BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K05

Length=304
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006346435.1|  PREDICTED: probable LRR receptor-like serine...  89.4    2e-18   Solanum tuberosum [potatoes]
ref|XP_004230793.1|  PREDICTED: probable LRR receptor-like serine...  88.2    5e-18   Solanum lycopersicum
ref|XP_009617369.1|  PREDICTED: probable LRR receptor-like serine...  86.7    2e-17   Nicotiana tomentosiformis
ref|XP_009772535.1|  PREDICTED: probable LRR receptor-like serine...  85.9    4e-17   Nicotiana sylvestris
ref|XP_002518770.1|  serine-threonine protein kinase, plant-type,...  79.3    8e-15   
ref|XP_010521450.1|  PREDICTED: probable LRR receptor-like serine...  78.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_004505211.1|  PREDICTED: probable LRR receptor-like serine...  78.6    2e-14   Cicer arietinum [garbanzo]
ref|XP_010521449.1|  PREDICTED: probable LRR receptor-like serine...  78.2    2e-14   Tarenaya hassleriana [spider flower]
dbj|BAK07987.1|  predicted protein                                    78.2    2e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN31071.1|  Putative LRR receptor-like serine/threonine-prote...  77.8    3e-14   Glycine soja [wild soybean]
gb|EYU37680.1|  hypothetical protein MIMGU_mgv1a004889mg              77.8    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_003528508.2|  PREDICTED: probable LRR receptor-like serine...  77.4    3e-14   Glycine max [soybeans]
ref|XP_011088266.1|  PREDICTED: putative leucine-rich repeat rece...  77.0    4e-14   Sesamum indicum [beniseed]
ref|XP_011088267.1|  PREDICTED: putative leucine-rich repeat rece...  77.0    4e-14   Sesamum indicum [beniseed]
ref|XP_006406523.1|  hypothetical protein EUTSA_v10022285mg           77.0    5e-14   Eutrema salsugineum [saltwater cress]
ref|XP_011000432.1|  PREDICTED: probable LRR receptor-like serine...  75.5    1e-13   Populus euphratica
dbj|BAB02964.1|  unnamed protein product                              75.1    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188554.1|  leucine-rich repeat-containing protein              75.1    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296645.1|  hypothetical protein CARUB_v10015204mg           75.1    2e-13   
ref|XP_002313850.2|  hypothetical protein POPTR_0009s10510g           74.3    4e-13   
gb|AAK92623.1|AC079633_3  Putative protein with similarity to put...  73.9    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010487850.1|  PREDICTED: putative leucine-rich repeat rece...  73.6    8e-13   Camelina sativa [gold-of-pleasure]
ref|NP_001049189.1|  Os03g0184400                                     73.6    8e-13   
ref|XP_010466053.1|  PREDICTED: putative leucine-rich repeat rece...  73.6    8e-13   Camelina sativa [gold-of-pleasure]
gb|EAY88815.1|  hypothetical protein OsI_10287                        73.6    8e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010241286.1|  PREDICTED: putative leucine-rich repeat rece...  73.2    9e-13   
ref|XP_010241285.1|  PREDICTED: putative leucine-rich repeat rece...  73.2    9e-13   Nelumbo nucifera [Indian lotus]
ref|XP_006649517.1|  PREDICTED: probable LRR receptor-like serine...  72.8    1e-12   Oryza brachyantha
gb|AES90183.2|  Serine/Threonine kinase, plant-type protein, puta...  72.8    1e-12   Medicago truncatula
ref|XP_010939430.1|  PREDICTED: probable LRR receptor-like serine...  72.8    1e-12   Elaeis guineensis
ref|XP_003520166.2|  PREDICTED: probable LRR receptor-like serine...  72.4    2e-12   Glycine max [soybeans]
ref|XP_003607986.1|  Receptor-like protein kinase                     72.4    2e-12   
gb|KDP42294.1|  hypothetical protein JCGZ_01618                       71.6    3e-12   Jatropha curcas
ref|XP_004985457.1|  PREDICTED: probable LRR receptor-like serine...  71.6    4e-12   Setaria italica
ref|XP_007156516.1|  hypothetical protein PHAVU_003G292500g           70.5    9e-12   Phaseolus vulgaris [French bean]
gb|KFK39243.1|  hypothetical protein AALP_AA3G219000                  70.5    9e-12   Arabis alpina [alpine rockcress]
ref|XP_010028481.1|  PREDICTED: probable LRR receptor-like serine...  69.7    1e-11   
ref|XP_003561977.1|  PREDICTED: probable leucine-rich repeat rece...  70.1    1e-11   Brachypodium distachyon [annual false brome]
ref|XP_008797310.1|  PREDICTED: probable LRR receptor-like serine...  70.1    1e-11   Phoenix dactylifera
ref|XP_008373156.1|  PREDICTED: putative leucine-rich repeat rece...  70.1    1e-11   Malus domestica [apple tree]
ref|XP_010028480.1|  PREDICTED: probable LRR receptor-like serine...  69.7    2e-11   
ref|XP_010028479.1|  PREDICTED: probable LRR receptor-like serine...  69.7    2e-11   Eucalyptus grandis [rose gum]
ref|XP_010647751.1|  PREDICTED: leucine-rich repeat receptor-like...  67.8    3e-11   
emb|CDX92310.1|  BnaA05g20970D                                        68.6    4e-11   
emb|CDX99256.1|  BnaC05g33710D                                        68.6    4e-11   
ref|XP_009419483.1|  PREDICTED: probable LRR receptor-like serine...  68.2    6e-11   
gb|KJB32383.1|  hypothetical protein B456_005G238300                  67.8    8e-11   Gossypium raimondii
ref|XP_004296071.2|  PREDICTED: putative leucine-rich repeat rece...  67.8    8e-11   Fragaria vesca subsp. vesca
ref|XP_009145818.1|  PREDICTED: putative leucine-rich repeat rece...  67.8    9e-11   Brassica rapa
ref|XP_002282141.2|  PREDICTED: probable LRR receptor-like serine...  67.4    1e-10   Vitis vinifera
ref|XP_002468379.1|  hypothetical protein SORBIDRAFT_01g044920        67.0    1e-10   
ref|XP_004166668.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-10   
ref|XP_004136983.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-10   Cucumis sativus [cucumbers]
gb|KGN43935.1|  hypothetical protein Csa_7G073710                     66.6    2e-10   Cucumis sativus [cucumbers]
ref|XP_008454942.1|  PREDICTED: probable LRR receptor-like serine...  66.6    2e-10   Cucumis melo [Oriental melon]
ref|XP_008236545.1|  PREDICTED: probable LRR receptor-like serine...  65.1    7e-10   
ref|XP_007200685.1|  hypothetical protein PRUPE_ppa017037mg           64.7    8e-10   
ref|XP_010107946.1|  hypothetical protein L484_027536                 64.7    9e-10   
gb|EPS72113.1|  hypothetical protein M569_02646                       64.3    1e-09   Genlisea aurea
gb|KJB12250.1|  hypothetical protein B456_002G007900                  62.4    5e-09   Gossypium raimondii
ref|XP_006851088.1|  hypothetical protein AMTR_s00025p00244550        62.4    6e-09   
ref|XP_008782339.1|  PREDICTED: probable LRR receptor-like serine...  62.0    7e-09   
emb|CBI32418.3|  unnamed protein product                              61.6    1e-08   Vitis vinifera
ref|NP_001063375.1|  Os09g0458300                                     61.2    2e-08   
ref|XP_008660471.1|  PREDICTED: receptor-like protein kinase At3g...  60.8    2e-08   Zea mays [maize]
ref|XP_008660470.1|  PREDICTED: receptor-like protein kinase At3g...  60.8    2e-08   Zea mays [maize]
ref|XP_010255977.1|  PREDICTED: probable LRR receptor-like serine...  60.1    3e-08   
ref|XP_010939431.1|  PREDICTED: probable LRR receptor-like serine...  60.1    4e-08   
gb|EEC84704.1|  hypothetical protein OsI_31653                        59.7    4e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_003578232.1|  PREDICTED: probable LRR receptor-like serine...  59.7    5e-08   Brachypodium distachyon [annual false brome]
ref|XP_009391353.1|  PREDICTED: probable LRR receptor-like serine...  59.7    6e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW89440.1|  hypothetical protein ZEAMMB73_263749                  58.5    1e-07   
gb|EMT12993.1|  Putative LRR receptor-like serine/threonine-prote...  58.5    1e-07   
ref|XP_007042419.1|  Leucine-rich repeat (LRR) family protein, pu...  57.4    3e-07   
ref|XP_010255974.1|  PREDICTED: probable LRR receptor-like serine...  56.2    9e-07   
emb|CDO97171.1|  unnamed protein product                              55.8    1e-06   Coffea canephora [robusta coffee]
ref|XP_006487131.1|  PREDICTED: probable LRR receptor-like serine...  55.1    2e-06   
ref|XP_010666243.1|  PREDICTED: probable LRR receptor-like serine...  53.1    9e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006423028.1|  hypothetical protein CICLE_v10030280mg           53.1    9e-06   
gb|KDO59697.1|  hypothetical protein CISIN_1g042915mg                 53.1    9e-06   Citrus sinensis [apfelsine]
gb|EYU45632.1|  hypothetical protein MIMGU_mgv11b003932mg             52.8    1e-05   Erythranthe guttata [common monkey flower]
ref|XP_003592431.1|  Receptor-like protein kinase                     52.8    1e-05   Medicago truncatula
ref|XP_006660701.1|  PREDICTED: probable LRR receptor-like serine...  52.0    2e-05   Oryza brachyantha
ref|XP_003555335.1|  PREDICTED: putative leucine-rich repeat rece...  51.6    3e-05   Glycine max [soybeans]
ref|XP_003535659.1|  PREDICTED: leucine-rich repeat receptor-like...  51.2    4e-05   Glycine max [soybeans]
ref|XP_004298162.1|  PREDICTED: leucine-rich repeat receptor-like...  50.8    5e-05   Fragaria vesca subsp. vesca
gb|KCW77026.1|  hypothetical protein EUGRSUZ_D01371                   50.4    7e-05   Eucalyptus grandis [rose gum]
ref|XP_006829745.1|  hypothetical protein AMTR_s00126p00126940        50.1    8e-05   
ref|XP_007143225.1|  hypothetical protein PHAVU_007G054600g           49.7    1e-04   Phaseolus vulgaris [French bean]
ref|XP_011071564.1|  PREDICTED: probable LRR receptor-like serine...  49.7    1e-04   Sesamum indicum [beniseed]
gb|KCW49706.1|  hypothetical protein EUGRSUZ_K03208                   49.3    2e-04   Eucalyptus grandis [rose gum]
ref|XP_010037926.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  49.3    2e-04   
ref|XP_010691040.1|  PREDICTED: probable LRR receptor-like serine...  48.9    2e-04   
ref|XP_010691039.1|  PREDICTED: probable LRR receptor-like serine...  48.9    2e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB12545.1|  hypothetical protein B456_002G023600                  48.9    2e-04   Gossypium raimondii
gb|KJB12544.1|  hypothetical protein B456_002G023600                  48.9    2e-04   Gossypium raimondii
ref|XP_010037927.1|  PREDICTED: probable LRR receptor-like serine...  48.1    5e-04   Eucalyptus grandis [rose gum]
ref|XP_008349097.1|  PREDICTED: probable LRR receptor-like serine...  47.8    6e-04   
gb|KCW49705.1|  hypothetical protein EUGRSUZ_K03207                   47.8    6e-04   Eucalyptus grandis [rose gum]



>ref|XP_006346435.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Solanum tuberosum]
Length=504

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = +3

Query  39   ISTSLFFC-LVFFPLIILAXTN-GVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSV  212
            +STS+F   LV  PL I A  N   P+GF LNCGGNE+++  SLT+ PDD++I   NK+ 
Sbjct  1    MSTSIFLLWLVSIPLAIHAAINVNQPQGFLLNCGGNEKIKQDSLTYGPDDRFIKTGNKTE  60

Query  213  VKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
            +KQ+ ++  L+++RYFP +   K+CY+ PV
Sbjct  61   IKQEGLVPLLSSVRYFPDDAEEKFCYNFPV  90



>ref|XP_004230793.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Solanum lycopersicum]
Length=510

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 63/90 (70%), Gaps = 2/90 (2%)
 Frame = +3

Query  39   ISTSLFFC-LVFFPLIILAXTN-GVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSV  212
            +STS+F   LV  PL I A  +   P+GF LNCGGNE+++  SLT+ PDD++I   NKS 
Sbjct  1    MSTSIFLLWLVSIPLTIHAAIDVNQPQGFLLNCGGNEKIQQDSLTYGPDDRFIKTGNKSE  60

Query  213  VKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
            +KQ+ ++  L+++R+FP++   K+CY+ PV
Sbjct  61   IKQEGLVPLLSSVRHFPADAEEKFCYNFPV  90



>ref|XP_009617369.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nicotiana tomentosiformis]
Length=511

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query  39   ISTSLFFC-LVFFPLIILAXTNG--VPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKS  209
            +STS+F   LV  PL I A  N    P GF LNCGG+E++E  SLT+ PDD +I   NKS
Sbjct  1    MSTSIFLLWLVSIPLAIYAAPNNKIQPHGFLLNCGGSEKIEQDSLTYTPDDNFIKTGNKS  60

Query  210  VVKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
             ++Q+ ++  L+++RYFP +   K+CY  PV
Sbjct  61   EIQQEGLVPLLSSVRYFPDDVEEKFCYHFPV  91



>ref|XP_009772535.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nicotiana sylvestris]
Length=511

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +3

Query  39   ISTSLFFC-LVFFPLIILAXTNG--VPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKS  209
            +STS+F   LV  PL I A  N    P GF LNCGG+E++E  SLT+ PDD +I   NKS
Sbjct  1    MSTSIFLLWLVSIPLAIHAAPNKNVQPHGFLLNCGGSEKIEQDSLTYTPDDNFIKTGNKS  60

Query  210  VVKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
             ++Q+ ++  L+++RYFP +   K+CY  PV
Sbjct  61   EIQQEGLVPLLSSVRYFPDDVEEKFCYHFPV  91



>ref|XP_002518770.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43695.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=521

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 3/89 (3%)
 Frame = +3

Query  39   ISTSLF-FCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVV  215
            +S S+F FCLV  P    A +   P+GF LNCG + E+   +L ++PD+ +IS  NKS +
Sbjct  1    MSLSIFLFCLVTIPFS--AHSLPAPRGFPLNCGASHEITQGNLKYIPDEGFISVGNKSSI  58

Query  216  KQQNILLTLTTLRYFPSNKARKWCYSLPV  302
                +L  L+TLRYFP  KARK+CY  P 
Sbjct  59   NTPGLLPLLSTLRYFPDKKARKYCYEFPT  87



>ref|XP_010521450.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase PAM74 isoform X2 [Tarenaya hassleriana]
Length=489

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GFFLNCG +   ++H + + PD+ +I+  N + + QQ++L  L+TLRYFP+  +RK+C
Sbjct  23   PRGFFLNCGSSSPAKVHDINYNPDEGFIAVGNTTTLNQQDLLPILSTLRYFPNKSSRKYC  82

Query  288  YSLPV  302
            YS PV
Sbjct  83   YSFPV  87



>ref|XP_004505211.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g59680-like [Cicer arietinum]
Length=553

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P G+F+NCGG+ EV + SL +VPD  Y    + + + Q ++L TLTTLRYFP+ ++RK+C
Sbjct  83   PLGYFINCGGSNEVTVDSLKYVPDGSYTKVGSVATINQPDLLPTLTTLRYFPNTQSRKFC  142

Query  288  YSLPV  302
            YS PV
Sbjct  143  YSFPV  147



>ref|XP_010521449.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Tarenaya hassleriana]
Length=518

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GFFLNCG +   ++H + + PD+ +I+  N + + QQ++L  L+TLRYFP+  +RK+C
Sbjct  23   PRGFFLNCGSSSPAKVHDINYNPDEGFIAVGNTTTLNQQDLLPILSTLRYFPNKSSRKYC  82

Query  288  YSLPV  302
            YS PV
Sbjct  83   YSFPV  87



>dbj|BAK07987.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=521

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF++NCG ++EV++ S+ +VPD  +I+  N S V + NIL  L TLR+FP   ARK+C
Sbjct  37   PRGFYINCGADKEVQVGSIKWVPDAGFIAVGNASAVDKPNILPVLATLRHFPDATARKYC  96

Query  288  YSLPV  302
            Y++P 
Sbjct  97   YTVPA  101



>gb|KHN31071.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=490

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query  39   ISTSLFF-CLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVV  215
            +S S+F   LV   ++  +    +P  +FL+CGG +EV + +LT++PD+ YI     + +
Sbjct  12   MSPSVFLLWLVIISVLAHSALASIPLAYFLDCGGTKEVTVDNLTYIPDESYIKVGKTTTI  71

Query  216  KQQNILLTLTTLRYFPSNKARKWCYSLPV  302
             + ++L  L+TLRYFP   A+K+CYSLPV
Sbjct  72   NKPDLLPILSTLRYFPDTSAKKYCYSLPV  100



>gb|EYU37680.1| hypothetical protein MIMGU_mgv1a004889mg [Erythranthe guttata]
Length=506

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +3

Query  39   ISTSLFFC-LVFFPLIILAXTNGVPKG-FFLNCGGNEEVELHSLTFVPDDKYISASNKSV  212
            +ST +F   LV  PL I A     P+G + LNCG +E  E   LT++PDD YIS  NK+ 
Sbjct  1    MSTCIFLLWLVSIPLSIHATPQ--PRGNYLLNCGASENAEEGPLTYIPDDNYISTGNKTS  58

Query  213  VKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
            + + +IL  L TLR+FP+  ARK+CY+ PV
Sbjct  59   LNRTDILPRLQTLRFFPNENARKFCYTFPV  88



>ref|XP_003528508.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51810-like [Glycine max]
Length=519

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query  39   ISTSLFFC-LVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVV  215
            +S S+F   LV   ++  +    +P  +FL+CGG +EV + +LT++PD+ YI     + +
Sbjct  12   MSPSVFLLWLVIISVLAHSALASIPLAYFLDCGGTKEVTVDNLTYIPDESYIKVGKTTTI  71

Query  216  KQQNILLTLTTLRYFPSNKARKWCYSLPV  302
             + ++L  L+TLRYFP   A+K+CYSLPV
Sbjct  72   NKPDLLPILSTLRYFPDTSAKKYCYSLPV  100



>ref|XP_011088266.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 isoform X1 [Sesamum indicum]
Length=516

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +3

Query  39   ISTSLFFCL--VFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSV  212
            +ST + F L  V  PL I A  + +P G+ LNCG +EE     L +VPDD +IS  NK+ 
Sbjct  1    MSTCMIFLLWLVSTPLAIHA--DSLPVGYLLNCGADEEAVEGPLKYVPDDHFISTGNKTT  58

Query  213  VKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
            + + +IL  L TLR+FP+ KARK+CYS  V
Sbjct  59   LNRTDILPRLRTLRFFPNAKARKFCYSFSV  88



>ref|XP_011088267.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 isoform X2 [Sesamum indicum]
Length=504

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 57/90 (63%), Gaps = 4/90 (4%)
 Frame = +3

Query  39   ISTSLFFCL--VFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSV  212
            +ST + F L  V  PL I A  + +P G+ LNCG +EE     L +VPDD +IS  NK+ 
Sbjct  1    MSTCMIFLLWLVSTPLAIHA--DSLPVGYLLNCGADEEAVEGPLKYVPDDHFISTGNKTT  58

Query  213  VKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
            + + +IL  L TLR+FP+ KARK+CYS  V
Sbjct  59   LNRTDILPRLRTLRFFPNAKARKFCYSFSV  88



>ref|XP_006406523.1| hypothetical protein EUTSA_v10022285mg [Eutrema salsugineum]
 gb|ESQ47976.1| hypothetical protein EUTSA_v10022285mg [Eutrema salsugineum]
Length=513

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF+LNCG +   +L+ +T+ PD  +IS  N + +KQ+++L  L+TLRYFP   +RK C
Sbjct  20   PRGFYLNCGSSSSTKLNDITYTPDKGFISVGNTTTIKQKDLLPILSTLRYFPDKSSRKHC  79

Query  288  YSLPV  302
            Y+ PV
Sbjct  80   YNFPV  84



>ref|XP_011000432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g59680 [Populus euphratica]
Length=509

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +3

Query  105  VPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKW  284
             P+GF LNCG +E++   +L ++PD  +IS  NKS +K  ++L  L+TLR+FP   A+K+
Sbjct  22   APRGFQLNCGASEDITHGNLKYIPDKGFISVGNKSAIKTADVLPVLSTLRFFPDTSAKKY  81

Query  285  CYSLPV  302
            CY LPV
Sbjct  82   CYVLPV  87



>dbj|BAB02964.1| unnamed protein product [Arabidopsis thaliana]
Length=499

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GFFLNCG +    L+ + + PD+ +IS  N + +KQ++++  L+TLRYFP   +RK C
Sbjct  20   PRGFFLNCGSSSSTNLNEIEYTPDEGFISVGNTTTIKQKDLVPILSTLRYFPDKSSRKHC  79

Query  288  YSLPV  302
            Y+ PV
Sbjct  80   YNFPV  84



>ref|NP_188554.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 gb|AEE76211.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=519

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GFFLNCG +    L+ + + PD+ +IS  N + +KQ++++  L+TLRYFP   +RK C
Sbjct  20   PRGFFLNCGSSSSTNLNEIEYTPDEGFISVGNTTTIKQKDLVPILSTLRYFPDKSSRKHC  79

Query  288  YSLPV  302
            Y+ PV
Sbjct  80   YNFPV  84



>ref|XP_006296645.1| hypothetical protein CARUB_v10015204mg [Capsella rubella]
 gb|EOA29543.1| hypothetical protein CARUB_v10015204mg [Capsella rubella]
Length=513

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GFFLNCG +    L+ + + PD+ +IS  N + +KQ++++  L+TLRYFP   +RK C
Sbjct  21   PRGFFLNCGSSSTTNLNEIDYTPDEGFISVGNTTTIKQKDLVPILSTLRYFPDKSSRKHC  80

Query  288  YSLPV  302
            Y+ PV
Sbjct  81   YNFPV  85



>ref|XP_002313850.2| hypothetical protein POPTR_0009s10510g [Populus trichocarpa]
 gb|EEE87805.2| hypothetical protein POPTR_0009s10510g [Populus trichocarpa]
Length=504

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  105  VPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKW  284
             P GF LNCG +E++   +L ++PD  +IS  NKS +K  ++L  L+TLR+FP   A+K+
Sbjct  22   APGGFQLNCGASEDITHGNLKYIPDKGFISVGNKSAIKTADVLPVLSTLRFFPDTSAKKY  81

Query  285  CYSLPV  302
            CY LPV
Sbjct  82   CYVLPV  87



>gb|AAK92623.1|AC079633_3 Putative protein with similarity to putative protein kinases 
[Oryza sativa Japonica Group]
Length=530

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF++NCG  +E ++ S+ ++ D+ +I+  N S V + NIL  L T+RYFP   ARK+C
Sbjct  35   PRGFYINCGSEKEEQIGSIKWIQDEGFIAVGNMSAVDKPNILPLLATVRYFPDATARKYC  94

Query  288  YSLPV  302
            Y LPV
Sbjct  95   YQLPV  99



>ref|XP_010487850.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Camelina sativa]
Length=520

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GFFLNCG +     + + + PD+ +IS  N + +KQ++++  L+TLRYFP   +RK C
Sbjct  21   PRGFFLNCGSSSSTNQNEIDYTPDEGFISVGNTTTIKQKDLIPILSTLRYFPDKSSRKHC  80

Query  288  YSLPV  302
            Y+ PV
Sbjct  81   YNFPV  85



>ref|NP_001049189.1| Os03g0184400 [Oryza sativa Japonica Group]
 gb|ABF94347.1| leucine-rich repeat family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11103.1| Os03g0184400 [Oryza sativa Japonica Group]
 gb|EEE58454.1| hypothetical protein OsJ_09686 [Oryza sativa Japonica Group]
Length=519

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF++NCG  +E ++ S+ ++ D+ +I+  N S V + NIL  L T+RYFP   ARK+C
Sbjct  35   PRGFYINCGSEKEEQIGSIKWIQDEGFIAVGNMSAVDKPNILPLLATVRYFPDATARKYC  94

Query  288  YSLPV  302
            Y LPV
Sbjct  95   YQLPV  99



>ref|XP_010466053.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Camelina sativa]
Length=520

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GFFLNCG +     + + + PD+ +IS  N + +KQ++++  L+TLRYFP   +RK C
Sbjct  21   PRGFFLNCGSSSSTNQNEIDYTPDEGFISVGNTTTIKQKDLIPILSTLRYFPDKSSRKHC  80

Query  288  YSLPV  302
            Y+ PV
Sbjct  81   YNFPV  85



>gb|EAY88815.1| hypothetical protein OsI_10287 [Oryza sativa Indica Group]
Length=512

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF++NCG  +E ++ S+ ++ D+ +I+  N S V + NIL  L T+RYFP   ARK+C
Sbjct  28   PRGFYINCGSEKEEQIGSIKWIQDEGFIAVGNMSTVDKPNILPLLATVRYFPDATARKYC  87

Query  288  YSLPV  302
            Y LPV
Sbjct  88   YQLPV  92



>ref|XP_010241286.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 isoform X2 [Nelumbo nucifera]
Length=501

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +3

Query  39   ISTSLFF-CLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVV  215
            +S S+F   LV  PL + A     P+GF +N GG++E+ + SL ++ DD +I+  NK+ +
Sbjct  1    MSLSIFLLWLVSIPLAVDA-VRSPPRGFRINSGGSKEIVVGSLDWIADDGFITVGNKTTL  59

Query  216  KQQNILLTLTTLRYFPSNKARKWCYSLPV  302
               N++  L+TLR+FP   ARK+CY +PV
Sbjct  60   DDPNLMPLLSTLRFFPDKSARKYCYEIPV  88



>ref|XP_010241285.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 isoform X1 [Nelumbo nucifera]
Length=512

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = +3

Query  39   ISTSLFF-CLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVV  215
            +S S+F   LV  PL + A  +  P+GF +N GG++E+ + SL ++ DD +I+  NK+ +
Sbjct  1    MSLSIFLLWLVSIPLAVDAVRS-PPRGFRINSGGSKEIVVGSLDWIADDGFITVGNKTTL  59

Query  216  KQQNILLTLTTLRYFPSNKARKWCYSLPV  302
               N++  L+TLR+FP   ARK+CY +PV
Sbjct  60   DDPNLMPLLSTLRFFPDKSARKYCYEIPV  88



>ref|XP_006649517.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g59680-like [Oryza brachyantha]
Length=512

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P GF++NCG  +E ++ S+ ++ D+ +I+  N S V + N+L  L+T+RYFP   ARK+C
Sbjct  28   PPGFYINCGAEKEEQIGSIRWIQDEGFITVGNVSAVDKPNVLPLLSTVRYFPDATARKYC  87

Query  288  YSLPV  302
            Y LPV
Sbjct  88   YQLPV  92



>gb|AES90183.2| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=504

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +3

Query  39   ISTSLFFC-LVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVV  215
            +S S+F   LV  PL+  +  +  P G+FLNCGG+ EV + SL + PD  Y      + +
Sbjct  12   MSPSVFLLFLVTVPLLAHSAPSN-PLGYFLNCGGSNEVTVDSLKYTPDGSYTKLGTVATI  70

Query  216  KQQNILLTLTTLRYFPSNKARKWCYSLPV  302
             + ++L TL+TLRYFP+  ++K+CYS PV
Sbjct  71   NKTDLLPTLSTLRYFPNTASKKFCYSFPV  99



>ref|XP_010939430.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Elaeis guineensis]
Length=509

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = +3

Query  51   LFFCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNI  230
            LF CL+ FPL + A ++  PKG  +NCG  EE  +  + ++ DD +I A N S +   NI
Sbjct  6    LFLCLLSFPLSLHA-SDPPPKGSHINCGSQEEDTIGGIKWIADDGFIKAGNISKLNIPNI  64

Query  231  LLTLTTLRYFPSNKARKWCY  290
            +  L++LRYFP   ARK+CY
Sbjct  65   MPLLSSLRYFPDKSARKYCY  84



>ref|XP_003520166.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51810-like [Glycine max]
 gb|KHN37506.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=491

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = +3

Query  36   AISTSLFF-CLVFFPLIILAXTNGVPKGFFLNCGGNEEVEL-HSLTFVPDDKYISASNKS  209
            ++S S+F   ++   L+  +    +P G+FL+CGG +EV + ++LT++PD  YI     +
Sbjct  11   SMSPSVFLLWIITISLLAHSALASIPLGYFLDCGGTKEVTIDNNLTYIPDGSYIKVGKTT  70

Query  210  VVKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
             + + ++L  L+TLRYFP   A+K+CYSLPV
Sbjct  71   TISKPDLLPILSTLRYFPDMWAKKYCYSLPV  101



>ref|XP_003607986.1| Receptor-like protein kinase [Medicago truncatula]
Length=558

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +3

Query  39   ISTSLFFC-LVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVV  215
            +S S+F   LV  PL+  +  +  P G+FLNCGG+ EV + SL + PD  Y      + +
Sbjct  12   MSPSVFLLFLVTVPLLAHSAPSN-PLGYFLNCGGSNEVTVDSLKYTPDGSYTKLGTVATI  70

Query  216  KQQNILLTLTTLRYFPSNKARKWCYSLPV  302
             + ++L TL+TLRYFP+  ++K+CYS PV
Sbjct  71   NKTDLLPTLSTLRYFPNTASKKFCYSFPV  99



>gb|KDP42294.1| hypothetical protein JCGZ_01618 [Jatropha curcas]
Length=499

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +3

Query  57   FCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILL  236
            F L    + +L+ +   P+GF L+CG + E+   ++ ++PD+ YIS  NK+ +K   +L 
Sbjct  6    FLLWLVSIPLLSHSLPAPRGFPLSCGSSSEITQGNIKYIPDEGYISVGNKTTIKTPGLLP  65

Query  237  TLTTLRYFPSNKARKWCYSLPV  302
             L+TLRYFP   ARK+CY  P 
Sbjct  66   LLSTLRYFPDASARKYCYVFPT  87



>ref|XP_004985457.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Setaria italica]
Length=518

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF+++CG +++V++ S+ +V D+ +I   N S + + N+L  L TLR+FP   ARK+C
Sbjct  34   PRGFYISCGSDKDVQVGSIKWVQDEGFIGVGNASAINKPNLLPLLATLRFFPDATARKYC  93

Query  288  YSLPV  302
            Y LPV
Sbjct  94   YELPV  98



>ref|XP_007156516.1| hypothetical protein PHAVU_003G292500g [Phaseolus vulgaris]
 gb|ESW28510.1| hypothetical protein PHAVU_003G292500g [Phaseolus vulgaris]
Length=512

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P G++L+CGG++EV +  L +V D  YI   + S + +  +L  L+T+RYFP   ARK+C
Sbjct  48   PLGYYLDCGGSKEVTVDDLKYVSDGSYIKVGSTSPINKPGLLPILSTVRYFPDASARKYC  107

Query  288  YSLPV  302
            YSLPV
Sbjct  108  YSLPV  112



>gb|KFK39243.1| hypothetical protein AALP_AA3G219000 [Arabis alpina]
Length=518

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF+LNCG +   +L+ + + PD ++I+  N + +KQ+++L  L+TLRYFP   +RK C
Sbjct  20   PRGFYLNCGSSSPTKLNEINYTPDQEFITVGNTTTIKQKDLLPILSTLRYFPDKSSRKHC  79

Query  288  YS  293
            Y+
Sbjct  80   YN  81



>ref|XP_010028481.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51810 isoform X3 [Eucalyptus grandis]
Length=410

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +3

Query  57   FCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILL  236
            F L    + + A ++  P+GF ++CG +EE    SL ++ DD +IS  NK+ +K  N+L 
Sbjct  6    FLLWLVSIPLFAHSSPAPRGFLIDCGASEESSSGSLKYILDDGFISVGNKTAIKTPNVLP  65

Query  237  TLTTLRYFPSNKARKWCYSLPV  302
             LTTLRYFP   ARK+CY +PV
Sbjct  66   ELTTLRYFPDKSARKYCYVIPV  87



>ref|XP_003561977.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g28990 [Brachypodium distachyon]
Length=516

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+G  +NCG ++E+ + S+ +VPD  +I+  N S V + ++L  L+TLR+FP   ARK+C
Sbjct  35   PRGLHMNCGADKELHIGSIKWVPDAAFIAVGNASSVNKPSVLPVLSTLRHFPDATARKYC  94

Query  288  YSLPV  302
            Y++P 
Sbjct  95   YNIPA  99



>ref|XP_008797310.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Phoenix dactylifera]
Length=508

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +3

Query  51   LFFCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNI  230
            LF CL+ FP  + A ++   +G+ +NCG  +E  + S+ ++ DD ++ A N S +   N+
Sbjct  5    LFLCLLSFPPSLHA-SDPPSRGYRINCGSQDEDTVGSIKWIADDGFVEAGNISKLNIPNM  63

Query  231  LLTLTTLRYFPSNKARKWCYSLPV  302
            +  L++LRYFP   ARK+CY +PV
Sbjct  64   MPVLSSLRYFPDKSARKYCYLIPV  87



>ref|XP_008373156.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Malus domestica]
Length=521

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +3

Query  84   ILAXTNGVPKGFFLNCGG---NEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLR  254
            +LA +   P+G+ LNCG    +E V + +L +  D+ +I   N S +KQ++++  L TLR
Sbjct  16   LLAHSQPNPRGYLLNCGAGPTSESVTVGNLKYTTDEGFILVGNTSTIKQEDLVPILATLR  75

Query  255  YFPSNKARKWCYSLPV  302
            YFP+  ARK+CYS+PV
Sbjct  76   YFPNKSARKYCYSIPV  91



>ref|XP_010028480.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Eucalyptus grandis]
Length=510

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +3

Query  57   FCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILL  236
            F L    + + A ++  P+GF ++CG +EE    SL ++ DD +IS  NK+ +K  N+L 
Sbjct  6    FLLWLVSIPLFAHSSPAPRGFLIDCGASEESSSGSLKYILDDGFISVGNKTAIKTPNVLP  65

Query  237  TLTTLRYFPSNKARKWCYSLPV  302
             LTTLRYFP   ARK+CY +PV
Sbjct  66   ELTTLRYFPDKSARKYCYVIPV  87



>ref|XP_010028479.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Eucalyptus grandis]
 gb|KCW55221.1| hypothetical protein EUGRSUZ_I01156 [Eucalyptus grandis]
Length=511

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +3

Query  57   FCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILL  236
            F L    + + A ++  P+GF ++CG +EE    SL ++ DD +IS  NK+ +K  N+L 
Sbjct  6    FLLWLVSIPLFAHSSPAPRGFLIDCGASEESSSGSLKYILDDGFISVGNKTAIKTPNVLP  65

Query  237  TLTTLRYFPSNKARKWCYSLPV  302
             LTTLRYFP   ARK+CY +PV
Sbjct  66   ELTTLRYFPDKSARKYCYVIPV  87



>ref|XP_010647751.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 isoform X2 [Vitis vinifera]
Length=311

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 3/89 (3%)
 Frame = +3

Query  39   ISTSLFF-CLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVV  215
            +S S+F   LV  PL + A     P+G  LNCG  +++   +L F+ D+ +IS  N S +
Sbjct  1    MSLSIFLLSLVTIPLSLHAIP--APRGVLLNCGSTKDIVTTNLKFITDEGFISVGNSSTL  58

Query  216  KQQNILLTLTTLRYFPSNKARKWCYSLPV  302
            K  ++   L+TLRYFP   A+K+CY +PV
Sbjct  59   KTPDLFPILSTLRYFPDKSAKKYCYVIPV  87



>emb|CDX92310.1| BnaA05g20970D [Brassica napus]
Length=514

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF+LNCG     +L+ + +  D  +I+  N + +KQ+++L  L+TLRYFP   +RK C
Sbjct  21   PRGFYLNCGSPSTTKLNDINYTSDRGFINVGNTTTIKQKDLLPILSTLRYFPDKSSRKHC  80

Query  288  YSLPV  302
            Y+ PV
Sbjct  81   YNFPV  85



>emb|CDX99256.1| BnaC05g33710D [Brassica napus]
Length=514

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF+LNCG     +L+ + +  D  +I+  N + +KQ+++L  L+TLRYFP   +RK C
Sbjct  21   PRGFYLNCGSPSTTKLNEINYTSDRGFINVGNTTTIKQKDLLPILSTLRYFPDKSSRKHC  80

Query  288  YSLPV  302
            Y+ PV
Sbjct  81   YNFPV  85



>ref|XP_009419483.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Musa acuminata subsp. malaccensis]
Length=498

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P G+++NCG ++E     + ++PD+ +I+  N S +   +I+  L T+RYFP   ARK+C
Sbjct  21   PGGYYINCGASQEETTGGIQWIPDEGFINVGNVSKIGTPDIVPILATVRYFPDESARKYC  80

Query  288  YSLPV  302
            YS+PV
Sbjct  81   YSIPV  85



>gb|KJB32383.1| hypothetical protein B456_005G238300 [Gossypium raimondii]
Length=504

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 2/79 (3%)
 Frame = +3

Query  63   LVFFPLIILAXTNGVPKGFFLNCGGN--EEVELHSLTFVPDDKYISASNKSVVKQQNILL  236
            L+  P ++ +  +  PKG  +NCG +  + V+   LT++PDD +  + NK+ +  +N+L 
Sbjct  10   LLTIPFLVHSSPDQQPKGLLINCGSDVKQTVKETGLTYIPDDGFTFSGNKTSLDAKNLLP  69

Query  237  TLTTLRYFPSNKARKWCYS  293
             L+TLRYFP   ARK+CY+
Sbjct  70   ILSTLRYFPDKVARKYCYT  88



>ref|XP_004296071.2| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Fragaria vesca subsp. vesca]
Length=522

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 4/69 (6%)
 Frame = +3

Query  108  PKGFFLNCGG----NEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKA  275
            P+G+ LNCG     N +V + +L +V D+ YIS    S +K  +++  LTTLRYFP   A
Sbjct  23   PRGYLLNCGAGASSNNDVIVGNLKYVTDEGYISVGKTSNIKNNDLVPILTTLRYFPDKSA  82

Query  276  RKWCYSLPV  302
            RK+CY +PV
Sbjct  83   RKYCYEIPV  91



>ref|XP_009145818.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440 [Brassica rapa]
Length=514

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF+LNCG     +L+ + +  D  +I+  N + +KQ+++L  L+TLRYFP   +RK C
Sbjct  21   PRGFYLNCGSPSITKLNDINYTSDRGFINVGNTTTIKQKDLLPILSTLRYFPDKSSRKHC  80

Query  288  YSLPV  302
            Y+ PV
Sbjct  81   YNFPV  85



>ref|XP_002282141.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X1 [Vitis vinifera]
Length=511

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 3/89 (3%)
 Frame = +3

Query  39   ISTSLFF-CLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVV  215
            +S S+F   LV  PL + A     P+G  LNCG  +++   +L F+ D+ +IS  N S +
Sbjct  1    MSLSIFLLSLVTIPLSLHAIP--APRGVLLNCGSTKDIVTTNLKFITDEGFISVGNSSTL  58

Query  216  KQQNILLTLTTLRYFPSNKARKWCYSLPV  302
            K  ++   L+TLRYFP   A+K+CY +PV
Sbjct  59   KTPDLFPILSTLRYFPDKSAKKYCYVIPV  87



>ref|XP_002468379.1| hypothetical protein SORBIDRAFT_01g044920 [Sorghum bicolor]
 gb|EER95377.1| hypothetical protein SORBIDRAFT_01g044920 [Sorghum bicolor]
Length=499

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  111  KGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWCY  290
            KGF+++CG  ++V++ S+ +  D+ + +  N S + + ++L  L TLRYFP   ARK+CY
Sbjct  42   KGFYISCGSGKDVQVGSINWAKDEGFTAVGNASAINKPHLLPVLATLRYFPDATARKYCY  101

Query  291  SLPV  302
             LPV
Sbjct  102  QLPV  105



>ref|XP_004166668.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51810-like [Cucumis sativus]
Length=508

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +3

Query  105  VPKGFFLNCGGNE---EVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKA  275
            +P+G+ LNCG  E   +V + SL ++ D+ +IS  N + +   N++  L+TLRYFP   A
Sbjct  25   LPRGYLLNCGATESTAKVTVGSLQYITDEGFISVGNTTKLLDPNLVPILSTLRYFPDKSA  84

Query  276  RKWCYSLPV  302
            RK+CYS+PV
Sbjct  85   RKYCYSIPV  93



>ref|XP_004136983.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g51810-like [Cucumis sativus]
Length=516

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +3

Query  105  VPKGFFLNCGGNE---EVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKA  275
            +P+G+ LNCG  E   +V + SL ++ D+ +IS  N + +   N++  L+TLRYFP   A
Sbjct  33   LPRGYLLNCGATESTAKVTVGSLQYITDEGFISVGNTTKLLDPNLVPILSTLRYFPDKSA  92

Query  276  RKWCYSLPV  302
            RK+CYS+PV
Sbjct  93   RKYCYSIPV  101



>gb|KGN43935.1| hypothetical protein Csa_7G073710 [Cucumis sativus]
Length=515

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +3

Query  105  VPKGFFLNCGGNE---EVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKA  275
            +P+G+ LNCG  E   +V + SL ++ D+ +IS  N + +   N++  L+TLRYFP   A
Sbjct  33   LPRGYLLNCGATESTAKVTVGSLQYITDEGFISVGNTTKLLDPNLVPILSTLRYFPDKSA  92

Query  276  RKWCYSLPV  302
            RK+CYS+PV
Sbjct  93   RKYCYSIPV  101



>ref|XP_008454942.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g59680 [Cucumis melo]
Length=508

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +3

Query  105  VPKGFFLNCGGNE---EVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKA  275
            +P+G+ LNCG  E   +V + SL ++ D+ +IS  N + +   N++  L+TLRYFP   A
Sbjct  25   LPRGYLLNCGATESTAKVTIGSLQYITDEGFISVGNTTKLLDPNLVSFLSTLRYFPDKSA  84

Query  276  RKWCYSLPV  302
            RK+CYS+PV
Sbjct  85   RKYCYSIPV  93



>ref|XP_008236545.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Prunus mume]
Length=516

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 43/66 (65%), Gaps = 4/66 (6%)
 Frame = +3

Query  117  FFLNCGGN----EEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKW  284
            + LNCG       +V + SL ++ D+ +IS  N S +KQ  ++  LTTLRYFP+  ARK+
Sbjct  22   YLLNCGAGPSPGNDVTVGSLKYITDEGFISVGNTSTIKQDGLVPILTTLRYFPNKSARKY  81

Query  285  CYSLPV  302
            CY++PV
Sbjct  82   CYAIPV  87



>ref|XP_007200685.1| hypothetical protein PRUPE_ppa017037mg [Prunus persica]
 gb|EMJ01884.1| hypothetical protein PRUPE_ppa017037mg [Prunus persica]
Length=501

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 43/66 (65%), Gaps = 4/66 (6%)
 Frame = +3

Query  117  FFLNCGGN----EEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKW  284
            + LNCG       +V + SL ++ D+ +IS  N S +KQ  ++  LTTLRYFP+  ARK+
Sbjct  22   YLLNCGAGPSPGNDVTVGSLKYITDEGFISVGNTSTIKQDGLVPILTTLRYFPNKSARKY  81

Query  285  CYSLPV  302
            CY++PV
Sbjct  82   CYAIPV  87



>ref|XP_010107946.1| hypothetical protein L484_027536 [Morus notabilis]
 gb|EXC17346.1| hypothetical protein L484_027536 [Morus notabilis]
Length=515

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 56/95 (59%), Gaps = 7/95 (7%)
 Frame = +3

Query  39   ISTSLFF-CLVFFPLIILAXTNGVPKGFFLNCGGNE---EVELHS---LTFVPDDKYISA  197
            +S S+F   LV  P +  + ++  P G+ L+CG  E   ++E  S   L +V D+ +IS 
Sbjct  1    MSLSIFLLWLVSIPFLSHSQSDPTPTGYLLDCGAGESSPQIETTSGIDLKYVTDEGFISV  60

Query  198  SNKSVVKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
             N + +  Q+++  L+TLRYFP   ARK+CYS+P 
Sbjct  61   GNITTLTNQDLVPILSTLRYFPDASARKYCYSVPA  95



>gb|EPS72113.1| hypothetical protein M569_02646, partial [Genlisea aurea]
Length=510

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVK-QQNILLTLTTLRYFPSNKARKW  284
            PKGF L CG   + +  SL + PDD YIS   ++ +    NIL  L++LR+FP + ARK 
Sbjct  27   PKGFLLTCGSTTQTKEGSLLYTPDDPYISTGKRATLNTTTNILPRLSSLRFFPHSNARKH  86

Query  285  CYSLPV  302
            CY+ PV
Sbjct  87   CYTFPV  92



>gb|KJB12250.1| hypothetical protein B456_002G007900 [Gossypium raimondii]
Length=460

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = +3

Query  108  PKGFFLNCGGN--EEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARK  281
            P+G  ++CG +  + +   SL+++PDD +I+  NK+ ++  ++L  L+TLRYFP   ARK
Sbjct  24   PRGTLVSCGSSTKQSIPDTSLSYIPDDGFINVGNKTTLESNDLLPILSTLRYFPQKSARK  83

Query  282  WCYSLPV  302
            +CY+  V
Sbjct  84   YCYTFQV  90



>ref|XP_006851088.1| hypothetical protein AMTR_s00025p00244550 [Amborella trichopoda]
 gb|ERN12669.1| hypothetical protein AMTR_s00025p00244550 [Amborella trichopoda]
Length=512

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 3/88 (3%)
 Frame = +3

Query  39   ISTSLFFCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVK  218
            +S SLFF  ++F + + A  N    G  L+CG         L ++PD  +I+  N + + 
Sbjct  1    MSLSLFF--IWF-IALPAFLNAQSPGLLLDCGAPRPTSEAGLQWLPDSDFINTGNTTSLS  57

Query  219  QQNILLTLTTLRYFPSNKARKWCYSLPV  302
              +I  TL++LRYFP  KARK+CY LPV
Sbjct  58   TPHIRTTLSSLRYFPDTKARKFCYVLPV  85



>ref|XP_008782339.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Phoenix dactylifera]
Length=515

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+G+F+NCG ++E  L  + +  D ++IS  N S +K   ++  L+ +RYFP   ARK+C
Sbjct  28   PRGYFINCGASKEETLSGIRWTSDTEFISVGNVSEIKVAGVVPILSQVRYFPDKSARKYC  87

Query  288  YSLPV  302
            +  PV
Sbjct  88   FVFPV  92



>emb|CBI32418.3| unnamed protein product [Vitis vinifera]
Length=520

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  114  GFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWCYS  293
            G  LNCG  +++   +L F+ D+ +IS  N S +K  ++   L+TLRYFP   A+K+CY 
Sbjct  19   GVLLNCGSTKDIVTTNLKFITDEGFISVGNSSTLKTPDLFPILSTLRYFPDKSAKKYCYV  78

Query  294  LPV  302
            +PV
Sbjct  79   IPV  81



>ref|NP_001063375.1| Os09g0458300 [Oryza sativa Japonica Group]
 dbj|BAD38375.1| putative serine/threonine-specific receptor protein kinase [Oryza 
sativa Japonica Group]
 dbj|BAF25289.1| Os09g0458300 [Oryza sativa Japonica Group]
 dbj|BAG98450.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69852.1| hypothetical protein OsJ_29635 [Oryza sativa Japonica Group]
Length=510

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +3

Query  114  GFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWCYS  293
            G+ ++CG   E  +  +T+VPD +++S  N S V+   +L  L++LRYFP   ARK+CY 
Sbjct  24   GYQISCGATSEKVVGDVTWVPDGRFVSVGNVSDVRSPGVLPVLSSLRYFPDTSARKYCYV  83

Query  294  LP  299
            +P
Sbjct  84   VP  85



>ref|XP_008660471.1| PREDICTED: receptor-like protein kinase At3g21340 isoform X2 
[Zea mays]
 gb|AFW89439.1| hypothetical protein ZEAMMB73_263749 [Zea mays]
Length=523

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF+++CG +++V++ S+ +  D+ + +  N S + + ++L  L  LRYFP   ARK+C
Sbjct  39   PRGFYISCGSDKDVQVGSIKWAKDEGFTAVGNASAINKPHLLPLLAALRYFPDATARKYC  98

Query  288  YSLPV  302
            Y LPV
Sbjct  99   YQLPV  103



>ref|XP_008660470.1| PREDICTED: receptor-like protein kinase At3g21340 isoform X1 
[Zea mays]
Length=535

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF+++CG +++V++ S+ +  D+ + +  N S + + ++L  L  LRYFP   ARK+C
Sbjct  39   PRGFYISCGSDKDVQVGSIKWAKDEGFTAVGNASAINKPHLLPLLAALRYFPDATARKYC  98

Query  288  YSLPV  302
            Y LPV
Sbjct  99   YQLPV  103



>ref|XP_010255977.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nelumbo nucifera]
Length=511

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 5/86 (6%)
 Frame = +3

Query  51   LFFCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNI  230
            LFFC +F   I++      PKG+F++CG  E   +    ++PD  Y+SA     +   +I
Sbjct  7    LFFCSLF---IVVYSQPSHPKGYFIDCGATELSVIDGREWLPDTNYVSAGVPKSINIPDI  63

Query  231  LLTLTTLRYFP--SNKARKWCYSLPV  302
            + TL+T+R FP   N  RK+CY +PV
Sbjct  64   VPTLSTVRSFPLDGNTRRKFCYVVPV  89



>ref|XP_010939431.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 isoform X2 [Elaeis guineensis]
Length=502

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = +3

Query  84   ILAXTNGVPKGFF----LNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTL  251
            I   ++G+P  F     +NCG  EE  +  + ++ DD +I A N S +   NI+  L++L
Sbjct  5    IFVHSDGLPTSFLSSSHINCGSQEEDTIGGIKWIADDGFIKAGNISKLNIPNIMPLLSSL  64

Query  252  RYFPSNKARKWCYSLPV  302
            RYFP   ARK+CY + V
Sbjct  65   RYFPDKSARKYCYLITV  81



>gb|EEC84704.1| hypothetical protein OsI_31653 [Oryza sativa Indica Group]
Length=510

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = +3

Query  114  GFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWCYS  293
            G+ ++CG   E  +  +T+VPD +++S  N S ++   +L  L++LRYFP   ARK+CY 
Sbjct  24   GYQISCGATSEKVVGDVTWVPDGRFVSVGNVSDMRSPGVLPVLSSLRYFPDTSARKYCYV  83

Query  294  LP  299
            +P
Sbjct  84   VP  85



>ref|XP_003578232.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Brachypodium distachyon]
Length=513

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = +3

Query  39   ISTSLFFCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVK  218
            I  SL   L+    I +   + +P G  +NCG   E    ++T+VPD ++++  N + +K
Sbjct  2    IPFSLLAVLLVGAAIQIHGADALP-GHQINCGAGSEHAAGNVTWVPDGRFVTVGNATDIK  60

Query  219  QQNILLTLTTLRYFPSNKARKWCYSLP  299
                +  L++LRYFP   ARK+CY LP
Sbjct  61   SPGTMPMLSSLRYFPDTSARKYCYVLP  87



>ref|XP_009391353.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Musa acuminata subsp. malaccensis]
Length=511

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 49/91 (54%), Gaps = 1/91 (1%)
 Frame = +3

Query  30   MAAISTSLFFCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKS  209
            M+ +S  L F L+  P  + A  +  P+GF +NCG      +  + ++ DD ++   N +
Sbjct  1    MSPLSFLLVFLLISLPPSLQASLS-PPRGFSINCGSKNVENIGGIEWITDDSFVKVGNAT  59

Query  210  VVKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
             +    I+  L++LRYFP   ARK+CY +P 
Sbjct  60   DLNIPGIVPVLSSLRYFPDKSARKYCYVIPA  90



>gb|AFW89440.1| hypothetical protein ZEAMMB73_263749 [Zea mays]
Length=433

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF+++CG +++V++ S+ +  D+ + +  N S + + ++L  L  LRYFP   ARK+C
Sbjct  39   PRGFYISCGSDKDVQVGSIKWAKDEGFTAVGNASAINKPHLLPLLAALRYFPDATARKYC  98

Query  288  YSLPV  302
            Y LPV
Sbjct  99   YQLPV  103



>gb|EMT12993.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=456

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKAR  278
            P+GF++NCG ++EV++ S+ +VPD  +I+  N S V +  I   L TLR FP+  AR
Sbjct  36   PRGFYINCGADKEVQVGSIKWVPDAGFIAVGNASAVNKPPIPPVLATLRPFPAPTAR  92



>ref|XP_007042419.1| Leucine-rich repeat (LRR) family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOX98250.1| Leucine-rich repeat (LRR) family protein, putative isoform 1 
[Theobroma cacao]
Length=527

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 8/80 (10%)
 Frame = +3

Query  57   FCLVFFPLIILAXTNGVPKGFFLNCGGN--EEVELHSLTFVPDDKYISASNKSVVKQQNI  230
            FC V+      A +  +  G  + CG +  + V    +T++PDD +    NK+ +K +++
Sbjct  38   FCFVY------AWSPCLDAGLLITCGSSVKQTVPDTKVTYIPDDGFTLVGNKTALKNKDL  91

Query  231  LLTLTTLRYFPSNKARKWCY  290
            L  LTTLRYFP   ARK+CY
Sbjct  92   LPVLTTLRYFPDKSARKYCY  111



>ref|XP_010255974.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nelumbo nucifera]
 ref|XP_010255975.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Nelumbo nucifera]
Length=521

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 8/89 (9%)
 Frame = +3

Query  51   LFFCLVFFPLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYI-SASNKSVVKQQN  227
            LFFC +F   I +      P GFF++CG N+   +  LT+ PD +Y+ S   +SV+  ++
Sbjct  6    LFFCSLF---IAVHSQPPPPTGFFIDCGANKSSVIDGLTWSPDSEYVFSGVPRSVIIPES  62

Query  228  --ILLTLTTLRYFP--SNKARKWCYSLPV  302
               + TL+TLR FP      RK+CY LPV
Sbjct  63   PYFVKTLSTLRSFPLEGRTQRKFCYVLPV  91



>emb|CDO97171.1| unnamed protein product [Coffea canephora]
Length=517

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +3

Query  111  KGFFLNCGGNEEVELHSLTFVPDDKYIS--ASNKSVVKQQNILLTLTTLRYFPSNKARKW  284
            K +F+NCG NE+V+   L ++ DD +IS   +  + + Q ++L  L+TLRY P    +K 
Sbjct  38   KDYFVNCGSNEDVDSWELKYLADDAFISPQGTKTATINQTDVLPILSTLRYIPDKTTKKK  97

Query  285  CY  290
            CY
Sbjct  98   CY  99



>ref|XP_006487131.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase PAM74-like [Citrus sinensis]
Length=512

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  39   ISTSLFFCLVFF--PLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSV  212
            +S  + F L FF  P   L+     P+ F L+CG    +    L F+PD  + S  N + 
Sbjct  1    MSLVIIFLLWFFSSPFFALSQPTTSPQDFLLSCGDTVGLTTGRLKFLPDKDFQSLGNTTS  60

Query  213  VKQQNILLTLTTLRYFPSNKARKWCY  290
            +KQ  +L  L+TLR+F   +ARK+CY
Sbjct  61   LKQPGLLPILSTLRFFTELQARKYCY  86



>ref|XP_010666243.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Beta vulgaris subsp. vulgaris]
Length=517

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +3

Query  105  VPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPS--NKAR  278
            +P+ F++NCG + ++E +   + PD  ++S      V    +L  L+T+R FP   N  R
Sbjct  22   IPRSFYINCGASSQIEFNGHQWQPDSSFVSVGTNRTVPSSRVLPILSTVRSFPQQRNTHR  81

Query  279  KWCYSL  296
            K+CY +
Sbjct  82   KFCYQI  87



>ref|XP_006423028.1| hypothetical protein CICLE_v10030280mg [Citrus clementina]
 gb|ESR36268.1| hypothetical protein CICLE_v10030280mg [Citrus clementina]
Length=501

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = +3

Query  39   ISTSLFFCLVFF--PLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSV  212
            +S  + F L FF  P   L+     P+ F L+CG    +    L F+PD  +    N + 
Sbjct  1    MSLVIIFLLWFFSSPFFALSQPTTSPQDFLLSCGDTVGLTTGRLKFLPDKDFQFLGNTTT  60

Query  213  VKQQNILLTLTTLRYFPSNKARKWCY  290
            +KQ  +L  L+TLR+F   +ARK+CY
Sbjct  61   LKQPGLLPILSTLRFFTELQARKYCY  86



>gb|KDO59697.1| hypothetical protein CISIN_1g042915mg [Citrus sinensis]
Length=501

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = +3

Query  39   ISTSLFFCLVFF--PLIILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSV  212
            +S  + F L FF  P   L+     P+ F L+CG    +    L F+PD  +    N + 
Sbjct  1    MSLVIIFLLWFFSSPFFALSQPTTSPQDFLLSCGDTVGLTTGRLKFLPDKDFQFLGNTTT  60

Query  213  VKQQNILLTLTTLRYFPSNKARKWCY  290
            +KQ  +L  L+TLR+F   +ARK+CY
Sbjct  61   LKQPGLLPILSTLRFFTELQARKYCY  86



>gb|EYU45632.1| hypothetical protein MIMGU_mgv11b003932mg [Erythranthe guttata]
Length=510

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +3

Query  123  LNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFP--SNKARKWCYSL  296
            ++CG N+ + L+ L +VPD  YIS      + +Q ++ TL T+R FP   N  +K+CY +
Sbjct  23   IDCGSNDGLSLNGLQWVPDTGYISTGTSKNIARQGLVPTLATVRTFPLQDNLFKKFCYEI  82

Query  297  PV  302
            PV
Sbjct  83   PV  84



>ref|XP_003592431.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES62682.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=508

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            PKGF +NCG     ++++ T++PD  +I+      +  Q +L TL TLR FP  + +K C
Sbjct  23   PKGFLINCGTLTTTQINNRTWLPDSNFITTGTPKNITTQVLLPTLKTLRSFPL-QVKKHC  81

Query  288  YSLPV  302
            Y++PV
Sbjct  82   YNIPV  86



>ref|XP_006660701.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720-like [Oryza brachyantha]
Length=535

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/60 (37%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  123  LNCGGNEEVELHSLTFVPD-DKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWCYSLP  299
            ++CG   E  +  +T+VPD  +++   N + +K   +L  L++LRYFP   ARK+CY +P
Sbjct  51   ISCGATSEKVVGDVTWVPDAGRFVGVGNATDLKSPGVLPVLSSLRYFPDTSARKYCYVVP  110



>ref|XP_003555335.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14440-like [Glycine max]
Length=510

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+G  +NCG +   +  + T++PD  +IS+ +   V    +  TL TLR FP  + +K C
Sbjct  21   PRGLLINCGAHSAAQFDNRTWLPDSGFISSGSPKTVTTPVLFPTLHTLRSFP-RQVKKHC  79

Query  288  YSLPV  302
            Y++PV
Sbjct  80   YNIPV  84



>ref|XP_003535659.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510-like [Glycine max]
Length=510

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+GF +NCG +   +  + T++PD  +IS+     V    +  TL TLR FP  +  K C
Sbjct  21   PRGFLINCGAHSAAQFQNRTWLPDSAFISSGTPLNVTTPVLFPTLHTLRSFP-RRVNKHC  79

Query  288  YSLPV  302
            Y++PV
Sbjct  80   YNIPV  84



>ref|XP_004298162.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g14510 [Fragaria vesca subsp. vesca]
Length=502

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKS-VVKQQNILLTLTTLRYFPSNKARKW  284
            PKG  +NCG   E E+    ++PD  ++S +  S  +    ++  L+TLR FP+   RK+
Sbjct  20   PKGTLINCGAEVESEIDGRQWLPDSSFLSGAGTSKTLNNSGLVPILSTLRSFPNVPGRKY  79

Query  285  CYSLPV  302
            CY++ V
Sbjct  80   CYNVQV  85



>gb|KCW77026.1| hypothetical protein EUGRSUZ_D01371 [Eucalyptus grandis]
Length=839

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 3/85 (4%)
 Frame = +3

Query  54   FFCLVFFPLIILAXTNGVPKGFF-LNCGGNEEV-ELHSLTFVPDDKYISASNKSVVKQQN  227
             F LVF+  +++  +     GFF L+CGG++   +   L ++PDD++      +V     
Sbjct  7    LFWLVFYTSVLMEPSTAELPGFFSLDCGGSQSFFDEIGLYWIPDDQFAFGERANVSLANE  66

Query  228  ILLTLTTLRYFPSNKARKWCYSLPV  302
                 TTLRYFP++  RK+CY+L V
Sbjct  67   TRAPYTTLRYFPADD-RKYCYTLNV  90



>ref|XP_006829745.1| hypothetical protein AMTR_s00126p00126940 [Amborella trichopoda]
 gb|ERM97161.1| hypothetical protein AMTR_s00126p00126940 [Amborella trichopoda]
Length=542

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 5/78 (6%)
 Frame = +3

Query  78   LIILAXTNGVP--KGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILL-TLTT  248
            L IL+ T+ VP   GF ++CG + +    +L ++PDD +I    K+ +   + L  TL+T
Sbjct  42   LGILSLTHAVPPPTGFLIDCGASNQTHDGALLWIPDDGFIYTGTKATLPSPHPLRPTLST  101

Query  249  LRYFPSNKARKWCYSLPV  302
            LR+F +  A K CY+ PV
Sbjct  102  LRHFTA--AHKHCYTFPV  117



>ref|XP_007143225.1| hypothetical protein PHAVU_007G054600g [Phaseolus vulgaris]
 gb|ESW15219.1| hypothetical protein PHAVU_007G054600g [Phaseolus vulgaris]
Length=513

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 36/65 (55%), Gaps = 1/65 (2%)
 Frame = +3

Query  108  PKGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWC  287
            P+G  +NCG     +   LT+ PD  ++S+ +   +    ++ TL TLR FP  + +K C
Sbjct  27   PRGLLINCGAQSPAQFDDLTWFPDSDFVSSGSPITLNSPVLVPTLQTLRSFP-RQVKKHC  85

Query  288  YSLPV  302
            Y +PV
Sbjct  86   YYVPV  90



>ref|XP_011071564.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Sesamum indicum]
Length=510

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = +3

Query  111  KGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFP--SNKARKW  284
            +  F++CG N +   + L ++PD+ YISA     +    ++ TL T+R FP  +N  +K+
Sbjct  23   RDVFIDCGANVKSTFNDLEWLPDNDYISAGTSKNITAPVLVPTLATVRTFPLQNNAFKKF  82

Query  285  CYSLPV  302
            CY +PV
Sbjct  83   CYEIPV  88



>gb|KCW49706.1| hypothetical protein EUGRSUZ_K03208 [Eucalyptus grandis]
Length=900

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 45/85 (53%), Gaps = 3/85 (4%)
 Frame = +3

Query  54   FFCLVFFPLIILAXTNGVPKGFF-LNCGGNEE-VELHSLTFVPDDKYISASNKSVVKQQN  227
             F LVF+  +++  +     GF  L+CGG++   +   L + PDD++      +V     
Sbjct  7    LFLLVFYTSVLMEPSTAQMPGFVSLDCGGSQSFTDEIGLEWTPDDQFTFGERTNVSLTNE  66

Query  228  ILLTLTTLRYFPSNKARKWCYSLPV  302
                 TTLRYFP++  RK+CY+L V
Sbjct  67   TRTQYTTLRYFPADD-RKYCYTLNV  90



>ref|XP_010037926.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Eucalyptus grandis]
Length=935

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 45/85 (53%), Gaps = 3/85 (4%)
 Frame = +3

Query  54   FFCLVFFPLIILAXTNGVPKGFF-LNCGGNEE-VELHSLTFVPDDKYISASNKSVVKQQN  227
             F LVF+  +++  +     GF  L+CGG++   +   L + PDD++      +V     
Sbjct  7    LFLLVFYTSVLMEPSTAQMPGFVSLDCGGSQSFTDEIGLEWTPDDQFTFGERTNVSLTNE  66

Query  228  ILLTLTTLRYFPSNKARKWCYSLPV  302
                 TTLRYFP++  RK+CY+L V
Sbjct  67   TRTQYTTLRYFPADD-RKYCYTLNV  90



>ref|XP_010691040.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase PAM74 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=514

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 41/79 (52%), Gaps = 3/79 (4%)
 Frame = +3

Query  63   LVFFPL-IILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISAS--NKSVVKQQNIL  233
            +V  PL +I A     P+GF ++CG  + ++++ L ++PD  +IS             + 
Sbjct  10   VVSIPLSLIHADDFPAPRGFLVSCGSTKSIDINGLKYIPDQSFISVGNVTNVKNNTNQVF  69

Query  234  LTLTTLRYFPSNKARKWCY  290
              L+ LR+FP   ARK CY
Sbjct  70   PILSELRFFPDKSARKSCY  88



>ref|XP_010691039.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase PAM74 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=515

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 41/79 (52%), Gaps = 3/79 (4%)
 Frame = +3

Query  63   LVFFPL-IILAXTNGVPKGFFLNCGGNEEVELHSLTFVPDDKYISAS--NKSVVKQQNIL  233
            +V  PL +I A     P+GF ++CG  + ++++ L ++PD  +IS             + 
Sbjct  10   VVSIPLSLIHADDFPAPRGFLVSCGSTKSIDINGLKYIPDQSFISVGNVTNVKNNTNQVF  69

Query  234  LTLTTLRYFPSNKARKWCY  290
              L+ LR+FP   ARK CY
Sbjct  70   PILSELRFFPDKSARKSCY  88



>gb|KJB12545.1| hypothetical protein B456_002G023600 [Gossypium raimondii]
Length=485

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 44/88 (50%), Gaps = 4/88 (5%)
 Frame = +3

Query  51   LFFCLVFFPLIILAXTNGVP-KGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQN  227
            LFF  +F     L+ +   P KG+ +NCG      +    ++PD  +ISA     +    
Sbjct  7    LFFSSIFLSFPSLSFSQQTPPKGYLINCGATRRSVIDGRVWLPDGNFISAGTSKSLTVPG  66

Query  228  ILLTLTTLRYFP---SNKARKWCYSLPV  302
            ++ TL+T+R FP    N  RK+CY + V
Sbjct  67   LVPTLSTVRSFPLENKNLRRKFCYVVRV  94



>gb|KJB12544.1| hypothetical protein B456_002G023600 [Gossypium raimondii]
Length=521

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 4/84 (5%)
 Frame = +3

Query  51   LFFCLVFFPLIILAXTNGVP-KGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQN  227
            LFF  +F     L+ +   P KG+ +NCG      +    ++PD  +ISA     +    
Sbjct  7    LFFSSIFLSFPSLSFSQQTPPKGYLINCGATRRSVIDGRVWLPDGNFISAGTSKSLTVPG  66

Query  228  ILLTLTTLRYFP---SNKARKWCY  290
            ++ TL+T+R FP    N  RK+CY
Sbjct  67   LVPTLSTVRSFPLENKNLRRKFCY  90



>ref|XP_010037927.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Eucalyptus grandis]
 gb|KCW49703.1| hypothetical protein EUGRSUZ_K03207 [Eucalyptus grandis]
 gb|KCW49704.1| hypothetical protein EUGRSUZ_K03207 [Eucalyptus grandis]
Length=931

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 46/91 (51%), Gaps = 4/91 (4%)
 Frame = +3

Query  39   ISTSLFFCLVFF--PLIILAXTNGVPKGFFLNCGGNEE-VELHSLTFVPDDKYISASNKS  209
            +   LF CL+ F   +++   T  +P    L+CGG++   +   L + PDD +      +
Sbjct  7    LGRGLFLCLLVFCTSVLMELSTAQMPGFVSLDCGGSQSFTDEIGLEWTPDDHFTFGERTN  66

Query  210  VVKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
            V          TTLRYFP++  RK+CY+L V
Sbjct  67   VSLTNETRTQYTTLRYFPADD-RKYCYTLNV  96



>ref|XP_008349097.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g67720 [Malus domestica]
Length=579

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +3

Query  111  KGFFLNCGGNEEVELHSLTFVPDDKYISASNKSVVKQQNILLTLTTLRYFPSNKARKWCY  290
            KG  +NCG   + E+ +  ++PD  ++SA     +    ++  L+T R FP+N  RK+CY
Sbjct  106  KGTLINCGAAVKSEIDAREWLPDTSFVSAGTPRNLTTPGLVPILSTARSFPNNPHRKFCY  165

Query  291  SLPV  302
            ++ V
Sbjct  166  TVQV  169



>gb|KCW49705.1| hypothetical protein EUGRSUZ_K03207 [Eucalyptus grandis]
Length=546

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 46/91 (51%), Gaps = 4/91 (4%)
 Frame = +3

Query  39   ISTSLFFCLVFF--PLIILAXTNGVPKGFFLNCGGNEE-VELHSLTFVPDDKYISASNKS  209
            +   LF CL+ F   +++   T  +P    L+CGG++   +   L + PDD +      +
Sbjct  7    LGRGLFLCLLVFCTSVLMELSTAQMPGFVSLDCGGSQSFTDEIGLEWTPDDHFTFGERTN  66

Query  210  VVKQQNILLTLTTLRYFPSNKARKWCYSLPV  302
            V          TTLRYFP++  RK+CY+L V
Sbjct  67   VSLTNETRTQYTTLRYFPADD-RKYCYTLNV  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562775562090