6    5e-08   Musa acuminata [banana]
ref|XP_009389350.1|  PREDICTED: kinesin light chain 3-like            61.2    6e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG13835.1|  Nephrocystin-3                                        60.8    7e-08   Gossypium arboreum [tree cotton]
ref|XP_004953633.1|  PREDICTED: uncharacterized protein LOC101762...  60.8    7e-08   Setaria italica
ref|XP_002452671.1|  hypothetical protein SORBIDRAFT_04g030360        60.8    8e-08   Sorghum bicolor [broomcorn]
ref|XP_002877085.1|  hypothetical protein ARALYDRAFT_484584           60.8    8e-08   
ref|XP_010425576.1|  PREDICTED: nephrocystin-3-like                   60.8    9e-08   Camelina sativa [gold-of-pleasure]
gb|ABF70142.1|  glycoside hydrolase family 17 protein                 60.5    1e-07   Musa balbisiana [starchy banana]
ref|NP_001147329.1|  kinesin light chain                              60.5    1e-07   
ref|XP_006395386.1|  hypothetical protein EUTSA_v10003775mg           60.1    1e-07   Eutrema salsugineum [saltwater cress]
ref|XP_010528254.1|  PREDICTED: nephrocystin-3                        59.7    2e-07   Tarenaya hassleriana [spider flower]
ref|XP_006415753.1|  hypothetical protein EUTSA_v10007008mg           59.3    3e-07   Eutrema salsugineum [saltwater cress]
ref|NP_001130826.1|  hypothetical protein                             58.9    3e-07   Zea mays [maize]
gb|KHG25182.1|  Nephrocystin-3                                        58.9    3e-07   Gossypium arboreum [tree cotton]
ref|XP_006290699.1|  hypothetical protein CARUB_v10016794mg           58.5    5e-07   Capsella rubella
emb|CDY56191.1|  BnaC05g51100D                                        56.2    3e-06   Brassica napus [oilseed rape]
ref|XP_010033277.1|  PREDICTED: uncharacterized protein LOC104422608  54.7    7e-06   Eucalyptus grandis [rose gum]
gb|EMT08479.1|  Nephrocystin-3                                        53.5    2e-05   
dbj|BAJ98431.1|  predicted protein                                    53.5    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS45896.1|  Nephrocystin-3                                        53.5    2e-05   Triticum urartu
gb|AAM13438.1|AF474071_1  similar to A. thaliana protein BAB01483...  53.5    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009113759.1|  PREDICTED: uncharacterized protein LOC103839034  53.1    2e-05   Brassica rapa
gb|ABR16125.1|  unknown                                               50.4    2e-04   Picea sitchensis



>ref|XP_009627990.1| PREDICTED: uncharacterized protein LOC104118460 [Nicotiana tomentosiformis]
Length=738

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPGVV+DEIHE+ E    +  EN NS    ++ VVN SP   L  Q+P NGG  Y  +GV
Sbjct  1    MPGVVMDEIHEEVEVK--ELKENGNSTPCKENAVVNESPEGALTPQNPANGGAVYAADGV  58

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIEELY+NVCEMQSS+ SPSR SYGSDGDESRIDSELRHL
Sbjct  59   VEPSIEELYENVCEMQSSDQSPSRPSYGSDGDESRIDSELRHL  101



>ref|XP_006345055.1| PREDICTED: kinesin light chain-like [Solanum tuberosum]
Length=730

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 74/103 (72%), Gaps = 11/103 (11%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPGVV+DEIHE  E  ELKEN N  S   N++         GLA   PRNGG  + G+GV
Sbjct  1    MPGVVMDEIHEVGEIKELKENGNSTSCKENEE--------GGLA---PRNGGEEHVGDGV  49

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIEELY+NVCEMQSS+ SPSR S+GSDGDESRIDSELRHL
Sbjct  50   VEPSIEELYENVCEMQSSDQSPSRHSFGSDGDESRIDSELRHL  92



>ref|XP_009795408.1| PREDICTED: uncharacterized protein LOC104242106 [Nicotiana sylvestris]
Length=738

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 74/103 (72%), Gaps = 2/103 (2%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPGVV+DEIHE+ E    +  EN NS    +  VVN SP   L  Q+P NGG  Y  +GV
Sbjct  1    MPGVVMDEIHEEVEVK--ELKENGNSTPWKEKAVVNESPEGALTPQNPPNGGAEYAADGV  58

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIEELY+NVCEMQSS+ SPSR SYGSDGDESRIDSELRHL
Sbjct  59   VEPSIEELYENVCEMQSSDQSPSRPSYGSDGDESRIDSELRHL  101



>ref|XP_010318909.1| PREDICTED: uncharacterized protein LOC104646605 [Solanum lycopersicum]
 ref|XP_010318910.1| PREDICTED: uncharacterized protein LOC104646605 [Solanum lycopersicum]
Length=730

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 72/103 (70%), Gaps = 11/103 (11%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPGVV+DEIHE  E  ELKEN N      N++         GL    PRNGG  + G+GV
Sbjct  1    MPGVVMDEIHEVGEVKELKENGNSTPCKENEE--------GGLG---PRNGGEEHVGDGV  49

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIEELY+NVCEMQSS+ SPSR S+GSDGDESRIDSELRHL
Sbjct  50   VEPSIEELYENVCEMQSSDQSPSRHSFGSDGDESRIDSELRHL  92



>emb|CDP12398.1| unnamed protein product [Coffea canephora]
Length=704

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG V++  HE+   SE+ EN N  +G  N  +V N S   GL +Q+P+NGGTG    G 
Sbjct  1    MPGFVMEVNHEEGPASEVNENGNSTNGKEN--VVANKSLNEGLTTQNPQNGGTGNVVEGE  58

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIE+LY+NVCEMQSS+HSPSR S+GS+G+ESRIDSELRHL
Sbjct  59   VETSIEQLYENVCEMQSSDHSPSRVSFGSEGEESRIDSELRHL  101



>ref|XP_004155014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101208453 
[Cucumis sativus]
Length=736

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 76/103 (74%), Gaps = 5/103 (5%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V+DEI+E+R       N++  S +H ++   N SPR+GL+ QSP +    +  +G+
Sbjct  1    MPGIVMDEINEER-----AVNKHNGSSIHIEESYENKSPRSGLSLQSPGSVHVDFPVDGL  55

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR+S+GSDG+ESRIDSEL HL
Sbjct  56   VDTSIEKLYENVCDMQSSDQSPSRRSFGSDGEESRIDSELNHL  98



>ref|XP_004138111.1| PREDICTED: uncharacterized protein LOC101208453 [Cucumis sativus]
 gb|KGN63584.1| hypothetical protein Csa_1G004960 [Cucumis sativus]
Length=736

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 76/103 (74%), Gaps = 5/103 (5%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V+DEI+E+R       N++  S +H ++   N SPR+GL+ QSP +    +  +G+
Sbjct  1    MPGIVMDEINEER-----AVNKHNGSSIHIEESYGNKSPRSGLSLQSPGSVHVDFPVDGL  55

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR+S+GSDG+ESRIDSEL HL
Sbjct  56   VDTSIEKLYENVCDMQSSDQSPSRRSFGSDGEESRIDSELNHL  98



>emb|CBI15036.3| unnamed protein product [Vitis vinifera]
Length=651

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 74/104 (71%), Gaps = 5/104 (5%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSP-RNGGTGYTGNG  252
            MPGVV++ ++ED   +EL    N +S    ++   N SP++ L  QSP R+ G  +  NG
Sbjct  1    MPGVVMEGVNEDGVANEL----NGSSTAFKENSASNKSPKSNLGLQSPPRSAGVEFPMNG  56

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            V + SIE+LYDNVCEMQSS+ SPSR S+GS+G+ESRIDSELRHL
Sbjct  57   VIDTSIEQLYDNVCEMQSSDQSPSRVSFGSEGEESRIDSELRHL  100



>ref|XP_010663184.1| PREDICTED: uncharacterized protein LOC100255253 [Vitis vinifera]
 ref|XP_010663185.1| PREDICTED: uncharacterized protein LOC100255253 [Vitis vinifera]
Length=738

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 74/104 (71%), Gaps = 5/104 (5%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSP-RNGGTGYTGNG  252
            MPGVV++ ++ED   +EL    N +S    ++   N SP++ L  QSP R+ G  +  NG
Sbjct  1    MPGVVMEGVNEDGVANEL----NGSSTAFKENSASNKSPKSNLGLQSPPRSAGVEFPMNG  56

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            V + SIE+LYDNVCEMQSS+ SPSR S+GS+G+ESRIDSELRHL
Sbjct  57   VIDTSIEQLYDNVCEMQSSDQSPSRVSFGSEGEESRIDSELRHL  100



>ref|XP_003601279.1| Kinesin light chain [Medicago truncatula]
 gb|AES71530.1| kinesin light chain [Medicago truncatula]
Length=795

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 71/104 (68%), Gaps = 4/104 (4%)
 Frame = +1

Query  73   KMPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNG  252
            KMPG+V + +H+D E +E+    N N       L    SPR+ ++ Q  ++ G  +  +G
Sbjct  28   KMPGIVTNGVHDDGEVNEM----NGNRSPTKASLTPIKSPRSSMSPQRRQSVGPNFQDDG  83

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            V E SIE+LY+NVC+MQSS+ SPSRQS+GSDGDESRIDSEL HL
Sbjct  84   VVEPSIEQLYENVCDMQSSDQSPSRQSFGSDGDESRIDSELHHL  127



>ref|XP_008453093.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103493911 
[Cucumis melo]
Length=737

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 75/103 (73%), Gaps = 5/103 (5%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V+DEI+E+R       N++  S +H ++   N SPR+GL+ QS  +    +  +G+
Sbjct  1    MPGIVMDEINEER-----AVNKHNGSSIHIEESYGNKSPRSGLSLQSHGSVHVDFPVDGL  55

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR+S+GSDG+ESRIDSEL HL
Sbjct  56   VDTSIEKLYENVCDMQSSDQSPSRRSFGSDGEESRIDSELNHL  98



>ref|XP_008360812.1| PREDICTED: uncharacterized protein LOC103424510 [Malus domestica]
Length=730

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 10/103 (10%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V + ++E           +ENS    ++  +NGSP++ L  QSPR+ G  +  +GV
Sbjct  1    MPGIVEEVVNES----------HENSTPSKENTALNGSPKSTLNQQSPRSRGLDHPVDGV  50

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR+S+ SDGDESRIDSELRHL
Sbjct  51   VDTSIEQLYENVCDMQSSDQSPSRRSFRSDGDESRIDSELRHL  93



>ref|XP_003601278.1| Kinesin light chain [Medicago truncatula]
 gb|AES71529.1| kinesin light chain [Medicago truncatula]
Length=767

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V + +H+D E +E+    N N       L    SPR+ ++ Q  ++ G  +  +GV
Sbjct  1    MPGIVTNGVHDDGEVNEM----NGNRSPTKASLTPIKSPRSSMSPQRRQSVGPNFQDDGV  56

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIE+LY+NVC+MQSS+ SPSRQS+GSDGDESRIDSEL HL
Sbjct  57   VEPSIEQLYENVCDMQSSDQSPSRQSFGSDGDESRIDSELHHL  99



>ref|XP_006476770.1| PREDICTED: uncharacterized protein LOC102617381 isoform X1 [Citrus 
sinensis]
 ref|XP_006476771.1| PREDICTED: uncharacterized protein LOC102617381 isoform X2 [Citrus 
sinensis]
Length=729

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 72/103 (70%), Gaps = 8/103 (8%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+++D+IHE+   SEL    N NS    ++ V N SP++    QSPR+   G     V
Sbjct  1    MPGIIMDDIHEEGVVSEL----NGNSTPVKENSVSNKSPKSTPCPQSPRDQPVG----EV  52

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR S+GSDG+ESRIDSELRHL
Sbjct  53   VDASIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHL  95



>ref|XP_011101334.1| PREDICTED: nephrocystin-3 isoform X2 [Sesamum indicum]
Length=659

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 5/123 (4%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V+D IHED        N + N     ++ V N SP   L  + P+N   G    GV
Sbjct  1    MPGIVMDGIHEDG-----AVNGDGNDMACKENPVANNSPARSLTPEGPQNDDRGDNVAGV  55

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHLvggemreveimeedeeL  435
             + SI++LY+NVCEMQSS+ SPSR S+GSDG+ESRIDSELRHLVGGEMREVEI+EED EL
Sbjct  56   VDTSIDQLYENVCEMQSSDQSPSRPSFGSDGEESRIDSELRHLVGGEMREVEIIEEDAEL  115

Query  436  QRP  444
            Q+P
Sbjct  116  QKP  118



>ref|XP_011101333.1| PREDICTED: uncharacterized protein LOC105179412 isoform X1 [Sesamum 
indicum]
Length=731

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 5/123 (4%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V+D IHED        N + N     ++ V N SP   L  + P+N   G    GV
Sbjct  1    MPGIVMDGIHEDG-----AVNGDGNDMACKENPVANNSPARSLTPEGPQNDDRGDNVAGV  55

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHLvggemreveimeedeeL  435
             + SI++LY+NVCEMQSS+ SPSR S+GSDG+ESRIDSELRHLVGGEMREVEI+EED EL
Sbjct  56   VDTSIDQLYENVCEMQSSDQSPSRPSFGSDGEESRIDSELRHLVGGEMREVEIIEEDAEL  115

Query  436  QRP  444
            Q+P
Sbjct  116  QKP  118



>ref|XP_009363029.1| PREDICTED: uncharacterized protein LOC103953033 [Pyrus x bretschneideri]
Length=730

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (69%), Gaps = 10/103 (10%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V + ++E           +ENS    ++  +NGSP++ L  QSPR+ G     +GV
Sbjct  1    MPGIVDEVVNES----------HENSTPSKENTALNGSPKSTLNQQSPRSRGHDRPVDGV  50

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR+S+ SDGDESRIDSELRHL
Sbjct  51   VDTSIEQLYENVCDMQSSDQSPSRRSFRSDGDESRIDSELRHL  93



>gb|KDO69676.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
 gb|KDO69677.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
Length=712

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 73/103 (71%), Gaps = 8/103 (8%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+++D+IHE+   SEL    N NS    ++ V N SP++    QSPR+   G    GV
Sbjct  1    MPGIIMDDIHEEGVVSEL----NGNSTPVKENSVSNKSPKSTPCPQSPRDQPDG---EGV  53

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR S+GSDG+ESRIDSELRHL
Sbjct  54   -DTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHL  95



>gb|KDO69678.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
 gb|KDO69679.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
 gb|KDO69680.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
Length=727

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 73/103 (71%), Gaps = 8/103 (8%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+++D+IHE+   SEL    N NS    ++ V N SP++    QSPR+   G    GV
Sbjct  1    MPGIIMDDIHEEGVVSEL----NGNSTPVKENSVSNKSPKSTPCPQSPRDQPDG---EGV  53

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR S+GSDG+ESRIDSELRHL
Sbjct  54   -DTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHL  95



>gb|KDO69674.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
 gb|KDO69675.1| hypothetical protein CISIN_1g004812mg [Citrus sinensis]
Length=729

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 73/103 (71%), Gaps = 8/103 (8%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+++D+IHE+   SEL    N NS    ++ V N SP++    QSPR+   G    GV
Sbjct  1    MPGIIMDDIHEEGVVSEL----NGNSTPVKENSVSNKSPKSTPCPQSPRDQPDG---EGV  53

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR S+GSDG+ESRIDSELRHL
Sbjct  54   -DTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHL  95



>ref|XP_006439809.1| hypothetical protein CICLE_v10019037mg [Citrus clementina]
 gb|ESR53049.1| hypothetical protein CICLE_v10019037mg [Citrus clementina]
Length=727

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 73/103 (71%), Gaps = 8/103 (8%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+++D+I+E+   SEL    N NS    ++ V N SP++    QSPR+   G    GV
Sbjct  1    MPGIIMDDIYEEGVVSEL----NGNSTPVKENSVSNKSPKSTPCPQSPRDQPDG---EGV  53

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR S+GSDG+ESRIDSELRHL
Sbjct  54   -DTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHL  95



>ref|XP_008374441.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103437723 
[Malus domestica]
Length=730

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 70/103 (68%), Gaps = 10/103 (10%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V + ++E           +ENS +  ++  +NGS ++ L  Q+PR+ G     +G+
Sbjct  1    MPGIVDEMVNES----------HENSMLSKENTALNGSRKSTLNQQTPRSTGLDRPVDGM  50

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR S+ SDGDESRIDSELRHL
Sbjct  51   VDTSIEQLYENVCDMQSSDQSPSRHSFQSDGDESRIDSELRHL  93



>gb|KHN19310.1| Nephrocystin-3 [Glycine soja]
Length=753

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 8/107 (7%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNG----GTGYT  243
            MPG+V + +H D   S     +++++     +LV   SPR G  S SP+ G    G  + 
Sbjct  1    MPGIVRNGVHHDEGGSNDMNGDHDSTSKEPLNLV--KSPRGG--SVSPQRGQGDDGANFG  56

Query  244  GNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            G+ V E SIE+LY+NVC+MQSS+ SPSRQS+GSDGDESRIDSELRHL
Sbjct  57   GDEVVEPSIEQLYENVCDMQSSDQSPSRQSFGSDGDESRIDSELRHL  103



>ref|XP_006578627.1| PREDICTED: nephrocystin-3-like [Glycine max]
 gb|KHN30909.1| Nephrocystin-3 [Glycine soja]
Length=755

 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 72/107 (67%), Gaps = 9/107 (8%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNG----GTGYT  243
            MPG+V + + ++   +E+  +++       + L +  SPR G  S SP  G    G  + 
Sbjct  6    MPGIVTNGVQDEGGSNEMNGDQDSP---FKEPLNLVKSPRGG--SVSPGRGQGDDGANFG  60

Query  244  GNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            G+GV E SIE+LY+NVC+MQSS+ SPSRQS+GSDGDESRIDSELRHL
Sbjct  61   GDGVVEPSIEQLYENVCDMQSSDQSPSRQSFGSDGDESRIDSELRHL  107



>ref|XP_004298939.1| PREDICTED: kinesin light chain 1 [Fragaria vesca subsp. vesca]
Length=732

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 68/103 (66%), Gaps = 10/103 (10%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V   ++E           N NS    ++  +N SP+  L++ SPR+ GT     GV
Sbjct  1    MPGIVEGAVNE----------LNGNSQTQKENSAMNRSPKITLSAHSPRSMGTDVPVEGV  50

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR+S+ SDG+ESRIDSELRHL
Sbjct  51   VDTSIEQLYENVCDMQSSDQSPSRRSFRSDGEESRIDSELRHL  93



>ref|XP_003528151.1| PREDICTED: nephrocystin-3-like [Glycine max]
Length=753

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 72/107 (67%), Gaps = 8/107 (7%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNG----GTGYT  243
            MPG+V + +H D   S     +++++     +LV   SPR G  S SP+ G    G  + 
Sbjct  1    MPGIVRNGVHHDEGGSNDLNGDHDSTSKEPLNLV--KSPRGG--SVSPQRGQGDDGANFG  56

Query  244  GNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            G+ V E SIE+LY+NVC+MQSS+ SPSRQS+GSDGDESRIDSELRHL
Sbjct  57   GDEVVEPSIEQLYENVCDMQSSDQSPSRQSFGSDGDESRIDSELRHL  103



>ref|XP_004501933.1| PREDICTED: uncharacterized protein LOC101499391 [Cicer arietinum]
Length=743

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 4/103 (4%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V + +H+D   +E+    NE+     + L    S R+ L+ Q  ++ G  +  +GV
Sbjct  1    MPGMVTNGVHDDGGSNEM----NEDHSPSKESLTPIKSLRSSLSPQRHQSVGPSFPVDGV  56

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIE+LY+NVC+MQSS+ SPSR+S+GSDGDESRIDSEL HL
Sbjct  57   VEPSIEQLYENVCDMQSSDQSPSRRSFGSDGDESRIDSELHHL  99



>ref|XP_006446488.1| hypothetical protein CICLE_v10014403mg [Citrus clementina]
 gb|ESR59728.1| hypothetical protein CICLE_v10014403mg [Citrus clementina]
Length=728

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 3/103 (3%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +D ++ D     + E      G + D  V   SPR+ L+ QSPR+       +G+
Sbjct  1    MPGLAMDALNGD--SGGVYEANGGYMG-YKDSFVQQKSPRSPLSPQSPRSDSLDLAIDGI  57

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIE+LY N+CEM+SSE SPSR SYGS G+ESRIDSELRHL
Sbjct  58   VETSIEQLYLNICEMESSEQSPSRASYGSYGEESRIDSELRHL  100



>ref|XP_010101208.1| hypothetical protein L484_015012 [Morus notabilis]
 gb|EXB87882.1| hypothetical protein L484_015012 [Morus notabilis]
Length=743

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 78/105 (74%), Gaps = 6/105 (6%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGY-TGNG  252
            MPG+V+DEI ED   + +    N NS    ++L VN SP++  + +SPRN G G  +G+G
Sbjct  1    MPGIVMDEISEDGVVNVM----NGNSPPPKENLGVNTSPKSNSSPKSPRNTGVGLPSGDG  56

Query  253  VA-EKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            V  + SIE+LY+NVC+MQSS+ SPSR+SYGSDG+ESRIDSELRHL
Sbjct  57   VVIDTSIEQLYENVCDMQSSDQSPSRRSYGSDGEESRIDSELRHL  101



>gb|KDO66204.1| hypothetical protein CISIN_1g004829mg [Citrus sinensis]
 gb|KDO66205.1| hypothetical protein CISIN_1g004829mg [Citrus sinensis]
 gb|KDO66206.1| hypothetical protein CISIN_1g004829mg [Citrus sinensis]
Length=728

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 3/103 (3%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +D ++ D     + E      G + D  V   SPR+ L+ QSPR+       +G+
Sbjct  1    MPGLAMDALNGD--SGGVYEANGGYMG-YKDSFVQQKSPRSPLSPQSPRSDSLDLAIDGI  57

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIE+LY N+CEM+SSE SPSR SYGS G+ESRIDSELRHL
Sbjct  58   VETSIEQLYLNICEMESSEQSPSRASYGSYGEESRIDSELRHL  100



>ref|XP_006470340.1| PREDICTED: uncharacterized protein LOC102619851 [Citrus sinensis]
Length=728

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 3/103 (3%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +D ++ D     + E      G + D  V   SPR+ L+ QSPR+       +G+
Sbjct  1    MPGLAMDALNGD--SGGVYEANGGYMG-YKDSFVQQKSPRSPLSPQSPRSDSLDLAIDGI  57

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIE+LY N+CEM+SSE SPSR SYGS G+ESRIDSELRHL
Sbjct  58   VETSIEQLYLNICEMESSEQSPSRASYGSYGEESRIDSELRHL  100



>ref|XP_010243016.1| PREDICTED: uncharacterized protein LOC104587203 [Nelumbo nucifera]
Length=736

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 71/103 (69%), Gaps = 5/103 (5%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MP  V+D I+ +  +SE+    N  S    ++L VN SPR+ L+ QSP++       +G+
Sbjct  1    MPEFVMDGINGEGTESEV----NGKSSPIKENLTVNRSPRSTLSPQSPQSA-LDMPLDGM  55

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NV EMQSS+ SPSR SYGSDG+ESRIDSELRHL
Sbjct  56   VDTSIEQLYENVYEMQSSDQSPSRISYGSDGEESRIDSELRHL  98



>ref|XP_010108770.1| hypothetical protein L484_020503 [Morus notabilis]
 gb|EXC20285.1| hypothetical protein L484_020503 [Morus notabilis]
Length=733

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 65/103 (63%), Gaps = 4/103 (4%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V+D  + D     L +  N +     +     GSPR+ L+ QSP++       +GV
Sbjct  1    MPGLVMDAFNGD----SLVDEANGDYTPRKESFTQQGSPRSPLSPQSPQSDSIDLVIDGV  56

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY NVCEMQSS+ SPSR S+ S G+ESRIDSELRHL
Sbjct  57   IDTSIEQLYHNVCEMQSSDQSPSRASFLSYGEESRIDSELRHL  99



>ref|XP_009334071.1| PREDICTED: uncharacterized protein LOC103926921 [Pyrus x bretschneideri]
Length=719

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +1

Query  184  GSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRI  363
            GSPR+ L+ QSP NG  G   NG  + SIE+LY N+CEMQSS+ +PSR S+GS G+ESRI
Sbjct  32   GSPRSTLSPQSPHNGSIGMVMNGRIDTSIEQLYHNICEMQSSDQTPSRASFGSFGEESRI  91

Query  364  DSELRHL  384
            DSEL HL
Sbjct  92   DSELNHL  98



>ref|XP_010251264.1| PREDICTED: uncharacterized protein LOC104593203 [Nelumbo nucifera]
Length=740

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 68/103 (66%), Gaps = 4/103 (4%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MP  V+D ++ +   SE+    N NS    + L ++ SP++ L+SQS R+       + +
Sbjct  1    MPEFVMDGVNGEGVVSEV----NNNSAPIKESLALSRSPKSTLSSQSARSDVLDMPLDDM  56

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               SIE+LYDNVCEMQSS+ SPSR SY SDGDESR+DSELRHL
Sbjct  57   VNTSIEQLYDNVCEMQSSDQSPSRISYVSDGDESRLDSELRHL  99



>gb|EYU17664.1| hypothetical protein MIMGU_mgv1a002285mg [Erythranthe guttata]
Length=691

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 66/103 (64%), Gaps = 14/103 (14%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V D +HED  D        ENS  + +  + NG    GL  Q P+NG       GV
Sbjct  1    MPGIVKDGVHEDGAD--------ENSMSNKEASISNG----GLTPQHPQNGNIEVAA-GV  47

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SI++LY+NVCEMQSS+ SPSR S GSDG+ESRIDSELRHL
Sbjct  48   -DTSIDQLYENVCEMQSSDQSPSRHSLGSDGEESRIDSELRHL  89



>ref|XP_008239759.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103338340 
[Prunus mume]
Length=718

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 68/103 (66%), Gaps = 10/103 (10%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V + ++E           N NS  + ++  +NG P+  ++ QSP + G     +GV
Sbjct  1    MPGIVEEVVYES----------NGNSMPNKENPALNGFPKGTMSQQSPGSTGPDRPVDGV  50

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR+S+ SDG+ESRIDSEL HL
Sbjct  51   VDTSIEQLYENVCDMQSSDQSPSRRSFRSDGEESRIDSELHHL  93



>ref|XP_007211296.1| hypothetical protein PRUPE_ppa001986mg [Prunus persica]
 gb|EMJ12495.1| hypothetical protein PRUPE_ppa001986mg [Prunus persica]
Length=732

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 68/103 (66%), Gaps = 10/103 (10%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V + ++E           N NS  + ++  +NG P+  ++ QSP + G     +GV
Sbjct  1    MPGIVEEVVYES----------NGNSMPNKENPALNGFPKGTMSQQSPGSTGPDRPVDGV  50

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSR+S+ SDG+ESRIDSEL HL
Sbjct  51   VDTSIEQLYENVCDMQSSDQSPSRRSFRSDGEESRIDSELHHL  93



>ref|XP_007217015.1| hypothetical protein PRUPE_ppa002085mg [Prunus persica]
 gb|EMJ18214.1| hypothetical protein PRUPE_ppa002085mg [Prunus persica]
Length=719

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 63/103 (61%), Gaps = 4/103 (4%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +D  +E  E  E     N +     +     GSPR+ L+ QSP +G  G   +G 
Sbjct  1    MPGLAMDAPNEYSEVDE----PNGDYAPQKESYSQQGSPRSPLSPQSPHSGSIGLAMDGG  56

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY NVCEMQSS+ SPSR S+GS G ESRIDSEL HL
Sbjct  57   IDTSIEQLYHNVCEMQSSDQSPSRASFGSFGAESRIDSELNHL  99



>ref|XP_007138082.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
 ref|XP_007138083.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
 ref|XP_007138084.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
 gb|ESW10076.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
 gb|ESW10077.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
 gb|ESW10078.1| hypothetical protein PHAVU_009G179000g [Phaseolus vulgaris]
Length=749

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 69/107 (64%), Gaps = 11/107 (10%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNG-  252
            M G+V +E+ ++ E +E+  N +  S    + L    SPR    S SP   G G T N  
Sbjct  1    MSGIVTNEVRDEGEGNEMNGNRDSPS---KETLSQVKSPR---GSSSP-GKGEGDTANFG  53

Query  253  ---VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               V E SIE+LY+NVC+MQSS+ SPSRQS+GSDGDESRIDSELRHL
Sbjct  54   VEEVVEPSIEQLYENVCDMQSSDQSPSRQSFGSDGDESRIDSELRHL  100



>ref|XP_004304619.1| PREDICTED: uncharacterized protein LOC101294682 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468264.1| PREDICTED: uncharacterized protein LOC101294682 [Fragaria vesca 
subsp. vesca]
Length=708

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +DE++ +     + E+  E +  H +     GSPR+ L  QSP +  TG   +G 
Sbjct  1    MPGLAMDEVNGN---GVVDEHSGEYTP-HKEGYNQQGSPRSPLNPQSPHSDSTGMPMDGP  56

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY NVCEMQSS+ SPSR S+GS G ESRIDSEL HL
Sbjct  57   IDTSIEQLYHNVCEMQSSDQSPSRASFGSFGAESRIDSELNHL  99



>ref|XP_007036200.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007036201.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY20701.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY20702.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma 
cacao]
Length=733

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 67/103 (65%), Gaps = 4/103 (4%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+++DEI E+   +E+    N  S    ++ V N SP++  + +SP        G   
Sbjct  1    MPGLIMDEIKEEAVMNEV----NGTSAHIKENSVSNKSPKSTPSPRSPHGADHPINGMVQ  56

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY+NVC+MQSS+ SPSRQS GS G+ESRIDSELRHL
Sbjct  57   VDTSIEQLYENVCDMQSSDQSPSRQSCGSYGEESRIDSELRHL  99



>ref|XP_002318043.2| hypothetical protein POPTR_0012s08160g [Populus trichocarpa]
 gb|EEE96263.2| hypothetical protein POPTR_0012s08160g [Populus trichocarpa]
Length=702

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 68/113 (60%), Gaps = 14/113 (12%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGT-------  234
            MPG+V D I E+   +E+    N NS    D+ V   SPR   +  S R+ G        
Sbjct  1    MPGIVTDGIDEEGIVNEM----NGNSVPMKDNSVPYKSPRRKSSPHSRRSTGLDPPIDGV  56

Query  235  ---GYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               G   +GV + SIE+LY+NVC+MQSS+ SP R S+GSDG+ESRIDSELRHL
Sbjct  57   SVYGVAVDGVLDTSIEQLYENVCDMQSSDQSPLRHSFGSDGEESRIDSELRHL  109



>gb|KDP31106.1| hypothetical protein JCGZ_11482 [Jatropha curcas]
Length=755

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 71/121 (59%), Gaps = 23/121 (19%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVH---NDDLVVNGSPRNGLASQSPRNGGTGYTG  246
            MPG+V D I     + E   N++E +G      ++ V N SP + L+ QSPR+       
Sbjct  1    MPGIVTDGI-----NGEAVVNDHETNGNFVSIKENPVSNKSPSSTLSRQSPRSTAVDLPA  55

Query  247  ---------------NGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRH  381
                           +GV + SIE+LY+NVC+MQSS+ SPSR S+GSDG+ESRIDSELRH
Sbjct  56   GGMPVGDVVNDKVAVHGVVDTSIEQLYENVCDMQSSDLSPSRHSFGSDGEESRIDSELRH  115

Query  382  L  384
            L
Sbjct  116  L  116



>ref|XP_011028570.1| PREDICTED: nephrocystin-3-like [Populus euphratica]
 ref|XP_011028571.1| PREDICTED: nephrocystin-3-like [Populus euphratica]
Length=746

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 69/113 (61%), Gaps = 14/113 (12%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGT-------  234
            MPG+V+D I+E+   +E+    N NS    ++ V N SPR+  +     + G        
Sbjct  1    MPGIVMDGINEEAIVNEM----NGNSVPMKENSVPNKSPRSASSPHGLHSAGLDPPVDAV  56

Query  235  ---GYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               G   +GV + SIE+LY+NVC+MQSS+ SPSR S+ SDG+ESRIDSEL HL
Sbjct  57   DVHGVAVDGVVDTSIEQLYENVCDMQSSDQSPSRHSFASDGEESRIDSELCHL  109



>ref|XP_002321593.2| hypothetical protein POPTR_0015s08660g [Populus trichocarpa]
 gb|EEF05720.2| hypothetical protein POPTR_0015s08660g [Populus trichocarpa]
Length=699

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 69/113 (61%), Gaps = 14/113 (12%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGT-------  234
            MPG+V+D I+E+   +E+    N NS    ++ V N SPR+  +     + G        
Sbjct  1    MPGIVMDGINEEAIVNEM----NGNSVPMKENSVPNKSPRSASSPHGLHSAGLDPPVDAV  56

Query  235  ---GYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               G   +GV + SIE+LY+NVC+MQSS+ SPSR S+ SDG+ESRIDSEL HL
Sbjct  57   AVHGVAVDGVVDTSIEQLYENVCDMQSSDQSPSRHSFASDGEESRIDSELCHL  109



>ref|XP_008379249.1| PREDICTED: tetratricopeptide repeat protein 28-like [Malus domestica]
Length=716

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  184  GSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRI  363
            GSPR+ L+ QSP +G  G   NG  + S E+LY N+CEMQSS+ SPS  S+GS G+ESRI
Sbjct  32   GSPRSTLSPQSPHSGSIGMAMNGGIDTSTEQLYHNICEMQSSDQSPSWASFGSFGEESRI  91

Query  364  DSELRHL  384
            DSEL HL
Sbjct  92   DSELNHL  98



>ref|XP_002511407.1| kinesin light chain, putative [Ricinus communis]
 gb|EEF52009.1| kinesin light chain, putative [Ricinus communis]
Length=767

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 72/128 (56%), Gaps = 29/128 (23%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V+D  +E+   +E+    N+NS    ++ + N SPR+ L+ QSP +        GV
Sbjct  1    MPGIVMDGNNEEAIVNEM----NDNSVPIKENAMSNKSPRSTLSPQSPCSNSVDLPAGGV  56

Query  256  -------------------------AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESR  360
                                      + SIE+LY+NVC+MQSS+ SPSR S+GSDG+ESR
Sbjct  57   PVGELTVDEVVVNEVAADETSVHGGVDTSIEQLYENVCDMQSSDLSPSRHSFGSDGEESR  116

Query  361  IDSELRHL  384
            IDSELRHL
Sbjct  117  IDSELRHL  124



>ref|XP_011044307.1| PREDICTED: tetratricopeptide repeat protein 28-like [Populus 
euphratica]
 ref|XP_011044308.1| PREDICTED: tetratricopeptide repeat protein 28-like [Populus 
euphratica]
Length=742

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 66/113 (58%), Gaps = 14/113 (12%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGT-------  234
            MPG+V+D I E+   +E+    N NS    D  V N SPR   +    R  G        
Sbjct  1    MPGIVMDGIDEEGIVNEM----NGNSVPMKDSSVPNKSPRRKSSPHGRRCTGLDPPVDGV  56

Query  235  ---GYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               G   +GV   SIE+LY+NVC++QSS+ SP R S+GSDG+ESRIDSELRHL
Sbjct  57   SVYGVAVDGVLGTSIEQLYENVCDIQSSDQSPLRHSFGSDGEESRIDSELRHL  109



>ref|XP_007031462.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
 gb|EOY02388.1| Tetratricopeptide repeat-like superfamily protein [Theobroma 
cacao]
Length=734

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +D I+ +   S + E  N     + D      SPR+ L+ QS ++       +GV
Sbjct  1    MPGLAMDAINGE---SGVDEPNNGFCTPYKDSFNQERSPRSALSPQSQQSDSIDLAIDGV  57

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIE+LY NV EMQSS+ SPS  SYGS G+ESRIDSELRHL
Sbjct  58   VETSIEQLYHNVYEMQSSDQSPSMTSYGSYGEESRIDSELRHL  100



>ref|XP_008341468.1| PREDICTED: tetratricopeptide repeat protein 28 [Malus domestica]
Length=710

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 63/103 (61%), Gaps = 7/103 (7%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +D ++ + +  E     N +     +     GSPR+ L+S   R+G  G   NG 
Sbjct  1    MPGLAMDAMNRNGDVDE----SNGDYAPQKESYSQQGSPRSTLSS---RSGSIGMAMNGG  53

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY NVCEMQSS+ SPSR S+GS G ESRIDSEL HL
Sbjct  54   IDTSIEQLYHNVCEMQSSDQSPSRASFGSFGGESRIDSELNHL  96



>emb|CBI34925.3| unnamed protein product [Vitis vinifera]
Length=670

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 60/103 (58%), Gaps = 12/103 (12%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V+D +H D        N     G  N       SP + L+ QS  +G      +GV
Sbjct  1    MPGLVMDGLHRDG-----MANYTPKEGFSN-------SPVSALSPQSHESGSIDLVIDGV  48

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               SIE+LY NVCEMQSS+ SPSR+S+ S G+ESRIDSEL HL
Sbjct  49   INTSIEQLYHNVCEMQSSDQSPSRRSFISYGNESRIDSELYHL  91



>ref|XP_010660916.1| PREDICTED: uncharacterized protein LOC100254332 [Vitis vinifera]
 ref|XP_010660917.1| PREDICTED: uncharacterized protein LOC100254332 [Vitis vinifera]
 ref|XP_010660918.1| PREDICTED: uncharacterized protein LOC100254332 [Vitis vinifera]
Length=728

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 60/103 (58%), Gaps = 12/103 (12%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V+D +H D        N     G  N       SP + L+ QS  +G      +GV
Sbjct  1    MPGLVMDGLHRDG-----MANYTPKEGFSN-------SPVSALSPQSHESGSIDLVIDGV  48

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               SIE+LY NVCEMQSS+ SPSR+S+ S G+ESRIDSEL HL
Sbjct  49   INTSIEQLYHNVCEMQSSDQSPSRRSFISYGNESRIDSELYHL  91



>gb|KJB07850.1| hypothetical protein B456_001G047800 [Gossypium raimondii]
Length=697

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 75/106 (71%), Gaps = 8/106 (8%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNG-GTGYTGNG  252
            MPG+++D+   ++E++++ E    +S +  +++V+N SP++    QS R      +  NG
Sbjct  1    MPGLIMDD---NKEEADMNEVNGTSSHI-KENVVLNKSPKSA-RPQSLRGAESASHLNNG  55

Query  253  V--AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +  A+ SIE+LY++VC+MQSS+ SPSRQS+GS G+ESRIDSEL HL
Sbjct  56   MNQADTSIEQLYEDVCDMQSSDQSPSRQSFGSYGEESRIDSELCHL  101



>gb|KJB07849.1| hypothetical protein B456_001G047800 [Gossypium raimondii]
Length=737

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 75/106 (71%), Gaps = 8/106 (8%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNG-GTGYTGNG  252
            MPG+++D+   ++E++++ E    +S +  +++V+N SP++    QS R      +  NG
Sbjct  1    MPGLIMDD---NKEEADMNEVNGTSSHI-KENVVLNKSPKSA-RPQSLRGAESASHLNNG  55

Query  253  V--AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +  A+ SIE+LY++VC+MQSS+ SPSRQS+GS G+ESRIDSEL HL
Sbjct  56   MNQADTSIEQLYEDVCDMQSSDQSPSRQSFGSYGEESRIDSELCHL  101



>ref|XP_008230606.1| PREDICTED: nephrocystin-3 [Prunus mume]
Length=722

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +1

Query  184  GSPRNGLASQSPRN---GGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDE  354
            GSPR+ L+ QSP++   G  G   +G  + SIE+LY NVCEMQSS+ SPSR S+GS G E
Sbjct  33   GSPRSPLSPQSPQSPHSGSIGLAMDGGIDTSIEQLYHNVCEMQSSDQSPSRASFGSFGAE  92

Query  355  SRIDSELRHL  384
            SRIDSEL HL
Sbjct  93   SRIDSELNHL  102



>ref|XP_009614635.1| PREDICTED: tetratricopeptide repeat protein 28-like [Nicotiana 
tomentosiformis]
Length=716

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 9/105 (9%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSG--VHNDDLVVNGSPRNGLASQSPRNGGTGYTGN  249
            MP  V+D        S L +N  E +G  +H+ +    GSPR+ L++ S          N
Sbjct  1    MPEFVMD-------GSILDDNHKEPNGHFIHHREFFYQGSPRSPLSTHSRETDSIDLDMN  53

Query  250  GVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            G  + SIE+LY+NV EMQSS++SPSR+S+ S G+ESRIDSELR+L
Sbjct  54   GAVDTSIEQLYNNVYEMQSSDYSPSRRSFLSYGEESRIDSELRYL  98



>emb|CDP02116.1| unnamed protein product [Coffea canephora]
Length=761

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = +1

Query  124  ELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQ  303
            E+   E     V + ++    SPR+ L++ SP          G  + SIEELY+NVCEMQ
Sbjct  59   EVSSREFTGPYVPHKEIFAQTSPRSPLSTHSPETDSIDLAIEGAVDTSIEELYNNVCEMQ  118

Query  304  SSEHSPSRQSYGSDGDESRIDSELRHL  384
            SS+ SPSR SY S G+ESRIDSELR+L
Sbjct  119  SSDQSPSRLSYLSYGEESRIDSELRYL  145



>ref|XP_010678757.1| PREDICTED: uncharacterized protein LOC104894269 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678758.1| PREDICTED: uncharacterized protein LOC104894269 [Beta vulgaris 
subsp. vulgaris]
Length=716

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (63%), Gaps = 15/108 (14%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSEL---KENENENSGVHNDDLVVNGSPRNGLASQSPRN-GGTGYT  243
            MPGVVV+ ++ED  +  +   KEN  +N            SP++ L+ QSPR+       
Sbjct  1    MPGVVVEGVNEDGLEVNVTPGKENSVQNMR----------SPKSTLSPQSPRSIEEEEVL  50

Query  244  GNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGD-ESRIDSELRHL  384
             +G    SIE+LYDNVCEM+SS+ SPSRQSY S+ D ESRIDSELRHL
Sbjct  51   MDGAVNTSIEQLYDNVCEMESSDQSPSRQSYLSEDDNESRIDSELRHL  98



>ref|XP_009375110.1| PREDICTED: uncharacterized protein LOC103963955 [Pyrus x bretschneideri]
Length=710

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 62/103 (60%), Gaps = 7/103 (7%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +D ++ + E  E     N +     +     GSPR+ L+S   R+G  G   NG 
Sbjct  1    MPGLAMDAMNRNGEVDE----SNGDYVPQKESYSQQGSPRSTLSS---RSGSIGMAMNGG  53

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY NVCEMQSS+ SPSR S GS G ESRIDSEL HL
Sbjct  54   IDTSIEQLYHNVCEMQSSDPSPSRASLGSFGGESRIDSELNHL  96



>ref|XP_009769549.1| PREDICTED: tetratricopeptide repeat protein 28 [Nicotiana sylvestris]
Length=716

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 9/105 (9%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSG--VHNDDLVVNGSPRNGLASQSPRNGGTGYTGN  249
            MP  V+D        S L +N  E +G  +H+ +    GSPR+ L++ S          N
Sbjct  1    MPEFVMD-------GSILDDNHKEPNGHFIHHREFFDQGSPRSPLSTHSRETDSIDLDMN  53

Query  250  GVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            G  + SIE+LY+NV EMQSS++SPSR+S+ S G+ESRIDSELR+L
Sbjct  54   GAVDTSIEQLYNNVYEMQSSDYSPSRRSFLSYGEESRIDSELRYL  98



>ref|XP_010555482.1| PREDICTED: kinesin light chain 1-like isoform X1 [Tarenaya hassleriana]
Length=658

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 59/104 (57%), Gaps = 29/104 (28%)
 Frame = +1

Query  73   KMPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNG  252
            KMPG+V +EI E+ +  EL                      NG +S  P  G   +T   
Sbjct  13   KMPGIVSEEIMEEEKVKEL----------------------NGNSSDPPIEGVLVHT---  47

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
                SIEEL DN+CEMQSS+ SPSRQS+GS GDESRIDS+LRHL
Sbjct  48   ----SIEELCDNLCEMQSSDQSPSRQSFGSYGDESRIDSDLRHL  87



>ref|XP_010555483.1| PREDICTED: kinesin light chain 1-like isoform X2 [Tarenaya hassleriana]
Length=655

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 59/104 (57%), Gaps = 29/104 (28%)
 Frame = +1

Query  73   KMPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNG  252
            KMPG+V +EI E+ +  EL                      NG +S  P  G   +T   
Sbjct  10   KMPGIVSEEIMEEEKVKEL----------------------NGNSSDPPIEGVLVHT---  44

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
                SIEEL DN+CEMQSS+ SPSRQS+GS GDESRIDS+LRHL
Sbjct  45   ----SIEELCDNLCEMQSSDQSPSRQSFGSYGDESRIDSDLRHL  84



>ref|XP_010555489.1| PREDICTED: kinesin light chain 1 isoform X1 [Tarenaya hassleriana]
Length=683

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 59/104 (57%), Gaps = 29/104 (28%)
 Frame = +1

Query  73   KMPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNG  252
            KMPG+V +EI E+ +  EL                      NG +S  P  G   +T   
Sbjct  13   KMPGIVSEEIMEEEKVKEL----------------------NGNSSDPPIEGVLVHT---  47

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
                SIEEL DN+CEMQSS+ SPSRQS+GS GDESRIDS+LRHL
Sbjct  48   ----SIEELCDNLCEMQSSDQSPSRQSFGSYGDESRIDSDLRHL  87



>ref|XP_010555484.1| PREDICTED: kinesin light chain 1-like isoform X3 [Tarenaya hassleriana]
Length=653

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 59/104 (57%), Gaps = 29/104 (28%)
 Frame = +1

Query  73   KMPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNG  252
            KMPG+V +EI E+ +  EL                      NG +S  P  G   +T   
Sbjct  8    KMPGIVSEEIMEEEKVKEL----------------------NGNSSDPPIEGVLVHT---  42

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
                SIEEL DN+CEMQSS+ SPSRQS+GS GDESRIDS+LRHL
Sbjct  43   ----SIEELCDNLCEMQSSDQSPSRQSFGSYGDESRIDSDLRHL  82



>ref|XP_010555491.1| PREDICTED: kinesin light chain 1 isoform X3 [Tarenaya hassleriana]
Length=678

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 59/104 (57%), Gaps = 29/104 (28%)
 Frame = +1

Query  73   KMPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNG  252
            KMPG+V +EI E+ +  EL                      NG +S  P  G   +T   
Sbjct  8    KMPGIVSEEIMEEEKVKEL----------------------NGNSSDPPIEGVLVHT---  42

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
                SIEEL DN+CEMQSS+ SPSRQS+GS GDESRIDS+LRHL
Sbjct  43   ----SIEELCDNLCEMQSSDQSPSRQSFGSYGDESRIDSDLRHL  82



>ref|XP_010555490.1| PREDICTED: kinesin light chain 1 isoform X2 [Tarenaya hassleriana]
Length=680

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 59/104 (57%), Gaps = 29/104 (28%)
 Frame = +1

Query  73   KMPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNG  252
            KMPG+V +EI E+ +  EL                      NG +S  P  G   +T   
Sbjct  10   KMPGIVSEEIMEEEKVKEL----------------------NGNSSDPPIEGVLVHT---  44

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
                SIEEL DN+CEMQSS+ SPSRQS+GS GDESRIDS+LRHL
Sbjct  45   ----SIEELCDNLCEMQSSDQSPSRQSFGSYGDESRIDSDLRHL  84



>gb|KHG27307.1| Nephrocystin-3 [Gossypium arboreum]
Length=730

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 17/105 (16%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPGV++DEI E+   +E+K      S    ++ V   +P    + QSPR       G+ +
Sbjct  1    MPGVLMDEIKEEGVLNEMKGT----SARVKENSVSKRTP----SPQSPR-------GDRM  45

Query  256  A--EKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               E SIE+LY+NVC+MQSS+ SPSRQS+GS G+ESRIDSEL HL
Sbjct  46   VQVETSIEQLYENVCDMQSSDQSPSRQSFGSYGEESRIDSELHHL  90



>ref|XP_007151047.1| hypothetical protein PHAVU_004G014000g [Phaseolus vulgaris]
 gb|ACZ74702.1| kinesin light chain-like protein [Phaseolus vulgaris]
 gb|ESW23041.1| hypothetical protein PHAVU_004G014000g [Phaseolus vulgaris]
Length=711

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 61/103 (59%), Gaps = 4/103 (4%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +DE + +       E  + +   H D      SPR+ L+ +S ++       +GV
Sbjct  1    MPGLAMDEFNVNSA----AEEPSGSYTPHKDYFAQQASPRSTLSPRSTQSDSIDLAIDGV  56

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY NVCEM+SS+HSPSR S+ S   ESRIDSEL HL
Sbjct  57   VDTSIEQLYHNVCEMRSSDHSPSRASFYSYDGESRIDSELGHL  99



>ref|XP_003524541.1| PREDICTED: kinesin light chain-like isoform X1 [Glycine max]
Length=702

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 65/106 (61%), Gaps = 11/106 (10%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +DE++       +     E SG + ++     SPR+ L+ +S ++       +GV
Sbjct  1    MPGLAMDELN-------VNSAAEEPSGSYKENFAQQASPRSTLSPRSIQSDSIDLAIDGV  53

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGS---DGDESRIDSELRHL  384
             + SIE+LY NVCEM+SS+HSPSR S+ S   DG ESRIDSEL HL
Sbjct  54   VDTSIEQLYHNVCEMRSSDHSPSRASFYSYDYDG-ESRIDSELGHL  98



>gb|KHN27426.1| Nephrocystin-3 [Glycine soja]
Length=702

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 65/106 (61%), Gaps = 11/106 (10%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +DE++       +     E SG + ++     SPR+ L+ +S ++       +GV
Sbjct  1    MPGLAMDELN-------VNSAAEEPSGSYKENFAQQASPRSTLSPRSIQSDSIDLAIDGV  53

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGS---DGDESRIDSELRHL  384
             + SIE+LY NVCEM+SS+HSPSR S+ S   DG ESRIDSEL HL
Sbjct  54   VDTSIEQLYHNVCEMRSSDHSPSRASFYSYDYDG-ESRIDSELGHL  98



>ref|XP_010555485.1| PREDICTED: kinesin light chain 1-like isoform X4 [Tarenaya hassleriana]
 ref|XP_010555486.1| PREDICTED: kinesin light chain 1-like isoform X4 [Tarenaya hassleriana]
 ref|XP_010555487.1| PREDICTED: kinesin light chain 1-like isoform X4 [Tarenaya hassleriana]
 ref|XP_010555488.1| PREDICTED: kinesin light chain 1-like isoform X4 [Tarenaya hassleriana]
Length=645

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 58/103 (56%), Gaps = 29/103 (28%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V +EI E+ +  EL                      NG +S  P  G   +T    
Sbjct  1    MPGIVSEEIMEEEKVKEL----------------------NGNSSDPPIEGVLVHT----  34

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               SIEEL DN+CEMQSS+ SPSRQS+GS GDESRIDS+LRHL
Sbjct  35   ---SIEELCDNLCEMQSSDQSPSRQSFGSYGDESRIDSDLRHL  74



>ref|XP_010555492.1| PREDICTED: kinesin light chain 1 isoform X4 [Tarenaya hassleriana]
 ref|XP_010555493.1| PREDICTED: kinesin light chain 1 isoform X4 [Tarenaya hassleriana]
 ref|XP_010555494.1| PREDICTED: kinesin light chain 1 isoform X4 [Tarenaya hassleriana]
 ref|XP_010555495.1| PREDICTED: kinesin light chain 1 isoform X4 [Tarenaya hassleriana]
 ref|XP_010555496.1| PREDICTED: kinesin light chain 1 isoform X4 [Tarenaya hassleriana]
Length=670

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 58/103 (56%), Gaps = 29/103 (28%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V +EI E+ +  EL                      NG +S  P  G   +T    
Sbjct  1    MPGIVSEEIMEEEKVKEL----------------------NGNSSDPPIEGVLVHT----  34

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               SIEEL DN+CEMQSS+ SPSRQS+GS GDESRIDS+LRHL
Sbjct  35   ---SIEELCDNLCEMQSSDQSPSRQSFGSYGDESRIDSDLRHL  74



>gb|KJB30306.1| hypothetical protein B456_005G136800 [Gossypium raimondii]
 gb|KJB30307.1| hypothetical protein B456_005G136800 [Gossypium raimondii]
Length=730

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 64/105 (61%), Gaps = 17/105 (16%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPGV +DEI E     E   NE + +  H  +   N   +   + QSPR       G+ +
Sbjct  1    MPGVPMDEIKE-----EGVMNEMKGTSAHVKE---NSVSKITPSPQSPR-------GDRM  45

Query  256  A--EKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               E SIE+LY+NVC+MQSS+ SPSRQS+GS G+ESRIDSEL HL
Sbjct  46   VQVETSIEQLYENVCDMQSSDQSPSRQSFGSYGEESRIDSELHHL  90



>ref|XP_003553842.1| PREDICTED: uncharacterized protein LOC100786477 isoform X1 [Glycine 
max]
 ref|XP_006603813.1| PREDICTED: uncharacterized protein LOC100786477 isoform X2 [Glycine 
max]
 gb|KHN23537.1| Nephrocystin-3 [Glycine soja]
Length=700

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 11/106 (10%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +DE +       +     E SG + ++     SPR+ L+ +S ++       +GV
Sbjct  1    MPGLAMDEFN-------VNNAAEEPSGSYKENFAQQASPRSTLSPRSIQSDSIDLAIDGV  53

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGS---DGDESRIDSELRHL  384
             + SIE+LY NVCEM+SS+HSPSR S+ S   DG ESRIDSEL HL
Sbjct  54   VDTSIEQLYHNVCEMRSSDHSPSRASFYSYDYDG-ESRIDSELGHL  98



>ref|XP_008782452.1| PREDICTED: uncharacterized protein LOC103701984 [Phoenix dactylifera]
Length=729

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 61/104 (59%), Gaps = 7/104 (7%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+++D +  +   +EL      NS    ++L    SPR   +  S  +          
Sbjct  1    MPGILLDGVDANEASNEL------NSSQIKENLSTPKSPRGSPSPMSAPSEALELPVESC  54

Query  256  AEKSIEELYDNVCEMQSS-EHSPSRQSYGSDGDESRIDSELRHL  384
             E SIE+LYDNVCEM SS + S SRQS+GSDG+ESRIDSELRHL
Sbjct  55   VEPSIEQLYDNVCEMASSSDGSLSRQSFGSDGEESRIDSELRHL  98



>ref|XP_010936735.1| PREDICTED: uncharacterized protein LOC105056290 [Elaeis guineensis]
Length=729

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 61/104 (59%), Gaps = 7/104 (7%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+++D +  +   +EL      NS    ++L    SPR   +  S  +          
Sbjct  1    MPGILLDGLDANEASNEL------NSSQIKENLSTPKSPRASPSLMSAPSEALDLPVESC  54

Query  256  AEKSIEELYDNVCEMQSS-EHSPSRQSYGSDGDESRIDSELRHL  384
             E SIE+LYDNVCEM SS + S SRQS+GSDG+ESRIDSELRHL
Sbjct  55   VEPSIEQLYDNVCEMASSSDGSLSRQSFGSDGEESRIDSELRHL  98



>ref|XP_010028340.1| PREDICTED: tetratricopeptide repeat protein 28 [Eucalyptus grandis]
 ref|XP_010028348.1| PREDICTED: tetratricopeptide repeat protein 28 [Eucalyptus grandis]
 ref|XP_010028356.1| PREDICTED: tetratricopeptide repeat protein 28 [Eucalyptus grandis]
 gb|KCW83451.1| hypothetical protein EUGRSUZ_B00370 [Eucalyptus grandis]
Length=751

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 12/112 (11%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTG---  246
            MPG+V+D  + +   SE+   +N N+    +  V N SP++  + QS ++  +  +    
Sbjct  1    MPGIVMDGTNGEEIVSEV---DNGNAAPFKESPVDNRSPKSPASQQSHQSHQSHQSHQSA  57

Query  247  ------NGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
                  +GV + SIE+LY NV EMQSS+HSPSRQS+ S+GDESRIDSELRHL
Sbjct  58   RHEVPVDGVVDTSIEKLYANVYEMQSSDHSPSRQSFESEGDESRIDSELRHL  109



>gb|EPS70530.1| hypothetical protein M569_04228, partial [Genlisea aurea]
Length=659

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +1

Query  202  LASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRH  381
            L+S SP N       + V E SIE+LY N+CEMQSS+HSPSR+S+ S G+ESRIDSELR 
Sbjct  1    LSSPSPDNDSLDLAMDEVVETSIEQLYYNICEMQSSDHSPSRRSFVSYGEESRIDSELRF  60

Query  382  L  384
            L
Sbjct  61   L  61



>ref|XP_010029186.1| PREDICTED: kinesin light chain [Eucalyptus grandis]
 gb|KCW56033.1| hypothetical protein EUGRSUZ_I01797 [Eucalyptus grandis]
Length=725

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLA--SQSPRNGGTGYTGN  249
            MPG+V   +++ R D  + ++   N   + +D     SPR+ L+  + SP +       +
Sbjct  1    MPGLV---MYDSRRDYRI-DDSGGNQSFYKEDSTQQFSPRSPLSPHTPSPHSDSDDLALD  56

Query  250  GVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            GV + SIE+LY NVCEMQSS+ SPS  S+ S G+ESRIDSEL HL
Sbjct  57   GVVDTSIEQLYYNVCEMQSSDQSPSGPSFLSYGEESRIDSELCHL  101



>ref|XP_006579755.1| PREDICTED: kinesin light chain-like isoform X2 [Glycine max]
Length=697

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 4/83 (5%)
 Frame = +1

Query  145  ENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPS  324
            E SG + ++     SPR+ L+ +S ++       +GV + SIE+LY NVCEM+SS+HSPS
Sbjct  12   EPSGSYKENFAQQASPRSTLSPRSIQSDSIDLAIDGVVDTSIEQLYHNVCEMRSSDHSPS  71

Query  325  RQSYGS---DGDESRIDSELRHL  384
            R S+ S   DG ESRIDSEL HL
Sbjct  72   RASFYSYDYDG-ESRIDSELGHL  93



>gb|KDP45346.1| hypothetical protein JCGZ_09595 [Jatropha curcas]
Length=729

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  187  SPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRID  366
            SPR+ L+  S  +       +GV + SIE+LY NVCEM+SS+ SPSR S+ S G+ESRID
Sbjct  26   SPRSTLSPNSQCSDSIDLAIDGVVDTSIEQLYHNVCEMESSDPSPSRASFLSYGEESRID  85

Query  367  SELRHL  384
            SELRHL
Sbjct  86   SELRHL  91



>ref|NP_001047883.1| Os02g0708400 [Oryza sativa Japonica Group]
 gb|AAL87157.1|AF480496_11 putative kinesin light chain gene [Oryza sativa Japonica Group]
 dbj|BAD08110.1| putative kinesin light chain [Oryza sativa Japonica Group]
 dbj|BAF09797.1| Os02g0708400 [Oryza sativa Japonica Group]
 dbj|BAG90897.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73865.1| hypothetical protein OsI_08639 [Oryza sativa Indica Group]
 gb|EEE57657.1| hypothetical protein OsJ_08096 [Oryza sativa Japonica Group]
Length=711

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 69/107 (64%), Gaps = 13/107 (12%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGG--TGYTGN  249
            MPG++VD +  +   +E+  ++N+++         + +PR+ +AS+S  +        G+
Sbjct  1    MPGIIVDGVVTEEAQNEVNSSQNKDN---------SSAPRSPVASKSMHSEALEMHVEGS  51

Query  250  GVAEKSIEELYDNVCEMQSSEHSPS--RQSYGSDGDESRIDSELRHL  384
            G  E SIE+LY+NVCEM+SS    S  R+S+GSDG+ESRIDSELRHL
Sbjct  52   GAGEPSIEQLYNNVCEMESSSEGGSPSRESFGSDGEESRIDSELRHL  98



>ref|XP_006647776.1| PREDICTED: uncharacterized protein LOC102714889 [Oryza brachyantha]
Length=710

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (64%), Gaps = 13/107 (12%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGG--TGYTGN  249
            MPG++VD +  +   +E+  ++N++         ++ +PR+ +AS+S  +        G+
Sbjct  1    MPGIIVDGVATEEAPNEVNSSQNKD---------ISSAPRSPVASKSMHSEALEMHVEGS  51

Query  250  GVAEKSIEELYDNVCEMQSSEHSPS--RQSYGSDGDESRIDSELRHL  384
            G  E SIE+LY+NVCEM+SS    S  R+S+ SDG+ESRIDSELRHL
Sbjct  52   GAGEPSIEQLYNNVCEMESSSEGGSPSRESFSSDGEESRIDSELRHL  98



>ref|XP_006338558.1| PREDICTED: uncharacterized protein LOC102590808 [Solanum tuberosum]
Length=716

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  184  GSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRI  363
            GSPR+ L++ S          NG  + SIE+LY+NV EMQSS++SPSR+S+ S G+ESRI
Sbjct  32   GSPRSPLSTHSRETESIDLDINGGVDTSIEQLYNNVYEMQSSDYSPSRRSFLSYGEESRI  91

Query  364  DSELRHL  384
            DSELR+L
Sbjct  92   DSELRYL  98



>ref|XP_004232294.1| PREDICTED: tetratricopeptide repeat protein 28-like [Solanum 
lycopersicum]
 ref|XP_010316284.1| PREDICTED: tetratricopeptide repeat protein 28-like [Solanum 
lycopersicum]
Length=716

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +1

Query  184  GSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRI  363
            GSPR+ L++ S          NG  + SIE+LY+NV EMQSS++SPSR+S+ S G+ESRI
Sbjct  32   GSPRSPLSTHSRETESIDLDINGGVDTSIEQLYNNVYEMQSSDYSPSRRSFLSYGEESRI  91

Query  364  DSELRHL  384
            DSELR+L
Sbjct  92   DSELRYL  98



>gb|EYU44745.1| hypothetical protein MIMGU_mgv1a002492mg [Erythranthe guttata]
Length=667

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 11/89 (12%)
 Frame = +1

Query  151  SGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNG-----------VAEKSIEELYDNVCE  297
            S V + + +   SPR+ L + SP    T  + +            + + SIE+LY NVCE
Sbjct  15   SNVASKEKLTEMSPRSPLGTHSPPPLSTTLSHDSSDSLDLVIDDVIIDTSIEQLYQNVCE  74

Query  298  MQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            MQSS+HSPSR+S+ S G+ESRIDSELR  
Sbjct  75   MQSSDHSPSRRSFLSYGEESRIDSELRFF  103



>gb|KEH24837.1| kinesin light chain [Medicago truncatula]
Length=629

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 5/104 (5%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVN-GSPRNGLASQSPRNGGTGYTGNG  252
            MP + ++E + +    E  E+       H D+      SPR+ L+ +S ++       +G
Sbjct  1    MPTIAMEEFNMNNATEEASESYTP----HKDNFTAQQASPRSTLSPRSIQSDSIDLAIDG  56

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            V + SIE+LY NV EM+SS+ SPSR S  S G+ESRIDSEL HL
Sbjct  57   VVDTSIEQLYTNVYEMRSSDQSPSRASLYSYGEESRIDSELGHL  100



>gb|KEH24836.1| kinesin light chain [Medicago truncatula]
Length=700

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 5/104 (5%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVN-GSPRNGLASQSPRNGGTGYTGNG  252
            MP + ++E + +    E  E+       H D+      SPR+ L+ +S ++       +G
Sbjct  1    MPTIAMEEFNMNNATEEASESYTP----HKDNFTAQQASPRSTLSPRSIQSDSIDLAIDG  56

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            V + SIE+LY NV EM+SS+ SPSR S  S G+ESRIDSEL HL
Sbjct  57   VVDTSIEQLYTNVYEMRSSDQSPSRASLYSYGEESRIDSELGHL  100



>ref|XP_011098764.1| PREDICTED: tetratricopeptide repeat protein 28-like [Sesamum 
indicum]
Length=710

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 7/77 (9%)
 Frame = +1

Query  175  VVNGSPRNGLASQSP-------RNGGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQS  333
             +  SPR+ L + SP        +       +G A+ SIE+LY NVCEMQSS+ SPSR+S
Sbjct  28   FIERSPRSPLTAHSPPLSTMSSESDSLDLAIDGGADTSIEQLYHNVCEMQSSDQSPSRRS  87

Query  334  YGSDGDESRIDSELRHL  384
            + S G+ESRIDSELR L
Sbjct  88   FLSYGEESRIDSELRFL  104



>ref|XP_004489282.1| PREDICTED: uncharacterized protein LOC101501435 [Cicer arietinum]
Length=700

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +1

Query  160  HNDDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSE-HSPSRQSY  336
            H D+     SPR+ L+ +S ++       + V + SIE+LY+NV EM+SSE  SPSR S+
Sbjct  23   HKDNFTQQASPRSTLSPRSTQSDSIDLAIDNVVDTSIEQLYNNVYEMRSSEDQSPSRASF  82

Query  337  GSDGDESRIDSELRHL  384
             S G+ESRIDSEL HL
Sbjct  83   YSYGEESRIDSELCHL  98



>ref|XP_011018373.1| PREDICTED: uncharacterized protein LOC105121433 [Populus euphratica]
 ref|XP_011018382.1| PREDICTED: uncharacterized protein LOC105121433 [Populus euphratica]
 ref|XP_011018390.1| PREDICTED: uncharacterized protein LOC105121433 [Populus euphratica]
Length=747

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  187  SPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRID  366
            SPR+ L+  SP +       +G+ + SI++LY NV  MQ S+ SPSR S+ S G+ESRID
Sbjct  39   SPRSTLSPHSPCSDSIDLAIHGIVDTSIDQLYHNVYRMQCSDPSPSRASFLSYGEESRID  98

Query  367  SELRHL  384
            SELRHL
Sbjct  99   SELRHL  104



>ref|XP_002312280.2| kinesin light chain-related family protein [Populus trichocarpa]
 gb|EEE89647.2| kinesin light chain-related family protein [Populus trichocarpa]
Length=684

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  187  SPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRID  366
            SPR+ L+  SP +       +G+ + SI+ LY NV  MQ S+ SPSR S+ S G+ESRID
Sbjct  40   SPRSTLSPHSPCSDSIDLAIHGIVDTSIDHLYHNVYRMQCSDPSPSRASFLSYGEESRID  99

Query  367  SELRHL  384
            SELRHL
Sbjct  100  SELRHL  105



>ref|XP_002893474.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69733.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=172

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +1

Query  253  VAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            + + +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  24   LFDTTIEELCKNLCELQSSNQSPSRQSFGSYGDESKIDSDLQHL  67



>ref|XP_006844980.1| hypothetical protein AMTR_s00058p00186720 [Amborella trichopoda]
 gb|ERN06655.1| hypothetical protein AMTR_s00058p00186720 [Amborella trichopoda]
Length=785

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 67/112 (60%), Gaps = 15/112 (13%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNG-  252
            MPG+V+D   +    S +KE   ++  V +     N S R+ L+ +SPR         G 
Sbjct  9    MPGLVMDVADKM---SPVKEEGMDHKVVGSSG---NKSLRSPLSPRSPRIDALDLPMEGT  62

Query  253  -----VAEKSIEELYDNVCEMQSS-EHSPSRQSY--GSDGDESRIDSELRHL  384
                 + + SIE+LYDNVC+M+SS + SPSRQS+  GSDG+ESRIDSEL HL
Sbjct  63   PTHECMIDTSIEQLYDNVCQMRSSGDQSPSRQSFGDGSDGNESRIDSELGHL  114



>ref|XP_009380347.1| PREDICTED: uncharacterized protein LOC103968764 [Musa acuminata 
subsp. malaccensis]
Length=728

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  259  EKSIEELYDNVCEMQSS-EHSPSRQSYGSDGDESRIDSELRHL  384
            E SIE+LYDNVCEM+SS + S SR S+GSDG+ESRIDSELRHL
Sbjct  56   EPSIEQLYDNVCEMESSSDGSRSRHSFGSDGEESRIDSELRHL  98



>ref|XP_003570205.1| PREDICTED: uncharacterized protein LOC100826447 [Brachypodium 
distachyon]
 gb|ACF22694.1| kinesin light chain [Brachypodium distachyon]
Length=711

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 63/107 (59%), Gaps = 10/107 (9%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSP--RNGLASQSPRNGGTGYTGN  249
            MPG+ VD I  +   +E+  ++N+      ++L    SP   N +AS            +
Sbjct  1    MPGIAVDGIVTEEVPNEVNSSQNK------ENLSAPRSPVASNMMASMQSETLEMHVENS  54

Query  250  GVAEKSIEELYDNVCEMQSSEHSPS--RQSYGSDGDESRIDSELRHL  384
            G  E SIE+LY+NVCEM+SS    S  R+S+GSDG+ESRIDSELRHL
Sbjct  55   GAGEPSIEQLYNNVCEMESSSEGGSPSRESFGSDGEESRIDSELRHL  101



>gb|KJB75858.1| hypothetical protein B456_012G061500 [Gossypium raimondii]
Length=720

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 63/103 (61%), Gaps = 6/103 (6%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +D ++ +   + ++E++N     +        SPR+ L   SPR+       +GV
Sbjct  1    MPGLAMDAMNGE---TGVEEHDNGFHTPYKYSFAQERSPRSAL---SPRSDSLDLAIDGV  54

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               SIE+LY NV EMQSS+ SPS  SYGS G+ESRIDSELRHL
Sbjct  55   VATSIEQLYHNVYEMQSSDQSPSLSSYGSYGEESRIDSELRHL  97



>gb|AFW73048.1| hypothetical protein ZEAMMB73_781821 [Zea mays]
Length=643

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = +1

Query  247  NGVAEKSIEELYDNVCEMQSSEH--SPSRQSYGSDGDESRIDSELRHL  384
            +G  E SIE+LY+NVCEM+SS    S S +S+GSDG+ESRIDSELRHL
Sbjct  54   SGTGEPSIEQLYNNVCEMKSSSEGGSLSHESFGSDGEESRIDSELRHL  101



>gb|AFW73049.1| kinesin light chain [Zea mays]
Length=713

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = +1

Query  247  NGVAEKSIEELYDNVCEMQSSEH--SPSRQSYGSDGDESRIDSELRHL  384
            +G  E SIE+LY+NVCEM+SS    S S +S+GSDG+ESRIDSELRHL
Sbjct  54   SGTGEPSIEQLYNNVCEMKSSSEGGSLSHESFGSDGEESRIDSELRHL  101



>gb|AAF99740.1|AC004557_19 F17L21.29 [Arabidopsis thaliana]
Length=684

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  54   TIEELCKNLCELQSSNQSPSRQSFGSYGDESKIDSDLQHL  93



>ref|XP_002893471.1| hypothetical protein ARALYDRAFT_472955 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69730.1| hypothetical protein ARALYDRAFT_472955 [Arabidopsis lyrata subsp. 
lyrata]
Length=645

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  15   TIEELCKNLCELQSSNQSPSRQSFGSYGDESKIDSDLQHL  54



>dbj|BAC42575.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64874.1| At1g27500 [Arabidopsis thaliana]
Length=650

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  20   TIEELCKNLCELQSSNQSPSRQSFGSYGDESKIDSDLQHL  59



>ref|NP_174070.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE30839.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=650

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  20   TIEELCKNLCELQSSNQSPSRQSFGSYGDESKIDSDLQHL  59



>ref|XP_006303924.1| hypothetical protein CARUB_v10008543mg [Capsella rubella]
 gb|EOA36822.1| hypothetical protein CARUB_v10008543mg [Capsella rubella]
Length=650

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  21   TIEELCKNLCELQSSNQSPSRQSFGSYGDESKIDSDLQHL  60



>ref|XP_010499233.1| PREDICTED: uncharacterized protein LOC104776804 isoform X3 [Camelina 
sativa]
Length=655

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  20   TIEELCKNLCELQSSNQSPSRQSFGSYGDESKIDSDLQHL  59



>ref|XP_010499229.1| PREDICTED: uncharacterized protein LOC104776804 isoform X1 [Camelina 
sativa]
 ref|XP_010499232.1| PREDICTED: uncharacterized protein LOC104776804 isoform X1 [Camelina 
sativa]
Length=656

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  20   TIEELCKNLCELQSSNQSPSRQSFGSYGDESKIDSDLQHL  59



>ref|XP_010478089.1| PREDICTED: uncharacterized protein LOC104757077 [Camelina sativa]
 ref|XP_010478090.1| PREDICTED: uncharacterized protein LOC104757077 [Camelina sativa]
Length=655

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  20   TIEELCKNLCELQSSNQSPSRQSFGSYGDESKIDSDLQHL  59



>ref|XP_010499231.1| PREDICTED: uncharacterized protein LOC104776804 isoform X2 [Camelina 
sativa]
 ref|XP_010499234.1| PREDICTED: uncharacterized protein LOC104776804 isoform X4 [Camelina 
sativa]
Length=656

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  20   TIEELCKNLCELQSSNQSPSRQSFGSYGDESKIDSDLQHL  59



>ref|XP_010460507.1| PREDICTED: uncharacterized protein LOC104741359 [Camelina sativa]
 ref|XP_010460508.1| PREDICTED: uncharacterized protein LOC104741359 [Camelina sativa]
Length=656

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  20   TIEELCKNLCELQSSNQSPSRQSFGSYGDESKIDSDLQHL  59



>ref|XP_010940045.1| PREDICTED: tetratricopeptide repeat protein 28-like [Elaeis guineensis]
Length=729

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 55/104 (53%), Gaps = 7/104 (7%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+++D ++      EL      NS    ++L    SPR   +  S             
Sbjct  1    MPGIMLDGVNGKEASDEL------NSSQIKENLSTPTSPRGSASPMSAPTEDLDLPVESC  54

Query  256  AEKSIEELYDNVCEM-QSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SI++LYDNVCEM  SSE S   +S+ SDG+ESRID EL+HL
Sbjct  55   VEPSIQQLYDNVCEMVSSSERSSCWESFESDGEESRIDLELQHL  98



>ref|XP_010502803.1| PREDICTED: nephrocystin-3-like [Camelina sativa]
 ref|XP_010502804.1| PREDICTED: nephrocystin-3-like [Camelina sativa]
Length=669

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  163  NDDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSE-HSPSRQSYG  339
             DD  +  SPR+ L+S            +G    SIE+LY NVCEM+SS+  SPSR S+ 
Sbjct  11   KDDSALQASPRSPLSS-------IDLAVDGAMNASIEQLYHNVCEMESSDDQSPSRASFI  63

Query  340  SDGDESRIDSELRHL  384
            S G ESRID ELRHL
Sbjct  64   SYGAESRIDLELRHL  78



>ref|XP_009151903.1| PREDICTED: nephrocystin-3 [Brassica rapa]
 ref|XP_009151904.1| PREDICTED: nephrocystin-3 [Brassica rapa]
 ref|XP_009151905.1| PREDICTED: nephrocystin-3 [Brassica rapa]
 ref|XP_009151906.1| PREDICTED: nephrocystin-3 [Brassica rapa]
 emb|CDX86457.1| BnaA06g31740D [Brassica napus]
Length=664

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  163  NDDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSE-HSPSRQSYG  339
            +D   V  SPR+ L+S            +G    SIE+LY NVCEM+SS+  SPSR S+ 
Sbjct  12   DDSAAVQASPRSPLSS-------IDLAMDGAMNASIEQLYHNVCEMESSDDQSPSRASFI  64

Query  340  SDGDESRIDSELRHL  384
            S G ESRID ELRHL
Sbjct  65   SYGAESRIDLELRHL  79



>ref|XP_010514504.1| PREDICTED: nephrocystin-3-like [Camelina sativa]
 ref|XP_010514505.1| PREDICTED: nephrocystin-3-like [Camelina sativa]
Length=669

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  163  NDDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSE-HSPSRQSYG  339
             DD  +  SPR+ L+S            +G    SIE+LY NVCEM+SS+  SPSR S+ 
Sbjct  11   KDDSALQASPRSPLSS-------IDLAVDGAMNASIEQLYHNVCEMESSDDQSPSRASFI  63

Query  340  SDGDESRIDSELRHL  384
            S G ESRID ELRHL
Sbjct  64   SYGAESRIDLELRHL  78



>ref|NP_189435.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
 dbj|BAB01483.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAS44558.1| kinesin light chain-like protein [Arabidopsis thaliana]
 gb|AEE77386.1| tetratricopeptide repeat domain-containing protein [Arabidopsis 
thaliana]
Length=663

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  163  NDDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSE-HSPSRQSYG  339
             DD  +  SPR+ L+S            +G    SIE+LY NVCEM+SS+  SPSR S+ 
Sbjct  11   KDDSALQASPRSPLSS-------IDLAIDGAMNASIEQLYHNVCEMESSDDQSPSRASFI  63

Query  340  SDGDESRIDSELRHL  384
            S G ESRID ELRHL
Sbjct  64   SYGAESRIDLELRHL  78



>gb|KJB33765.1| hypothetical protein B456_006G030200 [Gossypium raimondii]
Length=707

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 60/103 (58%), Gaps = 7/103 (7%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +D       +S + E  N  S  + D  V   SPR+ L+ +S      G   +G 
Sbjct  1    MPGLAMDA---RNGESGVVELNNGVSTAYKDSFVEERSPRSALSPKSQH----GLAIDGE  53

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIE+LY NV EMQSSE SPS  SYGS  DESRIDSELRHL
Sbjct  54   MEASIEQLYHNVYEMQSSEQSPSMSSYGSYIDESRIDSELRHL  96



>emb|CDY58518.1| BnaCnng33310D [Brassica napus]
Length=657

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 44/74 (59%), Gaps = 8/74 (11%)
 Frame = +1

Query  166  DDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSE-HSPSRQSYGS  342
            D   V  SPR+ L+S            +G    SIE+LY NVCEM+SS+  SPSR S+ S
Sbjct  13   DSAAVQASPRSPLSS-------IDLAMDGAMNASIEQLYHNVCEMESSDDQSPSRASFIS  65

Query  343  DGDESRIDSELRHL  384
             G ESRID ELRHL
Sbjct  66   YGAESRIDLELRHL  79



>gb|AAQ22597.1| At3g27960 [Arabidopsis thaliana]
 dbj|BAE99464.1| hypothetical protein [Arabidopsis thaliana]
Length=663

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  163  NDDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSE-HSPSRQSYG  339
             DD  +  SPR+ L+S            +G    SIE+LY NVCEM+SS+  SPSR S+ 
Sbjct  11   KDDSALQASPRSPLSS-------IDLAIDGAMNASIEQLYHNVCEMESSDDQSPSRASFI  63

Query  340  SDGDESRIDSELRHL  384
            S G ESRID ELRHL
Sbjct  64   SYGAESRIDLELRHL  78



>gb|ABF70051.1| kinesin light chain-related [Musa acuminata]
Length=715

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 61/109 (56%), Gaps = 18/109 (17%)
 Frame = +1

Query  76   MPGVVVDEIHEDRE-----DSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGY  240
            MPG+V+D +  +        S++KEN+  +    +  L    +P   L            
Sbjct  1    MPGIVMDGVGTNATPNGLNSSDIKENQTTSRSPISPSL--KSAPSEALE----------L  48

Query  241  TGNGVAEKSIEELYDNVCEMQSSEH-SPSRQSYGSDGDESRIDSELRHL  384
              +G  + SIE+LY NVCEM+SS + S S+QS+GSDG+ESRIDSEL HL
Sbjct  49   VLDGCKDLSIEQLYHNVCEMESSSNESLSQQSFGSDGEESRIDSELCHL  97



>ref|XP_009389350.1| PREDICTED: kinesin light chain 3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389351.1| PREDICTED: kinesin light chain 3-like [Musa acuminata subsp. 
malaccensis]
Length=715

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 61/109 (56%), Gaps = 18/109 (17%)
 Frame = +1

Query  76   MPGVVVDEIHED-----REDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGY  240
            MPG+V+D +  +        S++KEN+  +    +  L    +P   L            
Sbjct  1    MPGIVMDGVGTNVTPNGLNSSDIKENQTASRSPISPSL--KSAPSEALE----------L  48

Query  241  TGNGVAEKSIEELYDNVCEMQSSEH-SPSRQSYGSDGDESRIDSELRHL  384
              +G  + SIE+LY NVCEM+SS + S S+QS+GSDG+ESRIDSEL HL
Sbjct  49   VLDGCKDLSIEQLYHNVCEMESSSNESLSQQSFGSDGEESRIDSELCHL  97



>gb|KHG13835.1| Nephrocystin-3 [Gossypium arboreum]
Length=720

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 62/103 (60%), Gaps = 6/103 (6%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +D ++ +   + ++E++N     +        SPR+ L   SPR+       +GV
Sbjct  1    MPGLAMDAMNGE---TGVEEHDNGFHTPYKYSFAQERSPRSAL---SPRSDSLDLAIDGV  54

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
               SIE+LY NV EMQSS+ SPS  SYGS G+ES IDSELRHL
Sbjct  55   VATSIEQLYHNVYEMQSSDQSPSMSSYGSYGEESMIDSELRHL  97



>ref|XP_004953633.1| PREDICTED: uncharacterized protein LOC101762075 isoform X1 [Setaria 
italica]
 ref|XP_004953634.1| PREDICTED: uncharacterized protein LOC101762075 isoform X2 [Setaria 
italica]
Length=711

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = +1

Query  244  GNGVAEKSIEELYDNVCEMQSSEHSPS--RQSYGSDGDESRIDSELRHL  384
            G+G  E SIE+LY+NVCEM+SS    S  R+S+GSDG+ESRIDSELRHL
Sbjct  53   GSGAGEPSIEQLYNNVCEMESSSEGGSPSRESFGSDGEESRIDSELRHL  101



>ref|XP_002452671.1| hypothetical protein SORBIDRAFT_04g030360 [Sorghum bicolor]
 gb|EES05647.1| hypothetical protein SORBIDRAFT_04g030360 [Sorghum bicolor]
Length=713

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = +1

Query  244  GNGVAEKSIEELYDNVCEMQSSEHSPS--RQSYGSDGDESRIDSELRHL  384
            G+G  E SIE+LY+NVCEM+SS    S  R+S+GSDG+ESRIDSELRHL
Sbjct  53   GSGAGEPSIEQLYNNVCEMESSSEGGSPSRESFGSDGEESRIDSELRHL  101



>ref|XP_002877085.1| hypothetical protein ARALYDRAFT_484584 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53344.1| hypothetical protein ARALYDRAFT_484584 [Arabidopsis lyrata subsp. 
lyrata]
Length=661

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  163  NDDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSE-HSPSRQSYG  339
             DD  +  SPR+ L+S            +G    SIE+LY NVCEM+SS+  SPSR S+ 
Sbjct  11   KDDSALLASPRSPLSS-------IDLAIDGAMNASIEQLYHNVCEMESSDDQSPSRASFI  63

Query  340  SDGDESRIDSELRHL  384
            S G ESRID ELRHL
Sbjct  64   SYGAESRIDLELRHL  78



>ref|XP_010425576.1| PREDICTED: nephrocystin-3-like [Camelina sativa]
Length=669

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  163  NDDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSE-HSPSRQSYG  339
             DD  +  SPR+ L+S            +G    SIE+LY NVCEM+SS+  SPSR S+ 
Sbjct  11   KDDSALQPSPRSPLSS-------IDLAVDGAMNASIEQLYHNVCEMESSDDQSPSRASFI  63

Query  340  SDGDESRIDSELRHL  384
            S G ESRID ELRHL
Sbjct  64   SYGAESRIDLELRHL  78



>gb|ABF70142.1| glycoside hydrolase family 17 protein [Musa balbisiana]
Length=715

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 8/104 (8%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+V+D +  +   + L      NS    ++   + SP +     +P         +G 
Sbjct  1    MPGIVMDGVGTNATPNGL------NSSDSKENQTTSRSPISPSLKSAPSEA-LELVLDGC  53

Query  256  AEKSIEELYDNVCEMQSSEH-SPSRQSYGSDGDESRIDSELRHL  384
             + SIE+LY NVCEM+SS + S S+QS+GSDG+ESRIDSEL HL
Sbjct  54   KDLSIEQLYHNVCEMESSSNESLSQQSFGSDGEESRIDSELCHL  97



>ref|NP_001147329.1| kinesin light chain [Zea mays]
 gb|ACG26820.1| kinesin light chain [Zea mays]
Length=713

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = +1

Query  247  NGVAEKSIEELYDNVCEMQSSEH--SPSRQSYGSDGDESRIDSELRHL  384
            +G  E SIE+LY+NVCEM+SS    S S +S+GSDG+ESRIDSEL HL
Sbjct  54   SGTGEPSIEQLYNNVCEMKSSSEGGSLSHESFGSDGEESRIDSELHHL  101



>ref|XP_006395386.1| hypothetical protein EUTSA_v10003775mg [Eutrema salsugineum]
 ref|XP_006395387.1| hypothetical protein EUTSA_v10003775mg [Eutrema salsugineum]
 gb|ESQ32672.1| hypothetical protein EUTSA_v10003775mg [Eutrema salsugineum]
 gb|ESQ32673.1| hypothetical protein EUTSA_v10003775mg [Eutrema salsugineum]
Length=664

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +1

Query  163  NDDLVVNGSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSE-HSPSRQSYG  339
             DD  +  SPR+ L+S            +G    +IE+LY NVCEM+SS+  SPSR S+ 
Sbjct  11   KDDSALQTSPRSPLSS-------IDLAIDGAMNATIEQLYHNVCEMESSDDQSPSRASFI  63

Query  340  SDGDESRIDSELRHL  384
            S G ESRID ELRHL
Sbjct  64   SYGAESRIDLELRHL  78



>ref|XP_010528254.1| PREDICTED: nephrocystin-3 [Tarenaya hassleriana]
Length=680

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +1

Query  247  NGVAEKSIEELYDNVCEMQSSE-HSPSRQSYGSDGDESRIDSELRHL  384
            +G    SIE+LY NVCEM+SS+  SPSR SY S G+ESRID ELRHL
Sbjct  42   DGAMNASIEQLYHNVCEMESSDDQSPSRASYISYGEESRIDLELRHL  88



>ref|XP_006415753.1| hypothetical protein EUTSA_v10007008mg [Eutrema salsugineum]
 gb|ESQ34106.1| hypothetical protein EUTSA_v10007008mg [Eutrema salsugineum]
Length=664

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
            +IEEL  N+CE+QSS  SPSRQS+GS GDES+IDS+L+HL
Sbjct  29   TIEELCKNLCELQSSNQSPSRQSFGS-GDESKIDSDLQHL  67



>ref|NP_001130826.1| hypothetical protein [Zea mays]
 gb|ACF79192.1| unknown [Zea mays]
 gb|AFW63564.1| hypothetical protein ZEAMMB73_255866 [Zea mays]
Length=713

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = +1

Query  244  GNGVAEKSIEELYDNVCEMQSSEHSPS--RQSYGSDGDESRIDSELRHL  384
             +G  E SIE+LY+NVCEM+SS    S  R+S+GSDG+ESRIDSELRHL
Sbjct  53   ASGAGEPSIEQLYNNVCEMESSSEGGSPSRESFGSDGEESRIDSELRHL  101



>gb|KHG25182.1| Nephrocystin-3 [Gossypium arboreum]
Length=719

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 58/103 (56%), Gaps = 7/103 (7%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPRNGGTGYTGNGV  255
            MPG+ +D  +      EL +     S  + D  +   SPR  L+ +S      G   +G 
Sbjct  1    MPGLAMDARNGQSGVVELNDG---VSTAYKDSFIEERSPRRALSPKSQH----GLAIDGE  53

Query  256  AEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRIDSELRHL  384
             E SIE+LY NV EMQSSE SPS  SYGS  DESRIDSELRHL
Sbjct  54   MEASIEQLYHNVYEMQSSEQSPSMSSYGSYIDESRIDSELRHL  96



>ref|XP_006290699.1| hypothetical protein CARUB_v10016794mg [Capsella rubella]
 gb|EOA23597.1| hypothetical protein CARUB_v10016794mg [Capsella rubella]
Length=664

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 42/68 (62%), Gaps = 8/68 (12%)
 Frame = +1

Query  184  GSPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSE-HSPSRQSYGSDGDESR  360
             SPR+ L+S            +G    SIE+LY NVCEM+SS+  SPSR S+ S G ESR
Sbjct  18   ASPRSPLSS-------IDLAIDGAMNASIEQLYHNVCEMESSDDQSPSRASFISYGAESR  70

Query  361  IDSELRHL  384
            ID ELRHL
Sbjct  71   IDLELRHL  78



>emb|CDY56191.1| BnaC05g51100D, partial [Brassica napus]
Length=712

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDG-DESRIDSELRHL  384
            +IEEL +N+CE+QSS  SPSR S+GS G DES+IDS+L+HL
Sbjct  77   TIEELCNNLCELQSSNQSPSRHSFGSYGDDESKIDSDLQHL  117



>ref|XP_010033277.1| PREDICTED: uncharacterized protein LOC104422608 [Eucalyptus grandis]
 ref|XP_010033278.1| PREDICTED: uncharacterized protein LOC104422608 [Eucalyptus grandis]
 gb|KCW52886.1| hypothetical protein EUGRSUZ_J02210 [Eucalyptus grandis]
Length=722

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  187  SPRNGLASQSPRNGGTGYTGNGVAEKSIEELYDNVCEMQSSEHSPSRQSYGSDGDESRID  366
            SPR+ L+  SPR+       N V + SIE+LY+NV EMQSS+ SPSR S+ S G+ESR+D
Sbjct  34   SPRSPLSPHSPRSDSIDLYINHVVDISIEQLYNNVFEMQSSDQSPSRSSFLSYGEESRLD  93

Query  367  SELRHL  384
            SEL HL
Sbjct  94   SELGHL  99



>gb|EMT08479.1| Nephrocystin-3 [Aegilops tauschii]
Length=679

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = +1

Query  247  NGVAEKSIEELYDNVCEMQSSEHSPS---RQSYGSDGDESRIDSELRHL  384
            +G  E SIE+LY+NVCEM+SS        R+S+GSDG+ESRIDSELRHL
Sbjct  17   SGAGEPSIEQLYNNVCEMESSSEGGGSPSRESFGSDGEESRIDSELRHL  65



>dbj|BAJ98431.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=708

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = +1

Query  247  NGVAEKSIEELYDNVCEMQSSEHSPS---RQSYGSDGDESRIDSELRHL  384
            +G  E SIE+LY+NVCEM+SS        R+S+GSDG+ESRIDSELRHL
Sbjct  48   SGAGEPSIEQLYNNVCEMESSSEGGGSPSRESFGSDGEESRIDSELRHL  96



>gb|EMS45896.1| Nephrocystin-3 [Triticum urartu]
Length=678

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = +1

Query  247  NGVAEKSIEELYDNVCEMQSSEHSPS---RQSYGSDGDESRIDSELRHL  384
            +G  E SIE+LY+NVCEM+SS        R+S+GSDG+ESRIDSELRHL
Sbjct  17   SGAGEPSIEQLYNNVCEMESSSEGGGSPSRESFGSDGEESRIDSELRHL  65



>gb|AAM13438.1|AF474071_1 similar to A. thaliana protein BAB01483 similar to kinesin light 
chain [Hordeum vulgare subsp. vulgare]
Length=708

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = +1

Query  247  NGVAEKSIEELYDNVCEMQSSEHSPS---RQSYGSDGDESRIDSELRHL  384
            +G  E SIE+LY+NVCEM+SS        R+S+GSDG+ESRIDSELRHL
Sbjct  48   SGAGEPSIEQLYNNVCEMESSSEGGGSPSRESFGSDGEESRIDSELRHL  96



>ref|XP_009113759.1| PREDICTED: uncharacterized protein LOC103839034 [Brassica rapa]
 emb|CDY27619.1| BnaA09g27880D [Brassica napus]
Length=659

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +1

Query  265  SIEELYDNVCEMQSSEHSPSRQSYGSDG-DESRIDSELRHL  384
            +IEEL +N+CE++SS+ SPSR  +GS G DES+IDS+L+HL
Sbjct  24   TIEELCNNLCELESSKQSPSRHIFGSYGDDESKIDSDLQHL  64



>gb|ABR16125.1| unknown [Picea sitchensis]
Length=824

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 61/122 (50%), Gaps = 24/122 (20%)
 Frame = +1

Query  76   MPGVVVDEIHEDREDSELKENENENSGVHNDDLVVNGSPRNGLASQSPR-----------  222
            MPG+V  +  E+ +  +    +N  S   N     N SPR+ L+ +SP            
Sbjct  1    MPGLVSADAMEEEQQQQRSPVKNIKSESEN-----NKSPRSPLSPKSPTSMSKSPNSPHQ  55

Query  223  -----NGGTGYTGNGVAEKSIEELYDNVCEMQSS-EHSPSRQSYG--SDGDESRIDSELR  378
                 N      G G A  SIEELY+NVC+M+SS + SPSR S    S+ ++ RI+SEL+
Sbjct  56   QNSVDNNSNRENGAGNANTSIEELYENVCQMKSSGDQSPSRPSSTEQSEVEDFRIESELQ  115

Query  379  HL  384
             L
Sbjct  116  QL  117



Lambda      K        H        a         alpha
   0.304    0.127    0.352    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562360051550