BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001K04

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766349.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  82.8    2e-15   Nicotiana sylvestris
ref|XP_009593112.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.5    1e-14   Nicotiana tomentosiformis
ref|XP_004248314.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  80.1    2e-14   Solanum lycopersicum
ref|XP_006352588.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...  79.7    3e-14   Solanum tuberosum [potatoes]
emb|CAC80377.1|  glyceraldehyde-3-phosphate dehydrogenase             77.8    1e-13   Capsicum annuum
ref|XP_011095736.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  77.0    3e-13   Sesamum indicum [beniseed]
ref|XP_011086336.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  72.8    7e-12   Sesamum indicum [beniseed]
gb|EYU27576.1|  hypothetical protein MIMGU_mgv1a020814mg              69.7    6e-11   Erythranthe guttata [common monkey flower]
gb|EYU33796.1|  hypothetical protein MIMGU_mgv1a006939mg              68.9    1e-10   Erythranthe guttata [common monkey flower]
ref|XP_008226146.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  68.2    2e-10   Prunus mume [ume]
ref|XP_002312235.1|  glyceraldehyde 3-phosphate dehydrogenase 1 f...  67.8    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009350183.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  67.8    4e-10   Pyrus x bretschneideri [bai li]
ref|XP_002315071.2|  hypothetical protein POPTR_0010s17930g           67.4    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011016312.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  67.4    5e-10   Populus euphratica
ref|XP_007214718.1|  hypothetical protein PRUPE_ppa006087mg           66.6    8e-10   Prunus persica
ref|XP_010276220.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  66.2    1e-09   Nelumbo nucifera [Indian lotus]
ref|XP_008383156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  65.9    1e-09   Malus domestica [apple tree]
ref|XP_011013977.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  65.5    2e-09   Populus euphratica
ref|XP_009414498.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  65.1    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002263263.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  64.3    6e-09   Vitis vinifera
ref|XP_007022675.1|  Glyceraldehyde-3-phosphate dehydrogenase of ...  63.9    6e-09   
ref|XP_004139839.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  63.9    6e-09   Cucumis sativus [cucumbers]
ref|XP_008447086.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  63.9    6e-09   Cucumis melo [Oriental melon]
ref|XP_008371994.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  63.9    8e-09   
gb|KDP25059.1|  hypothetical protein JCGZ_22594                       63.2    1e-08   Jatropha curcas
gb|AJA29689.1|  glyceraldehyde-3-phosphate dehydrogenase              62.8    2e-08   Betula luminifera [liang ye hua]
ref|XP_010941678.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  62.0    3e-08   Elaeis guineensis
ref|XP_002513328.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...  61.6    4e-08   Ricinus communis
ref|XP_010095945.1|  Glyceraldehyde-3-phosphate dehydrogenase         61.6    4e-08   
gb|KJB14046.1|  hypothetical protein B456_002G108700                  61.6    5e-08   Gossypium raimondii
ref|XP_007022673.1|  Glyceraldehyde-3-phosphate dehydrogenase of ...  61.2    5e-08   
ref|XP_010914235.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  60.8    8e-08   Elaeis guineensis
emb|CDP13563.1|  unnamed protein product                              60.1    1e-07   Coffea canephora [robusta coffee]
gb|KJB45878.1|  hypothetical protein B456_007G336900                  58.5    4e-07   Gossypium raimondii
gb|KJB45876.1|  hypothetical protein B456_007G336900                  58.5    4e-07   Gossypium raimondii
gb|KJB45877.1|  hypothetical protein B456_007G336900                  58.5    4e-07   Gossypium raimondii
ref|XP_006422270.1|  hypothetical protein CICLE_v10005029mg           58.2    5e-07   Citrus clementina [clementine]
ref|XP_007022674.1|  Glyceraldehyde-3-phosphate dehydrogenase of ...  57.8    7e-07   
ref|XP_004306563.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  57.8    7e-07   Fragaria vesca subsp. vesca
emb|CDY33343.1|  BnaC05g12400D                                        57.4    9e-07   Brassica napus [oilseed rape]
ref|XP_006307603.1|  hypothetical protein CARUB_v10009227mg           57.4    9e-07   Capsella rubella
emb|CDY35080.1|  BnaA06g10900D                                        57.4    1e-06   Brassica napus [oilseed rape]
ref|XP_009408252.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  56.6    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_173080.1|  glyceraldehyde 3-phosphate dehydrogenase            56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67077.1|  putative glyceraldehyde-3-phosphate dehydrogenase     56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KDO61570.1|  hypothetical protein CISIN_1g014424mg                 55.8    3e-06   Citrus sinensis [apfelsine]
ref|XP_006416830.1|  hypothetical protein EUTSA_v10007716mg           56.2    3e-06   
gb|KDO61569.1|  hypothetical protein CISIN_1g014424mg                 55.8    3e-06   Citrus sinensis [apfelsine]
gb|EPS71916.1|  hypothetical protein M569_02842                       55.8    3e-06   Genlisea aurea
gb|KDO61568.1|  hypothetical protein CISIN_1g014424mg                 55.8    3e-06   Citrus sinensis [apfelsine]
ref|XP_008776392.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  55.8    3e-06   Phoenix dactylifera
ref|XP_002890157.1|  GAPCP-2                                          55.8    3e-06   
ref|XP_008456299.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  55.8    3e-06   Cucumis melo [Oriental melon]
ref|XP_010537806.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  55.1    6e-06   Tarenaya hassleriana [spider flower]
gb|AAO22684.1|  putative glyceraldehyde-3-phosphate dehydrogenase     55.1    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693410.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  54.7    8e-06   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG14985.1|  Glyceraldehyde-3-phosphate dehydrogenase              54.7    8e-06   Gossypium arboreum [tree cotton]
ref|XP_003596039.1|  Glyceraldehyde-3-phosphate dehydrogenase         54.3    1e-05   
ref|XP_003596038.1|  Glyceraldehyde-3-phosphate dehydrogenase         54.3    1e-05   Medicago truncatula
ref|XP_003596040.1|  Glyceraldehyde-3-phosphate dehydrogenase         54.3    1e-05   
ref|XP_007149305.1|  hypothetical protein PHAVU_005G059200g           53.9    1e-05   Phaseolus vulgaris [French bean]
gb|KHG16589.1|  Glyceraldehyde-3-phosphate dehydrogenase-2C cytos...  53.9    1e-05   Gossypium arboreum [tree cotton]
gb|KGN46796.1|  hypothetical protein Csa_6G136010                     53.9    2e-05   Cucumis sativus [cucumbers]
ref|XP_010417618.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  53.5    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010429843.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  53.5    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010417619.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  53.1    2e-05   
ref|XP_006389879.1|  hypothetical protein EUTSA_v10018604mg           53.1    3e-05   Eutrema salsugineum [saltwater cress]
emb|CDX79324.1|  BnaC06g19790D                                        52.8    4e-05   
ref|XP_004140018.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  52.4    4e-05   
ref|XP_004154566.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  52.4    5e-05   
ref|XP_010472812.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  52.4    5e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009149063.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  52.4    5e-05   Brassica rapa
ref|XP_004488757.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  52.0    6e-05   
ref|XP_004488755.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  52.0    7e-05   Cicer arietinum [garbanzo]
emb|CDY25342.1|  BnaC01g30110D                                        52.0    7e-05   Brassica napus [oilseed rape]
emb|CDY22281.1|  BnaC02g25850D                                        52.0    7e-05   Brassica napus [oilseed rape]
ref|NP_001242854.1|  uncharacterized protein LOC100804853             52.0    7e-05   
gb|KHN22160.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic   51.6    7e-05   Glycine soja [wild soybean]
ref|XP_009128365.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  51.6    8e-05   Brassica rapa
gb|AIX10972.1|  glyceraldehyde-3-phosphate dehydrogenase              51.6    1e-04   Ornithogalum longebracteatum [sea-onion]
ref|XP_010531997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  51.2    1e-04   Tarenaya hassleriana [spider flower]
gb|ADJ96634.1|  glyceraldehyde-3-phosphate dehydrogenase              51.2    1e-04   Guzmania wittmackii x Guzmania lingulata
gb|KFK42362.1|  hypothetical protein AALP_AA2G245800                  50.4    1e-04   Arabis alpina [alpine rockcress]
gb|KFK42359.1|  hypothetical protein AALP_AA2G245800                  50.4    1e-04   Arabis alpina [alpine rockcress]
ref|XP_009399260.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  50.8    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_178071.1|  glyceraldehyde-3-phosphate dehydrogenase GAPCP1     50.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008779271.1|  PREDICTED: bifunctional purine biosynthesis ...  50.4    2e-04   
emb|CDX67990.1|  BnaA07g20300D                                        50.1    3e-04   
ref|XP_009104524.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  50.1    3e-04   Brassica rapa
ref|XP_004488756.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...  49.7    3e-04   
ref|XP_003547755.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...  49.3    5e-04   Glycine max [soybeans]
gb|AFK39182.1|  unknown                                               48.9    7e-04   Medicago truncatula
ref|XP_002889251.1|  GAPCP-1                                          48.9    7e-04   



>ref|XP_009766349.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Nicotiana sylvestris]
Length=419

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  423
            M FSSLL+     P       SHR Q S AG +Q   SVK +SSIFG A+  +  SS+Q 
Sbjct  1    MAFSSLLK-----PTASFVRPSHRSQTSCAGLHQSANSVKLQSSIFGDAVSVMQCSSLQK  55

Query  424  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SG+ SIQPV+ATATELPPT+PKS+T+GKTR+GINGFG
Sbjct  56   SGACSIQPVRATATELPPTVPKSRTSGKTRIGINGFG  92



>ref|XP_009593112.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=418

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  334  GFNQGCTSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTR  513
            G +Q   SVK +SSIFG A+  +  SS+Q SG+ SIQPV+ATATELPPT+PKS+T+GKTR
Sbjct  25   GLHQSANSVKLQSSIFGDAVSVMQCSSLQKSGAGSIQPVRATATELPPTVPKSRTSGKTR  84

Query  514  VGINGFG  534
            +GINGFG
Sbjct  85   IGINGFG  91



>ref|XP_004248314.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Solanum lycopersicum]
Length=419

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 68/97 (70%), Gaps = 5/97 (5%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  423
            M FSSLL+     P       SHR Q S AG +    SVK +SSIFG A+  + SSS+Q 
Sbjct  1    MAFSSLLK-----PAASFVRPSHRSQVSCAGLHHSSNSVKLQSSIFGDAVTILQSSSLQK  55

Query  424  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SG+ SIQP++ATATELPPT+P+SQT GKTRVGINGFG
Sbjct  56   SGACSIQPIRATATELPPTVPRSQTGGKTRVGINGFG  92



>ref|XP_006352588.1| PREDICTED: glyceraldehyde 3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Solanum tuberosum]
Length=419

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  423
            M FSSLL+     P       SHR QAS AG +    SVK +SS+FG A+  + SSS+Q 
Sbjct  1    MAFSSLLK-----PTASLVRPSHRSQASCAGLHHSSNSVKLQSSVFGDAVTILQSSSLQK  55

Query  424  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SG+ SIQP++ATATELPPT+P+SQT GKTR+GINGFG
Sbjct  56   SGACSIQPIRATATELPPTVPRSQTGGKTRIGINGFG  92



>emb|CAC80377.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
 emb|CAC88118.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=419

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 65/97 (67%), Gaps = 5/97 (5%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  423
            M FSSLL+     P       SHR QAS  G      SVK +S+IFG  +    SSS+Q 
Sbjct  1    MAFSSLLK-----PTASLVRPSHRSQASCVGLQHSSNSVKLQSAIFGDVVSIAQSSSLQN  55

Query  424  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SG+ SIQP++ATATELPPT+PKSQT GKTRVGINGFG
Sbjct  56   SGACSIQPIRATATELPPTVPKSQTGGKTRVGINGFG  92



>ref|XP_011095736.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Sesamum indicum]
Length=426

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 4/100 (4%)
 Frame = +1

Query  244  MGFSS-LLRSVPASPVLhasss--shrhqaslaGFNQGCTSVKFESSIFGSALPNVHsss  414
            M FSS LLRS P SPVL A +   S R + S  G NQ   +VKF+SS+FG ++    S  
Sbjct  1    MAFSSSLLRSAP-SPVLDADAFCPSDRLKVSCGGLNQNVNAVKFQSSVFGISITLDSSLP  59

Query  415  vqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +Q S +  IQP+KATATE+PPT+ KS+++GKT++GINGFG
Sbjct  60   LQKSTTRCIQPIKATATEIPPTVQKSRSSGKTKIGINGFG  99



>ref|XP_011086336.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Sesamum indicum]
Length=425

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 3/99 (3%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqasla--GFNQGCTSVKFESSIFGSALPNVHsssv  417
            M FSS L     S VL A +  H     ++  G N    +VKF+SSIFG+ + +V SSS+
Sbjct  1    MAFSSSLLRSATSRVLDADAFRHSDNFKVSCGGHNHNVNAVKFQSSIFGTNV-SVDSSSL  59

Query  418  qgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            Q S + SIQP+KATATE+PPT+ KS+++GKT+VGINGFG
Sbjct  60   QKSTARSIQPIKATATEIPPTVAKSRSSGKTKVGINGFG  98



>gb|EYU27576.1| hypothetical protein MIMGU_mgv1a020814mg, partial [Erythranthe 
guttata]
Length=392

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 4/98 (4%)
 Frame = +1

Query  244  MGFSS-LLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvq  420
            M FSS L RS P SPV   +           G N    +VKF+SSIFG+ + +V SSS+Q
Sbjct  1    MAFSSSLTRSAP-SPV-QDTFRFTDRSKVSCGLNSNANAVKFQSSIFGTNV-SVDSSSLQ  57

Query  421  gsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
                 SI+P++ATATE+PPT+ KS ++GKT++GINGFG
Sbjct  58   KVMCRSIKPIRATATEIPPTVTKSHSSGKTKIGINGFG  95



>gb|EYU33796.1| hypothetical protein MIMGU_mgv1a006939mg [Erythranthe guttata]
Length=425

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 70/100 (70%), Gaps = 5/100 (5%)
 Frame = +1

Query  244  MGFSS-LLRSVPASPVLhasssshrhqasla--GFNQGCTSVKFESSIFGSALPNVHsss  414
            M FSS +LRS P SPV+ A +  H   + ++    N    S+KF+SSIFG+ +   +SSS
Sbjct  1    MAFSSSILRSAP-SPVVDADAFRHSDISKVSCRHLNHNANSMKFQSSIFGTNIL-AYSSS  58

Query  415  vqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            ++   + S+QP++ATATE+P T+PKS+ +GKT++GINGFG
Sbjct  59   LEKVTARSVQPIRATATEIPQTLPKSRGSGKTKIGINGFG  98



>ref|XP_008226146.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Prunus mume]
Length=428

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 67/103 (65%), Gaps = 7/103 (7%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqasl------aGFNQGCTSVKFESSIFGSALPNVH  405
            M  SSLLRS  ++P++ A  +     +S        GF +     K +SSIFG+++P+  
Sbjct  1    MAASSLLRSTASAPLIEALRAELAASSSASFKVSSVGFGRNLNCPKVQSSIFGTSIPS-R  59

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SSS+Q   + S+QP+KATATELPPTI +S + GKT+VGINGFG
Sbjct  60   SSSLQICSARSVQPIKATATELPPTIQRSGSGGKTKVGINGFG  102



>ref|XP_002312235.1| glyceraldehyde 3-phosphate dehydrogenase 1 family protein [Populus 
trichocarpa]
 gb|EEE89602.1| glyceraldehyde 3-phosphate dehydrogenase 1 family protein [Populus 
trichocarpa]
Length=422

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 67/99 (68%), Gaps = 6/99 (6%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESS--IFGSALPNVHsssv  417
            M FS+LLRS PA+P++ AS S      S   F    +S++F SS  IFG+++P   SSS+
Sbjct  1    MAFSTLLRSTPAAPLIEASRSDFSPSPSDR-FE--VSSIRFNSSKSIFGASVP-TGSSSL  56

Query  418  qgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
                  SIQP+KATATE+PPT+ +S+  GKT++GINGFG
Sbjct  57   HTCSGRSIQPIKATATEMPPTVLRSRADGKTKIGINGFG  95



>ref|XP_009350183.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=427

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqasl------aGFNQGCTSVKFESSIFGSALPNVH  405
            M  SSLLRS  ++P++ AS       AS        GF++     K +SSIFG+++P+  
Sbjct  1    MAASSLLRSTVSAPLIEASRPDLAASASACFKVSSVGFSRNLNCPKVQSSIFGTSIPS-G  59

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SSS+Q   + S+QP+KATATELPPT+ KS + GKT++GINGFG
Sbjct  60   SSSLQICSARSVQPIKATATELPPTVQKSGSGGKTKIGINGFG  102



>ref|XP_002315071.2| hypothetical protein POPTR_0010s17930g [Populus trichocarpa]
 gb|ABK95756.1| unknown [Populus trichocarpa]
 gb|EEF01242.2| hypothetical protein POPTR_0010s17930g [Populus trichocarpa]
Length=422

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (62%), Gaps = 2/97 (2%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  423
            M FS LLRS PA+P L  +S S    +    F     S     SIFG+++P   SSS Q 
Sbjct  1    MAFSCLLRSTPAAP-LVEASRSDFSPSPSDRFKVSSVSFNSLKSIFGTSIP-TGSSSSQT  58

Query  424  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
                SIQP+KATATE+PPT+ KS+  GKT++GINGFG
Sbjct  59   CSGRSIQPIKATATEMPPTVLKSRADGKTKIGINGFG  95



>ref|XP_011016312.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Populus euphratica]
Length=422

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 6/99 (6%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESS--IFGSALPNVHsssv  417
            M FS+LLRS PA+P++ A  S      S   F    +S++F SS  IFG+++P   SSS+
Sbjct  1    MAFSTLLRSTPAAPLIEACRSDFSPSPSDR-FE--VSSIRFNSSKSIFGASVP-TGSSSL  56

Query  418  qgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
                  SIQP+KATATE+PPT+ +S+  GKT++GINGFG
Sbjct  57   HKCSGRSIQPIKATATEMPPTVLRSRADGKTKIGINGFG  95



>ref|XP_007214718.1| hypothetical protein PRUPE_ppa006087mg [Prunus persica]
 gb|EMJ15917.1| hypothetical protein PRUPE_ppa006087mg [Prunus persica]
Length=428

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqasl------aGFNQGCTSVKFESSIFGSALPNVH  405
            M  SSLLRS  ++P++ AS +     +S        GF +     K +SSIFG+++P+  
Sbjct  1    MAASSLLRSTASAPLIEASRAELAASSSASFKVSSVGFGRNLNCPKVQSSIFGTSIPS-G  59

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SSS+Q   + S+QP+KATATELPPTI +S + GKT+VGINGFG
Sbjct  60   SSSLQICSARSVQPIKATATELPPTIQRSGSGGKTKVGINGFG  102



>ref|XP_010276220.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Nelumbo nucifera]
Length=430

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 12/106 (11%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqa---------slaGFNQGCTSVKFESSIFGSALP  396
            M FS+L+RSV  +PV   S                 S AG N+   S + ++S+FG+A+P
Sbjct  1    MAFSTLIRSV--TPVTQGSLCEVSQIDCRARAPGQVSCAGVNRNLNSARIQTSLFGTAVP  58

Query  397  NVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
               SSS+Q     SIQP++ATATE+PP I KS++ GKTR+GINGFG
Sbjct  59   G-ESSSLQKCSVRSIQPIRATATEIPPAIQKSRSGGKTRIGINGFG  103



>ref|XP_008383156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Malus domestica]
Length=427

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqasl------aGFNQGCTSVKFESSIFGSALPNVH  405
            M  SSLLRS  ++P++ AS +     AS        GF++     K +SSIFG+++P+  
Sbjct  1    MAASSLLRSTVSAPLIEASRADLAASASASFKVSSVGFSRNLNCPKVQSSIFGTSIPS-G  59

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
             SS+Q   + S+QP+KATATELPPT+ KS + GKT++GINGFG
Sbjct  60   LSSLQICSARSVQPIKATATELPPTVQKSGSGGKTKIGINGFG  102



>ref|XP_011013977.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Populus euphratica]
Length=422

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 60/97 (62%), Gaps = 2/97 (2%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  423
            M FS LLRS PA+P L  +S S    +    F     S     SIFG+++P   SSS+Q 
Sbjct  1    MAFSCLLRSTPAAP-LVEASRSDFSPSPSDRFKVSSVSFNSLKSIFGTSIPT-GSSSLQT  58

Query  424  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
                SIQP+KATA E+PPT+ KS+  GKT++GINGFG
Sbjct  59   CSGRSIQPIKATAIEMPPTVLKSRADGKTKIGINGFG  95



>ref|XP_009414498.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=429

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  355  SVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SV+  S + GSALP+V ++S Q S +  IQPVKATATE+PP + +S + G+T++GINGFG
Sbjct  43   SVEIRSGVLGSALPSVEANSSQRSRARGIQPVKATATEVPPAVRRSSSGGRTKIGINGFG  102



>ref|XP_002263263.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Vitis vinifera]
 emb|CBI24168.3| unnamed protein product [Vitis vinifera]
Length=429

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 69/104 (66%), Gaps = 9/104 (9%)
 Frame = +1

Query  244  MGFSSLLRSVPASP------VLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNV-  402
            M   SL RS P++       V+ +S  S R + S  GFN    S+K +++IFG+  P + 
Sbjct  1    MALYSLFRSAPSAAAAAAATVVDSSRPSDRCKVSCIGFNSNADSLKVQTTIFGT--PCIG  58

Query  403  HsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +SSS+Q   + S+QP+KATATELPPT+ KS ++G+T++GINGFG
Sbjct  59   NSSSLQKCSARSLQPIKATATELPPTVQKSWSSGQTKIGINGFG  102



>ref|XP_007022675.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
3, partial [Theobroma cacao]
 gb|EOY14200.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
3, partial [Theobroma cacao]
Length=350

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  373  SIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SIFG+A+    SSS++   S SIQP+KATATE+PPT+PKS+++GKT+VGINGFG
Sbjct  1    SIFGAAVSTGSSSSLRKCNSRSIQPIKATATEIPPTVPKSRSSGKTKVGINGFG  54



>ref|XP_004139839.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cucumis sativus]
 ref|XP_004159163.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cucumis sativus]
 gb|KGN44292.1| hypothetical protein Csa_7G239050 [Cucumis sativus]
Length=422

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = +1

Query  355  SVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            S+KF+SSIFG+ + +  SSS+Q   S +IQP+KATATELPPT+ KS++ GKT+VGINGFG
Sbjct  37   SLKFQSSIFGAQVSS-GSSSLQLRRSHNIQPIKATATELPPTVQKSRSGGKTKVGINGFG  95



>ref|XP_008447086.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Cucumis melo]
Length=422

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 65/97 (67%), Gaps = 2/97 (2%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvqg  423
            M  +SL RS PA+  + +S S      S A       S+KF+SSIFG+ + +  SSS+Q 
Sbjct  1    MAATSLFRSAPAASFVQSSPSFSSPDQSTASC-VNLNSLKFQSSIFGAQVSS-GSSSLQL  58

Query  424  sgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
              S +IQP+KATATELPPT+ KS++ GKT+VGINGFG
Sbjct  59   RRSHNIQPIKATATELPPTVQKSRSGGKTKVGINGFG  95



>ref|XP_008371994.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Malus domestica]
Length=427

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqasl------aGFNQGCTSVKFESSIFGSALPNVH  405
            M  SSLLRS  ++P++ AS +     A+        GF++     K +S IFG+++P+  
Sbjct  1    MAASSLLRSTVSAPLIEASRADLAASAAASFXVSSVGFSRNLNCPKVQSXIFGTSIPS-G  59

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SSS+Q   + S+QP+KATATELPPT+ +S + GKT++GINGFG
Sbjct  60   SSSLQICSARSVQPIKATATELPPTVQRSGSGGKTKIGINGFG  102



>gb|KDP25059.1| hypothetical protein JCGZ_22594 [Jatropha curcas]
Length=426

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 6/101 (6%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSV----KFESSIFGSALPNVHss  411
            M FSSLLRS  A+P++  S +     +S   F     +V    K   SIFG++L    SS
Sbjct  1    MAFSSLLRSTTAAPLIDDSLAELSSSSSDR-FKVSSVNVNRDLKSSKSIFGTSL-TTGSS  58

Query  412  svqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            S+Q   + S QP+KATATE+PPTI KS+  GKT++GINGFG
Sbjct  59   SLQACCTRSFQPIKATATEMPPTILKSRNDGKTKIGINGFG  99



>gb|AJA29689.1| glyceraldehyde-3-phosphate dehydrogenase [Betula luminifera]
Length=426

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 64/100 (64%), Gaps = 4/100 (4%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGF---NQGCTSVKFESSIFGSALPNVHsss  414
            M  SSLLRS   +P++ AS +    + S       N+     K +SSIFG+++ +  SSS
Sbjct  1    MASSSLLRSTAMAPLVEASRAEPSDRFSKVARVRSNRNLNCCKLQSSIFGTSVSSG-SSS  59

Query  415  vqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +Q     SIQPVKA ATE+PPT+ KS+T GKT+VGINGFG
Sbjct  60   LQKCTVRSIQPVKAIATEIPPTVQKSRTGGKTKVGINGFG  99



>ref|XP_010941678.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Elaeis guineensis]
Length=429

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +1

Query  352  TSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGF  531
            +S +  S IFGS L +V SS  Q   + SIQP+KATATE PP +P+S   GKT+VGINGF
Sbjct  42   SSAQICSGIFGSCLSSVESSLSQKPSARSIQPIKATATEAPPVVPRSSAGGKTKVGINGF  101

Query  532  G  534
            G
Sbjct  102  G  102



>ref|XP_002513328.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF48731.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=426

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 10/103 (10%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshr------hqaslaGFNQGCTSVKFESSIFGSALPNVH  405
            M FS +LRS   SP++ AS S          QAS   FN+    +K   S FG+++P   
Sbjct  1    MAFSCILRSTATSPLIEASRSDLSPSPSDPLQASSVNFNR---DLKASKSFFGTSVPTA-  56

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SSS++   + S+QP+KAT TE+PPTI KS++ G+T++GINGFG
Sbjct  57   SSSLEACSARSLQPIKATVTEMPPTILKSRSDGRTKIGINGFG  99



>ref|XP_010095945.1| Glyceraldehyde-3-phosphate dehydrogenase [Morus notabilis]
 gb|EXB62638.1| Glyceraldehyde-3-phosphate dehydrogenase [Morus notabilis]
Length=440

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 64/117 (55%), Gaps = 25/117 (21%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhassss-----------hrhqaslaGFNQGCTSVKFESSIFGSA  390
            M FSSLLRS   + ++ AS +             +   S  GF +     K +SS+FG+A
Sbjct  1    MAFSSLLRSTTGTALIEASRADFSSSPSSSNNPPKVSTSCIGFTR-----KTQSSMFGTA  55

Query  391  LPNVHsssvqgsg---------sssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            + +  S++              +  IQP+KATATELPPT+PKSQ  GKT+VGINGFG
Sbjct  56   VTSGSSATQLSVAIFLNPLRCNARKIQPIKATATELPPTVPKSQKGGKTKVGINGFG  112



>gb|KJB14046.1| hypothetical protein B456_002G108700 [Gossypium raimondii]
Length=426

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 69/101 (68%), Gaps = 7/101 (7%)
 Frame = +1

Query  244  MGFSSLLRSVPA-SPVLhasssshrhqaslaGFNQGCTSVKFE---SSIFGSALPNVHss  411
            M FSSL+RS  A SP+L AS+ S    +    +    +S+ F    +S FG+A+ +  SS
Sbjct  1    MAFSSLIRSTAAVSPLLQASARSDLSPSPS--YRLKVSSIGFGGNLNSFFGAAV-STKSS  57

Query  412  svqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            S+Q   S SIQP+KATATE+PPTI +S+++GKT+VGINGFG
Sbjct  58   SLQKCNSRSIQPIKATATEIPPTIARSRSSGKTKVGINGFG  98



>ref|XP_007022673.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
1 [Theobroma cacao]
 gb|EOY14198.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
1 [Theobroma cacao]
Length=438

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 63/96 (66%), Gaps = 3/96 (3%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  420
            M FSSL+RS  A+     S+ S    +         +S+ F  +SIFG+A+    SSS++
Sbjct  1    MAFSSLIRSTAAASTPLDSARSDLSPSPSDRLK--VSSIGFSGNSIFGAAVSTGSSSSLR  58

Query  421  gsgsssIQPVKATATELPPTIPKSQTTGKTRVGING  528
               S SIQP+KATATE+PPT+PKS+++GKT+VGING
Sbjct  59   KCNSRSIQPIKATATEIPPTVPKSRSSGKTKVGING  94



>ref|XP_010914235.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Elaeis guineensis]
Length=429

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 61/104 (59%), Gaps = 9/104 (9%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasss---shrhqaslaGFNQGCT----SVKFESSIFGSALPNV  402
            M FS+L+RS  A+P++  S     S     +   F   C     S +  SSIFG AL + 
Sbjct  1    MAFSTLVRS--ATPLIGGSRGCFPSDSGAQARESFKISCVRSSISAQIRSSIFGLALSSA  58

Query  403  HsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
             SS  Q   + SIQP+KATATE PP +P+S T GKT+VGINGFG
Sbjct  59   ESSLSQKPSARSIQPIKATATEAPPVVPRSSTGGKTKVGINGFG  102



>emb|CDP13563.1| unnamed protein product [Coffea canephora]
Length=426

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  355  SVKFESSIFGSA-LPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGF  531
            +V+F+SSI G+  L    S     + + SIQP+KATATE+PPTI KS + GKT+VGINGF
Sbjct  39   NVRFQSSIHGNRILAQSSSLQKCSTTARSIQPIKATATEIPPTISKSSSGGKTKVGINGF  98

Query  532  G  534
            G
Sbjct  99   G  99



>gb|KJB45878.1| hypothetical protein B456_007G336900 [Gossypium raimondii]
Length=428

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            IQP++ATATE+PPTIPKS+++GKT++GINGFG
Sbjct  71   IQPIQATATEIPPTIPKSRSSGKTKIGINGFG  102



>gb|KJB45876.1| hypothetical protein B456_007G336900 [Gossypium raimondii]
Length=430

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            IQP++ATATE+PPTIPKS+++GKT++GINGFG
Sbjct  71   IQPIQATATEIPPTIPKSRSSGKTKIGINGFG  102



>gb|KJB45877.1| hypothetical protein B456_007G336900 [Gossypium raimondii]
Length=418

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            IQP++ATATE+PPTIPKS+++GKT++GINGFG
Sbjct  71   IQPIQATATEIPPTIPKSRSSGKTKIGINGFG  102



>ref|XP_006422270.1| hypothetical protein CICLE_v10005029mg [Citrus clementina]
 ref|XP_006493767.1| PREDICTED: glyceraldehyde 3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR35510.1| hypothetical protein CICLE_v10005029mg [Citrus clementina]
Length=425

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  420
            M FSSLLRS  AS  L  +  +      + G +    S     SSIFG+++P+  SSS  
Sbjct  1    MAFSSLLRST-ASASLVRADLTSSPSDRVKGSSTAAFSRNLNTSSIFGTSVPSGSSSSSL  59

Query  421  gs-gsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
             +  + SIQP++ATATE+PPTI KS++ G T+VGINGFG
Sbjct  60   QTCAAKSIQPIRATATEIPPTIQKSRSDGNTKVGINGFG  98



>ref|XP_007022674.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
2, partial [Theobroma cacao]
 gb|EOY14199.1| Glyceraldehyde-3-phosphate dehydrogenase of plastid 2 isoform 
2, partial [Theobroma cacao]
Length=387

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 65/105 (62%), Gaps = 10/105 (10%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  420
            M FSSL+RS  A+     S+ S    +         +S+ F  +SIFG+A+    SSS++
Sbjct  1    MAFSSLIRSTAAASTPLDSARSDLSPSPSDRLK--VSSIGFSGNSIFGAAVSTGSSSSLR  58

Query  421  gsgsssIQPVKATATELPPTIP-------KSQTTGKTRVGINGFG  534
               S SIQP+KATATE+PPT+P       +S+++GKT+VGINGFG
Sbjct  59   KCNSRSIQPIKATATEIPPTVPSLFLICLESRSSGKTKVGINGFG  103



>ref|XP_004306563.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=426

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  334  GFNQGCTSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTR  513
            GF +     K +SSIFG+++ +  SSS+Q S + S+QP+KATATE+PPT  +S ++GK +
Sbjct  36   GFGRNLNCSKVQSSIFGASI-STGSSSLQTSSARSVQPIKATATEIPPTYQRSGSSGKIK  94

Query  514  VGINGFG  534
            +GINGFG
Sbjct  95   IGINGFG  101



>emb|CDY33343.1| BnaC05g12400D [Brassica napus]
Length=426

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 60/103 (58%), Gaps = 10/103 (10%)
 Frame = +1

Query  244  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  405
            M FSSLLRS       P   +  + S  H    S  GF+   TS +F     G+A+    
Sbjct  1    MAFSSLLRSAATSAAAPRVELYTSPSYDHFQVTSSLGFSHNLTSSRFS----GAAVSTDS  56

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SSS+Q   + S+QP+KATATE PP + + +++GKT+VGINGFG
Sbjct  57   SSSLQICNARSVQPIKATATEAPPAVYRPRSSGKTKVGINGFG  99



>ref|XP_006307603.1| hypothetical protein CARUB_v10009227mg [Capsella rubella]
 gb|EOA40501.1| hypothetical protein CARUB_v10009227mg [Capsella rubella]
Length=425

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 60/102 (59%), Gaps = 9/102 (9%)
 Frame = +1

Query  244  MGFSSLLRSVPASPV-----LhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHs  408
            M FS LLRS   S       L+ SSS    Q +  GF+   TS +F     G+AL    S
Sbjct  1    MAFSFLLRSAATSAAAPRLELYPSSSYEHSQVTSVGFSHNLTSSRFS----GAALSTGSS  56

Query  409  ssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SS+    + S+QP+KATAT  PP + +S+++GKT+VGINGFG
Sbjct  57   SSLHKCNARSVQPIKATATASPPAVQRSRSSGKTKVGINGFG  98



>emb|CDY35080.1| BnaA06g10900D [Brassica napus]
Length=426

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +1

Query  334  GFNQGCTSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTR  513
            GF++  TS +F     G+A+    SSS+Q   + S+QP+KATATE PPT+ +S+++GKT+
Sbjct  37   GFSRNLTSSRFS----GAAVSTGSSSSLQICNARSVQPIKATATEAPPTVYRSRSSGKTK  92

Query  514  VGINGFG  534
            VGINGFG
Sbjct  93   VGINGFG  99



>ref|XP_009408252.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=429

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 59/104 (57%), Gaps = 9/104 (9%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqasla---GFNQGCT----SVKFESSIFGSALPNV  402
            M FS+LLRS  A+P L  S       +       F   C     S    SSIFGS+ P+V
Sbjct  1    MAFSTLLRS--AAPALGGSRDRFPSDSGAPIPPSFKISCIRSPRSAGNRSSIFGSSFPSV  58

Query  403  HsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
             + S Q SG+ + QP+KATATE PP +  S + G+T+VGINGFG
Sbjct  59   EAYSSQRSGARNNQPIKATATEAPPFVKSSPSGGRTKVGINGFG  102



>ref|NP_173080.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 sp|Q5E924.1|G3PP2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPCP2, 
chloroplastic; AltName: Full=Glyceraldehyde-3-phosphate dehydrogenase 
of plastid 2; AltName: Full=NAD-dependent glyceraldehydephosphate 
dehydrogenase chloroplastic 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAX12866.1| At1g16300 [Arabidopsis thaliana]
 gb|AEE29433.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
Length=420

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 54/103 (52%), Gaps = 16/103 (16%)
 Frame = +1

Query  244  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  405
            M  SSLLRS       P   +  +SS +H    S  GF+   TS +F  +   +   N  
Sbjct  1    MALSSLLRSAATSAAAPRVELYPSSSYNHSQVTSSLGFSHSLTSSRFSGAAVSTGKYNAK  60

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
                       +QP+KATATE PP + +S+++GKT+VGINGFG
Sbjct  61   R----------VQPIKATATEAPPAVHRSRSSGKTKVGINGFG  93



>gb|AAM67077.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
Length=420

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 54/103 (52%), Gaps = 16/103 (16%)
 Frame = +1

Query  244  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  405
            M  SSLLRS       P   +  +SS +H    S  GF+   TS +F  +   +   N  
Sbjct  1    MALSSLLRSAATSAAAPRVELYPSSSYNHSQVTSSLGFSHSLTSSRFSGAAVSTGKYNAK  60

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
                       +QP+KATATE PP + +S+++GKT+VGINGFG
Sbjct  61   R----------VQPIKATATEAPPAVHRSRSSGKTKVGINGFG  93



>gb|KDO61570.1| hypothetical protein CISIN_1g014424mg [Citrus sinensis]
Length=334

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 3/99 (3%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  420
            M FSSLLRS  AS  L  +  +      + G      S     SSIFG+++P+  SSS  
Sbjct  1    MAFSSLLRST-ASASLVRADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSSSL  59

Query  421  gsgsss-IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
             + ++  IQP++ATATE+PPTI KS++ G T+VGINGFG
Sbjct  60   QTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFG  98



>ref|XP_006416830.1| hypothetical protein EUTSA_v10007716mg [Eutrema salsugineum]
 gb|ESQ35183.1| hypothetical protein EUTSA_v10007716mg [Eutrema salsugineum]
Length=423

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 59/103 (57%), Gaps = 10/103 (10%)
 Frame = +1

Query  244  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  405
            M FSSLLRS       P   +  + S  H    S  G +   TS +F       A+  + 
Sbjct  1    MAFSSLLRSAATSAAPPRLELYTSPSYDHFQVTSSLGLSHNLTSSRFSDV----AVSTMS  56

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SSS+Q   + ++QP+KATATE PP + +S+++GKT+VGINGFG
Sbjct  57   SSSLQKCNARTVQPIKATATEAPPAVQRSRSSGKTKVGINGFG  99



>gb|KDO61569.1| hypothetical protein CISIN_1g014424mg [Citrus sinensis]
Length=389

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (61%), Gaps = 3/99 (3%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  420
            M FSSLLRS  AS  L  +  +      + G      S     SSIFG+++P+  SSS  
Sbjct  1    MAFSSLLRST-ASASLVRADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSSSL  59

Query  421  gs-gsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
             +  +  IQP++ATATE+PPTI KS++ G T+VGINGFG
Sbjct  60   QTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFG  98



>gb|EPS71916.1| hypothetical protein M569_02842, partial [Genlisea aurea]
Length=398

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = +1

Query  343  QGCTSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGI  522
                +VKF SSI GS  P +HS S Q +   ++QPVKATATE P TIP S+ +   +VGI
Sbjct  11   HNLNTVKFMSSIVGSVAP-LHSFSKQNAAGHAVQPVKATATEAPTTIPISRDSRTNKVGI  69

Query  523  NGFG  534
            NGFG
Sbjct  70   NGFG  73



>gb|KDO61568.1| hypothetical protein CISIN_1g014424mg [Citrus sinensis]
Length=425

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 61/99 (62%), Gaps = 3/99 (3%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhasssshrhqaslaGFNQGCTSVKFE-SSIFGSALPNVHsssvq  420
            M FSSLLRS  AS  L  +  +      + G      S     SSIFG+++P+  SSS  
Sbjct  1    MAFSSLLRST-ASASLVRADLTSSPSDRVKGSPTAAFSRNLNTSSIFGTSVPSGSSSSSL  59

Query  421  gsgsss-IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
             + ++  IQP++ATATE+PPTI KS++ G T+VGINGFG
Sbjct  60   QTCAAKGIQPIRATATEIPPTIQKSRSDGNTKVGINGFG  98



>ref|XP_008776392.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Phoenix dactylifera]
Length=429

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 56/102 (55%), Gaps = 5/102 (5%)
 Frame = +1

Query  244  MGFSSLLRSV-PASPVLhasssshrhqaslaGFNQGC----TSVKFESSIFGSALPNVHs  408
            M FS LLRS  P +        S     +   F   C    +S +  SSIFGS L +V S
Sbjct  1    MAFSMLLRSATPLTGGWRDCFPSDFDARAPESFKISCMRIPSSAQIRSSIFGSVLSSVES  60

Query  409  ssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            SS Q   +  IQP+KATATE PP +P+S    KT+VGINGFG
Sbjct  61   SSSQKPSARGIQPIKATATEAPPVVPRSSAGAKTKVGINGFG  102



>ref|XP_002890157.1| GAPCP-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66416.1| GAPCP-2 [Arabidopsis lyrata subsp. lyrata]
Length=420

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 53/103 (51%), Gaps = 16/103 (16%)
 Frame = +1

Query  244  MGFSSLLRSVPASP------VLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  405
            M FSSLLRS   S       +  +SS  H    S  GF     S +F  +   +   N  
Sbjct  1    MAFSSLLRSAATSAAAPRFQLYPSSSYDHSQVTSSLGFTHNLASSRFSGAAVSTGKCNAK  60

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            S          +QP+KATATE PP + +S+++GKT+VGINGFG
Sbjct  61   S----------VQPIKATATEAPPIVHRSRSSGKTKVGINGFG  93



>ref|XP_008456299.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Cucumis melo]
Length=425

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  352  TSVKFESSIFGSALPN-VHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGING  528
            +S+K +S +FG+ + + V S  ++ S + ++QP+KATATE PP I K+ ++GKT++GING
Sbjct  37   SSLKLQSGVFGTTVSSGVSSLQLRSSSNRTVQPIKATATEAPPAIQKTPSSGKTKIGING  96

Query  529  FG  534
            FG
Sbjct  97   FG  98



>ref|XP_010537806.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=423

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 58/100 (58%), Gaps = 7/100 (7%)
 Frame = +1

Query  244  MGFSSLLRSVPASPVLhass---sshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsss  414
            M FSS LRS  A+P +   S   S H   +S   F+   TS  F       AL    S S
Sbjct  1    MTFSSFLRSSAAAPCVDFFSPPSSDHFKVSSCLVFSHNLTSSNFSDP----ALSTGSSLS  56

Query  415  vqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +Q   + S+QP+KATATE+PP + +S ++GKTRVGINGFG
Sbjct  57   LQKCNTRSMQPIKATATEVPPAVQRSDSSGKTRVGINGFG  96



>gb|AAO22684.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
Length=420

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 57/103 (55%), Gaps = 16/103 (16%)
 Frame = +1

Query  244  MGFSSLLRSV------PASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVH  405
            M  SSLLRS       P   +  +SS +H    S  GF+   TS +F     G+A+    
Sbjct  1    MALSSLLRSAATSAAAPRVELYPSSSYNHSQVTSSLGFSHSLTSSRFS----GAAV----  52

Query  406  sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
              S     +  +QP+KATATE PP + +S+++GKT+VGINGFG
Sbjct  53   --STGKYSAKRVQPIKATATEAPPAVHRSRSSGKTKVGINGFG  93



>ref|XP_010693410.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=419

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +1

Query  352  TSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGF  531
            +S+K +S+IFG+A+ N  SS +Q S  +S+QP+KATATE+PPT+ ++++  K ++GINGF
Sbjct  34   SSLKIQSNIFGTAV-NGGSSCIQESRLTSMQPIKATATEIPPTVQRTRSGAKIKIGINGF  92

Query  532  G  534
            G
Sbjct  93   G  93



>gb|KHG14985.1| Glyceraldehyde-3-phosphate dehydrogenase [Gossypium arboreum]
Length=377

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 7/101 (7%)
 Frame = +1

Query  244  MGFSSLLRSVPAS-PVLhasssshrhqaslaGFNQGCTSVKFE---SSIFGSALPNVHss  411
            M FSSL+RS  A+ P+L AS+ +    +         +S+ F    +S FG A+ +  SS
Sbjct  1    MAFSSLIRSTAAAYPLLEASARTDLSPSPSHRLK--VSSIGFGGNLNSFFGPAV-STKSS  57

Query  412  svqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            S+Q   S SIQP+KATATE+P TI +S+++GKT+VGINGFG
Sbjct  58   SLQKCNSRSIQPIKATATEIPTTIARSRSSGKTKVGINGFG  98



>ref|XP_003596039.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=392

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +1

Query  355  SVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            S + +++IFG+++P   S  +Q   + S+QP++ATATE+P  +  S +TGKTRVGINGFG
Sbjct  33   STRLQNNIFGTSIP-CDSLVLQNCNARSMQPIRATATEIPLPVQNSSSTGKTRVGINGFG  91



>ref|XP_003596038.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES66289.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=418

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +1

Query  355  SVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            S + +++IFG+++P   S  +Q   + S+QP++ATATE+P  +  S +TGKTRVGINGFG
Sbjct  33   STRLQNNIFGTSIP-CDSLVLQNCNARSMQPIRATATEIPLPVQNSSSTGKTRVGINGFG  91



>ref|XP_003596040.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES66291.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=405

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 61/98 (62%), Gaps = 8/98 (8%)
 Frame = +1

Query  244  MGFSSLLRS-VPASPVLhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNVHsssvq  420
            M  SSLLRS + +SP      SS R Q    G +    S + +++IFG+++P   S  +Q
Sbjct  1    MAASSLLRSAIVSSP------SSDRFQVLGNGSSISSKSTRLQNNIFGTSIP-CDSLVLQ  53

Query  421  gsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
               + S+QP++ATATE+P  +  S +TGKTRVGINGFG
Sbjct  54   NCNARSMQPIRATATEIPLPVQNSSSTGKTRVGINGFG  91



>ref|XP_007149305.1| hypothetical protein PHAVU_005G059200g [Phaseolus vulgaris]
 gb|ESW21299.1| hypothetical protein PHAVU_005G059200g [Phaseolus vulgaris]
Length=418

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 43/60 (72%), Gaps = 1/60 (2%)
 Frame = +1

Query  355  SVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            S+  ESSIFG+++    S  +Q   +  IQP+K+TATE+P    +S++TGKTRVGINGFG
Sbjct  33   SMGLESSIFGNSI-QCDSLVLQNYTARGIQPIKSTATEIPLPTQQSRSTGKTRVGINGFG  91



>gb|KHG16589.1| Glyceraldehyde-3-phosphate dehydrogenase-2C cytosolic [Gossypium 
arboreum]
Length=374

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +1

Query  370  SSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +SIFG+AL    S S+Q   S SIQP+KATA ++PP  PKS+ +GKT++GINGFG
Sbjct  42   NSIFGAALSTT-SVSLQKCNSRSIQPIKATAAKIPPAAPKSRKSGKTKIGINGFG  95



>gb|KGN46796.1| hypothetical protein Csa_6G136010 [Cucumis sativus]
Length=524

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  352  TSVKFESSIFGSALPN-VHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGING  528
             S+K +S +FG+ + +   S  ++ S + ++QP+KATATE PP I K+  +GKT++GING
Sbjct  136  NSLKLQSGLFGTTVSSGASSLQLRSSNNRTVQPIKATATEAPPAIQKTPRSGKTKIGING  195

Query  529  FG  534
            FG
Sbjct  196  FG  197



>ref|XP_010417618.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Camelina sativa]
Length=423

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATATE+PP + +S ++GKT+VGINGFG
Sbjct  66   VQPIKATATEVPPAVKRSSSSGKTKVGINGFG  97



>ref|XP_010429843.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Camelina sativa]
Length=423

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATATE+PP + +S ++GKT+VGINGFG
Sbjct  65   VQPIKATATEVPPAVKRSSSSGKTKVGINGFG  96



>ref|XP_010417619.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like, 
partial [Camelina sativa]
Length=399

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATATE+PP + +S ++GKT+VGINGFG
Sbjct  66   VQPIKATATEVPPAVKRSSSSGKTKVGINGFG  97



>ref|XP_006389879.1| hypothetical protein EUTSA_v10018604mg [Eutrema salsugineum]
 gb|ESQ27165.1| hypothetical protein EUTSA_v10018604mg [Eutrema salsugineum]
Length=426

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 56/104 (54%), Gaps = 12/104 (12%)
 Frame = +1

Query  244  MGFSSLLRSVPASPV-------LhasssshrhqaslaGFNQGCTSVKFESSIFGSALPNV  402
            M FSSL+RS  AS V         + +  H   +S  GF     S   +SS F  A    
Sbjct  1    MAFSSLVRSAAASTVAAPRADFFSSPARDHSKVSSSLGF-----SCNLKSSRFSGAAVAT  55

Query  403  HsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
              SS     + ++QP+KATATE+P  + +S ++GKT+VGINGFG
Sbjct  56   GPSSSLQKRNRNVQPIKATATEVPYAVQRSSSSGKTKVGINGFG  99



>emb|CDX79324.1| BnaC06g19790D [Brassica napus]
Length=421

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATAT++PP + +S +TGKT+VGINGFG
Sbjct  63   VQPIKATATQVPPAVQRSSSTGKTKVGINGFG  94



>ref|XP_004140018.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Cucumis 
sativus]
Length=415

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  355  SVKFESSIFGSALPN-VHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGF  531
            S+K +S +FG+ + +   S  ++ S + ++QP+KATATE PP I K+  +GKT++GINGF
Sbjct  38   SLKLQSGLFGTTVSSGASSLQLRSSNNRTVQPIKATATEAPPAIQKTPRSGKTKIGINGF  97

Query  532  G  534
            G
Sbjct  98   G  98



>ref|XP_004154566.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cucumis sativus]
Length=425

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 44/61 (72%), Gaps = 1/61 (2%)
 Frame = +1

Query  355  SVKFESSIFGSALPN-VHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGF  531
            S+K +S +FG+ + +   S  ++ S + ++QP+KATATE PP I K+  +GKT++GINGF
Sbjct  38   SLKLQSGLFGTTVSSGASSLQLRSSNNRTVQPIKATATEAPPAIQKTPRSGKTKIGINGF  97

Query  532  G  534
            G
Sbjct  98   G  98



>ref|XP_010472812.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Camelina sativa]
Length=424

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATATE+PP   +S ++GKT+VGINGFG
Sbjct  66   VQPIKATATEVPPAFKRSSSSGKTKVGINGFG  97



>ref|XP_009149063.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Brassica rapa]
Length=427

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATATE PP + +S+++GKT+VGINGFG
Sbjct  69   VQPIKATATEAPPAVYRSRSSGKTKVGINGFG  100



>ref|XP_004488757.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X3 [Cicer arietinum]
Length=373

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  361  KFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +  +SIFG+++ +  S  +Q   + SIQP++ATATE+P  + KS + GKTRVGINGFG
Sbjct  37   RLHNSIFGTSI-SCESIVLQNCNARSIQPIRATATEIPLPVQKSSSAGKTRVGINGFG  93



>ref|XP_004488755.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X1 [Cicer arietinum]
Length=420

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  361  KFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +  +SIFG+++ +  S  +Q   + SIQP++ATATE+P  + KS + GKTRVGINGFG
Sbjct  37   RLHNSIFGTSI-SCESIVLQNCNARSIQPIRATATEIPLPVQKSSSAGKTRVGINGFG  93



>emb|CDY25342.1| BnaC01g30110D [Brassica napus]
Length=415

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATAT+ PP + +S +TGKT+VGINGFG
Sbjct  57   LQPIKATATQAPPAVQRSSSTGKTKVGINGFG  88



>emb|CDY22281.1| BnaC02g25850D [Brassica napus]
Length=419

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATAT+ PP + +S +TGKT+VGINGFG
Sbjct  61   LQPIKATATQAPPAVQRSSSTGKTKVGINGFG  92



>ref|NP_001242854.1| uncharacterized protein LOC100804853 [Glycine max]
 gb|ACU21330.1| unknown [Glycine max]
Length=418

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +1

Query  364  FESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
              SSIFG+++    S  +Q      IQP+KATATE+P    +S++TGKTRVGINGFG
Sbjct  36   LHSSIFGTSI-QCDSLVLQNCNGRGIQPIKATATEIPLPTQQSRSTGKTRVGINGFG  91



>gb|KHN22160.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Glycine 
soja]
Length=418

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +1

Query  364  FESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
              SSIFG+++    S  +Q      IQP+KATATE+P    +S++TGKTRVGINGFG
Sbjct  36   LHSSIFGTSI-QCDSLVLQNCNGRGIQPIKATATEIPLPTQQSRSTGKTRVGINGFG  91



>ref|XP_009128365.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Brassica rapa]
Length=415

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATAT+ PP + +S +TGKT+VGINGFG
Sbjct  57   LQPIKATATQAPPAVQRSSSTGKTKVGINGFG  88



>gb|AIX10972.1| glyceraldehyde-3-phosphate dehydrogenase [Ornithogalum saundersiae]
Length=433

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            IQPVKATATE PP + +S + GKT++GINGFG
Sbjct  75   IQPVKATATEAPPAVARSSSGGKTKIGINGFG  106



>ref|XP_010531997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic 
[Tarenaya hassleriana]
Length=359

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATATE+PP + +S ++GKT++GINGFG
Sbjct  1    MQPIKATATEVPPAVQRSGSSGKTKIGINGFG  32



>gb|ADJ96634.1| glyceraldehyde-3-phosphate dehydrogenase [Guzmania wittmackii 
x Guzmania lingulata]
Length=421

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 4/66 (6%)
 Frame = +1

Query  337  FNQGCTSVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRV  516
            + +  +S    S +FG+A+    S+S + SG+ SIQP+KATAT  PP++PK  + GKT+V
Sbjct  33   YVRSLSSAPNHSRVFGAAI----STSSRKSGARSIQPIKATATAAPPSVPKLSSGGKTKV  88

Query  517  GINGFG  534
            GINGFG
Sbjct  89   GINGFG  94



>gb|KFK42362.1| hypothetical protein AALP_AA2G245800 [Arabis alpina]
Length=249

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATAT++PP + +S ++GKT+VGINGFG
Sbjct  61   VQPIKATATQVPPVVQRSGSSGKTKVGINGFG  92



>gb|KFK42359.1| hypothetical protein AALP_AA2G245800 [Arabis alpina]
Length=275

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATAT++PP + +S ++GKT+VGINGFG
Sbjct  61   VQPIKATATQVPPVVQRSGSSGKTKVGINGFG  92



>ref|XP_009399260.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=423

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +1

Query  379  FGSALPNVH-sssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            FGS+L +V   SS +     SIQPVKATATE PP +  S   GKT++GINGFG
Sbjct  44   FGSSLTSVDIYSSHKHVARRSIQPVKATATEAPPVVKSSSRGGKTKIGINGFG  96



>ref|NP_178071.1| glyceraldehyde-3-phosphate dehydrogenase GAPCP1 [Arabidopsis 
thaliana]
 sp|Q9SAJ6.1|G3PP1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPCP1, 
chloroplastic; AltName: Full=Glyceraldehyde-3-phosphate dehydrogenase 
of plastid 1; AltName: Full=NAD-dependent glyceraldehydephosphate 
dehydrogenase chloroplastic 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD30223.1|AC007202_5 Is a member of the PF|00044 glyceraldehyde 3-phosphate dehydrogenase 
family. ESTs gb|T43985, gb|N38667, gb|N65037, gb|AA713069 
and gb|AI099548 come from this gene [Arabidopsis thaliana]
 gb|AAK15554.1|AF348583_1 putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 dbj|BAC42558.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36260.1| glyceraldehyde-3-phosphate dehydrogenase of plastid [Arabidopsis 
thaliana]
Length=422

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATATE+P  + +S ++GKT+VGINGFG
Sbjct  64   VQPIKATATEVPSAVRRSSSSGKTKVGINGFG  95



>ref|XP_008779271.1| PREDICTED: bifunctional purine biosynthesis protein purH-like 
[Phoenix dactylifera]
Length=586

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGING  528
            IQP+KATATE PP +P+S T GKT+VGING
Sbjct  71   IQPIKATATEAPPMVPRSSTGGKTKVGING  100



>emb|CDX67990.1| BnaA07g20300D [Brassica napus]
Length=421

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATAT++P  + +S +TGKT+VGINGFG
Sbjct  63   VQPIKATATQVPAAVQRSSSTGKTKVGINGFG  94



>ref|XP_009104524.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic 
[Brassica rapa]
Length=421

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATAT++P  + +S +TGKT+VGINGFG
Sbjct  63   VQPIKATATQVPAAVQRSSSTGKTKVGINGFG  94



>ref|XP_004488756.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X2 [Cicer arietinum]
Length=373

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            IQP++ATATE+P  + KS + GKTRVGINGFG
Sbjct  15   IQPIRATATEIPLPVQKSSSAGKTRVGINGFG  46



>ref|XP_003547755.1| PREDICTED: glyceraldehyde 3-phosphate dehydrogenase GAPCP1, chloroplastic-like 
[Glycine max]
 gb|KHN00002.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Glycine 
soja]
Length=418

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 43/65 (66%), Gaps = 3/65 (5%)
 Frame = +1

Query  346  GCT--SVKFESSIFGSALPNVHsssvqgsgsssIQPVKATATELPPTIPKSQTTGKTRVG  519
            GC   S   ++SIFG+++    S  +Q   +  IQ +KATATE+P    +S++TGKTRVG
Sbjct  28   GCNLKSKGLQTSIFGTSI-QCDSLVLQNCNARHIQRIKATATEIPLPTQQSRSTGKTRVG  86

Query  520  INGFG  534
            INGFG
Sbjct  87   INGFG  91



>gb|AFK39182.1| unknown [Medicago truncatula]
 gb|AES66290.2| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=359

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP++ATATE+P  +  S +TGKTRVGINGFG
Sbjct  1    MQPIRATATEIPLPVQNSSSTGKTRVGINGFG  32



>ref|XP_002889251.1| GAPCP-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65510.1| GAPCP-1 [Arabidopsis lyrata subsp. lyrata]
Length=422

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  439  IQPVKATATELPPTIPKSQTTGKTRVGINGFG  534
            +QP+KATAT++P  + +S ++GKT+VGINGFG
Sbjct  64   VQPIKATATQVPSAVRRSSSSGKTKVGINGFG  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000