BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K06

Length=545
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011092178.1|  PREDICTED: chloroplast stem-loop binding pro...    233   1e-71   Sesamum indicum [beniseed]
ref|XP_009780849.1|  PREDICTED: chloroplast stem-loop binding pro...    232   2e-71   Nicotiana sylvestris
ref|XP_009619213.1|  PREDICTED: chloroplast stem-loop binding pro...    232   2e-71   Nicotiana tomentosiformis
ref|XP_004241412.1|  PREDICTED: chloroplast stem-loop binding pro...    228   1e-69   Solanum lycopersicum
emb|CDP20929.1|  unnamed protein product                                227   1e-69   Coffea canephora [robusta coffee]
ref|XP_006347295.1|  PREDICTED: chloroplast stem-loop binding pro...    227   1e-69   Solanum tuberosum [potatoes]
ref|XP_010674555.1|  PREDICTED: chloroplast stem-loop binding pro...    227   2e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011023817.1|  PREDICTED: chloroplast stem-loop binding pro...    226   4e-69   Populus euphratica
gb|KJB45476.1|  hypothetical protein B456_007G308300                    226   6e-69   Gossypium raimondii
gb|ABK96584.1|  unknown                                                 225   1e-68   Populus trichocarpa x Populus deltoides
emb|CDX94984.1|  BnaC05g06870D                                          224   2e-68   
gb|KFK43232.1|  hypothetical protein AALP_AA1G097200                    224   3e-68   Arabis alpina [alpine rockcress]
gb|KDP23362.1|  hypothetical protein JCGZ_23195                         224   3e-68   Jatropha curcas
ref|XP_006417582.1|  hypothetical protein EUTSA_v10007937mg             224   4e-68   Eutrema salsugineum [saltwater cress]
dbj|BAJ33886.1|  unnamed protein product                                223   4e-68   Eutrema halophilum
ref|XP_009148185.1|  PREDICTED: chloroplast stem-loop binding pro...    223   6e-68   Brassica rapa
ref|XP_004302291.1|  PREDICTED: chloroplast stem-loop binding pro...    223   7e-68   Fragaria vesca subsp. vesca
ref|XP_010024151.1|  PREDICTED: chloroplast stem-loop binding pro...    223   8e-68   Eucalyptus grandis [rose gum]
ref|XP_010544150.1|  PREDICTED: chloroplast stem-loop binding pro...    223   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_002319474.2|  hypothetical protein POPTR_0013s00760g             221   3e-67   Populus trichocarpa [western balsam poplar]
gb|AFK44229.1|  unknown                                                 221   4e-67   Medicago truncatula
ref|XP_010475766.1|  PREDICTED: chloroplast stem-loop binding pro...    221   6e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010458216.1|  PREDICTED: chloroplast stem-loop binding pro...    220   9e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006305088.1|  hypothetical protein CARUB_v10009455mg             220   1e-66   Capsella rubella
ref|NP_172405.1|  chloroplast stem-loop binding protein                 219   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007031209.1|  Chloroplast RNA binding                            219   1e-66   
gb|AAM65150.1|  putative RNA-binding protein                            219   1e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32648.1|  g5bf protein                                            219   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008777573.1|  PREDICTED: chloroplast stem-loop binding pro...    220   1e-66   Phoenix dactylifera
emb|CAA71589.1|  g5bf                                                   219   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889743.1|  catalytic/ coenzyme binding protein                219   2e-66   
emb|CAA75602.1|  putative RNA binding protein                           219   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008442117.1|  PREDICTED: chloroplast stem-loop binding pro...    219   2e-66   Cucumis melo [Oriental melon]
gb|AFK36692.1|  unknown                                                 219   2e-66   Medicago truncatula
ref|XP_002512541.1|  NAD dependent epimerase/dehydratase, putative      219   2e-66   Ricinus communis
ref|XP_010270866.1|  PREDICTED: chloroplast stem-loop binding pro...    219   2e-66   Nelumbo nucifera [Indian lotus]
ref|XP_006433573.1|  hypothetical protein CICLE_v10001494mg             217   2e-66   
ref|XP_006382356.1|  hypothetical protein POPTR_0005s01370g             219   3e-66   
gb|EPS69756.1|  hypothetical protein M569_05003                         218   4e-66   Genlisea aurea
ref|XP_010549317.1|  PREDICTED: chloroplast stem-loop binding pro...    218   1e-65   Tarenaya hassleriana [spider flower]
ref|XP_010270864.1|  PREDICTED: chloroplast stem-loop binding pro...    217   1e-65   Nelumbo nucifera [Indian lotus]
gb|EYU38405.1|  hypothetical protein MIMGU_mgv1a008259mg                216   3e-65   Erythranthe guttata [common monkey flower]
ref|XP_006472242.1|  PREDICTED: chloroplast stem-loop binding pro...    216   5e-65   Citrus sinensis [apfelsine]
ref|XP_007163307.1|  hypothetical protein PHAVU_001G223800g             216   5e-65   Phaseolus vulgaris [French bean]
ref|XP_009412145.1|  PREDICTED: chloroplast stem-loop binding pro...    216   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004146391.1|  PREDICTED: chloroplast stem-loop binding pro...    215   6e-65   Cucumis sativus [cucumbers]
ref|XP_006433571.1|  hypothetical protein CICLE_v10001494mg             215   8e-65   Citrus clementina [clementine]
ref|NP_001242018.1|  uncharacterized protein LOC100791076               214   1e-64   
gb|KHN03920.1|  Hypothetical protein glysoja_022606                     214   1e-64   Glycine soja [wild soybean]
ref|XP_006433572.1|  hypothetical protein CICLE_v10001494mg             214   1e-64   Citrus clementina [clementine]
gb|KHN43352.1|  Hypothetical protein glysoja_001935                     214   1e-64   Glycine soja [wild soybean]
ref|XP_006604786.1|  PREDICTED: chloroplast stem-loop binding pro...    214   2e-64   Glycine max [soybeans]
ref|XP_003554610.1|  PREDICTED: chloroplast stem-loop binding pro...    214   2e-64   Glycine max [soybeans]
ref|XP_004494526.1|  PREDICTED: chloroplast stem-loop binding pro...    214   2e-64   Cicer arietinum [garbanzo]
ref|XP_010941507.1|  PREDICTED: chloroplast stem-loop binding pro...    213   6e-64   Elaeis guineensis
ref|XP_009337636.1|  PREDICTED: chloroplast stem-loop binding pro...    211   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_008246177.1|  PREDICTED: chloroplast stem-loop binding pro...    211   2e-63   Prunus mume [ume]
ref|XP_008370362.1|  PREDICTED: chloroplast stem-loop binding pro...    211   3e-63   
ref|XP_007207335.1|  hypothetical protein PRUPE_ppa007071mg             211   3e-63   Prunus persica
ref|XP_002281395.1|  PREDICTED: chloroplast stem-loop binding pro...    211   3e-63   Vitis vinifera
gb|AFK37744.1|  unknown                                                 211   4e-63   Lotus japonicus
ref|XP_010092951.1|  hypothetical protein L484_018888                   210   5e-63   Morus notabilis
ref|XP_008350588.1|  PREDICTED: chloroplast stem-loop binding pro...    210   5e-63   
ref|XP_009337637.1|  PREDICTED: chloroplast stem-loop binding pro...    209   2e-62   Pyrus x bretschneideri [bai li]
ref|XP_006664006.1|  PREDICTED: chloroplast stem-loop binding pro...    208   3e-62   Oryza brachyantha
ref|XP_009373315.1|  PREDICTED: chloroplast stem-loop binding pro...    207   6e-62   Pyrus x bretschneideri [bai li]
ref|XP_009335504.1|  PREDICTED: chloroplast stem-loop binding pro...    207   7e-62   Pyrus x bretschneideri [bai li]
ref|XP_008246198.1|  PREDICTED: chloroplast stem-loop binding pro...    206   2e-61   Prunus mume [ume]
gb|EEC69165.1|  hypothetical protein OsI_38123                          205   4e-61   Oryza sativa Indica Group [Indian rice]
ref|NP_001066657.1|  Os12g0420200                                       205   6e-61   
ref|XP_004962574.1|  PREDICTED: chloroplast stem-loop binding pro...    204   2e-60   Setaria italica
ref|XP_010237291.1|  PREDICTED: chloroplast stem-loop binding pro...    200   4e-59   Brachypodium distachyon [annual false brome]
ref|XP_002442964.1|  hypothetical protein SORBIDRAFT_08g005500          200   6e-59   Sorghum bicolor [broomcorn]
dbj|BAK05017.1|  predicted protein                                      196   1e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010489928.1|  PREDICTED: chloroplast stem-loop binding pro...    194   8e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008648443.1|  PREDICTED: chloroplast stem-loop binding pro...    192   7e-56   
ref|NP_001131905.1|  uncharacterized protein LOC100193292               192   7e-56   Zea mays [maize]
gb|EMT28966.1|  hypothetical protein F775_32001                         198   1e-55   
gb|AFK48065.1|  unknown                                                 189   5e-55   Lotus japonicus
gb|KDO81612.1|  hypothetical protein CISIN_1g020797mg                   177   4e-52   Citrus sinensis [apfelsine]
gb|KDO81609.1|  hypothetical protein CISIN_1g020797mg                   177   8e-52   Citrus sinensis [apfelsine]
gb|KDO81607.1|  hypothetical protein CISIN_1g020797mg                   177   1e-51   Citrus sinensis [apfelsine]
gb|KDO81610.1|  hypothetical protein CISIN_1g020797mg                   177   1e-51   Citrus sinensis [apfelsine]
gb|KDO81606.1|  hypothetical protein CISIN_1g020797mg                   178   1e-51   Citrus sinensis [apfelsine]
gb|KDO81608.1|  hypothetical protein CISIN_1g020797mg                   177   3e-51   Citrus sinensis [apfelsine]
gb|KDO81605.1|  hypothetical protein CISIN_1g020797mg                   177   4e-51   Citrus sinensis [apfelsine]
gb|KDO81603.1|  hypothetical protein CISIN_1g020797mg                   176   1e-50   Citrus sinensis [apfelsine]
gb|ABK24300.1|  unknown                                                 178   2e-50   Picea sitchensis
gb|KDO81604.1|  hypothetical protein CISIN_1g020797mg                   176   2e-50   Citrus sinensis [apfelsine]
ref|XP_008648445.1|  PREDICTED: chloroplast stem-loop binding pro...    173   3e-49   
ref|XP_008658101.1|  PREDICTED: uncharacterized protein LOC100193...    173   3e-49   Zea mays [maize]
ref|XP_001764862.1|  predicted protein                                  153   1e-40   
ref|XP_002979442.1|  hypothetical protein SELMODRAFT_110839             151   2e-40   
ref|XP_002977885.1|  hypothetical protein SELMODRAFT_107618             149   6e-40   
ref|XP_002982469.1|  hypothetical protein SELMODRAFT_228849             144   1e-37   
ref|XP_002980988.1|  hypothetical protein SELMODRAFT_178601             143   2e-37   Selaginella moellendorffii
ref|XP_010941508.1|  PREDICTED: chloroplast stem-loop binding pro...    136   6e-35   
ref|XP_001690407.1|  chloroplast stem-loop-binding protein              134   8e-34   Chlamydomonas reinhardtii
ref|XP_002945687.1|  hypothetical protein VOLCADRAFT_78664              130   2e-32   Volvox carteri f. nagariensis
gb|KIZ07149.1|  hypothetical protein MNEG_0796                          118   8e-30   Monoraphidium neglectum
ref|XP_011398295.1|  Chloroplast stem-loop binding protein of 41 ...    120   5e-29   Auxenochlorella protothecoides
gb|KCW58622.1|  hypothetical protein EUGRSUZ_H01287                     119   2e-28   Eucalyptus grandis [rose gum]
gb|AFK39183.1|  unknown                                                 112   5e-26   Lotus japonicus
ref|XP_005845343.1|  hypothetical protein CHLNCDRAFT_36589              112   6e-26   Chlorella variabilis
ref|XP_005646252.1|  NAD(P)-binding protein                             105   2e-23   Coccomyxa subellipsoidea C-169
ref|XP_010070063.1|  PREDICTED: psbP domain-containing protein 1,...    104   2e-23   Eucalyptus grandis [rose gum]
ref|XP_010070062.1|  PREDICTED: psbP domain-containing protein 1,...    103   4e-23   Eucalyptus grandis [rose gum]
gb|KCW58626.1|  hypothetical protein EUGRSUZ_H01287                     102   5e-23   Eucalyptus grandis [rose gum]
ref|XP_008246190.1|  PREDICTED: psbP domain-containing protein 1,...  92.8    3e-19   Prunus mume [ume]
gb|KCW58625.1|  hypothetical protein EUGRSUZ_H01287                   90.1    2e-18   Eucalyptus grandis [rose gum]
ref|XP_005855445.1|  nad-dependent epimerase dehydratase              83.6    6e-16   Nannochloropsis gaditana CCMP526
gb|EWM24370.1|  nad-dependent epimerase dehydratase                   83.6    1e-15   Nannochloropsis gaditana
ref|WP_026082043.1|  3-beta hydroxysteroid dehydrogenase              82.4    1e-15   Fischerella sp. PCC 9339
ref|WP_029638354.1|  3-beta hydroxysteroid dehydrogenase [            82.0    2e-15   [Scytonema hofmanni] UTEX B 1581
ref|XP_005827760.1|  hypothetical protein GUITHDRAFT_96197            82.0    2e-15   Guillardia theta CCMP2712
ref|WP_015198868.1|  NAD-dependent epimerase/dehydratase              81.6    2e-15   Calothrix parietina
emb|CBN74028.1|  38 kDa ribosome-associated protein precursor         82.8    2e-15   Ectocarpus siliculosus
ref|WP_026795888.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  81.3    3e-15   Planktothrix
ref|WP_027255333.1|  3-beta hydroxysteroid dehydrogenase              81.3    3e-15   Planktothrix agardhii
ref|WP_026785486.1|  3-beta hydroxysteroid dehydrogenase              80.9    3e-15   Planktothrix rubescens
ref|WP_027250155.1|  3-beta hydroxysteroid dehydrogenase              80.9    3e-15   Planktothrix agardhii
ref|WP_006197986.1|  3-beta hydroxysteroid dehydrogenase/isomerase    80.9    4e-15   Nodularia spumigena
gb|AFY78521.1|  nucleoside-diphosphate-sugar epimerase                81.3    4e-15   Pleurocapsa sp. PCC 7327
ref|WP_009784478.1|  3-beta hydroxysteroid dehydrogenase/isomerase    80.5    6e-15   Lyngbya sp. PCC 8106
ref|WP_015783947.1|  NAD-dependent epimerase/dehydratase              80.1    7e-15   Cyanothece sp. PCC 8802
ref|WP_015173212.1|  NAD-dependent epimerase/dehydratase              80.1    8e-15   Geitlerinema sp. PCC 7407
ref|WP_012595308.1|  NAD-dependent epimerase/dehydratase              80.1    8e-15   Cyanothece sp. PCC 8801
ref|WP_039741151.1|  3-beta hydroxysteroid dehydrogenase              79.7    9e-15   
ref|XP_005536032.1|  similar to mRNA binding protein CSP41 precursor  80.9    1e-14   Cyanidioschyzon merolae strain 10D
ref|WP_026796328.1|  3-beta hydroxysteroid dehydrogenase              79.7    1e-14   Planktothrix
ref|WP_015224347.1|  NAD-dependent epimerase/dehydratase              79.3    1e-14   Halothece sp. PCC 7418
ref|WP_015117271.1|  nucleoside-diphosphate-sugar epimerase           79.3    1e-14   Rivularia sp. PCC 7116
ref|WP_039726406.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  79.3    1e-14   Lyngbya confervoides
ref|WP_006529067.1|  nucleoside-diphosphate-sugar epimerase           79.3    1e-14   Gloeocapsa sp. PCC 73106
ref|WP_035798183.1|  3-beta hydroxysteroid dehydrogenase              79.3    2e-14   Cyanothece sp. CCY0110
ref|WP_011318890.1|  3-beta hydroxysteroid dehydrogenase/isomerase    79.3    2e-14   Trichormus variabilis
ref|WP_010998959.1|  mRNA-binding protein                             79.3    2e-14   Nostocaceae
ref|WP_016859476.1|  mRNA binding protein                             79.0    2e-14   Fischerella muscicola
ref|XP_008246183.1|  PREDICTED: psbP domain-containing protein 1,...  79.3    2e-14   
ref|WP_015230954.1|  nucleoside-diphosphate-sugar epimerase           79.0    2e-14   Dactylococcopsis salina
ref|WP_035989819.1|  3-beta hydroxysteroid dehydrogenase              78.6    3e-14   Leptolyngbya sp. KIOST-1
ref|WP_009545065.1|  MULTISPECIES: NAD-dependent epimerase/dehydr...  78.6    3e-14   Cyanothece
ref|WP_015954771.1|  NAD-dependent epimerase/dehydratase              78.6    3e-14   Cyanothece sp. PCC 7424
ref|WP_016879750.1|  mRNA binding protein                             78.2    3e-14   Chlorogloeopsis fritschii
ref|WP_015155099.1|  NAD-dependent epimerase/dehydratase              78.2    4e-14   Chroococcidiopsis thermalis
ref|WP_015182798.1|  nucleoside-diphosphate-sugar epimerase           78.2    4e-14   Microcoleus sp. PCC 7113
ref|WP_023067618.1|  hypothetical protein                             77.8    4e-14   Lyngbya aestuarii
ref|WP_008052699.1|  putative UDP-glucose 4-epimerase                 77.8    5e-14   Arthrospira
ref|XP_006841605.1|  hypothetical protein AMTR_s00003p00211760        77.4    5e-14   
ref|XP_005715070.1|  similar to mRNA binding protein CSP41 precursor  79.0    5e-14   Chondrus crispus [carageen]
ref|WP_017748039.1|  mRNA binding protein                             77.8    6e-14   Scytonema hofmannii
ref|WP_039716152.1|  3-beta hydroxysteroid dehydrogenase              77.4    6e-14   
ref|WP_017653189.1|  mRNA binding protein                             77.4    7e-14   Fortiea contorta
ref|WP_026735807.1|  3-beta hydroxysteroid dehydrogenase              77.4    7e-14   Fischerella sp. PCC 9605
ref|WP_007310519.1|  mRNA-binding protein                             77.0    8e-14   Crocosphaera watsonii
ref|WP_009453963.1|  MULTISPECIES: NAD-dependent epimerase/dehydr...  77.0    9e-14   Fischerella thermalis
gb|KIE11660.1|  3-beta hydroxysteroid dehydrogenase                   77.0    9e-14   Tolypothrix bouteillei VB521301
ref|WP_006101901.1|  3-beta hydroxysteroid dehydrogenase/isomeras...  77.0    1e-13   Coleofasciculus chthonoplastes
ref|WP_028948726.1|  3-beta hydroxysteroid dehydrogenase              76.6    1e-13   Synechocystis sp. PCC 6714
ref|WP_006508721.1|  nucleoside-diphosphate-sugar epimerase           76.6    1e-13   Xenococcus sp. PCC 7305
ref|WP_019506359.1|  mRNA binding protein                             76.6    1e-13   Pleurocapsa sp. PCC 7319
ref|WP_021831139.1|  Ribosome-associated endonuclease, involved i...  76.6    1e-13   Crocosphaera watsonii
ref|WP_011613919.1|  NAD-dependent epimerase/dehydratase              76.6    1e-13   Trichodesmium erythraeum
ref|WP_041393425.1|  3-beta hydroxysteroid dehydrogenase              76.6    1e-13   Pleurocapsa minor
ref|XP_005708577.1|  NAD-dependent epimerase/dehydratase              77.4    1e-13   Galdieria sulphuraria
ref|WP_016870077.1|  mRNA binding protein                             76.6    1e-13   Fischerella muscicola
ref|WP_022607065.1|  nucleoside-diphosphate-sugar epimerase           76.3    1e-13   Rubidibacter lacunae
ref|WP_013320753.1|  NAD-dependent epimerase/dehydratase              76.3    2e-13   Cyanothece sp. PCC 7822
ref|WP_007305255.1|  similar to Nucleoside-diphosphate-sugar epim...  76.3    2e-13   Crocosphaera watsonii
ref|WP_006668390.1|  NAD-dependent epimerase/dehydratase              76.3    2e-13   Arthrospira maxima
ref|WP_035760106.1|  3-beta hydroxysteroid dehydrogenase              76.3    2e-13   Arthrospira platensis
ref|WP_006620185.1|  NAD-dependent epimerase/dehydratase              76.3    2e-13   Arthrospira platensis
gb|EKD07761.1|  NAD-dependent epimerase/dehydratase                   76.3    2e-13   Arthrospira platensis C1
ref|WP_026720806.1|  3-beta hydroxysteroid dehydrogenase              76.3    2e-13   Fischerella sp. PCC 9431
ref|WP_015192645.1|  NAD-dependent epimerase/dehydratase              76.3    2e-13   Stanieria cyanosphaera
ref|WP_015187023.1|  NAD-dependent epimerase/dehydratase              76.3    2e-13   Gloeocapsa sp. PCC 7428
ref|WP_017299031.1|  mRNA binding protein                             76.3    2e-13   Nodosilinea nodulosa
ref|WP_044194679.1|  3-beta hydroxysteroid dehydrogenase              75.9    2e-13   Oscillatoria acuminata
ref|WP_028089840.1|  3-beta hydroxysteroid dehydrogenase              75.5    3e-13   Dolichospermum circinale
ref|WP_040939413.1|  3-beta hydroxysteroid dehydrogenase              75.5    3e-13   
ref|WP_040934604.1|  3-beta hydroxysteroid dehydrogenase              75.5    3e-13   
ref|WP_040944850.1|  3-beta hydroxysteroid dehydrogenase              75.5    3e-13   
ref|WP_012164287.1|  NAD-dependent epimerase/dehydratase family p...  75.5    3e-13   Acaryochloris marina
ref|WP_036484619.1|  3-beta hydroxysteroid dehydrogenase              75.1    4e-13   Myxosarcina sp. GI1
ref|WP_007357035.1|  MULTISPECIES: NAD-dependent epimerase/dehydr...  75.1    5e-13   Kamptonema
ref|WP_008311812.1|  nucleoside-diphosphate-sugar epimerase           75.1    5e-13   Leptolyngbya sp. PCC 6406
ref|WP_015209022.1|  nucleoside-diphosphate-sugar epimerase           74.7    6e-13   Cylindrospermum stagnale
ref|WP_010872094.1|  hypothetical protein                             74.7    6e-13   Synechocystis
ref|WP_015141031.1|  nucleoside-diphosphate-sugar epimerase           74.7    6e-13   Nostoc sp. PCC 7524
ref|WP_015128322.1|  NAD-dependent epimerase/dehydratase              74.7    7e-13   Calothrix sp. PCC 7507
ref|WP_012409863.1|  NAD-dependent epimerase/dehydratase              74.3    7e-13   Nostoc punctiforme
ref|WP_027838844.1|  3-beta hydroxysteroid dehydrogenase              74.3    8e-13   Mastigocoleus testarum
ref|WP_024546780.1|  3-beta hydroxysteroid dehydrogenase              74.3    9e-13   Synechococcus
ref|WP_015201958.1|  NAD-dependent epimerase/dehydratase              74.3    1e-12   Crinalium epipsammum
ref|WP_026098387.1|  3-beta hydroxysteroid dehydrogenase              73.9    1e-12   Oscillatoria sp. PCC 10802
ref|WP_026082416.1|  3-beta hydroxysteroid dehydrogenase              73.9    1e-12   Mastigocladopsis repens
ref|WP_028084850.1|  3-beta hydroxysteroid dehydrogenase              73.9    1e-12   Dolichospermum circinale
ref|WP_037221707.1|  3-beta hydroxysteroid dehydrogenase              73.9    1e-12   
ref|WP_036003372.1|  3-beta hydroxysteroid dehydrogenase              73.6    1e-12   [Leptolyngbya] sp. JSC-1
ref|WP_017710841.1|  hypothetical protein                             73.6    2e-12   Prochlorothrix hollandica
ref|WP_010475080.1|  NAD-dependent epimerase/dehydratase family p...  73.6    2e-12   Acaryochloris sp. CCMEE 5410
ref|WP_015213760.1|  NAD-dependent epimerase/dehydratase              73.6    2e-12   Anabaena cylindrica
ref|WP_015134607.1|  NAD-dependent epimerase/dehydratase              73.6    2e-12   Leptolyngbya sp. PCC 7376
gb|KIJ82501.1|  3-beta hydroxysteroid dehydrogenase                   73.2    2e-12   Scytonema tolypothrichoides VB-61278
ref|WP_040687491.1|  3-beta hydroxysteroid dehydrogenase              73.2    2e-12   Pseudanabaena biceps
ref|WP_015115713.1|  NAD-dependent epimerase/dehydratase              72.4    4e-12   Nostoc sp. PCC 7107
ref|WP_017321687.1|  mRNA binding protein                             72.4    4e-12   cyanobacterium PCC 7702
ref|WP_026148475.1|  3-beta hydroxysteroid dehydrogenase              72.0    5e-12   Leptolyngbya boryana
ref|WP_016950568.1|  mRNA binding protein                             72.0    6e-12   Anabaena sp. PCC 7108
ref|WP_002769800.1|  hypothetical protein                             72.0    6e-12   Microcystis aeruginosa
ref|WP_026093134.1|  3-beta hydroxysteroid dehydrogenase              72.0    6e-12   Calothrix sp. PCC 7103
ref|WP_008185637.1|  nucleoside-diphosphate-sugar epimerase           72.0    6e-12   Moorea producens
ref|WP_023072519.1|  nucleoside-diphosphate-sugar epimerase           71.6    7e-12   Leptolyngbya sp. Heron Island J
ref|WP_041040676.1|  3-beta hydroxysteroid dehydrogenase              71.6    7e-12   Tolypothrix campylonemoides
gb|AFY81185.1|  nucleoside-diphosphate-sugar epimerase                71.6    7e-12   Oscillatoria acuminata PCC 6304
ref|WP_018397750.1|  mRNA binding protein                             71.6    7e-12   filamentous cyanobacterium ESFC-1
ref|WP_039204130.1|  3-beta hydroxysteroid dehydrogenase              71.6    8e-12   Aphanizomenon flos-aquae
ref|WP_002755819.1|  hypothetical protein                             71.2    9e-12   Microcystis aeruginosa
ref|WP_024970517.1|  3-beta hydroxysteroid dehydrogenase              71.2    1e-11   Microcystis aeruginosa
ref|WP_013191582.1|  NAD-dependent epimerase/dehydratase              71.2    1e-11   Trichormus azollae
ref|WP_016514465.1|  dTDP-glucose 4,6-dehydratase                     71.2    1e-11   Microcystis aeruginosa
ref|WP_002792534.1|  hypothetical protein                             71.2    1e-11   Microcystis aeruginosa
ref|WP_002775701.1|  hypothetical protein                             71.2    1e-11   Microcystis aeruginosa
ref|WP_012267203.1|  NAD-dependent epimerase/dehydratase              71.2    1e-11   Microcystis aeruginosa
ref|WP_015218019.1|  NAD-dependent epimerase/dehydratase              70.9    1e-11   Cyanobacterium aponinum
ref|WP_002801594.1|  hypothetical protein                             70.9    1e-11   Microcystis aeruginosa
ref|WP_015078767.1|  NAD-dependent epimerase/dehydratase              70.9    1e-11   Anabaena sp. 90
ref|WP_002786512.1|  hypothetical protein                             70.9    1e-11   Microcystis aeruginosa
ref|WP_035149086.1|  3-beta hydroxysteroid dehydrogenase              70.9    2e-11   Calothrix sp. 336/3
ref|WP_004160761.1|  hypothetical protein                             70.5    2e-11   Microcystis aeruginosa
ref|WP_039899813.1|  3-beta hydroxysteroid dehydrogenase              70.5    2e-11   Microcystis sp. T1-4
emb|CCI26921.1|  conserved hypothetical protein                       70.9    2e-11   Microcystis aeruginosa PCC 9809
ref|WP_044034560.1|  3-beta hydroxysteroid dehydrogenase              70.5    2e-11   Microcystis aeruginosa
emb|CCI31820.1|  conserved hypothetical protein                       70.5    2e-11   Microcystis sp. T1-4
emb|CCH97032.1|  conserved hypothetical protein                       70.5    2e-11   Microcystis aeruginosa PCC 9717
dbj|GAL93688.1|  ribosome-associated endonuclease                     70.5    2e-11   Microcystis aeruginosa NIES-44
ref|WP_043999088.1|  3-beta hydroxysteroid dehydrogenase              70.5    2e-11   Microcystis aeruginosa
ref|WP_009344170.1|  3-beta hydroxysteroid dehydrogenase/isomerase    70.5    2e-11   Aphanizomenonaceae
ref|WP_036018970.1|  3-beta hydroxysteroid dehydrogenase              69.7    3e-11   Leptolyngbya sp. PCC 7375
ref|WP_030007518.1|  3-beta hydroxysteroid dehydrogenase              69.7    3e-11   Synechococcus sp. NKBG042902
ref|WP_006276648.1|  3-beta hydroxysteroid dehydrogenase/isomerase    69.7    4e-11   Cylindrospermopsis raciborskii
ref|WP_002744731.1|  hypothetical protein                             69.7    4e-11   Microcystis aeruginosa
ref|WP_009556999.1|  nucleoside-diphosphate-sugar epimerase           69.3    5e-11   Oscillatoriales cyanobacterium JSC-12
ref|WP_017296158.1|  hypothetical protein                             69.3    5e-11   Geminocystis herdmanii
ref|WP_019499617.1|  hypothetical protein                             69.3    5e-11   Pseudanabaena sp. PCC 6802
ref|WP_017662831.1|  mRNA binding protein                             69.3    6e-11   Geitlerinema sp. PCC 7105
ref|WP_006632413.1|  NAD-dependent epimerase/dehydratase              68.9    7e-11   Microcoleus vaginatus
ref|WP_006454851.1|  3-beta hydroxysteroid dehydrogenase/isomeras...  68.9    7e-11   Synechococcus sp. PCC 7335
ref|WP_015176595.1|  NAD-dependent epimerase/dehydratase              68.9    7e-11   Oscillatoria nigro-viridis
ref|WP_009634119.1|  nucleoside-diphosphate-sugar epimerase           68.9    8e-11   Synechocystis sp. PCC 7509
ref|WP_027402803.1|  3-beta hydroxysteroid dehydrogenase              68.9    8e-11   Aphanizomenon flos-aquae
ref|WP_017306669.1|  mRNA binding protein                             67.8    2e-10   Spirulina subsalsa
ref|WP_041698440.1|  3-beta hydroxysteroid dehydrogenase              67.8    2e-10   
ref|WP_041429435.1|  3-beta hydroxysteroid dehydrogenase              67.4    3e-10   Synechococcus sp. PCC 7502
gb|ELS33647.1|  NAD-dependent epimerase/dehydratase                   67.0    4e-10   Pseudanabaena biceps PCC 7429
ref|WP_012307378.1|  NAD dependent epimerase/dehydratase family p...  66.2    6e-10   Synechococcus
ref|WP_015223287.1|  NAD-dependent epimerase/dehydratase              65.9    9e-10   
ref|XP_002184306.1|  predicted protein                                65.5    2e-09   Phaeodactylum tricornutum CCAP 1055/1
gb|ELP54431.1|  hypothetical protein O53_3250                         64.7    2e-09   Microcystis aeruginosa TAIHU98
gb|EKV03699.1|  nucleoside-diphosphate-sugar epimerase                64.3    2e-09   Leptolyngbya sp. PCC 7375
ref|WP_038025676.1|  3-beta hydroxysteroid dehydrogenase              64.3    3e-09   Synechococcus sp. PCC 7336
ref|WP_044304567.1|  3-beta hydroxysteroid dehydrogenase              63.9    5e-09   Richelia intracellularis
gb|ABX08895.1|  possible mRNA binding protein                         62.4    2e-08   Prochlorococcus marinus str. MIT 9211
gb|AFY70548.1|  NAD-dependent epimerase/dehydratase                   62.0    2e-08   Pseudanabaena sp. PCC 7367
emb|CDY64776.1|  BnaC08g50030D                                        57.4    5e-08   Brassica napus [oilseed rape]
gb|AFY74416.1|  nucleoside-diphosphate-sugar epimerase                60.5    6e-08   Synechococcus sp. PCC 7502
ref|WP_011935428.1|  NAD dependent epimerase/dehydratase              59.3    2e-07   Synechococcus sp. RCC307
ref|WP_017813133.1|  hypothetical protein                             58.9    2e-07   Paenibacillus sp. A9
emb|CCH67027.1|  Ribosome-associated endonuclease, involved in fi...  58.5    3e-07   Richelia intracellularis HH01
ref|WP_035834196.1|  3-beta hydroxysteroid dehydrogenase              58.2    4e-07   
gb|AAN46177.1|  unknown protein                                       58.2    4e-07   Synechococcus elongatus PCC 7942
ref|WP_036005282.1|  short-chain dehydrogenase                        58.2    5e-07   Bradyrhizobium yuanmingense
ref|WP_011244578.1|  MULTISPECIES: mRNA-binding protein               58.2    5e-07   Synechococcus
ref|WP_010317390.1|  nucleotide sugar epimerase                       57.8    6e-07   Synechococcus sp. CB0205
ref|WP_025309031.1|  hypothetical protein                             57.4    6e-07   Bdellovibrio bacteriovorus
ref|WP_036023563.1|  short-chain dehydrogenase                        57.8    7e-07   Bradyrhizobium yuanmingense
gb|EAQ73884.1|  Possible nucleotide sugar epimerase                   57.4    8e-07   Synechococcus sp. WH 5701
ref|WP_037980243.1|  3-beta hydroxysteroid dehydrogenase              57.4    8e-07   Synechococcus sp. WH 5701
ref|WP_038186335.1|  NAD-dependent dehydratase                        57.4    8e-07   Viridibacillus
ref|XP_009373314.1|  PREDICTED: psbP domain-containing protein 1,...  57.4    9e-07   
ref|WP_019152559.1|  hypothetical protein                             57.0    9e-07   
ref|WP_041391526.1|  3-beta hydroxysteroid dehydrogenase              57.0    1e-06   
ref|WP_008378472.1|  MULTISPECIES: hypothetical protein               57.0    1e-06   
gb|EPH93391.1|  NAD dependent epimerase/dehydratase family protein    57.0    1e-06   
gb|EGC69240.1|  NAD dependent epimerase/dehydratase family protein    57.0    1e-06   
ref|WP_034878512.1|  NAD dependent epimerase/dehydratase family p...  57.0    1e-06   
gb|AIQ96980.1|  Ribosome-associated endonuclease                      57.0    1e-06   
ref|XP_009337634.1|  PREDICTED: psbP domain-containing protein 1,...  56.6    1e-06   
ref|WP_038652281.1|  3-beta hydroxysteroid dehydrogenase              56.6    1e-06   
ref|WP_010748009.1|  hypothetical protein                             56.6    1e-06   
ref|WP_016205362.1|  nucleoside-diphosphate-sugar epimerase           56.6    1e-06   
gb|AII45723.1|  mRNA binding protein                                  56.6    2e-06   
ref|WP_025782115.1|  3-beta hydroxysteroid dehydrogenase              56.6    2e-06   
ref|WP_034872569.1|  NAD dependent epimerase/dehydratase family p...  56.2    2e-06   
gb|EPH65315.1|  NAD dependent epimerase/dehydratase family protein    56.2    2e-06   
ref|WP_041435035.1|  3-beta hydroxysteroid dehydrogenase              56.2    2e-06   
ref|WP_036201701.1|  NAD-dependent dehydratase                        55.8    3e-06   
ref|WP_033168425.1|  hypothetical protein                             55.5    3e-06   
gb|AHF63183.1|  putative nucleotide sugar epimerase                   55.5    3e-06   
ref|WP_041096713.1|  NAD-dependent dehydratase                        55.5    3e-06   
ref|WP_029552987.1|  3-beta hydroxysteroid dehydrogenase              55.5    4e-06   
ref|WP_036034871.1|  short-chain dehydrogenase                        55.5    4e-06   
ref|WP_036915776.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  55.5    4e-06   
ref|WP_019230120.1|  hypothetical protein                             55.5    4e-06   
ref|WP_011359584.1|  nucleotide sugar epimerase                       55.5    4e-06   
ref|WP_043696742.1|  3-beta hydroxysteroid dehydrogenase              55.5    4e-06   
ref|WP_035324130.1|  hypothetical protein                             55.1    4e-06   
ref|WP_022759455.1|  hypothetical protein                             55.1    4e-06   
ref|WP_031537789.1|  NAD-dependent dehydratase                        55.1    4e-06   
ref|WP_008405869.1|  NAD dependent epimerase/dehydratase              55.1    5e-06   
gb|ERI66007.1|  NAD dependent epimerase/dehydratase family protein    55.1    5e-06   
ref|WP_014822497.1|  NAD dependent epimerase/dehydratase              55.1    5e-06   
ref|WP_038556973.1|  3-beta hydroxysteroid dehydrogenase              54.7    7e-06   
gb|AII48879.1|  mRNA binding protein                                  54.7    7e-06   
ref|WP_015509517.1|  hypothetical protein                             54.3    8e-06   
ref|WP_036185880.1|  NAD-dependent dehydratase                        54.3    8e-06   
ref|WP_025930237.1|  3-beta hydroxysteroid dehydrogenase              54.3    8e-06   
ref|WP_034858034.1|  NAD dependent epimerase/dehydratase family p...  54.3    8e-06   
ref|WP_025491362.1|  reductase                                        54.3    8e-06   
ref|WP_005225796.1|  hypothetical protein                             54.3    9e-06   
gb|EPH61652.1|  NAD dependent epimerase/dehydratase family protein    54.3    9e-06   
ref|WP_026665560.1|  hypothetical protein                             54.3    9e-06   
ref|WP_026492227.1|  hypothetical protein                             54.3    9e-06   
ref|WP_036902866.1|  3-beta hydroxysteroid dehydrogenase              53.9    1e-05   
ref|WP_040375771.1|  NAD-dependent dehydratase                        53.9    1e-05   
ref|WP_025035298.1|  short-chain dehydrogenase                        53.9    1e-05   
ref|WP_007608562.1|  short-chain dehydrogenase                        53.9    1e-05   
ref|WP_027215610.1|  hypothetical protein                             53.9    1e-05   
ref|WP_042477167.1|  NAD-dependent dehydratase                        53.9    1e-05   
ref|WP_009790198.1|  possible nucleotide sugar epimerase              53.9    1e-05   
ref|WP_011823541.1|  mRNA binding protein                             53.5    2e-05   
ref|WP_013658973.1|  NAD-dependent epimerase/dehydratase              53.5    2e-05   
ref|WP_039707994.1|  hypothetical protein                             53.5    2e-05   
ref|WP_026653267.1|  hypothetical protein                             53.5    2e-05   
gb|KJC48445.1|  short-chain dehydrogenase                             53.5    2e-05   
ref|WP_032521524.1|  3-beta hydroxysteroid dehydrogenase              53.5    2e-05   
ref|WP_035315130.1|  hypothetical protein                             53.1    2e-05   
ref|WP_003126237.1|  MULTISPECIES: hypothetical protein               53.1    2e-05   
ref|WP_033795344.1|  epimerase                                        53.1    2e-05   
ref|WP_011293739.1|  mRNA binding protein                             53.1    3e-05   
ref|WP_008788739.1|  MULTISPECIES: hypothetical protein               52.8    3e-05   
ref|WP_028172070.1|  MULTISPECIES: short-chain dehydrogenase          53.1    3e-05   
ref|WP_011086118.1|  MULTISPECIES: short-chain dehydrogenase          53.1    3e-05   
ref|WP_018458684.1|  short-chain dehydrogenase                        52.8    3e-05   
ref|WP_036918229.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  52.8    3e-05   
ref|WP_015108401.1|  nucleoside-diphosphate-sugar epimerase           52.8    3e-05   
ref|WP_035396181.1|  hypothetical protein                             50.4    3e-05   
ref|WP_011132431.1|  mRNA binding protein                             52.8    3e-05   
ref|WP_004226130.1|  NAD dependent epimerase/dehydratase              52.8    3e-05   
ref|WP_027569260.1|  short-chain dehydrogenase                        52.8    3e-05   
ref|WP_038934226.1|  short-chain dehydrogenase                        52.8    3e-05   
ref|WP_027517108.1|  short-chain dehydrogenase                        52.8    3e-05   
ref|WP_036892226.1|  MULTISPECIES: 3-beta hydroxysteroid dehydrog...  52.8    3e-05   
ref|WP_005670230.1|  hypothetical protein                             52.8    3e-05   
ref|WP_007593109.1|  short-chain dehydrogenase                        52.8    3e-05   
ref|WP_010860217.1|  hypothetical protein                             52.8    3e-05   
ref|WP_006041446.1|  possible nucleotide sugar epimerase              52.8    3e-05   
ref|WP_011826376.1|  mRNA binding protein                             52.8    4e-05   
ref|WP_002094331.1|  epimerase                                        52.4    4e-05   
ref|WP_041660274.1|  epimerase                                        52.4    4e-05   
ref|WP_008103567.1|  NAD dependent epimerase/dehydratase family       52.4    5e-05   
ref|WP_011376360.1|  mRNA binding protein                             52.4    5e-05   
gb|KJC38886.1|  short-chain dehydrogenase                             52.4    5e-05   
ref|XP_009373313.1|  PREDICTED: psbP domain-containing protein 1,...  52.4    5e-05   
gb|AHK35698.1|  Uncharacterized protein Pd630_LPD12027                52.4    5e-05   
ref|WP_038955905.1|  short-chain dehydrogenase                        52.4    5e-05   
ref|WP_005245190.1|  hypothetical protein                             52.4    5e-05   
ref|WP_025117000.1|  NAD-dependent dehydratase                        52.0    5e-05   
ref|WP_041400161.1|  NAD-dependent dehydratase                        52.0    5e-05   
ref|WP_044592201.1|  short-chain dehydrogenase                        52.0    5e-05   
ref|WP_038543943.1|  3-beta hydroxysteroid dehydrogenase              52.0    5e-05   
gb|ENZ01606.1|  hypothetical protein HMPREF1092_00840                 52.0    5e-05   
ref|WP_039150703.1|  short-chain dehydrogenase                        52.0    5e-05   
ref|WP_007538858.1|  NAD-dependent epimerase/dehydratase              52.0    6e-05   
ref|WP_036118853.1|  NAD-dependent dehydratase                        52.0    6e-05   
emb|CDN42163.1|  NAD dependent epimerase                              52.0    6e-05   
ref|WP_040413947.1|  epimerase                                        52.0    6e-05   
ref|WP_011129898.1|  mRNA binding protein                             52.0    6e-05   
gb|EAU73732.1|  Possible nucleotide sugar epimerase                   52.0    6e-05   
ref|WP_038024118.1|  3-beta hydroxysteroid dehydrogenase              52.0    6e-05   
ref|WP_015550807.1|  NAD dependent epimerase/dehydratase family       50.1    6e-05   
ref|WP_017007807.1|  hypothetical protein                             52.0    6e-05   
gb|ACZ39746.1|  NAD-dependent epimerase/dehydratase                   52.0    6e-05   
ref|WP_027548952.1|  short-chain dehydrogenase                        52.0    6e-05   
ref|WP_016131029.1|  hypothetical protein                             51.6    6e-05   
ref|WP_035626690.1|  hypothetical protein                             51.6    7e-05   
ref|WP_008176765.1|  NAD dependent epimerase/dehydratase              51.6    7e-05   
ref|WP_010468159.1|  epimerase                                        52.0    7e-05   
ref|XP_008388461.1|  PREDICTED: psbP domain-containing protein 1,...  51.6    7e-05   
ref|WP_024864415.1|  hypothetical protein                             51.6    7e-05   
ref|WP_022777815.1|  epimerase                                        51.6    7e-05   
ref|WP_036802583.1|  hypothetical protein                             51.6    7e-05   
ref|WP_044737373.1|  epimerase                                        51.6    7e-05   
ref|WP_028951608.1|  3-beta hydroxysteroid dehydrogenase              51.6    7e-05   
ref|WP_002099232.1|  epimerase                                        51.6    8e-05   
ref|WP_042135563.1|  NAD-dependent dehydratase                        51.6    8e-05   
ref|WP_036907313.1|  3-beta hydroxysteroid dehydrogenase              51.6    8e-05   
gb|KGG19624.1|  Ribosome-associated endonuclease                      51.6    8e-05   
emb|CDY64775.1|  BnaC08g50020D                                        51.2    9e-05   
dbj|GAF19633.1|  isoflavone reductase                                 49.7    9e-05   
ref|WP_005043296.1|  NAD-dependent epimerase/dehydratase              51.2    1e-04   
ref|WP_002195968.1|  MULTISPECIES: epimerase                          51.2    1e-04   
gb|EOO64950.1|  hypothetical protein IKE_04491                        51.2    1e-04   
ref|WP_033693518.1|  epimerase                                        51.2    1e-04   
gb|ETT78310.1|  isoflavone reductase                                  51.2    1e-04   
gb|ADH09850.1|  isoflavone reductase                                  51.2    1e-04   
ref|WP_033714919.1|  epimerase                                        51.2    1e-04   
ref|WP_029699246.1|  epimerase                                        51.2    1e-04   
ref|WP_002042083.1|  epimerase                                        51.2    1e-04   
ref|WP_036920826.1|  3-beta hydroxysteroid dehydrogenase              51.2    1e-04   
ref|WP_033696049.1|  epimerase                                        51.2    1e-04   
ref|WP_033690657.1|  epimerase                                        51.2    1e-04   
ref|WP_011933072.1|  NAD dependent epimerase/dehydratase              51.2    1e-04   
gb|EJR93852.1|  hypothetical protein IKG_05348                        51.2    1e-04   
gb|EEL85103.1|  NAD-dependent epimerase/dehydratase                   51.2    1e-04   
gb|EOP63268.1|  hypothetical protein IIQ_04293                        51.2    1e-04   
ref|WP_026528745.1|  hypothetical protein                             51.2    1e-04   
ref|WP_017380236.1|  hypothetical protein                             51.2    1e-04   
ref|WP_001986984.1|  epimerase                                        51.2    1e-04   
gb|KGT41239.1|  epimerase                                             50.8    1e-04   
ref|WP_042850259.1|  3-beta hydroxysteroid dehydrogenase              50.8    1e-04   
ref|WP_000757293.1|  hypothetical protein                             50.8    1e-04   
gb|EJQ23820.1|  hypothetical protein IE9_05028                        50.8    1e-04   
ref|WP_033690190.1|  epimerase                                        50.8    1e-04   
ref|WP_029756929.1|  hypothetical protein                             50.8    1e-04   
ref|WP_009368965.1|  hypothetical protein                             51.6    1e-04   
ref|WP_036078389.1|  NAD-dependent dehydratase                        50.8    1e-04   
ref|WP_026516347.1|  hypothetical protein                             50.8    1e-04   
ref|WP_022800109.1|  NAD-dependent epimerase                          50.8    1e-04   
ref|WP_022494105.1|  hypothetical protein                             50.8    1e-04   
ref|WP_017657607.1|  epimerase                                        50.8    1e-04   
ref|WP_027461931.1|  NAD-dependent epimerase                          50.8    1e-04   
ref|WP_031558035.1|  hypothetical protein                             50.8    2e-04   
ref|WP_002025132.1|  MULTISPECIES: epimerase                          50.8    2e-04   
ref|WP_035629980.1|  hypothetical protein                             50.8    2e-04   
ref|WP_033692135.1|  epimerase                                        50.8    2e-04   
ref|WP_042504211.1|  3-beta hydroxysteroid dehydrogenase              50.8    2e-04   
gb|KIU75388.1|  isoflavone reductase                                  50.4    2e-04   
ref|WP_033828813.1|  NAD-dependent dehydratase                        50.4    2e-04   
gb|EJR65587.1|  hypothetical protein IK5_05613                        50.4    2e-04   
ref|WP_002198701.1|  epimerase                                        50.4    2e-04   
ref|WP_033542952.1|  hypothetical protein                             50.4    2e-04   
ref|WP_002113192.1|  epimerase                                        50.4    2e-04   
ref|WP_036231676.1|  hypothetical protein                             50.4    2e-04   
ref|WP_012593383.1|  epimerase                                        50.4    2e-04   
ref|WP_032514285.1|  3-beta hydroxysteroid dehydrogenase              50.4    2e-04   
ref|WP_041045860.1|  hypothetical protein                             50.4    2e-04   
ref|WP_036152785.1|  NAD-dependent dehydratase                        50.4    2e-04   
ref|WP_026510761.1|  hypothetical protein                             50.4    2e-04   
ref|WP_022762724.1|  hypothetical protein                             50.4    2e-04   
ref|WP_014685753.1|  NAD-dependent epimerase                          50.4    2e-04   
ref|WP_008323444.1|  NAD-dependent epimerase/dehydratase              50.4    2e-04   
ref|WP_002174474.1|  epimerase                                        50.1    2e-04   
ref|WP_041870969.1|  hypothetical protein                             50.1    2e-04   
ref|WP_018647565.1|  short-chain dehydrogenase                        50.1    2e-04   
ref|WP_036119607.1|  MULTISPECIES: NAD-dependent dehydratase          50.1    2e-04   
ref|WP_006076139.1|  NAD-dependent epimerase/dehydratase              50.1    2e-04   
ref|WP_027339238.1|  epimerase                                        50.1    2e-04   
ref|WP_036363875.1|  hypothetical protein                             50.1    3e-04   
gb|KID93814.1|  reductase                                             50.1    3e-04   
ref|WP_038970504.1|  short-chain dehydrogenase                        50.1    3e-04   
ref|WP_011683025.1|  NAD-dependent epimerase/dehydratase              50.1    3e-04   
gb|KID85165.1|  reductase                                             50.1    3e-04   
emb|CEG23758.1|  hypothetical protein BN1080_02762                    47.8    3e-04   
ref|WP_012295682.1|  NAD dependent epimerase/dehydratase              50.1    3e-04   
gb|ABI47683.1|  Possible nucleotide sugar epimerase                   50.1    3e-04   
ref|WP_008006339.1|  NAD-dependent epimerase/dehydratase              50.1    3e-04   
ref|WP_044024856.1|  hypothetical protein                             49.7    3e-04   
ref|WP_016078230.1|  hypothetical protein                             49.7    3e-04   
gb|AEN96149.1|  hypothetical protein RHOM_05150                       49.7    3e-04   
gb|ABB35620.1|  possible nucleotide sugar epimerase                   49.7    3e-04   
ref|WP_039871859.1|  NAD-dependent dehydratase                        49.7    3e-04   
ref|WP_042596800.1|  MULTISPECIES: epimerase                          49.7    3e-04   
ref|WP_000757289.1|  epimerase                                        49.7    3e-04   
ref|WP_000757288.1|  MULTISPECIES: epimerase                          49.7    3e-04   
gb|AFQ29308.1|  hypothetical protein BTF1_25725                       49.7    3e-04   
ref|WP_018315986.1|  short-chain dehydrogenase                        49.7    3e-04   
ref|WP_013173793.1|  epimerase [                                      49.7    3e-04   
ref|WP_006910886.1|  possible nucleotide sugar epimerase              49.7    3e-04   
gb|ACK97377.1|  conserved hypothetical protein                        49.7    3e-04   
ref|WP_000757287.1|  hypothetical protein                             49.7    3e-04   
gb|AFQ17645.1|  hypothetical protein BTG_21145                        49.7    3e-04   
ref|WP_000757290.1|  hypothetical protein                             49.7    4e-04   
ref|WP_003310130.1|  epimerase                                        49.7    4e-04   
gb|KGG15190.1|  Ribosome-associated endonuclease                      49.7    4e-04   
ref|WP_028155703.1|  short-chain dehydrogenase                        49.7    4e-04   
ref|WP_038695852.1|  NAD-dependent dehydratase                        49.7    4e-04   
ref|WP_003280977.1|  epimerase                                        49.7    4e-04   
ref|WP_021283905.1|  hypothetical protein                             49.7    4e-04   
ref|WP_029506230.1|  hypothetical protein                             49.7    4e-04   
ref|WP_005542921.1|  NAD dependent epimerase/dehydratase              49.7    4e-04   
ref|WP_010098770.1|  NAD dependent epimerase/dehydratase              49.3    4e-04   
ref|WP_026519551.1|  hypothetical protein                             49.3    4e-04   
ref|WP_019010427.1|  hypothetical protein                             49.7    4e-04   
ref|WP_033671087.1|  epimerase                                        49.3    4e-04   
ref|WP_017414337.1|  hypothetical protein                             49.7    4e-04   
ref|WP_025220321.1|  NAD-dependent dehydratase                        49.3    4e-04   
emb|CEG31232.1|  NAD-dependent epimerase/dehydratase                  49.7    4e-04   
ref|WP_020652123.1|  hypothetical protein                             49.3    4e-04   
ref|WP_018248534.1|  hypothetical protein                             49.3    4e-04   



>ref|XP_011092178.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Sesamum indicum]
Length=381

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 138/156 (88%), Gaps = 2/156 (1%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  256
            M S+V V  +  S +   L SS SDFNG +L  +SVQYKRK+WQPKGAL+++AS+ KKIL
Sbjct  1    MASMVVVHHKQPSSTSILLSSSLSDFNGARL-TASVQYKRKLWQPKGALRVTASSTKKIL  59

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIGIFLSRLLVKEGHQVTLFTR KAPIAQQLPGES++DFADFSSKILHLKGDR 
Sbjct  60   IMGGTRFIGIFLSRLLVKEGHQVTLFTRGKAPIAQQLPGESEADFADFSSKILHLKGDRK  119

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DF+FVKSSLAAEGFDVVYDINGREAVEVEPIL+ALP
Sbjct  120  DFEFVKSSLAAEGFDVVYDINGREAVEVEPILEALP  155



>ref|XP_009780849.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Nicotiana sylvestris]
Length=378

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 139/156 (89%), Gaps = 4/156 (3%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKIL  256
            M SLVAV  Q K  S + LPSS SDFNG KL +SS+Q+KRK  QPKGAL ++AS AKKIL
Sbjct  1    MASLVAV--QHKQPSFAVLPSSHSDFNGAKL-ISSLQFKRKPCQPKGALHVTASSAKKIL  57

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI+QQLPGESD D+ADFSSK+LHLKGDRM
Sbjct  58   IMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPISQQLPGESDQDYADFSSKLLHLKGDRM  117

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DFDFVKSSL+AEGFDVVYDINGREAVEVEPILDALP
Sbjct  118  DFDFVKSSLSAEGFDVVYDINGREAVEVEPILDALP  153



>ref|XP_009619213.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Nicotiana tomentosiformis]
Length=374

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 139/156 (89%), Gaps = 4/156 (3%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKIL  256
            M SLVAV  Q K  S + LPSS SDFNG KL +SS+Q+KRK  QPKGAL ++AS AKKIL
Sbjct  1    MASLVAV--QHKQPSFAVLPSSHSDFNGAKL-ISSLQFKRKPCQPKGALHVTASSAKKIL  57

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI+QQLPGESD D+ADFSSK+LHLKGDRM
Sbjct  58   IMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPISQQLPGESDQDYADFSSKLLHLKGDRM  117

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DFDFVKSSL+AEGFDVVYDINGREAVEVEPILDALP
Sbjct  118  DFDFVKSSLSAEGFDVVYDINGREAVEVEPILDALP  153



>ref|XP_004241412.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Solanum lycopersicum]
Length=379

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  256
            M SLVA+  QPK  S S LPSS SDFNG +L +SS QYKRK    KGALQ++AS+ KKIL
Sbjct  1    MASLVAI--QPKQPSFSLLPSSNSDFNGARL-ISSFQYKRKPCLSKGALQVTASSEKKIL  57

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI+QQLPGESD D+ADFSSK+LHLKGDRM
Sbjct  58   IMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPISQQLPGESDQDYADFSSKLLHLKGDRM  117

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DFDFVKSSL+AEG+DVVYDINGREA EVEPILDALP
Sbjct  118  DFDFVKSSLSAEGYDVVYDINGREATEVEPILDALP  153



>emb|CDP20929.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 134/156 (86%), Gaps = 4/156 (3%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  256
            M S+ AV  Q K  S S LPSS SDFNG +L  +SVQYKRKV  P+GAL +SASA KKIL
Sbjct  1    MASMAAV--QAKQPSFSVLPSSLSDFNGIRL-TTSVQYKRKVLHPRGALHVSASAAKKIL  57

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIGIFLSR LVKEGHQVTLFTR KAPIAQQLPGESD+DFADFSSKILHLKGDR 
Sbjct  58   IMGGTRFIGIFLSRFLVKEGHQVTLFTRGKAPIAQQLPGESDTDFADFSSKILHLKGDRK  117

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DF+FVKSSLAAEGFDVVYDINGREA E EPILDALP
Sbjct  118  DFEFVKSSLAAEGFDVVYDINGREAAEAEPILDALP  153



>ref|XP_006347295.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Solanum tuberosum]
Length=379

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  256
            M SLVA+  QPK  S S LPSS SDFNG +L +SS QYKRK    KGALQ++AS+ KKIL
Sbjct  1    MASLVAI--QPKQPSFSVLPSSHSDFNGARL-ISSFQYKRKPCLSKGALQVTASSEKKIL  57

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI+QQLPGESD D+ADFSSK+LHLKGDRM
Sbjct  58   IMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPISQQLPGESDQDYADFSSKLLHLKGDRM  117

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DFDFVKSSL+AEG+DVVYDINGREA EVEPILDALP
Sbjct  118  DFDFVKSSLSAEGYDVVYDINGREATEVEPILDALP  153



>ref|XP_010674555.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 133/158 (84%), Gaps = 3/158 (2%)
 Frame = +2

Query  77   IMVSLVAVVQ-QPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KK  250
            +   L+AV Q QP S       S  SDFNG +L   SVQ+KR V QPKGAL ++AS+ KK
Sbjct  1    MACRLMAVQQNQPASSLALFHSSLSSDFNGCRL-THSVQFKRNVVQPKGALHVTASSGKK  59

Query  251  ILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGD  430
            ILIMGGTRFIGIFLSRLLVKEGHQVTLFTR KAPIAQQLPGE+D+DFADFSSKILHLKGD
Sbjct  60   ILIMGGTRFIGIFLSRLLVKEGHQVTLFTRGKAPIAQQLPGEADADFADFSSKILHLKGD  119

Query  431  RMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            R DFDFVKSSL+AEG+DVVYDINGREAVEVEPILDALP
Sbjct  120  RQDFDFVKSSLSAEGYDVVYDINGREAVEVEPILDALP  157



>ref|XP_011023817.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Populus euphratica]
Length=380

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 130/156 (83%), Gaps = 3/156 (2%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  256
            M  LVAV QQ +        S   DFNGT+L  S VQ KR+VWQ KGALQ+SAS+ K IL
Sbjct  1    MARLVAVQQQTQPSFSLLPSSLS-DFNGTRLH-SQVQCKRRVWQTKGALQVSASSSKNIL  58

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI QQLPGESD D+ADFSSKILHLKGDR 
Sbjct  59   IMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDQDYADFSSKILHLKGDRK  118

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DF+FVK+SLAA+GFDVVYDINGREAVEVEPILDALP
Sbjct  119  DFEFVKTSLAAKGFDVVYDINGREAVEVEPILDALP  154



>gb|KJB45476.1| hypothetical protein B456_007G308300 [Gossypium raimondii]
Length=379

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 121/131 (92%), Gaps = 3/131 (2%)
 Frame = +2

Query  155  FNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVTL  331
            FNGTKL    +QYKRKV+QPKGAL I+AS+ KKILIMGGTRFIG+FLSRLLVKEGHQVTL
Sbjct  25   FNGTKLC--QIQYKRKVYQPKGALHIAASSTKKILIMGGTRFIGVFLSRLLVKEGHQVTL  82

Query  332  FTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREA  511
            FTR KAP+ QQLPGESDSD+A+F SKILHLKGDRMDFDFVKSSL+AEG+DVVYDINGREA
Sbjct  83   FTRGKAPVTQQLPGESDSDYAEFKSKILHLKGDRMDFDFVKSSLSAEGYDVVYDINGREA  142

Query  512  VEVEPILDALP  544
             EVEPILDALP
Sbjct  143  AEVEPILDALP  153



>gb|ABK96584.1| unknown [Populus trichocarpa x Populus deltoides]
Length=380

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 130/156 (83%), Gaps = 3/156 (2%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  256
            M  LVAV QQ +        S   DFNGT+L  S VQ KR+VWQ KGALQ+SAS+ K IL
Sbjct  1    MARLVAVQQQTQPSFSLLPSSLS-DFNGTRLH-SQVQCKRRVWQTKGALQVSASSSKNIL  58

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI QQLPGESD D++DFSSKILHLKGDR 
Sbjct  59   IMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDQDYSDFSSKILHLKGDRK  118

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DF+FVK+SLAA+GFDVVYDINGREAVEVEPILDALP
Sbjct  119  DFEFVKTSLAAKGFDVVYDINGREAVEVEPILDALP  154



>emb|CDX94984.1| BnaC05g06870D [Brassica napus]
Length=378

 Score =   224 bits (571),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL  S VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIGIFLSRLLVKEGHQVT
Sbjct  23   DFNGAKLH-SQVQYKRKVQQPKGALYVSASSEKKILIMGGTRFIGIFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  142  AEEVEPILDALP  153



>gb|KFK43232.1| hypothetical protein AALP_AA1G097200 [Arabis alpina]
Length=379

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 122/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV+QPKGAL +SAS+ KKILIMGGTRFIGIFLSRLLVKEGHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVYQPKGALYVSASSEKKILIMGGTRFIGIFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPI+DALP
Sbjct  142  AEEVEPIIDALP  153



>gb|KDP23362.1| hypothetical protein JCGZ_23195 [Jatropha curcas]
Length=380

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 130/156 (83%), Gaps = 3/156 (2%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKIL  256
            M  LVAV QQ +        S   DFNGT+L  S +Q KRKVWQ KGALQ++AS +K IL
Sbjct  1    MARLVAVQQQTQPSFSLLPSSFS-DFNGTRLH-SQIQCKRKVWQTKGALQVTASTSKNIL  58

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI QQLPGESD ++ADFSSKILHLKGDR 
Sbjct  59   IMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDQEYADFSSKILHLKGDRK  118

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DF+FVKSSL+A+GFDVVYDINGREAVEVEPILDALP
Sbjct  119  DFEFVKSSLSAKGFDVVYDINGREAVEVEPILDALP  154



>ref|XP_006417582.1| hypothetical protein EUTSA_v10007937mg [Eutrema salsugineum]
 gb|ESQ35935.1| hypothetical protein EUTSA_v10007937mg [Eutrema salsugineum]
Length=379

 Score =   224 bits (570),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV+QPKGAL +SAS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVYQPKGALYVSASSEKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPI+DALP
Sbjct  142  AEEVEPIIDALP  153



>dbj|BAJ33886.1| unnamed protein product [Thellungiella halophila]
Length=379

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV+QPKGAL +SAS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVYQPKGALYVSASSEKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPI+DALP
Sbjct  142  AEEVEPIIDALP  153



>ref|XP_009148185.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Brassica rapa]
 emb|CDX93509.1| BnaA06g05390D [Brassica napus]
Length=378

 Score =   223 bits (568),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIGIFLSRLLVKEGHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVQQPKGALYVSASSEKKILIMGGTRFIGIFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  142  AEEVEPILDALP  153



>ref|XP_004302291.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=380

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 129/156 (83%), Gaps = 3/156 (2%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKIL  256
            M  LV+V + P    L     S  DFNGT+L  S +Q+KR+V QP+GALQ+SAS AKKIL
Sbjct  1    MAKLVSVQRHPSVSLLPPSSLS--DFNGTRLLHSHLQFKRRVSQPRGALQVSASSAKKIL  58

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIGIFLSRLLVKEGHQVTLFTR KAPI QQLPGESDSD+ DF+SKILHLKGDR 
Sbjct  59   IMGGTRFIGIFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDSDYTDFASKILHLKGDRK  118

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DFDFVKSSL+AEGFDVVYDINGREA E+ PILD LP
Sbjct  119  DFDFVKSSLSAEGFDVVYDINGREAEEIVPILDGLP  154



>ref|XP_010024151.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Eucalyptus grandis]
 gb|KCW60581.1| hypothetical protein EUGRSUZ_H03311 [Eucalyptus grandis]
Length=382

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG++L  + VQYKRKV QPKGAL+++AS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  26   DFNGSRLH-ACVQYKRKVGQPKGALRVTASSNKKILIMGGTRFIGVFLSRLLVKEGHQVT  84

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPI QQLPGESD DFADFSSKILHLKGDR DFDFVKSSLAAEGFDVVYDINGRE
Sbjct  85   LFTRGKAPITQQLPGESDKDFADFSSKILHLKGDRKDFDFVKSSLAAEGFDVVYDINGRE  144

Query  509  AVEVEPILDALP  544
            A EV PILDALP
Sbjct  145  ADEVAPILDALP  156



>ref|XP_010544150.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Tarenaya hassleriana]
Length=379

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 120/132 (91%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNGTKL    VQYKRK ++PKGAL +SAS AKKILIMGGTRFIG+FLSRLLVK+GHQVT
Sbjct  23   DFNGTKLNFR-VQYKRKAYRPKGALHVSASSAKKILIMGGTRFIGVFLSRLLVKDGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSLAAEGFDVVYDINGRE
Sbjct  82   LFTRGKAPIAKQLPGESDEDFADFSSKILHLKGDRKDYDFVKSSLAAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EV PILDALP
Sbjct  142  AEEVAPILDALP  153



>ref|XP_002319474.2| hypothetical protein POPTR_0013s00760g [Populus trichocarpa]
 gb|ABK95651.1| unknown [Populus trichocarpa]
 gb|EEE95397.2| hypothetical protein POPTR_0013s00760g [Populus trichocarpa]
Length=380

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 129/156 (83%), Gaps = 3/156 (2%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  256
            M  LVAV QQ +        S   DFNGT+L  S V+ KR+VWQ KGALQ+SAS+ K IL
Sbjct  1    MARLVAVQQQTQPSFSLLPSSLS-DFNGTRLH-SQVRCKRRVWQTKGALQVSASSSKNIL  58

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI Q LPGESD D+ADFSSKILHLKGDR 
Sbjct  59   IMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPITQPLPGESDQDYADFSSKILHLKGDRK  118

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DF+FVK+SLAA+GFDVVYDINGREAVEVEPILDALP
Sbjct  119  DFEFVKTSLAAKGFDVVYDINGREAVEVEPILDALP  154



>gb|AFK44229.1| unknown [Medicago truncatula]
Length=378

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNGT+L  + +Q KRK WQPKG+L +SAS+ KKILIMGGTRFIG+FLSR LVKEGHQVT
Sbjct  23   DFNGTRLQ-THIQLKRKTWQPKGSLIVSASSTKKILIMGGTRFIGVFLSRQLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPI QQLPGESD+DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKAPITQQLPGESDTDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  142  AEEVEPILDALP  153



>ref|XP_010475766.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Camelina sativa]
Length=379

 Score =   221 bits (562),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG K+ +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFNGAKIHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPI+DALP
Sbjct  142  AEEVEPIIDALP  153



>ref|XP_010458216.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Camelina sativa]
Length=379

 Score =   220 bits (560),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV QPKG L +SAS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGGLYVSASSEKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPI+DALP
Sbjct  142  AEEVEPIIDALP  153



>ref|XP_006305088.1| hypothetical protein CARUB_v10009455mg [Capsella rubella]
 gb|EOA37986.1| hypothetical protein CARUB_v10009455mg [Capsella rubella]
Length=379

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKTPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPI++ALP
Sbjct  142  AEEVEPIIEALP  153



>ref|NP_172405.1| chloroplast stem-loop binding protein [Arabidopsis thaliana]
 sp|Q9SA52.1|CP41B_ARATH RecName: Full=Chloroplast stem-loop binding protein of 41 kDa 
b, chloroplastic; Short=CSP41-b; AltName: Full=Heteroglycan-interacting 
protein 1.3; AltName: Full=Protein CHLOROPLAST 
RNA BINDING; AltName: Full=Protein Gb5f; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG40395.1|AF325043_1 At1g09340 [Arabidopsis thaliana]
 gb|AAL16114.1|AF428282_1 At1g09340/T31J12_6 [Arabidopsis thaliana]
 gb|AAD18098.1| Identical to gb|Y10557 g5bf gene from Arabidopsis thaliana. ESTs 
gb|R30578, gb|R90475, gb|T22384, gb|T22425, gb|N64934 and 
gb|T46767 come from this gene [Arabidopsis thaliana]
 gb|AAK59555.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AAL47493.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AEE28431.1| chloroplast stem-loop binding protein [Arabidopsis thaliana]
Length=378

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSR+LVKEGHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGLFLSRILVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPIL+ALP
Sbjct  142  AEEVEPILEALP  153



>ref|XP_007031209.1| Chloroplast RNA binding [Theobroma cacao]
 gb|EOY11711.1| Chloroplast RNA binding [Theobroma cacao]
Length=379

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 132/155 (85%), Gaps = 3/155 (2%)
 Frame = +2

Query  83   VSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISA-SAKKILI  259
            +S + V Q  K  S+S LPSS SDF+GTKL     QYKRKVWQPKGAL ++A S KKIL+
Sbjct  1    MSKLVVFQPTKQPSISLLPSSLSDFSGTKLC--QFQYKRKVWQPKGALHVAAASTKKILV  58

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIGIFLSRLLVKEGHQVTLFTR KAPI QQLPGE DS+++DF SKILHLKGDR D
Sbjct  59   MGGTRFIGIFLSRLLVKEGHQVTLFTRGKAPITQQLPGEPDSEYSDFKSKILHLKGDRKD  118

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            F+FVKSSL+AEGFDVVYDINGREA EVEPILDALP
Sbjct  119  FEFVKSSLSAEGFDVVYDINGREADEVEPILDALP  153



>gb|AAM65150.1| putative RNA-binding protein [Arabidopsis thaliana]
Length=378

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSR+LVKEGHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGLFLSRILVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPIL+ALP
Sbjct  142  AEEVEPILEALP  153



>gb|AAL32648.1| g5bf protein [Arabidopsis thaliana]
Length=378

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSR+LVKEGHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGLFLSRILVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPIL+ALP
Sbjct  142  AEEVEPILEALP  153



>ref|XP_008777573.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Phoenix dactylifera]
Length=388

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            +FNGT L +S VQ KRKVWQPKGALQ+ AS AKKILIMGGTRFIG+FLSRLLVK+GHQVT
Sbjct  32   EFNGTALNIS-VQKKRKVWQPKGALQVKASSAKKILIMGGTRFIGVFLSRLLVKDGHQVT  90

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPI QQLPGESD ++A+FSSKILHLKGDR DF+FVK+SLA +GFDVVYDINGRE
Sbjct  91   LFTRGKAPITQQLPGESDQEYAEFSSKILHLKGDRQDFEFVKTSLADKGFDVVYDINGRE  150

Query  509  AVEVEPILDALP  544
            AVEVEPILDALP
Sbjct  151  AVEVEPILDALP  162



>emb|CAA71589.1| g5bf [Arabidopsis thaliana]
Length=378

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSR+LVKEGHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGLFLSRILVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPIL+ALP
Sbjct  142  AEEVEPILEALP  153



>ref|XP_002889743.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66002.1| catalytic/ coenzyme binding protein [Arabidopsis lyrata subsp. 
lyrata]
Length=378

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSRLLVK GHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALHVSASSEKKILIMGGTRFIGVFLSRLLVKGGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPI+DALP
Sbjct  142  AEEVEPIIDALP  153



>emb|CAA75602.1| putative RNA binding protein [Arabidopsis thaliana]
Length=374

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV QPKGAL +SAS+ KKILIMGGTRFIG+FLSR+LVKEGHQVT
Sbjct  19   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASSEKKILIMGGTRFIGLFLSRILVKEGHQVT  77

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K+PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  78   LFTRGKSPIAKQLPGESDQDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  137

Query  509  AVEVEPILDALP  544
            A EVEPIL+ALP
Sbjct  138  AEEVEPILEALP  149



>ref|XP_008442117.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Cucumis melo]
Length=383

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 119/132 (90%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-ILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG +L  + VQYKRKV QPKG L ++ASAKK ILIMGGTRFIGIFLSRLLVKEGHQVT
Sbjct  27   DFNGARLH-AQVQYKRKVMQPKGGLHVTASAKKNILIMGGTRFIGIFLSRLLVKEGHQVT  85

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAP+ QQLPGES++D+ADF SKILHLKGDR DFDFVKSSL+A GFDVVYDINGRE
Sbjct  86   LFTRGKAPVTQQLPGESEADYADFKSKILHLKGDRKDFDFVKSSLSAAGFDVVYDINGRE  145

Query  509  AVEVEPILDALP  544
            AVEVEPILDALP
Sbjct  146  AVEVEPILDALP  157



>gb|AFK36692.1| unknown [Medicago truncatula]
 gb|KEH24465.1| stem-loop-binding protein of 41 kDa protein B [Medicago truncatula]
Length=378

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG +L  + +Q KRK WQPKG+L +SAS+ KKILIMGGTRFIG+FLSR LVKEGHQVT
Sbjct  23   DFNGARLQ-THIQLKRKTWQPKGSLIVSASSTKKILIMGGTRFIGVFLSRQLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPI QQLPGESD+DFADFSSKILHLKGDR D+DFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKAPITQQLPGESDTDFADFSSKILHLKGDRKDYDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  142  AEEVEPILDALP  153



>ref|XP_002512541.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF49993.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=381

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 128/156 (82%), Gaps = 2/156 (1%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  256
            M  L+ + QQ +        S  SDFNGT+L  + +Q KR+VWQ KGALQ++AS+ K IL
Sbjct  1    MARLITIQQQTQPSFSLLTSSLSSDFNGTRLH-TQIQCKRRVWQAKGALQVTASSSKNIL  59

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI Q+LPGESD D+ADFSSK+LHLKGDR 
Sbjct  60   IMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPITQKLPGESDQDYADFSSKVLHLKGDRK  119

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DFDFVKSSL+A+GFDVVYDINGREA EV PILDALP
Sbjct  120  DFDFVKSSLSAKGFDVVYDINGREADEVAPILDALP  155



>ref|XP_010270866.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic isoform X2 [Nelumbo nucifera]
Length=381

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 129/151 (85%), Gaps = 2/151 (1%)
 Frame = +2

Query  98   VVQQPKslslsalpssrsDFNGTKLAVSSVQY-KRKVWQPKGALQISAS-AKKILIMGGT  271
            VV Q K  S S LPSS SDFNG +L+ SS+Q+ KRK WQ KGA Q+ AS AKKILIMGGT
Sbjct  5    VVVQQKQPSFSLLPSSLSDFNGVRLSNSSIQFSKRKEWQAKGAFQVKASSAKKILIMGGT  64

Query  272  RFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFV  451
            RFIG+FLSRLLVKEGHQVTLFTR K PI QQLPGESD D+ADFSSKILHLKGDR DF+FV
Sbjct  65   RFIGVFLSRLLVKEGHQVTLFTRGKTPITQQLPGESDQDYADFSSKILHLKGDRKDFEFV  124

Query  452  KSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            K+SLAAEGFDVVYDINGREA EVEPILD LP
Sbjct  125  KTSLAAEGFDVVYDINGREADEVEPILDGLP  155



>ref|XP_006433573.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
 gb|ESR46813.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
Length=305

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-ILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNGT++  S +QY+RKV QPK  LQI+AS++K ILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  24   DFNGTRIH-SQIQYRRKVLQPKVGLQITASSEKNILIMGGTRFIGVFLSRLLVKEGHQVT  82

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D+DFVKSSL+A+GFDVVYDINGRE
Sbjct  83   LFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKDYDFVKSSLSAKGFDVVYDINGRE  142

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  143  ADEVEPILDALP  154



>ref|XP_006382356.1| hypothetical protein POPTR_0005s01370g [Populus trichocarpa]
 gb|ERP60153.1| hypothetical protein POPTR_0005s01370g [Populus trichocarpa]
Length=380

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 129/156 (83%), Gaps = 3/156 (2%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKIL  256
            M  LVA+ QQ +      L S   DFNGT+L  S VQ KR+ WQ K ALQ+SAS+ K IL
Sbjct  1    MARLVAMQQQTQPSLSLLLSSLS-DFNGTRLH-SQVQCKRRAWQTKRALQVSASSSKNIL  58

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI QQLPGESD D+ADFSSK+LHLKGDR 
Sbjct  59   IMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDQDYADFSSKVLHLKGDRK  118

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            DF+FVK+SLAA+GFDV+YDINGREAVEVEPILDALP
Sbjct  119  DFEFVKTSLAAKGFDVIYDINGREAVEVEPILDALP  154



>gb|EPS69756.1| hypothetical protein M569_05003 [Genlisea aurea]
Length=379

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 124/133 (93%), Gaps = 3/133 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA--KKILIMGGTRFIGIFLSRLLVKEGHQV  325
            DFNG++L  +S+QYKR + QPKGA++++AS+  KKILIMGGTRFIGIFLSRLLVKEGHQV
Sbjct  23   DFNGSRL-TASIQYKRAMKQPKGAMRVTASSSSKKILIMGGTRFIGIFLSRLLVKEGHQV  81

Query  326  TLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGR  505
            TLFTR KAPI++QLPGESDSDFADF+SKILHLKGDR D++FVKSSL+AEGFDVVYDINGR
Sbjct  82   TLFTRGKAPISKQLPGESDSDFADFASKILHLKGDRQDYEFVKSSLSAEGFDVVYDINGR  141

Query  506  EAVEVEPILDALP  544
            EA EVEPILDALP
Sbjct  142  EAHEVEPILDALP  154



>ref|XP_010549317.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Tarenaya hassleriana]
Length=379

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRK ++PKGAL +SAS AKKILIMGGTRFIG+FLSRLL+K+GHQVT
Sbjct  23   DFNGAKLNLR-VQYKRKAYKPKGALHVSASSAKKILIMGGTRFIGVFLSRLLMKDGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K PIA+QLPGESD DFADFSSKILHLKGDR D+DFVKSSLAAEGFDVVYDINGRE
Sbjct  82   LFTRGKVPIAKQLPGESDEDFADFSSKILHLKGDRKDYDFVKSSLAAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EV P+LDALP
Sbjct  142  AEEVAPLLDALP  153



>ref|XP_010270864.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic isoform X1 [Nelumbo nucifera]
Length=382

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = +2

Query  98   VVQQPKslslsalpssrsDFNGTKLAVSSVQY--KRKVWQPKGALQISAS-AKKILIMGG  268
            VV Q K  S S LPSS SDFNG +L+ SS+Q   KRK WQ KGA Q+ AS AKKILIMGG
Sbjct  5    VVVQQKQPSFSLLPSSLSDFNGVRLSNSSIQQFSKRKEWQAKGAFQVKASSAKKILIMGG  64

Query  269  TRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDF  448
            TRFIG+FLSRLLVKEGHQVTLFTR K PI QQLPGESD D+ADFSSKILHLKGDR DF+F
Sbjct  65   TRFIGVFLSRLLVKEGHQVTLFTRGKTPITQQLPGESDQDYADFSSKILHLKGDRKDFEF  124

Query  449  VKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            VK+SLAAEGFDVVYDINGREA EVEPILD LP
Sbjct  125  VKTSLAAEGFDVVYDINGREADEVEPILDGLP  156



>gb|EYU38405.1| hypothetical protein MIMGU_mgv1a008259mg [Erythranthe guttata]
Length=379

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 122/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DF+G +L  +SVQYKRKVWQ K AL ++AS+ KKILIMGGTRFIG+FLSRLLVKEGH+VT
Sbjct  23   DFSGARL-TASVQYKRKVWQSKSALSVTASSEKKILIMGGTRFIGLFLSRLLVKEGHKVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPIAQQLPGESD++F+D++SKILHLKGDR DF+FVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKAPIAQQLPGESDTEFSDYASKILHLKGDRKDFEFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  142  ADEVEPILDALP  153



>ref|XP_006472242.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Citrus sinensis]
Length=380

 Score =   216 bits (549),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 134/156 (86%), Gaps = 3/156 (2%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-IL  256
            M S+V VVQ     S S L SS SDFNGT++  S +QY+RKV QPK  LQ++AS++K IL
Sbjct  1    MASMV-VVQHQTQPSFSTLTSSLSDFNGTRIH-SQIQYRRKVLQPKVGLQVTASSEKNIL  58

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            IMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR 
Sbjct  59   IMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPIAQQLPGESDEEFAEFSSKILHLKGDRK  118

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            D+DFVKSSL+A+GFDVVYDINGREA EVEPILDALP
Sbjct  119  DYDFVKSSLSAKGFDVVYDINGREADEVEPILDALP  154



>ref|XP_007163307.1| hypothetical protein PHAVU_001G223800g [Phaseolus vulgaris]
 gb|ESW35301.1| hypothetical protein PHAVU_001G223800g [Phaseolus vulgaris]
Length=378

 Score =   216 bits (549),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 120/132 (91%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DF+GT+L  + +Q KRK+WQPKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFSGTRLP-TQLQLKRKLWQPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR K P+ QQLPGESDSD+ADFSSKILHLKGDR DF+FVKSSL+AEGF+VVYDINGRE
Sbjct  82   LFTRGKTPVTQQLPGESDSDYADFSSKILHLKGDRKDFEFVKSSLSAEGFEVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  142  ADEVEPILDALP  153



>ref|XP_009412145.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=385

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 120/132 (91%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            +F+G  L++S +Q +R+ WQPKGALQ++AS AKKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  29   EFSGAALSIS-LQKRRRTWQPKGALQVTASGAKKILIMGGTRFIGVFLSRLLVKEGHQVT  87

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPI QQLPGESD D+ DF SKILHLKGDR DF+FVK+SLAA+GFDV+YDINGRE
Sbjct  88   LFTRGKAPITQQLPGESDQDYEDFKSKILHLKGDRKDFEFVKTSLAAKGFDVIYDINGRE  147

Query  509  AVEVEPILDALP  544
            AVEVEPILDALP
Sbjct  148  AVEVEPILDALP  159



>ref|XP_004146391.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004156003.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Cucumis sativus]
 gb|KGN54798.1| hypothetical protein Csa_4G500330 [Cucumis sativus]
Length=383

 Score =   215 bits (548),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-ILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG +L  + VQYKRKV QPKG L ++ASAKK ILIMGGTRFIGIFLSRLLVKEGHQVT
Sbjct  27   DFNGARLH-AQVQYKRKVMQPKGGLHVTASAKKNILIMGGTRFIGIFLSRLLVKEGHQVT  85

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAP+ QQLPGES++D+ADF SKILHLKGDR DFDFVKSSL+A GFDVVYDINGRE
Sbjct  86   LFTRGKAPVTQQLPGESEADYADFKSKILHLKGDRKDFDFVKSSLSAAGFDVVYDINGRE  145

Query  509  AVEVEPILDALP  544
            A EVEPI+DALP
Sbjct  146  ADEVEPIIDALP  157



>ref|XP_006433571.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
 gb|ESR46811.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
Length=380

 Score =   215 bits (548),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-ILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNGT++  S +QY+RKV QPK  LQI+AS++K ILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  24   DFNGTRIH-SQIQYRRKVLQPKVGLQITASSEKNILIMGGTRFIGVFLSRLLVKEGHQVT  82

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D+DFVKSSL+A+GFDVVYDINGRE
Sbjct  83   LFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKDYDFVKSSLSAKGFDVVYDINGRE  142

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  143  ADEVEPILDALP  154



>ref|NP_001242018.1| uncharacterized protein LOC100791076 [Glycine max]
 gb|ACU24022.1| unknown [Glycine max]
Length=378

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DF+GT+L  + +Q+KRK   PKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFSGTRLQ-TQLQFKRKQCHPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAP+ QQLPGESDSD+ADFSSKILHLKGDR DFDFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKAPVTQQLPGESDSDYADFSSKILHLKGDRKDFDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  142  ADEVEPILDALP  153



>gb|KHN03920.1| Hypothetical protein glysoja_022606 [Glycine soja]
Length=378

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DF+GT+L  + +Q+KRK   PKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFSGTRLQ-TQLQFKRKQCHPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAP+ QQLPGESDSD+ADFSSKILHLKGDR DFDFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKAPVTQQLPGESDSDYADFSSKILHLKGDRKDFDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  142  ADEVEPILDALP  153



>ref|XP_006433572.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
 gb|ESR46812.1| hypothetical protein CICLE_v10001494mg [Citrus clementina]
Length=381

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKK-ILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNGT++     QY+RKV QPK  LQI+AS++K ILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  24   DFNGTRIHSQIQQYRRKVLQPKVGLQITASSEKNILIMGGTRFIGVFLSRLLVKEGHQVT  83

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D+DFVKSSL+A+GFDVVYDINGRE
Sbjct  84   LFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKDYDFVKSSLSAKGFDVVYDINGRE  143

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  144  ADEVEPILDALP  155



>gb|KHN43352.1| Hypothetical protein glysoja_001935 [Glycine soja]
Length=378

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 120/132 (91%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DF+GT+L  + +Q+KRK+  PKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFSGTRLQ-TQLQFKRKLCHPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAP+ QQLPGESD+D+ADFSSKILHLKGDR DFDFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKAPVTQQLPGESDNDYADFSSKILHLKGDRKDFDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  142  ADEVEPILDALP  153



>ref|XP_006604786.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X2 [Glycine max]
Length=376

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 120/132 (91%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DF+GT+L  + +Q+KRK+  PKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFSGTRLQ-TQLQFKRKLCHPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAP+ QQLPGESD+D+ADFSSKILHLKGDR DFDFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKAPVTQQLPGESDNDYADFSSKILHLKGDRKDFDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  142  ADEVEPILDALP  153



>ref|XP_003554610.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X1 [Glycine max]
Length=378

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 120/132 (91%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DF+GT+L  + +Q+KRK+  PKG+  +SAS+ KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFSGTRLQ-TQLQFKRKLCHPKGSFYVSASSTKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAP+ QQLPGESD+D+ADFSSKILHLKGDR DFDFVKSSL+AEGFDVVYDINGRE
Sbjct  82   LFTRGKAPVTQQLPGESDNDYADFSSKILHLKGDRKDFDFVKSSLSAEGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPILDALP
Sbjct  142  ADEVEPILDALP  153



>ref|XP_004494526.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Cicer arietinum]
Length=378

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DF GT+   + +Q KRK WQPKG+  +SAS  KK+LIMGGTRFIG+FLSRLLVK+GHQVT
Sbjct  23   DFTGTRFQ-THIQLKRKTWQPKGSFYVSASTNKKVLIMGGTRFIGVFLSRLLVKQGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPI QQLPGESD+DFADFSSKILHLKGDR D+DFVKSSL+A+GFDVVYDINGRE
Sbjct  82   LFTRGKAPITQQLPGESDTDFADFSSKILHLKGDRKDYDFVKSSLSAQGFDVVYDINGRE  141

Query  509  AVEVEPILDALP  544
            A EVEPI+DALP
Sbjct  142  AEEVEPIIDALP  153



>ref|XP_010941507.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic isoform X1 [Elaeis guineensis]
Length=388

 Score =   213 bits (542),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%), Gaps = 2/129 (2%)
 Frame = +2

Query  161  GTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKEGHQVTLFT  337
            GT + +S +Q KRKVWQPKGAL + AS AKKILIMGGTRFIG+FLSRLLVK+GHQVTLFT
Sbjct  35   GTAVNIS-IQKKRKVWQPKGALHVKASSAKKILIMGGTRFIGVFLSRLLVKDGHQVTLFT  93

Query  338  R*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVE  517
            R KAPI+QQLPGESD ++A+FSSKILHLKGDR DF+FVK+SLAA GFDVVYDINGREAVE
Sbjct  94   RGKAPISQQLPGESDQEYAEFSSKILHLKGDRKDFEFVKTSLAANGFDVVYDINGREAVE  153

Query  518  VEPILDALP  544
            VEPILDALP
Sbjct  154  VEPILDALP  162



>ref|XP_009337636.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X3 [Pyrus x bretschneideri]
Length=383

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 130/158 (82%), Gaps = 3/158 (2%)
 Frame = +2

Query  80   MVSLVAVV-QQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKK  250
            M  LVAV  QQ  S      PSS SDFNGTKL  S +Q KR+  QP+G ALQ+SAS AKK
Sbjct  1    MARLVAVQPQQRNSSFSLLPPSSLSDFNGTKLLHSQLQCKRRASQPRGGALQVSASSAKK  60

Query  251  ILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGD  430
            ILIMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI QQLPGESD+D+ DF+SKILHLKGD
Sbjct  61   ILIMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDADYTDFTSKILHLKGD  120

Query  431  RMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            R D+DFVKSSL+AEG+DVVYDINGREA EV PI++ LP
Sbjct  121  RKDYDFVKSSLSAEGYDVVYDINGREAEEVVPIIEGLP  158



>ref|XP_008246177.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic isoform X1 [Prunus mume]
Length=383

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = +2

Query  80   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKI  253
            M  LVAV  QQ         PSS SDFNGT+L  S +Q KR+V QPK ALQ++AS AKKI
Sbjct  1    MARLVAVQPQQRHPSFSLLPPSSLSDFNGTRLLHSQLQCKRRVSQPKVALQVTASSAKKI  60

Query  254  LIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDR  433
            LIMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI QQLPGESD D+ DF+SKILHLKGDR
Sbjct  61   LIMGGTRFIGLFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDKDYTDFASKILHLKGDR  120

Query  434  MDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
             D++FVKSSL+AEGFDVVYDINGREA EV PIL+ LP
Sbjct  121  KDYEFVKSSLSAEGFDVVYDINGREAEEVVPILEGLP  157



>ref|XP_008370362.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Malus domestica]
Length=383

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 129/158 (82%), Gaps = 3/158 (2%)
 Frame = +2

Query  80   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKK  250
            M  LVAV  QQ         PSS SDFNGTKL  S +Q KR+  QP+G ALQ+SAS AKK
Sbjct  1    MARLVAVQPQQRNPSFSLLPPSSLSDFNGTKLLHSQLQCKRRASQPRGXALQVSASSAKK  60

Query  251  ILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGD  430
            ILIMGGTRFIGIFLSRLLVKEGHQVTLFTR KAPI QQLPGESD+D+ DF+SKILHLKGD
Sbjct  61   ILIMGGTRFIGIFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDADYTDFASKILHLKGD  120

Query  431  RMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            R D+DFVKSSL+AEG+DVVYDINGREA EV PI++ LP
Sbjct  121  RKDYDFVKSSLSAEGYDVVYDINGREAEEVVPIIEGLP  158



>ref|XP_007207335.1| hypothetical protein PRUPE_ppa007071mg [Prunus persica]
 gb|EMJ08534.1| hypothetical protein PRUPE_ppa007071mg [Prunus persica]
Length=383

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = +2

Query  80   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKI  253
            M  LVAV  QQ         PSS SDFNGT+L  S +Q KR+V QPK ALQ++AS AKKI
Sbjct  1    MARLVAVQPQQRHPSFSLLPPSSLSDFNGTRLLHSQLQCKRRVSQPKVALQVTASSAKKI  60

Query  254  LIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDR  433
            LIMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI QQLPGESD D+ DF+SKILHLKGDR
Sbjct  61   LIMGGTRFIGLFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDKDYTDFASKILHLKGDR  120

Query  434  MDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
             D++FVKSSL+AEGFDVVYDINGREA EV PIL+ LP
Sbjct  121  KDYEFVKSSLSAEGFDVVYDINGREAEEVVPILEGLP  157



>ref|XP_002281395.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Vitis vinifera]
 emb|CAN73432.1| hypothetical protein VITISV_032681 [Vitis vinifera]
 emb|CBI39625.3| unnamed protein product [Vitis vinifera]
Length=378

 Score =   211 bits (537),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = +2

Query  98   VVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTR  274
            VVQ     S S LPSS SDFNG +L  + +Q +RKV QPKGAL ++AS  KKIL+MGGTR
Sbjct  5    VVQHQNQPSFSLLPSSLSDFNGIRL-TNHIQCRRKVCQPKGALHVTASGEKKILMMGGTR  63

Query  275  FIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVK  454
            FIG+FL+RLLVKEGHQVTLFTR KA I QQLPGESD D+A+FSSK+LHLKGDR DF+FVK
Sbjct  64   FIGVFLARLLVKEGHQVTLFTRGKAAITQQLPGESDKDYAEFSSKVLHLKGDRKDFEFVK  123

Query  455  SSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +SLAAEGFDVVYDINGREAVE+EPILDALP
Sbjct  124  TSLAAEGFDVVYDINGREAVEIEPILDALP  153



>gb|AFK37744.1| unknown [Lotus japonicus]
Length=377

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 116/131 (89%), Gaps = 1/131 (1%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKKILIMGGTRFIGIFLSRLLVKEGHQVTL  331
            DF+GT+L  + +Q++RK WQPKG    ++S KKILIMGGTRFIG+FLSRLLVKEGHQVTL
Sbjct  23   DFSGTRLQ-TQIQFRRKAWQPKGFHVSASSTKKILIMGGTRFIGVFLSRLLVKEGHQVTL  81

Query  332  FTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREA  511
            FTR KAPI QQLPGESD DF+DFSSKI HLKGDR D+DFVKSSL+AEGFDVVYDINGREA
Sbjct  82   FTRGKAPITQQLPGESDGDFSDFSSKIKHLKGDRKDYDFVKSSLSAEGFDVVYDINGREA  141

Query  512  VEVEPILDALP  544
             EVEPI++ALP
Sbjct  142  EEVEPIIEALP  152



>ref|XP_010092951.1| hypothetical protein L484_018888 [Morus notabilis]
 gb|EXB53004.1| hypothetical protein L484_018888 [Morus notabilis]
Length=380

 Score =   210 bits (535),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +2

Query  98   VVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTR  274
            VVQQ     LS LPSS SDFNGTKL  + VQ+K++  QPKGALQ++AS+ KKILIMGGTR
Sbjct  6    VVQQQHKTPLSLLPSSLSDFNGTKLH-AQVQFKKRDSQPKGALQVTASSTKKILIMGGTR  64

Query  275  FIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVK  454
            FIG+FLSRLLVKEGHQVTLFTR KAPI+QQLPGESD+D+ DFSSKILHLKGDR D D VK
Sbjct  65   FIGVFLSRLLVKEGHQVTLFTRGKAPISQQLPGESDADYTDFSSKILHLKGDRKDSDVVK  124

Query  455  SSLAAEGFDVVYDINGREAVEVEPILDALP  544
            S L+AEGFDVVYDINGREA EV PILDALP
Sbjct  125  SGLSAEGFDVVYDINGREADEVAPILDALP  154



>ref|XP_008350588.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Malus domestica]
Length=383

 Score =   210 bits (535),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 129/158 (82%), Gaps = 3/158 (2%)
 Frame = +2

Query  80   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKK  250
            M  LVAV  QQ         PSS SDFNGTKL  S +Q KR+  QP+G ALQ+SAS AKK
Sbjct  1    MARLVAVQPQQRNPSFSLLPPSSLSDFNGTKLLHSQLQCKRRASQPRGGALQVSASSAKK  60

Query  251  ILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGD  430
            ILIMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI QQLPGESD+D+ DF+SKILHLKGD
Sbjct  61   ILIMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDADYTDFASKILHLKGD  120

Query  431  RMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            R D+DFVKSSL+AEG+DVVYDINGREA EV PI++ LP
Sbjct  121  RRDYDFVKSSLSAEGYDVVYDINGREAEEVVPIIEGLP  158



>ref|XP_009337637.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X4 [Pyrus x bretschneideri]
Length=381

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 132/157 (84%), Gaps = 3/157 (2%)
 Frame = +2

Query  80   MVSLVAVVQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKKI  253
            M  LV VVQQ +  SLS LPSS S FNGT+L    +Q KR+  QP+G ALQ+SAS AKKI
Sbjct  1    MARLV-VVQQQRQPSLSPLPSSFSHFNGTRLHTPQLQCKRRASQPRGGALQVSASSAKKI  59

Query  254  LIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDR  433
            LIMGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI QQLPGESD+D+ DF+SKILHLKGDR
Sbjct  60   LIMGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDADYTDFTSKILHLKGDR  119

Query  434  MDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
             D+DFVKSSL+AEG+DVVYDINGREA EV PI++ LP
Sbjct  120  KDYDFVKSSLSAEGYDVVYDINGREAEEVVPIIEGLP  156



>ref|XP_006664006.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Oryza brachyantha]
Length=376

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 121/134 (90%), Gaps = 4/134 (3%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKEGHQ  322
            DF+G  L++SS Q +R+ WQP+GA +Q++A+A  K IL+MGGTRFIG+FLSRLLVKEGHQ
Sbjct  19   DFSGAALSISS-QTRRRSWQPRGARMQVAAAADSKNILVMGGTRFIGVFLSRLLVKEGHQ  77

Query  323  VTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDING  502
            VTLFTR KAPI QQLPGESD+++A+FSSK+LHLKGDR DFDFVK+SLAA+GFDVVYDING
Sbjct  78   VTLFTRGKAPITQQLPGESDAEYAEFSSKVLHLKGDRQDFDFVKTSLAAKGFDVVYDING  137

Query  503  REAVEVEPILDALP  544
            REAVEV PILDALP
Sbjct  138  REAVEVAPILDALP  151



>ref|XP_009373315.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Pyrus x bretschneideri]
Length=383

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 128/158 (81%), Gaps = 3/158 (2%)
 Frame = +2

Query  80   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKK  250
            M  LVAV  QQ         PSS SDFNGTKL    +Q KR+  QP+G ALQ+SAS AKK
Sbjct  1    MARLVAVQTQQRNPSFSLLPPSSLSDFNGTKLLHFQLQCKRRASQPRGGALQVSASSAKK  60

Query  251  ILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGD  430
            ILIMGGTRFIG+FLSRLLVK+GHQVTLFTR KAPI QQLPGESD+D+ DF+SKILHLKGD
Sbjct  61   ILIMGGTRFIGVFLSRLLVKDGHQVTLFTRGKAPITQQLPGESDADYTDFASKILHLKGD  120

Query  431  RMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            R D+DFVKSSL+AEG+DVVYDINGREA EV PI++ LP
Sbjct  121  RKDYDFVKSSLSAEGYDVVYDINGREAEEVVPIIEGLP  158



>ref|XP_009335504.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Pyrus x bretschneideri]
Length=383

 Score =   207 bits (528),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 128/158 (81%), Gaps = 3/158 (2%)
 Frame = +2

Query  80   MVSLVAV-VQQPKslslsalpssrsDFNGTKLAVSSVQYKRKVWQPKG-ALQISAS-AKK  250
            M  LVAV  QQ         PSS SDFNGTKL    +Q KR+  QP+G ALQ+SAS AKK
Sbjct  1    MARLVAVQTQQRNPSFSLLPPSSLSDFNGTKLLHFQLQCKRRASQPRGGALQVSASSAKK  60

Query  251  ILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGD  430
            ILIMGGTRFIG+FLSRLLVK+GHQVTLFTR KAPI QQLPGESD+D+ DF+SKILHLKGD
Sbjct  61   ILIMGGTRFIGVFLSRLLVKDGHQVTLFTRGKAPITQQLPGESDADYTDFASKILHLKGD  120

Query  431  RMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            R D+DFVKSSL+AEG+DVVYDINGREA EV PI++ LP
Sbjct  121  RKDYDFVKSSLSAEGYDVVYDINGREAEEVVPIIEGLP  158



>ref|XP_008246198.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic isoform X4 [Prunus mume]
Length=382

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNGT+L  + +Q KR+V QPK ALQ++AS AKKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  26   DFNGTRLH-TQLQCKRRVSQPKVALQVTASSAKKILIMGGTRFIGLFLSRLLVKEGHQVT  84

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGRE  508
            LFTR KAPI QQLPGESD D+ DF+SKILHLKGDR D++FVKSSL+AEGFDVVYDINGRE
Sbjct  85   LFTRGKAPITQQLPGESDKDYTDFASKILHLKGDRKDYEFVKSSLSAEGFDVVYDINGRE  144

Query  509  AVEVEPILDALP  544
            A EV PIL+ LP
Sbjct  145  AEEVVPILEGLP  156



>gb|EEC69165.1| hypothetical protein OsI_38123 [Oryza sativa Indica Group]
Length=373

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 120/134 (90%), Gaps = 4/134 (3%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKEGHQ  322
            DF+   L++S+ Q +R+ WQP+GA +Q++A+A  K IL+MGGTRFIG+FLSRLLVKEGHQ
Sbjct  19   DFSSAALSIST-QARRRSWQPRGARMQVAAAADSKNILVMGGTRFIGVFLSRLLVKEGHQ  77

Query  323  VTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDING  502
            VTLFTR KAPI QQLPGESD+++A+FSSK+LHLKGDR DFDFVK+SLAA+GFDVVYDING
Sbjct  78   VTLFTRGKAPITQQLPGESDAEYAEFSSKVLHLKGDRQDFDFVKTSLAAKGFDVVYDING  137

Query  503  REAVEVEPILDALP  544
            REAVEV PILDALP
Sbjct  138  REAVEVAPILDALP  151



>ref|NP_001066657.1| Os12g0420200 [Oryza sativa Japonica Group]
 gb|ABA97622.2| RNA binding protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29676.1| Os12g0420200 [Oryza sativa Japonica Group]
 gb|EEE53110.1| hypothetical protein OsJ_35887 [Oryza sativa Japonica Group]
Length=376

 Score =   205 bits (521),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 120/134 (90%), Gaps = 4/134 (3%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKEGHQ  322
            DF+   L++S+ Q +R+ WQP+GA +Q++A+A  K IL+MGGTRFIG+FLSRLLVKEGHQ
Sbjct  19   DFSSAALSIST-QARRRSWQPRGARMQVAAAADSKNILVMGGTRFIGVFLSRLLVKEGHQ  77

Query  323  VTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDING  502
            VTLFTR KAPI QQLPGESD+++A+FSSK+LHLKGDR DFDFVK+SLAA+GFDVVYDING
Sbjct  78   VTLFTRGKAPITQQLPGESDAEYAEFSSKVLHLKGDRQDFDFVKTSLAAKGFDVVYDING  137

Query  503  REAVEVEPILDALP  544
            REAVEV PILDALP
Sbjct  138  REAVEVAPILDALP  151



>ref|XP_004962574.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Setaria italica]
Length=376

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 122/134 (91%), Gaps = 4/134 (3%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKEGHQ  322
            DF+G  ++VS+ Q +R+ WQP+GA +Q+SA+A  K IL+MGGTRFIG+FLSRLLVKEGHQ
Sbjct  19   DFSGAAVSVST-QKRRRSWQPRGARIQVSAAADSKNILVMGGTRFIGVFLSRLLVKEGHQ  77

Query  323  VTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDING  502
            VTLFTR KAPI QQLPGESD+++A+FSSKI HLKGDRMDF+FVK+SLAA+G++VVYDING
Sbjct  78   VTLFTRGKAPITQQLPGESDAEYAEFSSKIQHLKGDRMDFEFVKTSLAAKGYNVVYDING  137

Query  503  REAVEVEPILDALP  544
            REAVEVEPI++ALP
Sbjct  138  REAVEVEPIIEALP  151



>ref|XP_010237291.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic [Brachypodium distachyon]
Length=378

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 120/134 (90%), Gaps = 4/134 (3%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKEGHQ  322
            DF+G  L++S+ Q +R+ WQP+GA +Q++A+A  K IL+MGGTRFIG+F+SRLLVKEGHQ
Sbjct  21   DFSGAALSMST-QNRRRSWQPRGARMQVAAAADSKNILVMGGTRFIGVFMSRLLVKEGHQ  79

Query  323  VTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDING  502
            VTLFTR KAP+ QQLPGESD+++A+FSSK+LHLKGDR DFDFVK++L+A+GFDVVYDING
Sbjct  80   VTLFTRGKAPVTQQLPGESDAEYAEFSSKVLHLKGDRQDFDFVKTNLSAKGFDVVYDING  139

Query  503  REAVEVEPILDALP  544
            REA EV PIL+ALP
Sbjct  140  REATEVAPILEALP  153



>ref|XP_002442964.1| hypothetical protein SORBIDRAFT_08g005500 [Sorghum bicolor]
 gb|EES16802.1| hypothetical protein SORBIDRAFT_08g005500 [Sorghum bicolor]
Length=384

 Score =   200 bits (508),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 120/137 (88%), Gaps = 6/137 (4%)
 Frame = +2

Query  152  DFNGTKLAVS-SVQYKRKVWQPKGA-LQISASA----KKILIMGGTRFIGIFLSRLLVKE  313
            DF+G  +++S S Q +R  WQP+GA +Q+SA+A    K IL+MGGTRFIG+FLSR+LVKE
Sbjct  19   DFSGAAVSISVSAQKRRSSWQPRGARVQVSAAAAADSKNILVMGGTRFIGVFLSRILVKE  78

Query  314  GHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYD  493
            GHQVTLFTR KAPI QQLPGESD+++A+FSSK+ HLKGDR DF+FVK+SLAA+G+DVVYD
Sbjct  79   GHQVTLFTRGKAPITQQLPGESDAEYAEFSSKVQHLKGDRQDFEFVKTSLAAKGYDVVYD  138

Query  494  INGREAVEVEPILDALP  544
            INGREAV+VEPI+DALP
Sbjct  139  INGREAVQVEPIIDALP  155



>dbj|BAK05017.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 118/134 (88%), Gaps = 4/134 (3%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKEGHQ  322
            DF G  +++S+ Q +R+ WQP+GA +Q++A+A  K ILIMGGTRFIG+FLSR LV+EGHQ
Sbjct  12   DFGGAAISISA-QNRRRSWQPRGARMQVAAAADSKNILIMGGTRFIGLFLSRKLVQEGHQ  70

Query  323  VTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDING  502
            VTLFTR KAPI QQLPGESD+++A+FSSK+LHLKGDR DFDFVK+SL+A+GF+VVYDING
Sbjct  71   VTLFTRGKAPITQQLPGESDAEYAEFSSKVLHLKGDRKDFDFVKTSLSAKGFNVVYDING  130

Query  503  REAVEVEPILDALP  544
            REA EV PIL+ALP
Sbjct  131  REATEVSPILEALP  144



>ref|XP_010489928.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like [Camelina sativa]
Length=367

 Score =   194 bits (493),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 106/119 (89%), Gaps = 2/119 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNG KL +  VQYKRKV QPKGAL +SAS  KKILIMGGTRFIG+FLSRLLVKEGHQVT
Sbjct  23   DFNGAKLHLQ-VQYKRKVHQPKGALYVSASTEKKILIMGGTRFIGVFLSRLLVKEGHQVT  81

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGR  505
            LFTR K+PIA+QLPGESD DFADFSSKI HLKGDR D+DFVKSSL+AEGFDVVYDING 
Sbjct  82   LFTRGKSPIAKQLPGESDQDFADFSSKIHHLKGDRKDYDFVKSSLSAEGFDVVYDINGN  140



>ref|XP_008648443.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X1 [Zea mays]
 ref|XP_008658099.1| PREDICTED: uncharacterized protein LOC100193292 isoform X1 [Zea 
mays]
 gb|AFW74489.1| hypothetical protein ZEAMMB73_436145 [Zea mays]
 gb|AFW86811.1| hypothetical protein ZEAMMB73_149219 [Zea mays]
Length=375

 Score =   192 bits (487),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKKILIMGGTRFIGIFLSRLLVKEGHQVTL  331
            DF+G   AVS    KR+    +  +  +A +K IL+MGGTRFIG+FLSRLLVKEGHQVTL
Sbjct  19   DFSGAAAAVSISTQKRRSRGARVQVSAAADSKNILVMGGTRFIGVFLSRLLVKEGHQVTL  78

Query  332  FTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREA  511
            FTR KAPI QQLPGESD+++ADFSSK+LHLKGDR DF+FVK+SLAA G+DVVYDINGREA
Sbjct  79   FTRGKAPITQQLPGESDAEYADFSSKVLHLKGDRQDFEFVKTSLAANGYDVVYDINGREA  138

Query  512  VEVEPILDALP  544
            V+VEPI++ALP
Sbjct  139  VQVEPIIEALP  149



>ref|NP_001131905.1| uncharacterized protein LOC100193292 [Zea mays]
 ref|XP_008648444.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X2 [Zea mays]
 gb|ACF80521.1| unknown [Zea mays]
 gb|AFW74488.1| hypothetical protein ZEAMMB73_436145 [Zea mays]
 gb|AFW86812.1| hypothetical protein ZEAMMB73_149219 [Zea mays]
Length=374

 Score =   192 bits (487),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKKILIMGGTRFIGIFLSRLLVKEGHQVTL  331
            DF+G   AVS    KR+    +  +  +A +K IL+MGGTRFIG+FLSRLLVKEGHQVTL
Sbjct  19   DFSGAAAAVSISTQKRRSRGARVQVSAAADSKNILVMGGTRFIGVFLSRLLVKEGHQVTL  78

Query  332  FTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREA  511
            FTR KAPI QQLPGESD+++ADFSSK+LHLKGDR DF+FVK+SLAA G+DVVYDINGREA
Sbjct  79   FTRGKAPITQQLPGESDAEYADFSSKVLHLKGDRQDFEFVKTSLAANGYDVVYDINGREA  138

Query  512  VEVEPILDALP  544
            V+VEPI++ALP
Sbjct  139  VQVEPIIEALP  149



>gb|EMT28966.1| hypothetical protein F775_32001 [Aegilops tauschii]
Length=903

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 118/134 (88%), Gaps = 4/134 (3%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGA-LQISASA--KKILIMGGTRFIGIFLSRLLVKEGHQ  322
            DF G  +++S+ Q +R+ WQP+GA +Q++A+A  K ILIMGGTRFIG+FLSR LV+EGHQ
Sbjct  87   DFGGAAISISA-QNRRRSWQPRGARMQVAAAADSKNILIMGGTRFIGLFLSRKLVQEGHQ  145

Query  323  VTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDING  502
            VTLFTR KAPI QQLPGESD+++A+FSSK+LHLKGDR DFDFVK+SL+A+GF+VVYDING
Sbjct  146  VTLFTRGKAPITQQLPGESDAEYAEFSSKVLHLKGDRKDFDFVKTSLSAKGFNVVYDING  205

Query  503  REAVEVEPILDALP  544
            REA EV PIL+ALP
Sbjct  206  REATEVSPILEALP  219



>gb|AFK48065.1| unknown [Lotus japonicus]
Length=377

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISASAKKILIMGGTRFIGIFLSRLLVKEGHQVTL  331
            DF+GT+L  + +Q++RK WQPKG    ++S KKILIMGGTRFIG+FLSRLLVKEGHQVTL
Sbjct  23   DFSGTRLQ-TQIQFRRKAWQPKGFHVSASSTKKILIMGGTRFIGVFLSRLLVKEGHQVTL  81

Query  332  FTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREA  511
            FTR KAPI QQLPGESDSDF+DFSSKI HLKGDR D+DFVKSSL+AEGFDVVYDINGREA
Sbjct  82   FTRGKAPITQQLPGESDSDFSDFSSKIKHLKGDRKDYDFVKSSLSAEGFDVVYDINGREA  141

Query  512  VEVEPILDALP  544
             EVEPI++ALP
Sbjct  142  EEVEPIIEALP  152



>gb|KDO81612.1| hypothetical protein CISIN_1g020797mg [Citrus sinensis]
Length=197

 Score =   177 bits (448),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIG+FLSRLLVKEGHQVTLFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D
Sbjct  1    MGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKD  60

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +DFVKSSL+A+GFDVVYDINGREA EVEPILDALP
Sbjct  61   YDFVKSSLSAKGFDVVYDINGREADEVEPILDALP  95



>gb|KDO81609.1| hypothetical protein CISIN_1g020797mg [Citrus sinensis]
Length=246

 Score =   177 bits (450),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIG+FLSRLLVKEGHQVTLFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D
Sbjct  1    MGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKD  60

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +DFVKSSL+A+GFDVVYDINGREA EVEPILDALP
Sbjct  61   YDFVKSSLSAKGFDVVYDINGREADEVEPILDALP  95



>gb|KDO81607.1| hypothetical protein CISIN_1g020797mg [Citrus sinensis]
Length=265

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIG+FLSRLLVKEGHQVTLFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D
Sbjct  1    MGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKD  60

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +DFVKSSL+A+GFDVVYDINGREA EVEPILDALP
Sbjct  61   YDFVKSSLSAKGFDVVYDINGREADEVEPILDALP  95



>gb|KDO81610.1| hypothetical protein CISIN_1g020797mg [Citrus sinensis]
 gb|KDO81611.1| hypothetical protein CISIN_1g020797mg [Citrus sinensis]
Length=249

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIG+FLSRLLVKEGHQVTLFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D
Sbjct  1    MGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKD  60

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +DFVKSSL+A+GFDVVYDINGREA EVEPILDALP
Sbjct  61   YDFVKSSLSAKGFDVVYDINGREADEVEPILDALP  95



>gb|KDO81606.1| hypothetical protein CISIN_1g020797mg [Citrus sinensis]
Length=295

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIG+FLSRLLVKEGHQVTLFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D
Sbjct  1    MGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKD  60

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +DFVKSSL+A+GFDVVYDINGREA EVEPILDALP
Sbjct  61   YDFVKSSLSAKGFDVVYDINGREADEVEPILDALP  95



>gb|KDO81608.1| hypothetical protein CISIN_1g020797mg [Citrus sinensis]
Length=287

 Score =   177 bits (449),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIG+FLSRLLVKEGHQVTLFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D
Sbjct  1    MGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKD  60

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +DFVKSSL+A+GFDVVYDINGREA EVEPILDALP
Sbjct  61   YDFVKSSLSAKGFDVVYDINGREADEVEPILDALP  95



>gb|KDO81605.1| hypothetical protein CISIN_1g020797mg [Citrus sinensis]
Length=287

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIG+FLSRLLVKEGHQVTLFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D
Sbjct  1    MGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKD  60

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +DFVKSSL+A+GFDVVYDINGREA EVEPILDALP
Sbjct  61   YDFVKSSLSAKGFDVVYDINGREADEVEPILDALP  95



>gb|KDO81603.1| hypothetical protein CISIN_1g020797mg [Citrus sinensis]
Length=314

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIG+FLSRLLVKEGHQVTLFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D
Sbjct  1    MGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKD  60

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +DFVKSSL+A+GFDVVYDINGREA EVEPILDALP
Sbjct  61   YDFVKSSLSAKGFDVVYDINGREADEVEPILDALP  95



>gb|ABK24300.1| unknown [Picea sitchensis]
Length=407

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 112/138 (81%), Gaps = 7/138 (5%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRK--VWQPKGALQISASA-----KKILIMGGTRFIGIFLSRLLVK  310
            DFNG +L     Q++     ++ +G ++I+AS+     KKILIMGGTRFIG++LSRLLVK
Sbjct  44   DFNGVRLDNHPQQFQTNKLSYKSRGRVEITASSSSVPPKKILIMGGTRFIGVYLSRLLVK  103

Query  311  EGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVY  490
             GH+VTLFTR K+P+ Q+L GE+D ++A+FSSK+LH+KGDR DF+F+K+ L+A GFDVVY
Sbjct  104  AGHEVTLFTRGKSPVTQKLAGETDQEYAEFSSKVLHIKGDRQDFEFLKTKLSASGFDVVY  163

Query  491  DINGREAVEVEPILDALP  544
            DINGREAVEVEPILDALP
Sbjct  164  DINGREAVEVEPILDALP  181



>gb|KDO81604.1| hypothetical protein CISIN_1g020797mg [Citrus sinensis]
Length=321

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIG+FLSRLLVKEGHQVTLFTR KAPIAQQLPGESD +FA+FSSKILHLKGDR D
Sbjct  1    MGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPIAQQLPGESDQEFAEFSSKILHLKGDRKD  60

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +DFVKSSL+A+GFDVVYDINGREA EVEPILDALP
Sbjct  61   YDFVKSSLSAKGFDVVYDINGREADEVEPILDALP  95



>ref|XP_008648445.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic-like isoform X3 [Zea mays]
 ref|XP_008658100.1| PREDICTED: uncharacterized protein LOC100193292 isoform X2 [Zea 
mays]
 gb|AFW74491.1| hypothetical protein ZEAMMB73_436145 [Zea mays]
 gb|AFW86809.1| hypothetical protein ZEAMMB73_149219 [Zea mays]
Length=321

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI QQLPGESD+++ADFSSK+LHLKGDR D
Sbjct  1    MGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDAEYADFSSKVLHLKGDRQD  60

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            F+FVK+SLAA G+DVVYDINGREAV+VEPI++ALP
Sbjct  61   FEFVKTSLAANGYDVVYDINGREAVQVEPIIEALP  95



>ref|XP_008658101.1| PREDICTED: uncharacterized protein LOC100193292 isoform X3 [Zea 
mays]
 gb|AFW74490.1| hypothetical protein ZEAMMB73_436145 [Zea mays]
 gb|AFW86810.1| hypothetical protein ZEAMMB73_149219 [Zea mays]
Length=320

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  260  MGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMD  439
            MGGTRFIG+FLSRLLVKEGHQVTLFTR KAPI QQLPGESD+++ADFSSK+LHLKGDR D
Sbjct  1    MGGTRFIGVFLSRLLVKEGHQVTLFTRGKAPITQQLPGESDAEYADFSSKVLHLKGDRQD  60

Query  440  FDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            F+FVK+SLAA G+DVVYDINGREAV+VEPI++ALP
Sbjct  61   FEFVKTSLAANGYDVVYDINGREAVQVEPIIEALP  95



>ref|XP_001764862.1| predicted protein [Physcomitrella patens]
 gb|EDQ70304.1| predicted protein [Physcomitrella patens]
Length=420

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +2

Query  236  ASAKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKIL  415
            + +K IL+MGGTRFIG+FL+R LVK GHQVTLFTR KAPI QQLPGESD ++A++SSK+ 
Sbjct  89   SESKNILMMGGTRFIGLFLARELVKAGHQVTLFTRGKAPITQQLPGESDEEYAEYSSKVK  148

Query  416  HLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            HL+GDR DFD +K  L    F++VYDINGRE  EVEPIL+ALP
Sbjct  149  HLQGDRQDFDGLKEKLKGTNFNIVYDINGREGKEVEPILEALP  191



>ref|XP_002979442.1| hypothetical protein SELMODRAFT_110839 [Selaginella moellendorffii]
 gb|EFJ19331.1| hypothetical protein SELMODRAFT_110839 [Selaginella moellendorffii]
Length=358

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  242  AKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHL  421
            AKKIL+MGGTRFIG++L+RLLVK GH+VTLFTR K P+ Q++  E+D ++A++SSK+ H+
Sbjct  29   AKKILMMGGTRFIGVYLARLLVKAGHEVTLFTRGKTPVTQKIASETDQEYAEYSSKVKHI  88

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +GDR DFD +KS +A+ GF++VYDINGREAVEVEPI+DA+P
Sbjct  89   QGDRQDFDGMKSKIASAGFEIVYDINGREAVEVEPIIDAIP  129



>ref|XP_002977885.1| hypothetical protein SELMODRAFT_107618 [Selaginella moellendorffii]
 gb|EFJ21223.1| hypothetical protein SELMODRAFT_107618 [Selaginella moellendorffii]
Length=358

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  242  AKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHL  421
             KKIL+MGGTRFIG++L+RLLVK GH+VTLFTR K P+ Q++  E+D ++A++SSK+ H+
Sbjct  29   TKKILMMGGTRFIGVYLARLLVKAGHEVTLFTRGKTPVTQKIASETDQEYAEYSSKVKHI  88

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +GDR DFD +KS +A+ GF++VYDINGREAVEVEPI+DA+P
Sbjct  89   QGDRQDFDGMKSKIASAGFEIVYDINGREAVEVEPIIDAIP  129



>ref|XP_002982469.1| hypothetical protein SELMODRAFT_228849 [Selaginella moellendorffii]
 gb|EFJ16222.1| hypothetical protein SELMODRAFT_228849 [Selaginella moellendorffii]
Length=371

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 8/124 (6%)
 Frame = +2

Query  197  RKVWQ--PKGALQISAS------AKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAP  352
            R  W+  P+G +   AS      AKKIL+MGG+RFIG++L+R LVK GH+V+LFTR K P
Sbjct  21   RNPWRRRPQGVVNTKASLGAPERAKKILMMGGSRFIGVYLARTLVKAGHEVSLFTRGKTP  80

Query  353  IAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPIL  532
            I QQL GES+  +A++  ++ H++GDR DF+ +KS +   GF+VVYDINGREA EVEPI+
Sbjct  81   ITQQLAGESNEAYAEYQLRVKHIQGDRQDFEALKSKIGEAGFEVVYDINGREAAEVEPIV  140

Query  533  DALP  544
            DALP
Sbjct  141  DALP  144



>ref|XP_002980988.1| hypothetical protein SELMODRAFT_178601 [Selaginella moellendorffii]
 gb|EFJ17689.1| hypothetical protein SELMODRAFT_178601 [Selaginella moellendorffii]
Length=371

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 8/124 (6%)
 Frame = +2

Query  197  RKVW--QPKGALQISAS------AKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAP  352
            R  W  +P+G +   AS      AKKIL+MGG+RFIG++L+R LVK GH+V+LFTR K P
Sbjct  21   RNPWHRRPQGVVTTKASLGAPERAKKILMMGGSRFIGVYLARTLVKAGHEVSLFTRGKTP  80

Query  353  IAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPIL  532
            I QQL GES+  +A++  ++ H++GDR DF+ +KS +   GF+VVYDINGREA EVEPI+
Sbjct  81   ITQQLAGESNEAYAEYQLRVKHIQGDRQDFEALKSKIGEAGFEVVYDINGREAAEVEPIV  140

Query  533  DALP  544
            DALP
Sbjct  141  DALP  144



>ref|XP_010941508.1| PREDICTED: chloroplast stem-loop binding protein of 41 kDa b, 
chloroplastic isoform X2 [Elaeis guineensis]
Length=343

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  320  QVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDIN  499
            QVTLFTR KAPI+QQLPGESD ++A+FSSKILHLKGDR DF+FVK+SLAA GFDVVYDIN
Sbjct  43   QVTLFTRGKAPISQQLPGESDQEYAEFSSKILHLKGDRKDFEFVKTSLAANGFDVVYDIN  102

Query  500  GREAVEVEPILDALP  544
            GREAVEVEPILDALP
Sbjct  103  GREAVEVEPILDALP  117



>ref|XP_001690407.1| chloroplast stem-loop-binding protein [Chlamydomonas reinhardtii]
 gb|AAO22242.1| 38 kDa ribosome-associated protein precursor [Chlamydomonas reinhardtii]
 gb|EDP05666.1| chloroplast stem-loop-binding protein [Chlamydomonas reinhardtii]
Length=401

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  242  AKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHL  421
            +KKIL+MGGTRFIG++L+R L+ +GH VTLFTR K  +A ++P ++ S FADFS K+ H+
Sbjct  58   SKKILLMGGTRFIGLYLARDLIAQGHDVTLFTRGKKKVASEIPDDTPSSFADFSRKVKHI  117

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPIL  532
            +GDRMDF  V+  LA EGF VVYDINGREAVEVEP+L
Sbjct  118  QGDRMDFPEVERKLAREGFQVVYDINGREAVEVEPVL  154



>ref|XP_002945687.1| hypothetical protein VOLCADRAFT_78664 [Volvox carteri f. nagariensis]
 gb|EFJ52682.1| hypothetical protein VOLCADRAFT_78664 [Volvox carteri f. nagariensis]
Length=401

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +2

Query  245  KKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLK  424
            KKIL+MGGTRFIG++L+R LV+ GH+VTLFTR K  +A ++P ++ + FA FS  I H++
Sbjct  56   KKILMMGGTRFIGLYLARQLVEAGHEVTLFTRGKKKVAYEIPDDTPASFATFSRSIKHIQ  115

Query  425  GDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPIL  532
            GDRMDF  V+  LA EGF VVYDINGREAVEVEP+L
Sbjct  116  GDRMDFPEVERKLAREGFQVVYDINGREAVEVEPVL  151



>gb|KIZ07149.1| hypothetical protein MNEG_0796 [Monoraphidium neglectum]
Length=150

 Score =   118 bits (295),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = +2

Query  221  ALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFAD  397
            A+Q  A+  KKIL+MGGTRFIG++L+R LV+EGH+VTL+TR K  I  ++  ++ + +  
Sbjct  27   AVQCKATTPKKILMMGGTRFIGVYLARQLVEEGHEVTLYTRGKKAITYKIADDTAAGYDQ  86

Query  398  FSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDAL  541
            F+  + H+ GDR DF  V++ L   GF VVYDINGREA E EP++ AL
Sbjct  87   FAKSVKHIAGDRQDFADVEAKLKGRGFQVVYDINGREAAESEPLIKAL  134



>ref|XP_011398295.1| Chloroplast stem-loop binding protein of 41 kDa b, chloroplastic 
[Auxenochlorella protothecoides]
 gb|KFM25400.1| Chloroplast stem-loop binding protein of 41 kDa b, chloroplastic 
[Auxenochlorella protothecoides]
Length=334

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +2

Query  233  SASAKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKI  412
            SA+   IL++GGTRFIG +L+R LV+EGHQVTL TR KAPIA ++P ++D   A +S  +
Sbjct  3    SAAPSNILMLGGTRFIGQYLARQLVEEGHQVTLLTRGKAPIAARIPDDTDESHAAYSDAV  62

Query  413  LHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
             H+  DR D D VK++L    F+VVYDINGREA E + IL+ALP
Sbjct  63   QHIAADRKDADAVKNALKGREFNVVYDINGREAEEADLILEALP  106



>gb|KCW58622.1| hypothetical protein EUGRSUZ_H01287 [Eucalyptus grandis]
Length=329

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 2/84 (2%)
 Frame = +2

Query  161  GTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVTLFT  337
            GT+L  + +QYKRKVWQPKGAL ++AS+ +KILIMGGTRFI +FLSRLL K GHQ+TLFT
Sbjct  29   GTRLH-ACIQYKRKVWQPKGALCVTASSTEKILIMGGTRFIRVFLSRLLTKVGHQMTLFT  87

Query  338  R*KAPIAQQLPGESDSDFADFSSK  409
            R +API QQLPGE D   ADFSSK
Sbjct  88   RVEAPIIQQLPGELDKVHADFSSK  111



>gb|AFK39183.1| unknown [Lotus japonicus]
Length=326

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = +2

Query  176  VSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAP  352
            ++ +Q KRKVWQPKG+   +AS+ KK+L+MGG RF G+FLSRL VKEGHQVTL TR + P
Sbjct  33   LTQIQLKRKVWQPKGSFSATASSPKKMLMMGGNRFTGVFLSRLFVKEGHQVTLCTRGEVP  92

Query  353  IAQQLPGESDSDFADFSSK  409
            I Q LP ESDSD ADFSSK
Sbjct  93   ITQHLPDESDSDCADFSSK  111



>ref|XP_005845343.1| hypothetical protein CHLNCDRAFT_36589 [Chlorella variabilis]
 gb|EFN53241.1| hypothetical protein CHLNCDRAFT_36589 [Chlorella variabilis]
Length=407

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +2

Query  224  LQISASAKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFS  403
            +  + + KKIL++GGTRFIG++L+R L++ GH+VTL TR K P+  ++P ++D  FA F 
Sbjct  72   MSAAVAPKKILMLGGTRFIGLYLARQLIEAGHEVTLLTRGKKPVTYRIPDDTDESFAKFE  131

Query  404  SKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDAL  541
              + H+  DR D + +K+ L  +GF+VVYDINGREA E   +LDA+
Sbjct  132  QSVKHIACDRTDAEAMKTHLQNKGFEVVYDINGREADECALVLDAV  177



>ref|XP_005646252.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21708.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=369

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = +2

Query  221  ALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFAD  397
            A+++SA+A K++LI+GGTRFIG++L+R LV+ GH VTL TR K  +  Q+P ++D  +  
Sbjct  40   AVRVSAAATKEVLILGGTRFIGVYLARQLVEAGHGVTLLTRGKKEVTYQIPDDTDESYKA  99

Query  398  FSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDAL  541
            + S + H+  DR D   + S LA + FD VYD+NGREA E + +L AL
Sbjct  100  YKSAVKHIAADRKDKSMLDSQLAGKKFDAVYDMNGREADEADLVLGAL  147



>ref|XP_010070063.1| PREDICTED: psbP domain-containing protein 1, chloroplastic isoform 
X2 [Eucalyptus grandis]
 gb|KCW58624.1| hypothetical protein EUGRSUZ_H01287 [Eucalyptus grandis]
Length=311

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 2/89 (2%)
 Frame = +2

Query  161  GTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVTLFT  337
            GT+L  + +QYKRKVWQPKGAL ++AS+ +KILIMGGTRFI +FLSRLL K GHQ+TLFT
Sbjct  29   GTRLH-ACIQYKRKVWQPKGALCVTASSTEKILIMGGTRFIRVFLSRLLTKVGHQMTLFT  87

Query  338  R*KAPIAQQLPGESDSDFADFSSKILHLK  424
            R +API QQLP    S  A   S  + L+
Sbjct  88   RVEAPIIQQLPVPRRSVMALILSSCIFLR  116



>ref|XP_010070062.1| PREDICTED: psbP domain-containing protein 1, chloroplastic isoform 
X1 [Eucalyptus grandis]
 gb|KCW58623.1| hypothetical protein EUGRSUZ_H01287 [Eucalyptus grandis]
Length=314

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 61/72 (85%), Gaps = 2/72 (3%)
 Frame = +2

Query  161  GTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVTLFT  337
            GT+L  + +QYKRKVWQPKGAL ++AS+ +KILIMGGTRFI +FLSRLL K GHQ+TLFT
Sbjct  29   GTRLH-ACIQYKRKVWQPKGALCVTASSTEKILIMGGTRFIRVFLSRLLTKVGHQMTLFT  87

Query  338  R*KAPIAQQLPG  373
            R +API QQLP 
Sbjct  88   RVEAPIIQQLPA  99



>gb|KCW58626.1| hypothetical protein EUGRSUZ_H01287 [Eucalyptus grandis]
Length=251

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 61/72 (85%), Gaps = 2/72 (3%)
 Frame = +2

Query  161  GTKLAVSSVQYKRKVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVTLFT  337
            GT+L  + +QYKRKVWQPKGAL ++AS+ +KILIMGGTRFI +FLSRLL K GHQ+TLFT
Sbjct  29   GTRLH-ACIQYKRKVWQPKGALCVTASSTEKILIMGGTRFIRVFLSRLLTKVGHQMTLFT  87

Query  338  R*KAPIAQQLPG  373
            R +API QQLP 
Sbjct  88   RVEAPIIQQLPA  99



>ref|XP_008246190.1| PREDICTED: psbP domain-containing protein 1, chloroplastic isoform 
X3 [Prunus mume]
Length=330

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 64/87 (74%), Gaps = 2/87 (2%)
 Frame = +2

Query  152  DFNGTKLAVSSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKEGHQVT  328
            DFNGT+L  + +QY+R V +PK  L ++AS AKK L  GG + IG+FLSRL +K+G Q++
Sbjct  26   DFNGTRLH-TQLQYRRNVSRPKETLYVTASNAKKSLTAGGIQSIGVFLSRLFIKDGLQLS  84

Query  329  LFTR*KAPIAQQLPGESDSDFADFSSK  409
            L +R + PI +QL GES+ D ADFSSK
Sbjct  85   LLSRPRTPITEQLSGESNKDCADFSSK  111



>gb|KCW58625.1| hypothetical protein EUGRSUZ_H01287 [Eucalyptus grandis]
Length=310

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 1/59 (2%)
 Frame = +2

Query  200  KVWQPKGALQISASA-KKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPG  373
            +VWQPKGAL ++AS+ +KILIMGGTRFI +FLSRLL K GHQ+TLFTR +API QQLP 
Sbjct  37   QVWQPKGALCVTASSTEKILIMGGTRFIRVFLSRLLTKVGHQMTLFTRVEAPIIQQLPA  95



>ref|XP_005855445.1| nad-dependent epimerase dehydratase [Nannochloropsis gaditana 
CCMP526]
 gb|EKU20904.1| nad-dependent epimerase dehydratase [Nannochloropsis gaditana 
CCMP526]
Length=354

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = +2

Query  224  LQISASAKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFS  403
            ++   + KK+LI+GGTRF G++L + L   G+ +TLF R K    + +PGES   +A+  
Sbjct  26   MKAPGAGKKVLIIGGTRFSGLYLFKELHDRGYDITLFNRGKT-ANRPVPGESAESYAERI  84

Query  404  SKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDAL  541
             +   +KGDR + D + +   A  FDV+YD+NGRE  + +P+ DA 
Sbjct  85   GQATFVKGDRTNPDDLAALAKAHEFDVIYDMNGREKTDTQPLADAY  130



>gb|EWM24370.1| nad-dependent epimerase dehydratase [Nannochloropsis gaditana]
Length=383

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  224  LQISASAKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFS  403
            ++   + KK+LI+GGTRF G++L + L   G+ +TLF R K    + +PGES   +A+  
Sbjct  55   MKAPGAGKKVLIIGGTRFSGLYLFKELHDRGYDITLFNRGKT-ANRPVPGESAESYAERI  113

Query  404  SKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDA  538
             +   +KGDR + D + +   A  FDV+YD+NGRE  + +P+ DA
Sbjct  114  GQATFVKGDRTNPDDLAALAKAHEFDVIYDMNGREKTDTQPLADA  158



>ref|WP_026082043.1| 3-beta hydroxysteroid dehydrogenase [Fischerella sp. PCC 9339]
Length=311

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (62%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV++GH++ LF R   P+  +  G+              + G
Sbjct  2    RILIMGGTRFIGVYLTQLLVQQGHEIVLFNRGNRPVPIKGVGQ--------------ITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FDV++D NGRE  + EP+
Sbjct  48   DRTDTTLLKEKLSQENFDVIFDNNGRELTDTEPL  81



>ref|WP_029638354.1| 3-beta hydroxysteroid dehydrogenase [[Scytonema hofmanni] UTEX 
B 1581]
Length=317

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV+ GH+V LF R   P+ +Q               +  + G
Sbjct  2    RILIMGGTRFIGVYLTKLLVESGHKVVLFNRGNRPVPEQ---------------VEQITG  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FDV++D NGRE  + +P+
Sbjct  47   DRTDATQLKEKLSPENFDVIFDNNGRELTDTQPL  80



>ref|XP_005827760.1| hypothetical protein GUITHDRAFT_96197 [Guillardia theta CCMP2712]
 gb|EKX40780.1| hypothetical protein GUITHDRAFT_96197 [Guillardia theta CCMP2712]
Length=341

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 61/99 (62%), Gaps = 1/99 (1%)
 Frame = +2

Query  239  SAKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILH  418
            S + +LI+GGTRF G +L + LV  GHQVTL+ R K    + LPGES+SD+        +
Sbjct  2    SKESVLIIGGTRFSGAYLWKELVDRGHQVTLYNRGKTS-PKPLPGESESDYKRRLETTKY  60

Query  419  LKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            L GDR D + +K+ +    +  VYD+NGREA +  P+ D
Sbjct  61   LMGDRKDPEQIKNLVDPSLYTYVYDMNGREASDTAPLAD  99



>ref|WP_015198868.1| NAD-dependent epimerase/dehydratase [Calothrix parietina]
 gb|AFZ02240.1| NAD-dependent epimerase/dehydratase [Calothrix sp. PCC 6303]
Length=312

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 61/94 (65%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L++LLV++GH+V LF R   P+    P E           +  +KG
Sbjct  2    QILVMGGTRFIGVYLTKLLVEQGHEVVLFNRGNRPV----PVEG----------VRQIKG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR + + +K++LA E FD V+D NGRE  + +P+
Sbjct  48   DRTNSESLKAALANEKFDAVFDNNGRELTDTQPL  81



>emb|CBN74028.1| 38 kDa ribosome-associated protein precursor [Ectocarpus siliculosus]
Length=383

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +2

Query  197  RKVWQPKGALQISASA--KKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLP  370
            R   +P  +L+++A+   +++L++GGTRF G++L++ L   GH+V L+ R +    +QLP
Sbjct  33   RTGARPSSSLRMAAAEGKQRVLVIGGTRFSGLYLTKELHSRGHEVVLYNRGQT-ANKQLP  91

Query  371  GESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
             ESD+++A     +  + GDR D +  +S+L  E FD V+D+N RE  + + + D
Sbjct  92   CESDAEYAKRVEDVKTIVGDRKDPEVCQSTLGGEKFDAVFDMNAREVSDTKAVAD  146



>ref|WP_026795888.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Planktothrix]
Length=311

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LVK+GH+V LF R K P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVKQGHEVVLFNRGKKPA----PVEG----------IKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + ++  LA E FD ++D NGRE  + +P+ D
Sbjct  48   DRTDANQIQEKLANEQFDAIFDNNGRELNDTKPLAD  83



>ref|WP_027255333.1| 3-beta hydroxysteroid dehydrogenase [Planktothrix agardhii]
Length=311

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LVK+GH+V LF R K P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVKQGHEVVLFNRGKKPA----PVEG----------IKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + ++  LA E FD ++D NGRE  + +P+ D
Sbjct  48   DRTDANQIQEKLANEQFDAIFDNNGRELNDTKPLAD  83



>ref|WP_026785486.1| 3-beta hydroxysteroid dehydrogenase [Planktothrix rubescens]
Length=311

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LVK+GH+V LF R K P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVKQGHEVVLFNRGKKPA----PVEG----------IKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + ++  LA E FD ++D NGRE  + +P+ D
Sbjct  48   DRTDANQIQEKLANEQFDAIFDNNGRELNDTKPLAD  83



>ref|WP_027250155.1| 3-beta hydroxysteroid dehydrogenase [Planktothrix agardhii]
 gb|KEI66874.1| mRNA-binding protein [Planktothrix agardhii NIVA-CYA 126/8]
Length=311

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LVK+GH+V LF R K P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVKQGHEVVLFNRGKKPA----PVEG----------IKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + ++  LA E FD ++D NGRE  + +P+ D
Sbjct  48   DRTDANQIQEKLANEQFDAIFDNNGRELNDTKPLAD  83



>ref|WP_006197986.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Nodularia spumigena]
 gb|EAW43864.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Nodularia spumigena 
CCY9414]
 gb|AHJ29290.1| Ribosome-associated endonuclease, involved in final steps of 
23S rRNA maturation [Nodularia spumigena CCY9414]
Length=312

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 60/94 (64%), Gaps = 13/94 (14%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV++GH+V LF R   P+   LPG            +  + G
Sbjct  2    RILIMGGTRFIGVYLTQLLVEQGHEVVLFNRGNRPVP-HLPG------------VGQIIG  48

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR +   +K  L++E FDV++D NGRE  + +P+
Sbjct  49   DRTNATQLKEKLSSEKFDVIFDNNGRELTDTQPL  82



>gb|AFY78521.1| nucleoside-diphosphate-sugar epimerase [Pleurocapsa sp. PCC 7327]
Length=342

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 64/108 (59%), Gaps = 19/108 (18%)
 Frame = +2

Query  215  KGALQISASAK-KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDS  385
            KG  QI  S K +ILIMGGTRFIG++L+++LV+ GH+V LF R    AP+A         
Sbjct  21   KGNKQIEGSIKMRILIMGGTRFIGVYLTKILVERGHEVVLFNRGNNPAPVA---------  71

Query  386  DFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
                    +  ++GDR D   +K  LA+E FD ++D NGRE  + +P+
Sbjct  72   -------GVKQIQGDRTDVAQLKEKLASESFDAIFDNNGRELSDTQPL  112



>ref|WP_009784478.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Lyngbya sp. PCC 
8106]
 gb|EAW36986.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Lyngbya sp. PCC 
8106]
Length=310

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 56/96 (58%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV++GH+V LF R   P                   I  + G
Sbjct  2    RILIMGGTRFIGVYLTQILVEQGHEVVLFNRGNKPAP--------------VDGIKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D D +K  LA E FD ++D NGR+  + +P+ D
Sbjct  48   DRTDADQIKEKLANENFDAIFDNNGRQLSDTQPLAD  83



>ref|WP_015783947.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 8802]
 gb|ACV00917.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 8802]
Length=309

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV++GH+V LF R   P+    P E           +  +KG
Sbjct  2    RILIMGGTRFIGVYLTKVLVEQGHEVVLFNRGNKPV----PVEG----------VQQIKG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR +   +K +L++E FD V+D NGRE  + +P+++
Sbjct  48   DRTNISQLKETLSSEQFDAVFDNNGRELSDTQPLVE  83



>ref|WP_015173212.1| NAD-dependent epimerase/dehydratase [Geitlerinema sp. PCC 7407]
 gb|AFY67648.1| NAD-dependent epimerase/dehydratase [Geitlerinema sp. PCC 7407]
Length=311

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 58/96 (60%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+R+LV++GH+V LF R   P                 + +  ++G
Sbjct  2    RILIMGGTRFIGVYLTRILVEQGHEVVLFNRGNKPAP--------------VAGVQQIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  LA E FD V+D NGRE  + +P+++
Sbjct  48   DRTDAGQLKEKLAGESFDAVFDNNGRELSDTQPLVE  83



>ref|WP_012595308.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 8801]
 gb|ACK66038.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 8801]
Length=309

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 62/96 (65%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV++GH+V LF R   P+    P E           +  +KG
Sbjct  2    RILIMGGTRFIGVYLTKVLVEQGHEVVLFNRGNKPV----PVEG----------VQQIKG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR +   +K +L++E FD V+D NGRE  + +P+++
Sbjct  48   DRTNISQLKETLSSEQFDAVFDNNGRELSDTQPLVE  83



>ref|WP_039741151.1| 3-beta hydroxysteroid dehydrogenase [Hassallia byssoidea]
 gb|KIF36231.1| 3-beta hydroxysteroid dehydrogenase [Hassallia byssoidea VB512170]
Length=312

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV+ GH V LF R   P  QQ               +  + G
Sbjct  2    RILIMGGTRFIGVYLTKMLVESGHTVVLFNRGNRPAPQQ---------------VEQITG  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FDV++D NGRE  + +P+
Sbjct  47   DRTDAAQLKEKLSQESFDVIFDNNGRELTDTQPL  80



>ref|XP_005536032.1| similar to mRNA binding protein CSP41 precursor [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM79746.1| similar to mRNA binding protein CSP41 precursor [Cyanidioschyzon 
merolae strain 10D]
Length=414

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +2

Query  212  PKGALQISASAKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDF  391
            P      +  +K+ L++GGTRF G++L+++L   GH+V L+ R   P+ Q++P E + +F
Sbjct  78   PMSCRADTIGSKRCLVIGGTRFSGVYLAKVLGDLGHEVVLYNRGSKPL-QRVPNEPEGEF  136

Query  392  ADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            A  ++    + GDR   D VK  LA+E FD ++D+NGRE  +  P 
Sbjct  137  AARAAMSSTIIGDRTKPDEVKEKLASENFDAIFDMNGRELEDTRPF  182



>ref|WP_026796328.1| 3-beta hydroxysteroid dehydrogenase [Planktothrix prolifica]
Length=311

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV++GH+V LF R K P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVEQGHEVVLFNRGKKPA----PVEG----------IKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + ++  LA E FD ++D NGRE  + +P+ D
Sbjct  48   DRTDANQIQEKLANEQFDAIFDNNGRELNDTKPLAD  83



>ref|WP_015224347.1| NAD-dependent epimerase/dehydratase [Halothece sp. PCC 7418]
 gb|AFZ42469.1| NAD-dependent epimerase/dehydratase [Halothece sp. PCC 7418]
Length=311

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG+ L+++LV++GH+VTLF R   P     P E           +  + G
Sbjct  2    RILIMGGTRFIGVALTKILVEQGHEVTLFNRGNNPS----PVEG----------VREVHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D D +K  LA E FD ++D NGRE  + +P+++
Sbjct  48   DRKDTDQLKDQLAKESFDAIFDNNGRELSDTQPLIE  83



>ref|WP_015117271.1| nucleoside-diphosphate-sugar epimerase [Rivularia sp. PCC 7116]
 gb|AFY53693.1| nucleoside-diphosphate-sugar epimerase [Rivularia sp. PCC 7116]
Length=312

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 58/96 (60%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV++GH V LF R   P    LP E+          +  + G
Sbjct  2    RILIMGGTRFIGVYLTQLLVEQGHDVVLFNRGNRP----LPVEN----------VTQIIG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   ++  L  E FDV++D NGRE  + +P+ D
Sbjct  48   DRTDSKQLQEKLKNENFDVIFDNNGRELTDTQPLAD  83



>ref|WP_039726406.1| MULTISPECIES: 3-beta hydroxysteroid dehydrogenase [Oscillatoriophycideae]
 gb|KIF14623.1| 3-beta hydroxysteroid dehydrogenase [Aphanocapsa montana BDHKU210001]
 gb|KIF39549.1| 3-beta hydroxysteroid dehydrogenase [Lyngbya confervoides BDU141951]
Length=311

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 61/96 (64%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L++LLV++GH V LF R   P     P ES          +  ++G
Sbjct  2    RILVMGGTRFIGVYLTQLLVQQGHDVVLFNRGNKPA----PVES----------VQTIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K++LA E FD ++D NGRE  + +P+++
Sbjct  48   DRKDIAQLKAALAGEKFDAIFDNNGRELSDTQPLVE  83



>ref|WP_006529067.1| nucleoside-diphosphate-sugar epimerase [Gloeocapsa sp. PCC 73106]
 gb|ELR98122.1| nucleoside-diphosphate-sugar epimerase [Gloeocapsa sp. PCC 73106]
Length=311

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV+ GH+V LF R   P    LPG            +  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVEAGHEVVLFNRGNKPTP--LPG------------VKQITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR+  + +K  LA E FD ++D NGRE  + +P+++
Sbjct  48   DRLQPEVLKEKLAGEHFDAIFDNNGRELADTQPLVE  83



>ref|WP_035798183.1| 3-beta hydroxysteroid dehydrogenase [Cyanothece sp. CCY0110]
Length=311

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 58/96 (60%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++ LVK+GH+V LF R   P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTKELVKQGHEVVLFNRGNKPA----PIEG----------ITQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + +K  LA+E FD ++D N RE  + +P++D
Sbjct  48   DRKDTNQLKEKLASESFDAIFDNNSRELSDTQPLVD  83



>ref|WP_011318890.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Anabaena variabilis]
 gb|ABA21723.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Anabaena variabilis 
ATCC 29413]
Length=313

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%), Gaps = 15/95 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPI-AQQLPGESDSDFADFSSKILHLK  424
            +ILIMGGTRFIG++L+++LV++GH+V LF R   P+ A Q  G+              + 
Sbjct  2    RILIMGGTRFIGVYLTQILVEQGHEVVLFNRGNRPLPALQGVGQ--------------II  47

Query  425  GDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            GDR D   +K  L+AE FDVV+D NGRE  + +P+
Sbjct  48   GDRTDATQLKEKLSAENFDVVFDNNGRELTDTQPL  82



>ref|WP_010998959.1| mRNA-binding protein [Nostoc sp. PCC 7120]
 dbj|BAB76530.1| mRNA-binding protein [Nostoc sp. PCC 7120]
Length=311

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%), Gaps = 15/95 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPI-AQQLPGESDSDFADFSSKILHLK  424
            +ILIMGGTRFIG++L+++LV++GH+V LF R   P+ A Q  G+              + 
Sbjct  2    RILIMGGTRFIGVYLTQILVEQGHEVVLFNRGNRPLPALQGVGQ--------------II  47

Query  425  GDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            GDR D   +K  L+AE FDVV+D NGRE  + +P+
Sbjct  48   GDRTDATQLKEKLSAENFDVVFDNNGRELTDTQPL  82



>ref|WP_016859476.1| mRNA binding protein [Fischerella muscicola]
Length=311

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV++GH+V LF R   P   +  G+              + G
Sbjct  2    RILIMGGTRFIGVYLTQLLVQQGHEVVLFNRGNRPAPVEGVGQ--------------ITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FD ++D NGRE  + +P+
Sbjct  48   DRTDTTLLKEKLSQENFDAIFDNNGRELTDTQPL  81



>ref|XP_008246183.1| PREDICTED: psbP domain-containing protein 1, chloroplastic isoform 
X2 [Prunus mume]
Length=350

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = +2

Query  179  SSVQYKRKVWQPKGALQISAS-AKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPI  355
            S++  +R V +PK  L ++AS AKK L  GG + IG+FLSRL +K+G Q++L +R + PI
Sbjct  54   STLNSRRNVSRPKETLYVTASNAKKSLTAGGIQSIGVFLSRLFIKDGLQLSLLSRPRTPI  113

Query  356  AQQLPGESDSDFADFSSK  409
             +QL GES+ D ADFSSK
Sbjct  114  TEQLSGESNKDCADFSSK  131



>ref|WP_015230954.1| nucleoside-diphosphate-sugar epimerase [Dactylococcopsis salina]
 gb|AFZ51980.1| nucleoside-diphosphate-sugar epimerase [Dactylococcopsis salina 
PCC 8305]
Length=311

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KILIMGGTRFIG+ L+++LV++GH++TLF R   P     P E           +  + G
Sbjct  2    KILIMGGTRFIGVALTKILVEQGHKITLFNRGNNPS----PVEG----------VKTING  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D D +K  LA E FD ++D NGRE  + +P+++
Sbjct  48   DRKDADQLKEKLATETFDAIFDNNGRELSDTQPLVE  83



>ref|WP_035989819.1| 3-beta hydroxysteroid dehydrogenase [Leptolyngbya sp. KIOST-1]
Length=310

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 61/98 (62%), Gaps = 18/98 (18%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            ++L+MGGTRFIG++L++LL+++GH+V LF R    AP+A                 +  +
Sbjct  2    RVLVMGGTRFIGVYLTKLLIEQGHEVVLFNRGNRPAPVA----------------GVPTI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
             GDR D D +K+ LA E FD ++D NGRE  + +P+++
Sbjct  46   VGDRTDADNLKTQLAGERFDAIFDNNGRELSDTQPLIE  83



>ref|WP_009545065.1| MULTISPECIES: NAD-dependent epimerase/dehydratase [Cyanothece]
 gb|ACB53127.1| mRNA-binding protein [Cyanothece sp. ATCC 51142]
Length=311

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 59/98 (60%), Gaps = 18/98 (18%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            +ILIMGGTRFIG++L++ LVK+GH+V LF R    API                  I  +
Sbjct  2    RILIMGGTRFIGVYLTKELVKQGHEVVLFNRGNKAAPI----------------EGITQI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
             GDR D + +K  LA+E FD ++D NGRE  + +P+++
Sbjct  46   HGDRKDANQLKEKLASESFDAIFDNNGRELSDTQPLVE  83



>ref|WP_015954771.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 7424]
 gb|ACK71170.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 7424]
Length=311

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            ++L+MGGTRFIG++L+++LVK+GH V LF R   P+    P E           I  + G
Sbjct  2    RVLVMGGTRFIGVYLTKVLVKQGHDVVLFNRGNKPV----PIEG----------IEQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  LA+E FD ++D NGRE  + +P+
Sbjct  48   DRQDSTQLKDKLASEKFDAIFDNNGRELTDTQPL  81



>ref|WP_016879750.1| mRNA binding protein [Chlorogloeopsis fritschii]
Length=312

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV++GH+V LF R   P     P E           +  + G
Sbjct  2    RILIMGGTRFIGVYLTQLLVQKGHEVVLFNRGNRPT----PVEG----------VRQITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  LA E FD ++D NGRE  + +P+++
Sbjct  48   DRTDTTQLKEKLAKENFDAIFDNNGRELSDTQPLVE  83



>ref|WP_015155099.1| NAD-dependent epimerase/dehydratase [Chroococcidiopsis thermalis]
 gb|AFY88553.1| NAD-dependent epimerase/dehydratase [Chroococcidiopsis thermalis 
PCC 7203]
Length=309

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV +GH+V LF R   PI    P E           I  ++G
Sbjct  2    RILIMGGTRFIGVYLTKILVAQGHEVVLFNRGNRPI----PVEG----------ITQIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR   + +K+ L+ E FD +YD NGRE  + +P+ +
Sbjct  48   DRTSPEQLKAKLSQEHFDAIYDNNGRELSDTQPLAE  83



>ref|WP_015182798.1| nucleoside-diphosphate-sugar epimerase [Microcoleus sp. PCC 7113]
 gb|AFZ18649.1| nucleoside-diphosphate-sugar epimerase [Microcoleus sp. PCC 7113]
Length=311

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV++GH V LF R K P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTKLLVEQGHDVVLFNRGKKPA----PVEG----------IQQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K+ L+ E FD ++D NGRE  + +P+
Sbjct  48   DRTDASQLKNKLSQEQFDAIFDNNGRELSDTQPL  81



>ref|WP_023067618.1| hypothetical protein [Lyngbya aestuarii]
 gb|ERT06177.1| hypothetical protein M595_3882 [Lyngbya aestuarii BL J]
Length=310

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 55/96 (57%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV++GH+V LF R   P                   I  + G
Sbjct  2    RILIMGGTRFIGVYLTQMLVEQGHEVVLFNRGNKPAP--------------VDGIKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  LA E FD ++D NGR+  + +P+ D
Sbjct  48   DRTDASQIKEKLANENFDAIFDNNGRQLSDTQPLAD  83



>ref|WP_008052699.1| putative UDP-glucose 4-epimerase [Arthrospira sp. PCC 8005]
 emb|CCE17889.1| putative UDP-glucose 4-epimerase [Arthrospira sp. PCC 8005]
 emb|CDM96691.1| putative UDP-glucose 4-epimerase [Arthrospira sp. PCC 8005]
Length=311

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 56/96 (58%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV +GH+V LF R   P                   I  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVSQGHEVVLFNRGNKPSP--------------VDGIKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + +K  L+ E FDV++D NGR+  + +P+ D
Sbjct  48   DRTDANQLKEKLSGETFDVIFDNNGRQLSDTQPLAD  83



>ref|XP_006841605.1| hypothetical protein AMTR_s00003p00211760 [Amborella trichopoda]
 gb|ERN03280.1| hypothetical protein AMTR_s00003p00211760 [Amborella trichopoda]
Length=281

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  386  DFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILDALP  544
            +F     ++LHLKGDR DF+FVK++L++  F++VYDINGREAVEVEPILD LP
Sbjct  3    NFMSVWIQVLHLKGDRQDFEFVKTTLSSSDFEIVYDINGREAVEVEPILDGLP  55



>ref|XP_005715070.1| similar to mRNA binding protein CSP41 precursor [Chondrus crispus]
 emb|CDF35251.1| similar to mRNA binding protein CSP41 precursor [Chondrus crispus]
Length=401

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 61/102 (60%), Gaps = 3/102 (3%)
 Frame = +2

Query  239  SAKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQ---QLPGESDSDFADFSSK  409
            + K++L++GGTRF G++L   L   G  V +  R   P+     ++PGE+D  F + + +
Sbjct  67   TGKRVLVIGGTRFSGLYLVHELANRGANVVVLNRGSKPVGDPSLKVPGETDEHFKERNDR  126

Query  410  ILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
               +  DR D + + S+LA+E FDV++D NGRE  + +P+ D
Sbjct  127  TTQIVADRTDAEALTSALASEKFDVIFDNNGRELSDSKPLAD  168



>ref|WP_017748039.1| mRNA binding protein [Scytonema hofmanni]
Length=311

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 58/94 (62%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L++LLV++GH+V LF R   P+  +  G+              + G
Sbjct  2    RILIVGGTRFIGVYLTKLLVEQGHEVILFNRGNRPVPVEGVGQ--------------ITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FDV++D NGRE  + +P+
Sbjct  48   DRTDATQLKEKLSHENFDVIFDNNGRELSDTQPL  81



>ref|WP_039716152.1| 3-beta hydroxysteroid dehydrogenase [Scytonema millei]
 gb|KIF18641.1| 3-beta hydroxysteroid dehydrogenase [Scytonema millei VB511283]
Length=309

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 58/94 (62%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV +GH+V LF R   PI    P E           +  ++G
Sbjct  2    RILIMGGTRFIGVYLTKILVAQGHEVVLFNRGNRPI----PVEG----------VTQIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR   + +K+ L+ E FD +YD NGRE  + +P+
Sbjct  48   DRTSPEQLKAKLSQEHFDAIYDNNGRELSDTQPL  81



>ref|WP_017653189.1| mRNA binding protein [Microchaete sp. PCC 7126]
Length=312

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 59/94 (63%), Gaps = 13/94 (14%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L++LLV++GH+V LF R   P+   L G            +  + G
Sbjct  2    RILVMGGTRFIGVYLTQLLVEQGHEVVLFNRGNRPVP-SLQG------------VGQIIG  48

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K+ L+ E FDVV+D NGRE  + +P+
Sbjct  49   DRTDAVQLKAKLSQENFDVVFDNNGRELTDTQPL  82



>ref|WP_026735807.1| 3-beta hydroxysteroid dehydrogenase [Fischerella sp. PCC 9605]
Length=313

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV++GH+V LF R   P                  ++  + G
Sbjct  2    RILIMGGTRFIGVYLTQLLVQQGHEVVLFNRGNRPAP--------------VGRVGQITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FD ++D NGRE  + +P+
Sbjct  48   DRTDATQLKEKLSKENFDAIFDNNGRELTDTQPL  81



>ref|WP_007310519.1| mRNA-binding protein [Crocosphaera watsonii]
 gb|EHJ13062.1| mRNA-binding protein [Crocosphaera watsonii WH 0003]
 emb|CCQ57604.1| Ribosome-associated endonuclease, involved in final steps of 
23S rRNA maturation [Crocosphaera watsonii WH 0005]
 emb|CCQ65044.1| Ribosome-associated endonuclease, involved in final steps of 
23S rRNA maturation [Crocosphaera watsonii WH 0402]
Length=311

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++ LVK+GH+V LF R   P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTKELVKQGHEVVLFNRGNKPA----PIEG----------IKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  LA+E F+ ++D NGRE  + +P+++
Sbjct  48   DRKDATQLKEKLASENFEAIFDNNGRELSDTQPLIE  83



>ref|WP_009453963.1| MULTISPECIES: NAD-dependent epimerase/dehydratase [Fischerella]
 gb|EHC19442.1| NAD-dependent epimerase/dehydratase [Fischerella sp. JSC-11]
Length=311

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L++LLV++GH+V LF R   P    LP E           I  + G
Sbjct  2    RILIVGGTRFIGVYLTQLLVQQGHEVVLFNRGNRP----LPVEG----------IGQITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FD ++D NGRE  + +P+
Sbjct  48   DRTDATQLKEKLSKENFDAIFDNNGRELTDTQPL  81



>gb|KIE11660.1| 3-beta hydroxysteroid dehydrogenase [Tolypothrix bouteillei VB521301]
Length=311

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L++LLV++GH+V LF R   PI  +  G+              + G
Sbjct  2    RILIVGGTRFIGVYLTKLLVEQGHEVVLFNRGNRPIPVEGVGQ--------------ITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FD ++D NGRE  + +P+
Sbjct  48   DRTDATQLKEKLSHENFDAIFDNNGRELSDTQPL  81



>ref|WP_006101901.1| 3-beta hydroxysteroid dehydrogenase/isomerase family [Coleofasciculus 
chthonoplastes]
 gb|EDX74570.1| 3-beta hydroxysteroid dehydrogenase/isomerase family [Coleofasciculus 
chthonoplastes PCC 7420]
Length=311

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 58/96 (60%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV++GH+V LF R   P     P E           +  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVEQGHEVVLFNRGNKPA----PVEG----------VQQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  L+ E FD ++D NGRE  + +P+++
Sbjct  48   DRKDATQLKEKLSGEAFDAIFDNNGRELSDTQPLVE  83



>ref|WP_028948726.1| 3-beta hydroxysteroid dehydrogenase [Synechocystis sp. PCC 6714]
 gb|AIE73770.1| Ribosome-associated endonuclease, involved in final steps of 
23S rRNA maturation [Synechocystis sp. PCC 6714]
Length=311

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 56/96 (58%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIGI L R+LV +GH+V LF R   P              D  + +  + G
Sbjct  2    RILIMGGTRFIGIHLCRVLVAQGHEVVLFNRGNRP--------------DPVNGVAQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR   + ++S L  E FDV++D NGRE  + +P++D
Sbjct  48   DRRVSEQLRSKLETEEFDVIFDNNGRELSDTQPLVD  83



>ref|WP_006508721.1| nucleoside-diphosphate-sugar epimerase [Xenococcus sp. PCC 7305]
 gb|ELS04172.1| nucleoside-diphosphate-sugar epimerase [Xenococcus sp. PCC 7305]
Length=312

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 58/96 (60%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            ++L+MGGTRFIG++L+++LV +GH+V LF R   P     P E           +  + G
Sbjct  2    RVLVMGGTRFIGVYLTKVLVAQGHEVVLFNRGNKPA----PVEG----------VTQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  L+ E FDVV+D NGRE  + +P+++
Sbjct  48   DRKDAAQLKEKLSGESFDVVFDNNGRELSDTQPLVE  83



>ref|WP_019506359.1| mRNA binding protein [Pleurocapsa sp. PCC 7319]
Length=311

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 58/96 (60%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L+++LV +GH+V LF R   P     P E           +  ++G
Sbjct  2    RILMMGGTRFIGVYLTKVLVDQGHEVVLFNRGNNPA----PVEG----------VSQIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  LA E FD ++D NGRE  + +P+++
Sbjct  48   DRKDASQLKEKLAGESFDAIFDNNGRELSDTQPLVE  83



>ref|WP_021831139.1| Ribosome-associated endonuclease, involved in final steps of 
23S rRNA maturation [Crocosphaera watsonii]
 emb|CCQ64367.1| Ribosome-associated endonuclease, involved in final steps of 
23S rRNA maturation [Crocosphaera watsonii WH 0401]
 emb|CCQ52072.1| Ribosome-associated endonuclease, involved in final steps of 
23S rRNA maturation [Crocosphaera watsonii WH 8502]
Length=311

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++ LVK+GH+V LF R   P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTKELVKKGHEVVLFNRGNKPA----PIEG----------IKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  LA+E F+ ++D NGRE  + +P+++
Sbjct  48   DRKDATQLKEKLASENFEAIFDNNGRELSDTQPLIE  83



>ref|WP_011613919.1| NAD-dependent epimerase/dehydratase [Trichodesmium erythraeum]
 gb|ABG53602.1| NAD-dependent epimerase/dehydratase [Trichodesmium erythraeum 
IMS101]
Length=310

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV++GH+V LF R   P                 S I  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVEKGHEVVLFNRGNKPAP--------------VSGIKEIYG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D + +K  LA+E FD ++D NGR+  + +P+
Sbjct  48   DRTDINQLKEKLASEKFDAIFDNNGRKLSDTKPL  81



>ref|WP_041393425.1| 3-beta hydroxysteroid dehydrogenase [Pleurocapsa minor]
Length=311

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV+ GH+V LF R   P                 + +  ++G
Sbjct  2    RILIMGGTRFIGVYLTKILVERGHEVVLFNRGNNPAP--------------VAGVKQIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  LA+E FD ++D NGRE  + +P+
Sbjct  48   DRTDVAQLKEKLASESFDAIFDNNGRELSDTQPL  81



>ref|XP_005708577.1| NAD-dependent epimerase/dehydratase [Galdieria sulphuraria]
 gb|EME32057.1| NAD-dependent epimerase/dehydratase [Galdieria sulphuraria]
Length=378

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 66/127 (52%), Gaps = 14/127 (11%)
 Frame = +2

Query  203  VWQP-----------KGALQISASAKKILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KA  349
            VWQP              L  + + + +L++GGTRF G++++R L   GHQV LF R   
Sbjct  18   VWQPTTGFKSHFLRKNNGLLFTRTHRNLLLIGGTRFSGLYIARELALSGHQVVLFNRGSV  77

Query  350  PIAQ---QLPGESDSDFADFSSKILHLKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEV  520
            PI     ++ GE++ DF    S    +KGDR     +   + +E +D ++D NGRE  + 
Sbjct  78   PIGDISLKIRGETEKDFQTRMSNTHLIKGDRTHPQDILRVVQSEKWDAIFDNNGRELSDS  137

Query  521  EPILDAL  541
            +P +D L
Sbjct  138  KPWIDGL  144



>ref|WP_016870077.1| mRNA binding protein [Fischerella muscicola]
Length=311

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L++LLV++GH+V LF R   P    LP E           +  + G
Sbjct  2    RILIVGGTRFIGVYLTQLLVQQGHEVVLFNRGNRP----LPVEG----------VGQITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FD ++D NGRE  + +P+
Sbjct  48   DRTDATQLKQKLSKENFDAIFDNNGRELTDTQPL  81



>ref|WP_022607065.1| nucleoside-diphosphate-sugar epimerase [Rubidibacter lacunae]
 gb|ERN41488.1| nucleoside-diphosphate-sugar epimerase [Rubidibacter lacunae 
KORDI 51-2]
Length=312

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            ++L+MGGTRFIG++L++LLV+ G  VTLF R   P                 + +  ++G
Sbjct  2    RVLVMGGTRFIGVYLTKLLVERGDDVTLFNRGNKPTP--------------VAGVETVRG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K +LA + FD V+D NGREAV+ +P+++
Sbjct  48   DRKDVRQLKEALAGKEFDAVFDNNGREAVDTQPLVE  83



>ref|WP_013320753.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 7822]
 gb|ADN12643.1| NAD-dependent epimerase/dehydratase [Cyanothece sp. PCC 7822]
Length=311

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG+FL+++LVK+GH+V LF R   P+    P E           +  + G
Sbjct  2    RILIMGGTRFIGVFLTKILVKQGHEVVLFNRGNKPV----PIEG----------VEQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  LA + FD ++D NGRE  + +P+
Sbjct  48   DRQDPVQLKEKLANQKFDAIFDNNGRELNDTQPL  81



>ref|WP_007305255.1| similar to Nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii]
 gb|EAM51128.1| similar to Nucleoside-diphosphate-sugar epimerases [Crocosphaera 
watsonii WH 8501]
Length=311

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++ LVK+GH+V LF R   P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTKELVKKGHEVVLFNRGNKPA----PIEG----------IKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  LA+E F+ ++D NGRE  + +P+++
Sbjct  48   DRKDATQLKEKLASESFEAIFDNNGRELSDTQPLIE  83



>ref|WP_006668390.1| NAD-dependent epimerase/dehydratase [Arthrospira maxima]
 gb|EDZ96251.1| NAD-dependent epimerase/dehydratase [Arthrospira maxima CS-328]
Length=311

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 54/96 (56%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV  GH V LF R   P                   I  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVSHGHDVVLFNRGNKPSP--------------VDGIKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + +K  L+ E FDV++D NGR+  + +P+ D
Sbjct  48   DRTDANQLKEKLSGETFDVIFDNNGRQLSDTQPLAD  83



>ref|WP_035760106.1| 3-beta hydroxysteroid dehydrogenase [Arthrospira platensis]
Length=311

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 54/96 (56%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV  GH V LF R   P                   I  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVSHGHDVVLFNRGNKPSP--------------VDGIKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + +K  L+ E FDV++D NGR+  + +P+ D
Sbjct  48   DRTDANQLKEKLSGETFDVIFDNNGRQLSDTQPLAD  83



>ref|WP_006620185.1| NAD-dependent epimerase/dehydratase [Arthrospira platensis]
 dbj|BAI92738.1| mRNA-binding protein [Arthrospira platensis NIES-39]
 gb|KDR54064.1| 3-beta hydroxysteroid dehydrogenase [Arthrospira platensis str. 
Paraca]
Length=311

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 57/96 (59%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV +GH+V LF R   P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTKILVSQGHEVVLFNRGNKP----SPVEG----------IKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   ++  L+ E FDV++D NGR+  + +P+ D
Sbjct  48   DRTDSQQLQEKLSGETFDVIFDNNGRQLSDTQPLAD  83



>gb|EKD07761.1| NAD-dependent epimerase/dehydratase [Arthrospira platensis C1]
Length=314

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 54/96 (56%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV  GH V LF R   P                   I  + G
Sbjct  5    RILIMGGTRFIGVYLTKILVSHGHDVVLFNRGNKPSP--------------VDGIKQIHG  50

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + +K  L+ E FDV++D NGR+  + +P+ D
Sbjct  51   DRTDANQLKEKLSGETFDVIFDNNGRQLSDTQPLAD  86



>ref|WP_026720806.1| 3-beta hydroxysteroid dehydrogenase [Fischerella sp. PCC 9431]
Length=311

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV++GH+V LF R   P+  +  G+              + G
Sbjct  2    RILIMGGTRFIGVYLTQLLVQQGHEVVLFNRGNRPVPVEGVGQ--------------ITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR +   +K  L+ E FD ++D NGRE  + +P+
Sbjct  48   DRTNSIQLKEKLSQENFDAIFDNNGRELTDTQPL  81



>ref|WP_015192645.1| NAD-dependent epimerase/dehydratase [Stanieria cyanosphaera]
 gb|AFZ34973.1| NAD-dependent epimerase/dehydratase [Stanieria cyanosphaera PCC 
7437]
Length=311

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 57/96 (59%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV++GH+V LF R   P     P E           +  ++G
Sbjct  2    RILIMGGTRFIGVYLTKILVQQGHEVVLFNRGNKPA----PIEG----------VQQIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  L    FD V+D NGRE  + +P+++
Sbjct  48   DRKDTALLKEKLGQTSFDAVFDNNGRELSDTQPLVE  83



>ref|WP_015187023.1| NAD-dependent epimerase/dehydratase [Gloeocapsa sp. PCC 7428]
 gb|AFZ29146.1| NAD-dependent epimerase/dehydratase [Gloeocapsa sp. PCC 7428]
Length=314

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L+R LV +GH+V LF R   P+                + +  + G
Sbjct  2    RILVMGGTRFIGVYLTRKLVAQGHEVVLFNRGNRPLP--------------VAGVAQITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR   D +K  L+++ FDV++D NGRE  + +P+
Sbjct  48   DRTHADDLKEKLSSQNFDVIFDNNGRELSDTQPL  81



>ref|WP_017299031.1| mRNA binding protein [Nodosilinea nodulosa]
Length=310

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            ++L+MGGTRFIG++L++LL+++GH+V LF R   P     P E           +  + G
Sbjct  2    RVLVMGGTRFIGVYLTKLLIEQGHEVVLFNRGNRPA----PVEG----------VPTIVG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K+ LA E FD ++D NGRE  + +P+++
Sbjct  48   DRTDPSSLKTQLAGETFDAIFDNNGRELSDTQPLIE  83



>ref|WP_044194679.1| 3-beta hydroxysteroid dehydrogenase [Oscillatoria acuminata]
Length=310

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 57/96 (59%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L+++LV++GH V LF R   P     P E           +  + G
Sbjct  2    RILMMGGTRFIGVYLTKILVEQGHSVVLFNRGNKPA----PVEG----------VEQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  LA+E FD ++D NGRE  + +P+ D
Sbjct  48   DRTDESQLKEKLASEQFDAIFDNNGRELSDTKPLAD  83



>ref|WP_028089840.1| 3-beta hydroxysteroid dehydrogenase [Dolichospermum circinale]
Length=310

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL++GGTRFIG++L++LL+K GH+V LF R   P                 S +  + G
Sbjct  2    RILVIGGTRFIGVYLTQLLLKAGHEVVLFNRGNHPTP---------------SGVGQIIG  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D + ++  LA E FDVV+D NGRE  + +P+
Sbjct  47   DRTDPNQLREKLAQETFDVVFDNNGRELADTQPL  80



>ref|WP_040939413.1| 3-beta hydroxysteroid dehydrogenase [Prochloron didemni]
Length=311

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            ++LIMGGTRFIG++L+++LV +GH+V LF R   P     P E           I  +KG
Sbjct  2    RVLIMGGTRFIGVYLTKILVGQGHEVVLFNRGNKPA----PVEG----------IQQIKG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FDV++D NGR+  + +P+
Sbjct  48   DRQDPSQLKEKLSRETFDVIFDNNGRQLRDTQPL  81



>ref|WP_040934604.1| 3-beta hydroxysteroid dehydrogenase [Prochloron didemni]
Length=311

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            ++LIMGGTRFIG++L+++LV +GH+V LF R   P     P E           I  +KG
Sbjct  2    RVLIMGGTRFIGVYLTKILVGQGHEVVLFNRGNKPA----PVEG----------IQQIKG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FDV++D NGR+  + +P+
Sbjct  48   DRQDPSQLKEKLSRETFDVIFDNNGRQLRDTQPL  81



>ref|WP_040944850.1| 3-beta hydroxysteroid dehydrogenase [Prochloron didemni]
Length=311

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            ++LIMGGTRFIG++L+++LV +GH+V LF R   P     P E           I  +KG
Sbjct  2    RVLIMGGTRFIGVYLTKILVGQGHEVVLFNRGNKPA----PVEG----------IQQIKG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FDV++D NGR+  + +P+
Sbjct  48   DRQDPSQLKEKLSRETFDVIFDNNGRQLRDTQPL  81



>ref|WP_012164287.1| NAD-dependent epimerase/dehydratase family protein [Acaryochloris 
marina]
 gb|ABW28931.1| NAD-dependent epimerase/dehydratase family protein [Acaryochloris 
marina MBIC11017]
Length=312

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIGI+LSR+LV +GH V LF R               + A   + +  ++G
Sbjct  2    RILMMGGTRFIGIYLSRILVDQGHDVVLFNR--------------GNHAPAVAGLTQIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K+ LA E FD ++D NGR+  + +P+
Sbjct  48   DRTDAAQLKAKLAHEKFDAIFDNNGRKLSDTQPL  81



>ref|WP_036484619.1| 3-beta hydroxysteroid dehydrogenase [Myxosarcina sp. GI1]
Length=311

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 55/96 (57%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV  GH+V LF R   P                 +++  + G
Sbjct  2    RILIMGGTRFIGVYLTKLLVDRGHEVVLFNRGNNPPP--------------VAEVKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  LA E FD ++D NGRE    +P+++
Sbjct  48   DRKDPSQLKEKLAEESFDAIFDNNGRELEHTKPLVE  83



>ref|WP_007357035.1| MULTISPECIES: NAD-dependent epimerase/dehydratase [Kamptonema]
 emb|CBN57843.1| NAD-dependent epimerase/dehydratase [ [[Oscillatoria] sp. PCC 
6506]
Length=312

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 55/94 (59%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L+++LV +GH+V LF R K P                   +  + G
Sbjct  2    RILMMGGTRFIGVYLTKILVAQGHEVVLFNRGKKPAP--------------VDGVQQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L++E FD ++D NGRE  + +P+
Sbjct  48   DRTDASQLKEKLSSEKFDAIFDNNGRELSDTQPL  81



>ref|WP_008311812.1| nucleoside-diphosphate-sugar epimerase [Leptolyngbya sp. PCC 
6406]
Length=311

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L+RLLV++GH+V L  R   P                 S +  +  
Sbjct  2    RILVMGGTRFIGVYLTRLLVEQGHEVVLLNRGNKPAP--------------VSGVAQIHC  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K++L  + FD ++D NGRE  + +P+++
Sbjct  48   DRKDTTALKTALVGQNFDAIFDNNGREQSDTQPLVE  83



>ref|WP_015209022.1| nucleoside-diphosphate-sugar epimerase [Cylindrospermum stagnale]
 gb|AFZ25774.1| nucleoside-diphosphate-sugar epimerase [Cylindrospermum stagnale 
PCC 7417]
Length=312

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 13/94 (14%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L++ LV+ GH+V LF R   P A  L G            +  + G
Sbjct  2    RILIIGGTRFIGVYLTQQLVEAGHEVVLFNRGNRP-APSLQG------------VGQIIG  48

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K+ LA E FDV++D NGRE  + +P+
Sbjct  49   DRTDATVLKAKLAQETFDVIFDNNGRELTDTQPL  82



>ref|WP_010872094.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_440784.1| hypothetical protein slr1540 [Synechocystis sp. PCC 6803]
 dbj|BAA17464.1| slr1540 [Synechocystis sp. PCC 6803]
 dbj|BAK49638.1| hypothetical protein SYNGTS_0890 [Synechocystis sp. PCC 6803]
 dbj|BAL28637.1| hypothetical protein SYNGTI_0890 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL31806.1| hypothetical protein SYNPCCN_0889 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL34975.1| hypothetical protein SYNPCCP_0889 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM51193.1| hypothetical protein BEST7613_2262 [Synechocystis sp. PCC 6803]
 gb|AGF51153.1| hypothetical protein MYO_18960 [Synechocystis sp. PCC 6803]
Length=311

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 55/96 (57%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIGI L R+LV +GH+V LF R   P              D  + +  + G
Sbjct  2    RILIMGGTRFIGIHLCRVLVAQGHEVVLFNRGNRP--------------DPVNGVAQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR   + ++  L  E FDV++D NGRE  + +P++D
Sbjct  48   DRRVAEQLREKLEKEEFDVIFDNNGRELSDTQPLVD  83



>ref|WP_015141031.1| nucleoside-diphosphate-sugar epimerase [Nostoc sp. PCC 7524]
 gb|AFY50621.1| nucleoside-diphosphate-sugar epimerase [Nostoc sp. PCC 7524]
Length=312

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 13/94 (14%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LV++GH+V LF R   P+   L G            +  + G
Sbjct  2    RILIMGGTRFIGVYLTQILVEQGHEVVLFNRGNRPLP-NLQG------------VGQIIG  48

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L  E FDV++D NGRE  + +P+
Sbjct  49   DRTDPTQLKEKLLQENFDVIFDNNGRELSDTQPL  82



>ref|WP_015128322.1| NAD-dependent epimerase/dehydratase [Calothrix sp. PCC 7507]
 gb|AFY32508.1| NAD-dependent epimerase/dehydratase [Calothrix sp. PCC 7507]
Length=312

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 13/94 (14%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++ LV++GHQV LF R    +   L G            +  + G
Sbjct  2    RILIMGGTRFIGVYLTQRLVEQGHQVVLFNRGNRAVP-SLQG------------VEQIIG  48

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K+ L+ E FDV++D NGRE  + +P+
Sbjct  49   DRTDATQLKAKLSQENFDVIFDNNGRELTDTQPL  82



>ref|WP_012409863.1| NAD-dependent epimerase/dehydratase [Nostoc punctiforme]
 gb|ACC81889.1| NAD-dependent epimerase/dehydratase [Nostoc punctiforme PCC 73102]
Length=312

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 58/94 (62%), Gaps = 13/94 (14%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIGI+L++LLV++GH+V LF R          G   +       +I+   G
Sbjct  2    RILIMGGTRFIGIYLTQLLVEQGHEVVLFNR----------GNRATPSLQGVGQII---G  48

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K+ L+ E FDV++D NGRE  + +P+
Sbjct  49   DRTDPTQLKAKLSQESFDVIFDNNGRELTDTQPL  82



>ref|WP_027838844.1| 3-beta hydroxysteroid dehydrogenase [Mastigocoleus testarum]
Length=311

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV+ GH+V LF R   P+     G+              + G
Sbjct  2    RILIMGGTRFIGVYLTKLLVEAGHEVILFNRGNRPLPVNGVGQ--------------IIG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   ++  L  E FDVV+D NGRE  + +P+
Sbjct  48   DRKDPSQLQEKLGKERFDVVFDNNGRELTDTQPL  81



>ref|WP_024546780.1| 3-beta hydroxysteroid dehydrogenase [Synechococcus sp. NKBG15041c]
Length=310

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (59%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L+++L K GH+V LF R   P                 + +  + G
Sbjct  2    RILIIGGTRFIGVYLTQVLQKAGHEVVLFNRGNHPA---------------PAGVGQIVG  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D + +K+ LA E FDVV+D NGRE    +P+
Sbjct  47   DRQDPEQLKTKLAGESFDVVFDNNGRELAHTKPL  80



>ref|WP_015201958.1| NAD-dependent epimerase/dehydratase [Crinalium epipsammum]
 gb|AFZ11836.1| NAD-dependent epimerase/dehydratase [Crinalium epipsammum PCC 
9333]
Length=313

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG+ L+++LV++GH+V LF R   P     P E           +  + G
Sbjct  2    RILIMGGTRFIGVSLTKILVEQGHEVVLFNRGNKP----APVEG----------VQQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L++E FD ++D NGRE  + +P+
Sbjct  48   DRTDASQLKDKLSSEKFDAIFDNNGRELSDTQPL  81



>ref|WP_026098387.1| 3-beta hydroxysteroid dehydrogenase [Oscillatoria sp. PCC 10802]
Length=311

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 54/94 (57%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L+++L++ GH V LF R   P     P E           +  + G
Sbjct  2    RILMMGGTRFIGVYLTKILIERGHDVVLFNRGNKPA----PVEG----------VKQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  LA E FD +YD NGRE  + +P+
Sbjct  48   DRTDAAQLKEKLAGEEFDAIYDNNGRELSDTQPL  81



>ref|WP_026082416.1| 3-beta hydroxysteroid dehydrogenase [Mastigocladopsis repens]
Length=311

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L++LLV++GH+V LF R   P     P E           +  + G
Sbjct  2    RILIVGGTRFIGVYLTKLLVEQGHEVVLFNRGNRPA----PIEG----------VEQITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FD ++D NGRE  + +P+
Sbjct  48   DRTDAAQLKEKLSNENFDAIFDNNGRELSDTQPL  81



>ref|WP_028084850.1| 3-beta hydroxysteroid dehydrogenase [Dolichospermum circinale]
Length=317

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 60/97 (62%), Gaps = 14/97 (14%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQ---QLPGESDSDFADFSSKILH  418
            +IL++GGTRFIG++L++LL+K GH+V LF R   P      Q+ G+ ++           
Sbjct  2    RILVIGGTRFIGVYLTQLLLKAGHEVVLFNRGNHPTPSGVGQIIGDREA-----------  50

Query  419  LKGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            L+ +R D + ++  LA E FDVV+D NGRE  + +P+
Sbjct  51   LRRNRTDPNQLREKLAQETFDVVFDNNGRELADTQPL  87



>ref|WP_037221707.1| 3-beta hydroxysteroid dehydrogenase [Richelia intracellularis]
 emb|CDN14481.1| Ribosome-associated endonuclease, involved in final steps of 
23S rRNA maturation [Richelia intracellularis]
Length=310

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 60/98 (61%), Gaps = 18/98 (18%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            +ILIMGGTRFIG+ L+++LV++GH+V LF R    AP+ Q                +  +
Sbjct  2    RILIMGGTRFIGVHLTQILVEQGHEVVLFNRGNLPAPVPQ----------------VKTI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
             GDR D   +K  LA E FD+++D NGR+ ++ +P+++
Sbjct  46   IGDRTDATELKDKLATEDFDIIFDNNGRKLIDTKPLVE  83



>ref|WP_036003372.1| 3-beta hydroxysteroid dehydrogenase [Leptolyngbya sp. JSC-1]
Length=311

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 57/96 (59%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+RLL  + H V LF R   P +  +  +              ++G
Sbjct  2    RILIMGGTRFIGVYLTRLLTAQEHDVVLFNRGNRPASLGIEKQ--------------IQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + +K+ LA E FD ++D NGRE  + +P+++
Sbjct  48   DRTDPEALKTKLADEEFDAIFDNNGRELSDTQPLVE  83



>ref|WP_017710841.1| hypothetical protein [Prochlorothrix hollandica]
Length=313

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 57/96 (59%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L++ LV +GH V LF R   P                 + +  + G
Sbjct  2    RILVMGGTRFIGVYLTQQLVSQGHDVVLFNRGNRPSP--------------VAGVTQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K++L+ + FDV++D NGRE  + +P+++
Sbjct  48   DRTDAAQLKANLSDQSFDVIFDNNGRELADTQPLVE  83



>ref|WP_010475080.1| NAD-dependent epimerase/dehydratase family protein [Acaryochloris 
sp. CCMEE 5410]
Length=312

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIGI+LS++L  +GH V LF R               + A   + +  ++G
Sbjct  2    RILMMGGTRFIGIYLSQILADQGHDVVLFNR--------------GNHAPAVAGLTQIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +KS LA E FD ++D NGR+  + +P+
Sbjct  48   DRTDAAQLKSKLAHEKFDAIFDNNGRKLSDTQPL  81



>ref|WP_015213760.1| NAD-dependent epimerase/dehydratase [Anabaena cylindrica]
 gb|AFZ57111.1| NAD-dependent epimerase/dehydratase [Anabaena cylindrica PCC 
7122]
Length=310

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (60%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL++GGTRFIG++L++LLV+ GH+V LF R   P  +                +  + G
Sbjct  2    RILVIGGTRFIGVYLTQLLVEAGHEVVLFNRGNFPAPE---------------AVGQIIG  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K+ L+ E FDV++D NGRE  + +P+
Sbjct  47   DRTDPSQLKAKLSQENFDVIFDNNGRELTDTQPL  80



>ref|WP_015134607.1| NAD-dependent epimerase/dehydratase [Leptolyngbya sp. PCC 7376]
 gb|AFY38851.1| NAD-dependent epimerase/dehydratase [Leptolyngbya sp. PCC 7376]
Length=309

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L+++L++ GH+V LF R   P  +                +  ++G
Sbjct  2    RILIIGGTRFIGVYLTQILLEAGHEVVLFNRGNHPAPE---------------GVTQIQG  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  LA E FD V+D NGRE    +P+
Sbjct  47   DRKDPAQLKEKLAGESFDAVFDNNGRELAHTQPL  80



>gb|KIJ82501.1| 3-beta hydroxysteroid dehydrogenase [Scytonema tolypothrichoides 
VB-61278]
Length=311

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 55/94 (59%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L+RLLV++GH V LF R   P     P E           +  + G
Sbjct  2    RILVMGGTRFIGVYLTRLLVEQGHSVVLFNRGNRPA----PVEG----------VEQIWG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L++  FD ++D NGRE  + +P+
Sbjct  48   DRTDAAQLKEKLSSVNFDAIFDNNGRELTDTQPL  81



>ref|WP_040687491.1| 3-beta hydroxysteroid dehydrogenase [Pseudanabaena biceps]
Length=316

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 57/96 (59%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KIL+MGGTRFIG+ L +LLV +GH+VTLF R K P          S  A   + I    G
Sbjct  2    KILVMGGTRFIGVSLVKLLVSQGHEVTLFNRGKKP----------SPIAGLRTII----G  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   ++  L  E F+V++D NGRE  + +P+++
Sbjct  48   DRTDPQQLQDKLRGESFEVIFDNNGRELSDTQPLVE  83



>ref|WP_015115713.1| NAD-dependent epimerase/dehydratase [Nostoc sp. PCC 7107]
 gb|AFY45525.1| NAD-dependent epimerase/dehydratase [Nostoc sp. PCC 7107]
Length=310

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++L+++GH+V LF R    +                S +  + G
Sbjct  2    RILIMGGTRFIGVYLTQILLEQGHEVVLFNRGNRSVP---------------SGVGQIIG  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L+ E FD+++D NGRE  + +P+
Sbjct  47   DRTDAAQLKEKLSQENFDIIFDNNGRELSDTQPL  80



>ref|WP_017321687.1| mRNA binding protein [cyanobacterium PCC 7702]
Length=311

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRF+G++L++LLV++GH+V LF R   P+                + +  + G
Sbjct  2    RILIVGGTRFVGVYLTQLLVQQGHEVVLFNRGNRPVP--------------VAGVEQITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR +   ++  LA E FD ++D NGRE  + +P+
Sbjct  48   DRTNAPQLQEKLAQENFDAIFDNNGRELSDTQPL  81



>ref|WP_026148475.1| 3-beta hydroxysteroid dehydrogenase [Leptolyngbya boryana]
Length=308

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 57/94 (61%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L++LLV++GH VTLF R   P     P E           +  + G
Sbjct  2    RILIMGGTRFIGVYLTQLLVQQGHDVTLFNRGNKPA----PVEG----------VKQVTG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR + D +K  LA+  FD V+D NGRE  + +P+
Sbjct  48   DRTNADDLK-QLASLDFDAVFDNNGRELSDTQPL  80



>ref|WP_016950568.1| mRNA binding protein [Anabaena sp. PCC 7108]
Length=310

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L++LL++ GH+V  F R  +P                   +  + G
Sbjct  2    RILIIGGTRFIGVYLTQLLLETGHEVVFFNRGNSPAPM---------------GVGQIIG  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K+ L+ E FDV++D NGRE  + +P+
Sbjct  47   DRTDSSQLKAKLSPENFDVIFDNNGRELADTQPL  80



>ref|WP_002769800.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI03640.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9443]
Length=311

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 18/97 (19%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            KILIMGGTRFIG+ L+++LV++GH+V LF R    AP+A                 +  +
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAPVA----------------GVRQI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPIL  532
             GDR D   +K  L  E F+ ++D NGRE  + +P++
Sbjct  46   HGDRTDASQLKEKLKNESFEAIFDNNGRELSDTQPLV  82



>ref|WP_026093134.1| 3-beta hydroxysteroid dehydrogenase [Calothrix sp. PCC 7103]
Length=313

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIGI+L++ LV++GH+V LF R   P                 S +  + G
Sbjct  2    RILIMGGTRFIGIYLTQQLVEQGHEVVLFNRGNRPAP--------------VSGVEVITG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR + + +K  L  E FD ++D NGRE  + +P+
Sbjct  48   DRTNPEQLKQKLQGEKFDAIFDNNGRELTDTQPL  81



>ref|WP_008185637.1| nucleoside-diphosphate-sugar epimerase [Moorea producens]
 gb|EGJ31860.1| nucleoside-diphosphate-sugar epimerase [Moorea producens 3L]
Length=312

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRF+G++L+++LV+ GH+V LF R   P    LPG            +  + G
Sbjct  2    RILIMGGTRFVGVYLTKVLVEMGHEVVLFNRGNKPAP--LPG------------VQQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + +K  L+++ FD ++D N RE  + +P+++
Sbjct  48   DRKDPNQLKEMLSSQEFDGIFDNNARELSDTQPLVE  83



>ref|WP_023072519.1| nucleoside-diphosphate-sugar epimerase [Leptolyngbya sp. Heron 
Island J]
 gb|ESA36691.1| nucleoside-diphosphate-sugar epimerase [Leptolyngbya sp. Heron 
Island J]
Length=305

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 15/96 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L+RLL+  GH VTL  R    + Q                +  ++ 
Sbjct  2    RILVMGGTRFIGVYLTRLLLAAGHTVTLLNRGNRSVPQ---------------GVEVVRC  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR   D +K++LA + FD +YD NGRE  + +P+++
Sbjct  47   DRKSPDDLKTALAGKTFDAIYDNNGRELSDTQPLVE  82



>ref|WP_041040676.1| 3-beta hydroxysteroid dehydrogenase [Tolypothrix campylonemoides]
 gb|KIJ73728.1| 3-beta hydroxysteroid dehydrogenase [Tolypothrix campylonemoides 
VB511288]
Length=311

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L++LLV++GH+V LF R   P   +  G+              + G
Sbjct  2    RILIVGGTRFIGVYLTKLLVEQGHEVVLFNRGNRPAPVEGVGQ--------------IIG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  L++  FD V+D NGRE  + +P+
Sbjct  48   DRTDAAQLKEKLSSINFDAVFDNNGRELTDTQPL  81



>gb|AFY81185.1| nucleoside-diphosphate-sugar epimerase [Oscillatoria acuminata 
PCC 6304]
Length=306

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 54/93 (58%), Gaps = 14/93 (15%)
 Frame = +2

Query  257  IMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKGDRM  436
            +MGGTRFIG++L+++LV++GH V LF R   P     P E           +  + GDR 
Sbjct  1    MMGGTRFIGVYLTKILVEQGHSVVLFNRGNKPA----PVEG----------VEQIHGDRT  46

Query  437  DFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            D   +K  LA+E FD ++D NGRE  + +P+ D
Sbjct  47   DESQLKEKLASEQFDAIFDNNGRELSDTKPLAD  79



>ref|WP_018397750.1| mRNA binding protein [filamentous cyanobacterium ESFC-1]
Length=309

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+++LVK+ H+V LF R   P                   I  + G
Sbjct  2    RILIMGGTRFIGVYLTQILVKQNHEVVLFNRGNNPPP--------------VDNIEQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR   + +K+ LA + FD ++D NGRE    +P+
Sbjct  48   DRKSPEDLKAKLAGQDFDAIFDNNGRELSHTQPL  81



>ref|WP_039204130.1| 3-beta hydroxysteroid dehydrogenase [Aphanizomenon flos-aquae]
 gb|KHG39485.1| 3-beta hydroxysteroid dehydrogenase [Aphanizomenon flos-aquae 
2012/KM1/D3]
 gb|KHG39662.1| 3-beta hydroxysteroid dehydrogenase [Aphanizomenon flos-aquae 
2012/KM1/D3]
Length=310

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL++GGTRFIG++L+ LL+K GH+V LF R   P                 + +  + G
Sbjct  2    RILVIGGTRFIGVYLTELLMKAGHEVVLFNRGNHPA---------------PAGVGQIIG  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR +   ++  LA E FDVV+D NGRE  + +P+
Sbjct  47   DRTNSTQLQEKLAPESFDVVFDNNGRELTDTQPL  80



>ref|WP_002755819.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH93825.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9432]
Length=311

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 57/98 (58%), Gaps = 18/98 (18%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            KILIMGGTRFIG+ L+++LV++GH+V LF R    AP+A                 +  +
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAPVA----------------GVRQI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
             GDR D   +K  L  E F+ ++D NGRE  + +P+++
Sbjct  46   HGDRTDPGQLKEKLKNESFEAIFDNNGRELSDTQPLVE  83



>ref|WP_024970517.1| 3-beta hydroxysteroid dehydrogenase [Microcystis aeruginosa]
Length=311

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 57/98 (58%), Gaps = 18/98 (18%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            KILIMGGTRFIG+ L+++LV++GH+V LF R    AP+A                 +  +
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAPVA----------------GVQQI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
             GDR D   +K  L  E F+ ++D NGRE  + +P+++
Sbjct  46   HGDRTDPGQLKEKLKNESFEAIFDNNGRELSDTQPLVE  83



>ref|WP_013191582.1| NAD-dependent epimerase/dehydratase [Trichormus azollae]
 gb|ADI64566.1| NAD-dependent epimerase/dehydratase ['Nostoc azollae' 0708]
Length=310

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL++GGTRFIG++L++LLV+ GH+V LF R   P+             D   +I+   G
Sbjct  2    RILVIGGTRFIGVYLTQLLVEVGHEVVLFNRGNHPV------------PDGVGQII---G  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +   LA E FDV++D NGRE  + +P+
Sbjct  47   DRTDSTQLTEKLAQEEFDVIFDNNGRELADTKPL  80



>ref|WP_016514465.1| dTDP-glucose 4,6-dehydratase [Microcystis aeruginosa]
 gb|EPF24510.1| dTDP-glucose 4,6-dehydratase [Microcystis aeruginosa SPC777]
 gb|EPF24659.1| dTDP-glucose 4,6-dehydratase [Microcystis aeruginosa SPC777]
Length=311

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KILIMGGTRFIG+ L+++LV++GH+V LF R   P                 + +  + G
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAP--------------VAGVRQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  L  E F+ ++D NGRE  + +P+++
Sbjct  48   DRTDPGQLKEKLKNESFEAIFDNNGRELSDTQPLVE  83



>ref|WP_002792534.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI22356.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9808]
Length=311

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 57/98 (58%), Gaps = 18/98 (18%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            KILIMGGTRFIG+ L+++LV++GH+V LF R    AP+A                 +  +
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAPVA----------------GVRQI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
             GDR D   +K  L  E F+ ++D NGRE  + +P+++
Sbjct  46   HGDRTDPRQLKEKLKNESFEAIFDNNGRELSDTQPLVE  83



>ref|WP_002775701.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI06125.1| conserved hypothetical protein [Microcystis aeruginosa PCC 7941]
Length=311

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KILIMGGTRFIG+ L+++LV++GH+V LF R   P                 + +  + G
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAP--------------VAGVRQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  L  E F+ ++D NGRE  + +P+++
Sbjct  48   DRTDPGQLKEKLENESFEAIFDNNGRELSDTQPLVE  83



>ref|WP_012267203.1| NAD-dependent epimerase/dehydratase [Microcystis aeruginosa]
 dbj|BAG04470.1| NAD-dependent epimerase/dehydratase [Microcystis aeruginosa NIES-843]
Length=313

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KILIMGGTRFIG+ L+++LV++GH+V LF R   P                 + +  + G
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAP--------------VAGVRQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  L  E F+ ++D NGRE  + +P+++
Sbjct  48   DRTDPAQLKEKLKNESFEAIFDNNGRELSDTQPLVE  83



>ref|WP_015218019.1| NAD-dependent epimerase/dehydratase [Cyanobacterium aponinum]
 gb|AFZ52287.1| NAD-dependent epimerase/dehydratase [Cyanobacterium aponinum 
PCC 10605]
Length=310

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG+ L+++LV +GH+V LF R   P                 + I  + G
Sbjct  2    RILIMGGTRFIGVSLTKILVAQGHEVVLFNRGNKPAP--------------VNGIEQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR +   +K  LA + FD ++D NGRE  + +P+++
Sbjct  48   DRTNASELKDKLAGQKFDAIFDNNGRELKDTKPLVE  83



>ref|WP_002801594.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI39175.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701]
Length=311

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KILIMGGTRFIG+ L+++LV++GH+V LF R   P                 + +  + G
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAP--------------VAGVRQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  L  E F+ ++D NGRE  + +P+++
Sbjct  48   DRTDPAQLKEKLKNESFEAIFDNNGRELSDTQPLVE  83



>ref|WP_015078767.1| NAD-dependent epimerase/dehydratase [Anabaena sp. 90]
 gb|AFW93603.1| NAD-dependent epimerase/dehydratase [Anabaena sp. 90]
Length=310

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 57/96 (59%), Gaps = 19/96 (20%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            +IL++GGTRFIG++L++LL+K+GH+V LF R    AP                 + +  +
Sbjct  2    RILVIGGTRFIGVYLTQLLIKDGHEVVLFNRGNHAAP-----------------AGVGQI  44

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
             GDR +   ++  LA E FDVV+D NGRE  + +P+
Sbjct  45   IGDRTNSTQLQEKLAPESFDVVFDNNGRELTDTQPL  80



>ref|WP_002786512.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI15631.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9807]
Length=311

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 57/98 (58%), Gaps = 18/98 (18%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            KILIMGGTRFIG+ L+++LV++GH+V LF R    AP+A                 +  +
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAPVA----------------GVRQI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
             GDR D   +K  L  E F+ ++D NGRE  + +P+++
Sbjct  46   HGDRTDAAQLKEKLKNEDFEAIFDNNGRELRDTQPLVE  83



>ref|WP_035149086.1| 3-beta hydroxysteroid dehydrogenase [Calothrix sp. 336/3]
 gb|KFB81632.1| 3-beta hydroxysteroid dehydrogenase [Calothrix sp. 336/3]
Length=312

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L++LLV  GH V LF R      + LP           + +  + G
Sbjct  2    RILVMGGTRFIGVYLTKLLVAAGHDVVLFNRGN----RSLP----------VAGVGQIIG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K++LA E FD ++D NGRE  + +P+
Sbjct  48   DRTDAAQLKATLATEKFDAIFDNNGRELGDSQPL  81



>ref|WP_004160761.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI13248.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9806]
Length=311

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KILIMGGTRFIG+ L+++LV++GH+V LF R   P                 + +  + G
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAP--------------VAGVRQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  L  E F+ ++D NGRE  + +P+++
Sbjct  48   DRTDPAQLKEKLKNEDFEAIFDNNGRELSDTQPLVE  83



>ref|WP_039899813.1| 3-beta hydroxysteroid dehydrogenase [Microcystis sp. T1-4]
Length=311

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KILIMGGTRFIG+ L+++LV++GH+V LF R   P                 + +  + G
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAP--------------VAGVRQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  L  E F+ ++D NGRE  + +P+++
Sbjct  48   DRTDPAQLKEKLKNESFEAIFDNNGRELRDTQPLVE  83



>emb|CCI26921.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9809]
Length=316

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 18/97 (19%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            KILIMGGTRFIG+ L+++LV++GH+V LF R    AP+A                 +  +
Sbjct  5    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAPVA----------------GVRQI  48

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPIL  532
             GDR D   +K  L  E F+ ++D NGRE  + +P++
Sbjct  49   HGDRTDPAQLKEKLKNESFEAIFDNNGRELSDTQPLV  85



>ref|WP_044034560.1| 3-beta hydroxysteroid dehydrogenase [Microcystis aeruginosa]
Length=313

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 18/97 (19%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            KILIMGGTRFIG+ L+++LV++GH+V LF R    AP+A                 +  +
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAPVA----------------GVRQI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPIL  532
             GDR D   +K  L  E F+ ++D NGRE  + +P++
Sbjct  46   HGDRTDPAQLKEKLKNESFEAIFDNNGRELSDTQPLV  82



>emb|CCI31820.1| conserved hypothetical protein [Microcystis sp. T1-4]
Length=314

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 55/96 (57%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KILIMGGTRFIG+ L+++LV++GH+V LF R   P                 + +  + G
Sbjct  5    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAP--------------VAGVRQIHG  50

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  L  E F+ ++D NGRE  + +P+++
Sbjct  51   DRTDPAQLKEKLKNESFEAIFDNNGRELRDTQPLVE  86



>emb|CCH97032.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
Length=314

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 18/97 (19%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            KILIMGGTRFIG+ L+++LV++GH+V LF R    AP+A                 +  +
Sbjct  5    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAPVA----------------GVRQI  48

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPIL  532
             GDR D   +K  L  E F+ ++D NGRE  + +P++
Sbjct  49   HGDRTDPAQLKEKLKNESFEAIFDNNGRELSDTQPLV  85



>dbj|GAL93688.1| ribosome-associated endonuclease [Microcystis aeruginosa NIES-44]
Length=311

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 55/95 (58%), Gaps = 14/95 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KILIMGGTRFIG+ L+++LV++GH+V LF R   P                 + +  ++G
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAP--------------VAGVRQIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPIL  532
            DR D   +K  L  E F+ ++D NGRE  + +P++
Sbjct  48   DRTDPVQLKEKLKNESFEAIFDNNGRELSDTQPLV  82



>ref|WP_043999088.1| 3-beta hydroxysteroid dehydrogenase [Microcystis aeruginosa]
Length=311

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 54/95 (57%), Gaps = 14/95 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KILIMGGTRFIG+ L+++LV++GH+V LF R   P                 + +  + G
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAP--------------VAGVRQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPIL  532
            DR D   +K  L  E F+ ++D NGRE  + +P++
Sbjct  48   DRTDPAQLKEKLKNESFEAIFDNNGRELSDTQPLV  82



>ref|WP_009344170.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Raphidiopsis brookii]
 gb|EFA72077.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Raphidiopsis brookii 
D9]
Length=314

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 16/94 (17%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL++GGTRFIG++L++LL+K GH+V LF R   P                 + +  + G
Sbjct  2    RILVIGGTRFIGVYLTQLLIKAGHEVVLFNRGNHPTP---------------NGVGQVIG  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   + S L+ E FDV++D NGRE  + EP+
Sbjct  47   DRTDPSQL-SKLSQESFDVIFDNNGRELTDTEPL  79



>ref|WP_036018970.1| 3-beta hydroxysteroid dehydrogenase [Leptolyngbya sp. PCC 7375]
Length=305

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 15/96 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L+RLL+  GH+VTL  R   P                   +  ++ 
Sbjct  2    RILVMGGTRFIGVYLTRLLLAAGHRVTLLNRGNRPAP---------------DGVEVVRC  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR   + +K++LA + FD +YD NGRE  + +P+++
Sbjct  47   DRKSPEDLKAALAGKTFDAIYDNNGRELGDTQPLVE  82



>ref|WP_030007518.1| 3-beta hydroxysteroid dehydrogenase [Synechococcus sp. NKBG042902]
Length=310

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 15/94 (16%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L+++L+  GH+V LF R   P                 + +  + G
Sbjct  2    RILIIGGTRFIGVYLTQVLLAAGHEVVLFNRGNHPA---------------PTGVGQIIG  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   +K  LA E FD ++D NGRE    +P+
Sbjct  47   DRQDSAQLKEKLAGETFDAIFDNNGRELAHTQPL  80



>ref|WP_006276648.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Cylindrospermopsis 
raciborskii]
 gb|EFA70459.1| 3-beta hydroxysteroid dehydrogenase/isomerase [Cylindrospermopsis 
raciborskii CS-505]
Length=307

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 16/94 (17%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL++GGTRFIG++L++LL+K GH+V LF R   P              D   +I+   G
Sbjct  2    RILVIGGTRFIGVYLTQLLIKAGHEVVLFNRGNHPA------------PDGVGQII---G  46

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR D   + S L+ E FDV++D NGRE  + EP+
Sbjct  47   DRTDPSQL-SKLSQESFDVIFDNNGRELTDTEPL  79



>ref|WP_002744731.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO87020.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS47406.1| hypothetical protein C789_2809 [Microcystis aeruginosa DIANCHI905]
Length=311

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 57/98 (58%), Gaps = 18/98 (18%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            KILIMGGTRFIG+ L+++LV++GH+V LF R    AP+A                 +  +
Sbjct  2    KILIMGGTRFIGVSLTKVLVEQGHEVVLFNRGNKPAPVA----------------GVRQI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
             GDR D   ++  L  E F+ ++D NGRE  + +P+++
Sbjct  46   HGDRTDPAQLQEKLKNESFEAIFDNNGRELSDTQPLVE  83



>ref|WP_009556999.1| nucleoside-diphosphate-sugar epimerase [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68232.1| nucleoside-diphosphate-sugar epimerase [Oscillatoriales cyanobacterium 
JSC-12]
Length=309

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILIMGGTRFIG++L+RLL ++ H+V LF R   P     P E           I  + G
Sbjct  2    RILIMGGTRFIGVYLTRLLYEKEHEVVLFNRGNKPT----PVEG----------IAQIHG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR +   +K+ L  + FD ++D NGRE  + +P+
Sbjct  48   DRTNPADLKAKLEGQEFDAIFDNNGRELSDTQPL  81



>ref|WP_017296158.1| hypothetical protein [Geminocystis herdmanii]
Length=311

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 55/98 (56%), Gaps = 18/98 (18%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            +ILIMGGTRFIG+ L+++LV +GH+V LF R    AP+                  I  +
Sbjct  2    RILIMGGTRFIGVALTKILVAQGHEVVLFNRGNKSAPV----------------EGIKQI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
              DR D + +K  L  E FD ++D NGRE  + +P+++
Sbjct  46   SCDRKDIESMKEKLKGEKFDAIFDNNGRELSDTQPLVE  83



>ref|WP_019499617.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=316

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 54/96 (56%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            KIL+MGGTRF+G+ L++ LV  GH+V LF R   P     P E           +  +KG
Sbjct  2    KILVMGGTRFMGVALTKKLVDRGHEVVLFNRGNKPA----PVEG----------VRVIKG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D   +K  L+ E FD ++D N RE  + +P+++
Sbjct  48   DRTDAQQLKDKLSGEQFDAIFDNNARELTDTQPLVE  83



>ref|WP_017662831.1| mRNA binding protein [Geitlerinema sp. PCC 7105]
Length=313

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 54/98 (55%), Gaps = 18/98 (18%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*K--APIAQQLPGESDSDFADFSSKILHL  421
            +IL+MGGTRFIG++L++ LV  GH V LF R    AP+                  +  +
Sbjct  2    RILVMGGTRFIGVYLTKQLVNAGHDVVLFNRGNKSAPV----------------EGVSEI  45

Query  422  KGDRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
             GDR D + ++  L+ E FD ++D NGR+  + +P+ D
Sbjct  46   HGDRTDAEQLRDKLSGESFDAIFDNNGRKLGDTQPLAD  83



>ref|WP_006632413.1| NAD-dependent epimerase/dehydratase [Microcoleus vaginatus]
 gb|EGK88606.1| NAD-dependent epimerase/dehydratase [Microcoleus vaginatus FGP-2]
Length=313

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (59%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L+++L  +GH+V LF R   P+                + +  ++G
Sbjct  2    RILMMGGTRFIGVYLTKILAAQGHEVVLFNRGNKPVP--------------VAGVKQIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR + + ++  L+   FD V+D NGRE  + +P+
Sbjct  48   DRTNVEQLQEKLSTVEFDAVFDNNGRELSDTKPL  81



>ref|WP_006454851.1| 3-beta hydroxysteroid dehydrogenase/isomerase family [Synechococcus 
sp. PCC 7335]
 gb|EDX85108.1| 3-beta hydroxysteroid dehydrogenase/isomerase family [Synechococcus 
sp. PCC 7335]
Length=309

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 54/96 (56%), Gaps = 14/96 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            ++L++GGTRFIG++L+R LVK+GH VTL  R   P                  ++  +  
Sbjct  2    RVLVIGGTRFIGVYLTRQLVKQGHAVTLLNRGNHPAP--------------VDEVETIVC  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPILD  535
            DR D + +K +L+ + FD ++D NGRE    +P+ D
Sbjct  48   DRTDPEALKQALSDQSFDAIFDNNGRELAHTKPLAD  83



>ref|WP_015176595.1| NAD-dependent epimerase/dehydratase [Oscillatoria nigro-viridis]
 gb|AFZ07312.1| NAD-dependent epimerase/dehydratase [Oscillatoria nigro-viridis 
PCC 7112]
Length=313

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (59%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +IL+MGGTRFIG++L+++L  +GH+V LF R   P+                + +  ++G
Sbjct  2    RILMMGGTRFIGVYLTKILAAQGHEVVLFNRGNKPVP--------------VAGVKQIQG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR + + ++  L+   FD V+D NGRE  + +P+
Sbjct  48   DRTNVEQLQEKLSTVEFDAVFDNNGRELSDTKPL  81



>ref|WP_009634119.1| nucleoside-diphosphate-sugar epimerase [Synechocystis sp. PCC 
7509]
Length=312

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 14/94 (15%)
 Frame = +2

Query  248  KILIMGGTRFIGIFLSRLLVKEGHQVTLFTR*KAPIAQQLPGESDSDFADFSSKILHLKG  427
            +ILI+GGTRFIG++L++LL   GH+V LF R   P                 S I  + G
Sbjct  2    RILIIGGTRFIGVYLTKLLAATGHEVVLFNRGNHPAP--------------VSGIEQIIG  47

Query  428  DRMDFDFVKSSLAAEGFDVVYDINGREAVEVEPI  529
            DR   D +   L+++ FD ++D NGRE  + +P+
Sbjct  48   DRTVADEITQKLSSQHFDAIFDNNGRELADTQPV  81



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490